2DUBA

Enoyl-coa hydratase complexed with octanoyl-coa
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
259
structure length
254
Chain Sequence
NFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQDCYSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFKDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of enoyl-CoA hydratase complexed with octanoyl-CoA reveals the structural adaptations required for binding of a long chain fatty acid-CoA molecule.
pubmed doi rcsb
molecule tags Lyase
molecule keywords 2-ENOYL-COA HYDRATASE
total genus 89
structure length 254
sequence length 259
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 1997-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 2dubA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2dubA01
3OT6A 3T89A 5E0SA 1NZYB 4ELSA 4U0GH 2J5II 1ON3A 4JYLA 4K2NA 1XNYA 3R9SA 5DU6A 3I47A 3MOYA 3T8BA 2Q34A 3L3SA 3LKEA 4FN7A 2J5GA 5KJPA 4RYFA 5DKPA 4JWVA 1RJMA 3N6RB 4B3HA 3Q0JA 4KWBA 3QXIA 1N6DA 3ZWCA 4JCTA 3PGQA 2ZL3A 4ZDBA 3TT7A 2A81A 4U0HA 1WDLA 3RSTA 4I4ZA 3Q0GA 3IB9A 4JVTA 3RRVA 4OLQA 4IZCA 5CTCA 1FC6A 5FIFA 2WTBA 3QXZA 1HNUA 4JJTA 2PG8A 3BEZA 3TDCA 3GF7A 1YG6A 3Q7HA 5KDRB 4G2RA 2C8TA 1WDKA 2F9YA 5DU4A 1YG8A 1J7XA 2NP9A 3GKBA 4Q1IA 4B3IA 2DUBA 2VSUE 3V5IA 2F6IA 4ASIA 3V5EA 2ZQRA 2VSSF 4OG1A 1UYVA 5MGBA 1EF8A 4U19A 5FUSA 3H0SA 2PPYA 4B3JA 3PZKA 3LAOA 4K3WA 4FN8A 4KPKA 1UYSA 4I52A 2DEOA 2D3TA 3BF0A 5INIA 5C90A 3WG5A 1RJNA 3TVUA 4YLHA 3R6HA 4FJWD 3TLFA 5DUCA 4OMRA 4U0GA 4KD6A 5DU8A 4Z0MA 4Q0GA 4ZDCA 1TG6A 3H0UA 1N6EA 2VSSA 2ZL2A 2VSUC 5INFA 5INGA 1N6FA 5CTBA 3RSIA 1K32A 3QYRA 4DI1A 1VRGA 5DZKH 1WZ8A 3KTKA 4U18A 3QREA 2J5GD 5DTWA 3KTHA 2VSSE 3TV5A 5E0NX 5JBWA 1WDMA 5DZKA 1ON9A 4QIIA 3IBBA 3HLN1 3STAA 4ELXA 1MJ3A 3KTGA 2UZFA 3P5MA 1HNOA 1Q51A 3TT6A 1HZDA 2W3PA 2VREA 1SG4A 2CE3A 4EMMA 3T88A 3TRRA 3FF6A 1DUBA 2F9IA 2ZL0A 4IZDA 3IAVA 1DCIA 3OMEA 2FZSA 4ZDFA 3ZW8A 4ELWA 3Q1TA 2PBPA 1FC7A 5DL1A 1PJHA 1XO6A 5E0SH 2J5IB 3HINA 4FZWC 2FW2A 1OD4A 3GLMA 3R0OA 3ZWBA 1SZOA 2F6QA 3VIVA 3GMAA 3SLLA 3H0JA 4JCQA 1FCFA 5DUFA 4EMLA 4ZU2A 3ISAA 2F9IB 1XX4A 4FNBA 2F9YB 3JU1A 2J5IA 1O8UA 1XNWA 3R9QA 4EMPA 5G1SA 3DORA 3MFMA 5DTPA 1EY3A 4JFCA 4MI2A 4WYOB 3G64A 