2DUBA

Enoyl-coa hydratase complexed with octanoyl-coa
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
259
structure length
254
Chain Sequence
NFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQDCYSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFKDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-ENOYL-COA HYDRATASE
publication title