3HP0A 4HNKA 3P2LA 4IZBA 3QWDA 2HW5A 3U9SB 4FB8A 3T3WA 5C9GA 4K29A 4GM2A 1UYRA 2QQ3A 3SWXA 3DJAA 4MOUA 4NEKA 4U1AA 2FBMA 1X0UA 4FNDA 3H02A 3HRXA 5IKLB 2ZQQA 4KNPA 1OD2A 2GTRA 1PIXA 2Q35A 1K39A 3K8XA 1XNVA 1JXZA 4JCRA 4L6WA 5G1QA 1Y7OA 3K50A 4JOTA 3QKAA 4JCSA 4JYJA 3TVWA 2Q2XA 3NJDA 2X58A 3MT6A 2EJ5A 4F47A 3ZW9A 3U9TB 3M6MA 2A7SA 4ZDDA 1NZYA 3TZ3A 3HE2A 4RCNA 5JBXA 1UYTA 2J5SA 3GF3A 3P85A 2VSUF 3QMJA 1UIYA 3MYBA 2VX2A 1W2XA 4MXIA 4GHNA 2A7KA 3QK8A 3H0QA 2ZL4A 3H81A 3ZWAA 1FC9A 1TYFA 4L8KA 4LK5A 3OC7A 4QIJA 3NJBA 2IEXA 1Q52A 4WZ8B 1EF9A 4NNQA 3U9RB 3FDUA 4RYFH 4QFEA 3KTJA 4ZDEA 3ST9A 4WCZA 3T8AA 5G1RA 3M6NA 3KTIA 3PEAA 4JSBA 2VSUA 5KDRA 3R9TA 3PE8A 3BPPA 4I42A 3KQFA 2CBYA 2X24A 4FZWA 4HC8A 2BZRA
chains in the Genus database with same CATH superfamily
3OT6A 3T89A 5E0SA 1NZYB 4ELSA 3O4XE 4U0GH 2J5II 1ON3A 4JYLA 4K2NA 1XNYA 3R9SA 5DU6A 3I47A 3MOYA 3T8BA 2Q34A 3L3SA 3LKEA 4FN7A 2J5GA 5KJPA 4RYFA 5DKPA 4JWVA 1RJMA 3N6RB 4B3HA 3Q0JA 4KWBA 3QXIA 1N6DA 3ZWCA 4JCTA 3PGQA 2ZL3A 4ZDBA 3TT7A 2A81A 4U0HA 3L8JA 1WDLA 3RSTA 4I4ZA 3Q0GA 3IB9A 4JVTA 3RRVA 3IRBA 4OLQA 4IZCA 5CTCA 1FC6A 5FIFA 2P63A 2WTBA 3QXZA 1HNUA 4JJTA 2PG8A 3BEZA 3TDCA 3GF7A 1YG6A 3Q7HA 5KDRB 3A4MA 4G2RA 2C8TA 1WDKA 2F9YA 5DU4A 1YG8A 1J7XA 3A4NA 2NP9A 3GKBA 4Q1IA 4B3IA 2DUBA 2VSUE 4J2UA 3V5IA 1Y64B 2F6IA 4ASIA 3V5EA 2ZQRA 3ADDA 2VSSF 4OG1A 3L8IA 1UYVA 5MGBA 1EF8A 4U19A 5FUSA 3H0SA 2PPYA 4B3JA 3PZKA 3LAOA 4HDTA 4K3WA 4FN8A 4KPKA 1UYSA 4I52A 2DEOA 2D3TA 3BF0A 5INIA 5C90A 3WG5A 1RJNA 3AM1A 3TVUA 4YLHA 3R6HA 4FJWD 3TLFA 5DUCA 4OMRA 4U0GA 4KD6A 5DU8A 4Z0MA 4Q0GA 4ZDCA 1TG6A 3H0UA 1N6EA 2VSSA 2ZL2A 2VSUC 5INFA 5INGA 1N6FA 5CTBA 3RSIA 1K32A 3QYRA 4DI1A 1VRGA 5DZKH 3BPTA 1WZ8A 3KTKA 4U18A 3QREA 2J5GD 3W8IB 5DTWA 3KTHA 2VSSE 3TV5A 5E0NX 5JBWA 1WDMA 5DZKA 1ON9A 4QIIA 3IBBA 3HLN1 3STAA 4ELXA 1MJ3A 3KTGA 2UZFA 5HUQA 3P5MA 1HNOA 1Q51A 3W8HB 1UX4A 3TT6A 1HZDA 2W3PA 2VREA 1SG4A 2CE3A 3T88A 3TRRA 3FF6A 4EMMA 1DUBA 2F9IA 2ZL0A 4IZDA 3IAVA 1DCIA 3RQEA 3OMEA 2FZSA 4ZDFA 3ZW8A 4ELWA 3Q1TA 2PBPA 1FC7A 5DL1A 1PJHA 1XO6A 5E0SH 2J5IB 3HINA 4FZWC 2FW2A 1OD4A 3GLMA 3R0OA 3ZWBA 1SZOA 3ADCA 2F6QA 3VIVA 3GMAA 3SLLA 3H0JA 3RQFA 4JCQA 1FCFA 5DUFA 4EMLA 4ZU2A 3ISAA 2F9IB 1XX4A 4FNBA 2F9YB 3JU1A 2J5IA 1O8UA 1XNWA 3R9QA 4EMPA 5G1SA 3DORA 3MFMA 5DTPA 1EY3A 4JFCA 4MI2A 4WYOB 3G64A 3HP0A 4HNKA 3P2LA 4IZBA 3QWDA 2HW5A 3U9SB 4FB8A 3T3WA 5C9GA 4K29A 4GM2A 1UYRA 2QQ3A 3SWXA 3DJAA 1UX5A 4MOUA 4NEKA 4U1AA 2FBMA 1X0UA 4FNDA 3H02A 3HRXA 5IKLB 2ZQQA 4KNPA 1OD2A 2GTRA 1PIXA 2Q35A 1K39A 3K8XA 1XNVA 1JXZA 4JCRA 4L6WA 5G1QA 1Y7OA 3K50A 4JOTA 3QKAA 4JCSA 4JYJA 3TVWA 2Q2XA 3NJDA 2X58A 3MT6A 2EJ5A 4F47A 3ZW9A 3U9TB 3M6MA 2A7SA 4ZDDA 4GEHB 1NZYA 3TZ3A 3HE2A 4RCNA 5JBXA 1UYTA 2J5SA 3GF3A 3P85A 2VSUF 3QMJA 1UIYA 3MYBA 2VX2A 1W2XA 4MXIA 4GHNA 2A7KA 3QK8A 3H0QA 3ADBA 2ZL4A 3H81A 3ZWAA 1FC9A 1TYFA 4L8KA 4LK5A 3OC7A 4QIJA 3A4LA 3NJBA 2IEXA 1Q52A 4WZ8B 2YJGA 1EF9A 3AJMA 4NNQA 3U9RB 3FDUA 4RYFH 4QFEA 3KTJA 4ZDEA 3ST9A 4NARA 4WCZA 3T8AA 5G1RA 3M6NA 3KTIA 3RQGA 3PEAA 4JSBA 2VSUA 5KDRA 3R9TA 3PE8A 3BPPA 4I42A 3KQFA 2X24A 2CBYA 4FZWA 4HC8A 2BZRA
chains in the Genus database with same CATH topology
3OT6A 3T89A 5E0SA 1NZYB 4ELSA 4U0GH 2J5II 1ON3A 4JYLA 4K2NA 1XNYA 3R9SA 5DU6A 3I47A 3MOYA 3T8BA 2Q34A 3L3SA 3LKEA 4FN7A 2J5GA 5KJPA 4RYFA 5DKPA 4JWVA 1RJMA 3N6RB 4B3HA 3Q0JA 4KWBA 3QXIA 1N6DA 3ZWCA 4JCTA 3PGQA 2ZL3A 4ZDBA 3TT7A 2A81A 4U0HA 1WDLA 3RSTA 4I4ZA 3Q0GA 3IB9A 4JVTA 3RRVA 4OLQA 4IZCA 5CTCA 1FC6A 5FIFA 2WTBA 3QXZA 1HNUA 4JJTA 2PG8A 3BEZA 3TDCA 3GF7A 1YG6A 3Q7HA 5KDRB 4G2RA 2C8TA 1WDKA 2F9YA 5DU4A 1YG8A 1J7XA 2NP9A 3GKBA 4Q1IA 4B3IA 2DUBA 2VSUE 4J2UA 3V5IA 2F6IA 4ASIA 3V5EA 2ZQRA 2VSSF 4OG1A 1UYVA 5MGBA 1EF8A 4U19A 5FUSA 3H0SA 2PPYA 4B3JA 3PZKA 3LAOA 4HDTA 4K3WA 4FN8A 4KPKA 1UYSA 4I52A 2DEOA 2D3TA 3BF0A 5INIA 5C90A 3WG5A 1RJNA 3TVUA 4YLHA 3R6HA 4FJWD 3TLFA 5DUCA 4OMRA 4U0GA 4KD6A 5DU8A 4Z0MA 4Q0GA 4ZDCA 1TG6A 3H0UA 1N6EA 2VSSA 2ZL2A 2VSUC 5INFA 5INGA 1N6FA 5CTBA 3RSIA 1K32A 3QYRA 4DI1A 1VRGA 5DZKH 3BPTA 1WZ8A 3KTKA 4U18A 3QREA 2J5GD 5DTWA 3KTHA 2VSSE 3TV5A 5E0NX 5JBWA 1WDMA 5DZKA 1ON9A 4QIIA 3IBBA 3HLN1 3STAA 4ELXA 1MJ3A 3KTGA 2UZFA 5HUQA 3P5MA 1HNOA 1Q51A 3TT6A 1HZDA 2W3PA 2VREA 1SG4A 2CE3A 4EMMA 3T88A 3TRRA 3FF6A 1DUBA 2F9IA 2ZL0A 4IZDA 3IAVA 1DCIA 3OMEA 2FZSA 4ZDFA 3ZW8A 4ELWA 3Q1TA 2PBPA 1FC7A 5DL1A 1PJHA 1XO6A 5E0SH 2J5IB 3HINA 4FZWC 2FW2A 1OD4A 3GLMA 3R0OA 3ZWBA 1SZOA 2F6QA 3VIVA 3GMAA 3SLLA 3H0JA 4JCQA 1FCFA 5DUFA 4EMLA 4ZU2A 3ISAA 2F9IB 1XX4A 4FNBA 2F9YB 3JU1A 2J5IA 1O8UA 1XNWA 3R9QA 4EMPA 5G1SA 3DORA 3MFMA 5DTPA 1EY3A 4JFCA 4MI2A 4WYOB 3G64A 3HP0A 4HNKA 3P2LA 4IZBA 3QWDA 2HW5A 3U9SB 4FB8A 3T3WA 5C9GA 4K29A 4GM2A 1UYRA 2QQ3A 3SWXA 3DJAA 4MOUA 4NEKA 4U1AA 2FBMA 1X0UA 4FNDA 3H02A 3HRXA 5IKLB 2ZQQA 4KNPA 1OD2A 2GTRA 1PIXA 2Q35A 1K39A 3K8XA 1XNVA 1JXZA 4JCRA 4L6WA 5G1QA 1Y7OA 3K50A 4JOTA 3QKAA 4JCSA 4JYJA 3TVWA 2Q2XA 3NJDA 2X58A 3MT6A 2EJ5A 4F47A 3ZW9A 3U9TB 3M6MA 2A7SA 4ZDDA 1NZYA 3TZ3A 3HE2A 4RCNA 5JBXA 1UYTA 2J5SA 3GF3A 3P85A 2VSUF 3QMJA 1UIYA 3MYBA 2VX2A 1W2XA 4MXIA 4GHNA 2A7KA 3QK8A 3H0QA 2ZL4A 3H81A 3ZWAA 1FC9A 1TYFA 4L8KA 4LK5A 3OC7A 4QIJA 3NJBA 2IEXA 1Q52A 4WZ8B 2YJGA 1EF9A 4NNQA 3U9RB 3FDUA 4RYFH 4QFEA 3KTJA 4ZDEA 3ST9A 4NARA 4WCZA 3T8AA 5G1RA 3M6NA 3KTIA 3PEAA 4JSBA 2VSUA 5KDRA 3R9TA 3PE8A 3BPPA 4I42A 3KQFA 2CBYA 2X24A 4FZWA 4HC8A 2BZRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OT6 A;  3T89 A;  5E0S A;  1NZY B;  4ELS A;  4U0G H;  2J5I I;  1ON3 A;  4JYL A;  4K2N A;  1XNY A;  3R9S A;  5DU6 A;  3I47 A;  3MOY A;  3T8B A;  2Q34 A;  3L3S A;  3LKE A;  4FN7 A;  2J5G A;  5KJP A;  4RYF A;  5DKP A;  4JWV A;  1RJM A;  3N6R B;  4B3H A;  3Q0J A;  4KWB A;  3QXI A;  1N6D A;  3ZWC A;  4JCT A;  3PGQ A;  2ZL3 A;  4ZDB A;  3TT7 A;  2A81 A;  4U0H A;  1WDL A;  3RST A;  4I4Z A;  3Q0G A;  3IB9 A;  4JVT A;  3RRV A;  4OLQ A;  4IZC A;  5CTC A;  1FC6 A;  5FIF A;  2WTB A;  3QXZ A;  1HNU A;  4JJT A;  2PG8 A;  3BEZ A;  3TDC A;  3GF7 A;  1YG6 A;  3Q7H A;  5KDR B;  4G2R A;  2C8T A;  1WDK A;  2F9Y A;  5DU4 A;  1YG8 A;  1J7X A;  2NP9 A;  3GKB A;  4Q1I A;  4B3I A;  2DUB A;  2VSU E;  3V5I A;  2F6I A;  4ASI A;  3V5E A;  2ZQR A;  2VSS F;  4OG1 A;  1UYV A;  5MGB A;  1EF8 A;  4U19 A;  5FUS A;  3H0S A;  2PPY A;  4B3J A;  3PZK A;  3LAO A;  4K3W A;  4FN8 A;  4KPK A;  1UYS A;  4I52 A;  2DEO A;  2D3T A;  3BF0 A;  5INI A;  5C90 A;  3WG5 A;  1RJN A;  3TVU A;  4YLH A;  3R6H A;  4FJW D;  3TLF A;  5DUC A;  4OMR A;  4U0G A;  4KD6 A;  5DU8 A;  4Z0M A;  4Q0G A;  4ZDC A;  1TG6 A;  3H0U A;  1N6E A;  2VSS A;  2ZL2 A;  2VSU C;  5INF A;  5ING A;  1N6F A;  5CTB A;  3RSI A;  1K32 A;  3QYR A;  4DI1 A;  1VRG A;  5DZK H;  1WZ8 A;  3KTK A;  4U18 A;  3QRE A;  2J5G D;  5DTW A;  3KTH A;  2VSS E;  3TV5 A;  5E0N X;  5JBW A;  1WDM A;  5DZK A;  1ON9 A;  4QII A;  3IBB A;  3HLN 1;  3STA A;  4ELX A;  1MJ3 A;  3KTG A;  2UZF A;  3P5M A;  1HNO A;  1Q51 A;  3TT6 A;  1HZD A;  2W3P A;  2VRE A;  1SG4 A;  2CE3 A;  4EMM A;  3T88 A;  3TRR A;  3FF6 A;  1DUB A;  2F9I A;  2ZL0 A;  4IZD A;  3IAV A;  1DCI A;  3OME A;  2FZS A;  4ZDF A;  3ZW8 A;  4ELW A;  3Q1T A;  2PBP A;  1FC7 A;  5DL1 A;  1PJH A;  1XO6 A;  5E0S H;  2J5I B;  3HIN A;  4FZW C;  2FW2 A;  1OD4 A;  3GLM A;  3R0O A;  3ZWB A;  1SZO A;  2F6Q A;  3VIV A;  3GMA A;  3SLL A;  3H0J A;  4JCQ A;  1FCF A;  5DUF A;  4EML A;  4ZU2 A;  3ISA A;  2F9I B;  1XX4 A;  4FNB A;  2F9Y B;  3JU1 A;  2J5I A;  1O8U A;  1XNW A;  3R9Q A;  4EMP A;  5G1S A;  3DOR A;  3MFM A;  5DTP A;  1EY3 A;  4JFC A;  4MI2 A;  4WYO B;  3G64 A;  3HP0 A;  4HNK A;  3P2L A;  4IZB A;  3QWD A;  2HW5 A;  3U9S B;  4FB8 A;  3T3W A;  5C9G A;  4K29 A;  4GM2 A;  1UYR A;  2QQ3 A;  3SWX A;  3DJA A;  4MOU A;  4NEK A;  4U1A A;  2FBM A;  1X0U A;  4FND A;  3H02 A;  3HRX A;  5IKL B;  2ZQQ A;  4KNP A;  1OD2 A;  2GTR A;  1PIX A;  2Q35 A;  1K39 A;  3K8X A;  1XNV A;  1JXZ A;  4JCR A;  4L6W A;  5G1Q A;  1Y7O A;  3K50 A;  4JOT A;  3QKA A;  4JCS A;  4JYJ A;  3TVW A;  2Q2X A;  3NJD A;  2X58 A;  3MT6 A;  2EJ5 A;  4F47 A;  3ZW9 A;  3U9T B;  3M6M A;  2A7S A;  4ZDD A;  1NZY A;  3TZ3 A;  3HE2 A;  4RCN A;  5JBX A;  1UYT A;  2J5S A;  3GF3 A;  3P85 A;  2VSU F;  3QMJ A;  1UIY A;  3MYB A;  2VX2 A;  1W2X A;  4MXI A;  4GHN A;  2A7K A;  3QK8 A;  3H0Q A;  2ZL4 A;  3H81 A;  3ZWA A;  1FC9 A;  1TYF A;  4L8K A;  4LK5 A;  3OC7 A;  4QIJ A;  3NJB A;  2IEX A;  1Q52 A;  4WZ8 B;  1EF9 A;  4NNQ A;  3U9R B;  3FDU A;  4RYF H;  4QFE A;  3KTJ A;  4ZDE A;  3ST9 A;  4WCZ A;  3T8A A;  5G1R A;  3M6N A;  3KTI A;  3PEA A;  4JSB A;  2VSU A;  5KDR A;  3R9T A;  3PE8 A;  3BPP A;  4I42 A;  3KQF A;  2CBY A;  2X24 A;  4FZW A;  4HC8 A;  2BZR A; 
#chains in the Genus database with same CATH topology
 3OT6 A;  3T89 A;  5E0S A;  1NZY B;  4ELS A;  3O4X E;  4U0G H;  2J5I I;  1ON3 A;  4JYL A;  4K2N A;  1XNY A;  3R9S A;  5DU6 A;  3I47 A;  3MOY A;  3T8B A;  2Q34 A;  3L3S A;  3LKE A;  4FN7 A;  2J5G A;  5KJP A;  4RYF A;  5DKP A;  4JWV A;  1RJM A;  3N6R B;  4B3H A;  3Q0J A;  4KWB A;  3QXI A;  1N6D A;  3ZWC A;  4JCT A;  3PGQ A;  2ZL3 A;  4ZDB A;  3TT7 A;  2A81 A;  4U0H A;  3L8J A;  1WDL A;  3RST A;  4I4Z A;  3Q0G A;  3IB9 A;  4JVT A;  3RRV A;  3IRB A;  4OLQ A;  4IZC A;  5CTC A;  1FC6 A;  5FIF A;  2P63 A;  2WTB A;  3QXZ A;  1HNU A;  4JJT A;  2PG8 A;  3BEZ A;  3TDC A;  3GF7 A;  1YG6 A;  3Q7H A;  5KDR B;  3A4M A;  4G2R A;  2C8T A;  1WDK A;  2F9Y A;  5DU4 A;  1YG8 A;  1J7X A;  3A4N A;  2NP9 A;  3GKB A;  4Q1I A;  4B3I A;  2DUB A;  2VSU E;  4J2U A;  3V5I A;  1Y64 B;  2F6I A;  4ASI A;  3V5E A;  2ZQR A;  3ADD A;  2VSS F;  4OG1 A;  3L8I A;  1UYV A;  5MGB A;  1EF8 A;  4U19 A;  5FUS A;  3H0S A;  2PPY A;  4B3J A;  3PZK A;  3LAO A;  4HDT A;  4K3W A;  4FN8 A;  4KPK A;  1UYS A;  4I52 A;  2DEO A;  2D3T A;  3BF0 A;  5INI A;  5C90 A;  3WG5 A;  1RJN A;  3AM1 A;  3TVU A;  4YLH A;  3R6H A;  4FJW D;  3TLF A;  5DUC A;  4OMR A;  4U0G A;  4KD6 A;  5DU8 A;  4Z0M A;  4Q0G A;  4ZDC A;  1TG6 A;  3H0U A;  1N6E A;  2VSS A;  2ZL2 A;  2VSU C;  5INF A;  5ING A;  1N6F A;  5CTB A;  3RSI A;  1K32 A;  3QYR A;  4DI1 A;  1VRG A;  5DZK H;  3BPT A;  1WZ8 A;  3KTK A;  4U18 A;  3QRE A;  2J5G D;  3W8I B;  5DTW A;  3KTH A;  2VSS E;  3TV5 A;  5E0N X;  5JBW A;  1WDM A;  5DZK A;  1ON9 A;  4QII A;  3IBB A;  3HLN 1;  3STA A;  4ELX A;  1MJ3 A;  3KTG A;  2UZF A;  5HUQ A;  3P5M A;  1HNO A;  1Q51 A;  3W8H B;  1UX4 A;  3TT6 A;  1HZD A;  2W3P A;  2VRE A;  1SG4 A;  2CE3 A;  3T88 A;  3TRR A;  3FF6 A;  4EMM A;  1DUB A;  2F9I A;  2ZL0 A;  4IZD A;  3IAV A;  1DCI A;  3RQE A;  3OME A;  2FZS A;  4ZDF A;  3ZW8 A;  4ELW A;  3Q1T A;  2PBP A;  1FC7 A;  5DL1 A;  1PJH A;  1XO6 A;  5E0S H;  2J5I B;  3HIN A;  4FZW C;  2FW2 A;  1OD4 A;  3GLM A;  3R0O A;  3ZWB A;  1SZO A;  3ADC A;  2F6Q A;  3VIV A;  3GMA A;  3SLL A;  3H0J A;  3RQF A;  4JCQ A;  1FCF A;  5DUF A;  4EML A;  4ZU2 A;  3ISA A;  2F9I B;  1XX4 A;  4FNB A;  2F9Y B;  3JU1 A;  2J5I A;  1O8U A;  1XNW A;  3R9Q A;  4EMP A;  5G1S A;  3DOR A;  3MFM A;  5DTP A;  1EY3 A;  4JFC A;  4MI2 A;  4WYO B;  3G64 A;  3HP0 A;  4HNK A;  3P2L A;  4IZB A;  3QWD A;  2HW5 A;  3U9S B;  4FB8 A;  3T3W A;  5C9G A;  4K29 A;  4GM2 A;  1UYR A;  2QQ3 A;  3SWX A;  3DJA A;  1UX5 A;  4MOU A;  4NEK A;  4U1A A;  2FBM A;  1X0U A;  4FND A;  3H02 A;  3HRX A;  5IKL B;  2ZQQ A;  4KNP A;  1OD2 A;  2GTR A;  1PIX A;  2Q35 A;  1K39 A;  3K8X A;  1XNV A;  1JXZ A;  4JCR A;  4L6W A;  5G1Q A;  1Y7O A;  3K50 A;  4JOT A;  3QKA A;  4JCS A;  4JYJ A;  3TVW A;  2Q2X A;  3NJD A;  2X58 A;  3MT6 A;  2EJ5 A;  4F47 A;  3ZW9 A;  3U9T B;  3M6M A;  2A7S A;  4ZDD A;  4GEH B;  1NZY A;  3TZ3 A;  3HE2 A;  4RCN A;  5JBX A;  1UYT A;  2J5S A;  3GF3 A;  3P85 A;  2VSU F;  3QMJ A;  1UIY A;  3MYB A;  2VX2 A;  1W2X A;  4MXI A;  4GHN A;  2A7K A;  3QK8 A;  3H0Q A;  3ADB A;  2ZL4 A;  3H81 A;  3ZWA A;  1FC9 A;  1TYF A;  4L8K A;  4LK5 A;  3OC7 A;  4QIJ A;  3A4L A;  3NJB A;  2IEX A;  1Q52 A;  4WZ8 B;  2YJG A;  1EF9 A;  3AJM A;  4NNQ A;  3U9R B;  3FDU A;  4RYF H;  4QFE A;  3KTJ A;  4ZDE A;  3ST9 A;  4NAR A;  4WCZ A;  3T8A A;  5G1R A;  3M6N A;  3KTI A;  3RQG A;  3PEA A;  4JSB A;  2VSU A;  5KDR A;  3R9T A;  3PE8 A;  3BPP A;  4I42 A;  3KQF A;  2X24 A;  2CBY A;  4FZW A;  4HC8 A;  2BZR A; 
#chains in the Genus database with same CATH homology
 3OT6 A;  3T89 A;  5E0S A;  1NZY B;  4ELS A;  4U0G H;  2J5I I;  1ON3 A;  4JYL A;  4K2N A;  1XNY A;  3R9S A;  5DU6 A;  3I47 A;  3MOY A;  3T8B A;  2Q34 A;  3L3S A;  3LKE A;  4FN7 A;  2J5G A;  5KJP A;  4RYF A;  5DKP A;  4JWV A;  1RJM A;  3N6R B;  4B3H A;  3Q0J A;  4KWB A;  3QXI A;  1N6D A;  3ZWC A;  4JCT A;  3PGQ A;  2ZL3 A;  4ZDB A;  3TT7 A;  2A81 A;  4U0H A;  1WDL A;  3RST A;  4I4Z A;  3Q0G A;  3IB9 A;  4JVT A;  3RRV A;  4OLQ A;  4IZC A;  5CTC A;  1FC6 A;  5FIF A;  2WTB A;  3QXZ A;  1HNU A;  4JJT A;  2PG8 A;  3BEZ A;  3TDC A;  3GF7 A;  1YG6 A;  3Q7H A;  5KDR B;  4G2R A;  2C8T A;  1WDK A;  2F9Y A;  5DU4 A;  1YG8 A;  1J7X A;  2NP9 A;  3GKB A;  4Q1I A;  4B3I A;  2DUB A;  2VSU E;  4J2U A;  3V5I A;  2F6I A;  4ASI A;  3V5E A;  2ZQR A;  2VSS F;  4OG1 A;  1UYV A;  5MGB A;  1EF8 A;  4U19 A;  5FUS A;  3H0S A;  2PPY A;  4B3J A;  3PZK A;  3LAO A;  4HDT A;  4K3W A;  4FN8 A;  4KPK A;  1UYS A;  4I52 A;  2DEO A;  2D3T A;  3BF0 A;  5INI A;  5C90 A;  3WG5 A;  1RJN A;  3TVU A;  4YLH A;  3R6H A;  4FJW D;  3TLF A;  5DUC A;  4OMR A;  4U0G A;  4KD6 A;  5DU8 A;  4Z0M A;  4Q0G A;  4ZDC A;  1TG6 A;  3H0U A;  1N6E A;  2VSS A;  2ZL2 A;  2VSU C;  5INF A;  5ING A;  1N6F A;  5CTB A;  3RSI A;  1K32 A;  3QYR A;  4DI1 A;  1VRG A;  5DZK H;  3BPT A;  1WZ8 A;  3KTK A;  4U18 A;  3QRE A;  2J5G D;  5DTW A;  3KTH A;  2VSS E;  3TV5 A;  5E0N X;  5JBW A;  1WDM A;  5DZK A;  1ON9 A;  4QII A;  3IBB A;  3HLN 1;  3STA A;  4ELX A;  1MJ3 A;  3KTG A;  2UZF A;  5HUQ A;  3P5M A;  1HNO A;  1Q51 A;  3TT6 A;  1HZD A;  2W3P A;  2VRE A;  1SG4 A;  2CE3 A;  4EMM A;  3T88 A;  3TRR A;  3FF6 A;  1DUB A;  2F9I A;  2ZL0 A;  4IZD A;  3IAV A;  1DCI A;  3OME A;  2FZS A;  4ZDF A;  3ZW8 A;  4ELW A;  3Q1T A;  2PBP A;  1FC7 A;  5DL1 A;  1PJH A;  1XO6 A;  5E0S H;  2J5I B;  3HIN A;  4FZW C;  2FW2 A;  1OD4 A;  3GLM A;  3R0O A;  3ZWB A;  1SZO A;  2F6Q A;  3VIV A;  3GMA A;  3SLL A;  3H0J A;  4JCQ A;  1FCF A;  5DUF A;  4EML A;  4ZU2 A;  3ISA A;  2F9I B;  1XX4 A;  4FNB A;  2F9Y B;  3JU1 A;  2J5I A;  1O8U A;  1XNW A;  3R9Q A;  4EMP A;  5G1S A;  3DOR A;  3MFM A;  5DTP A;  1EY3 A;  4JFC A;  4MI2 A;  4WYO B;  3G64 A;  3HP0 A;  4HNK A;  3P2L A;  4IZB A;  3QWD A;  2HW5 A;  3U9S B;  4FB8 A;  3T3W A;  5C9G A;  4K29 A;  4GM2 A;  1UYR A;  2QQ3 A;  3SWX A;  3DJA A;  4MOU A;  4NEK A;  4U1A A;  2FBM A;  1X0U A;  4FND A;  3H02 A;  3HRX A;  5IKL B;  2ZQQ A;  4KNP A;  1OD2 A;  2GTR A;  1PIX A;  2Q35 A;  1K39 A;  3K8X A;  1XNV A;  1JXZ A;  4JCR A;  4L6W A;  5G1Q A;  1Y7O A;  3K50 A;  4JOT A;  3QKA A;  4JCS A;  4JYJ A;  3TVW A;  2Q2X A;  3NJD A;  2X58 A;  3MT6 A;  2EJ5 A;  4F47 A;  3ZW9 A;  3U9T B;  3M6M A;  2A7S A;  4ZDD A;  1NZY A;  3TZ3 A;  3HE2 A;  4RCN A;  5JBX A;  1UYT A;  2J5S A;  3GF3 A;  3P85 A;  2VSU F;  3QMJ A;  1UIY A;  3MYB A;  2VX2 A;  1W2X A;  4MXI A;  4GHN A;  2A7K A;  3QK8 A;  3H0Q A;  2ZL4 A;  3H81 A;  3ZWA A;  1FC9 A;  1TYF A;  4L8K A;  4LK5 A;  3OC7 A;  4QIJ A;  3NJB A;  2IEX A;  1Q52 A;  4WZ8 B;  2YJG A;  1EF9 A;  4NNQ A;  3U9R B;  3FDU A;  4RYF H;  4QFE A;  3KTJ A;  4ZDE A;  3ST9 A;  4NAR A;  4WCZ A;  3T8A A;  5G1R A;  3M6N A;  3KTI A;  3PEA A;  4JSB A;  2VSU A;  5KDR A;  3R9T A;  3PE8 A;  3BPP A;  4I42 A;  3KQF A;  2CBY A;  2X24 A;  4FZW A;  4HC8 A;  2BZR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...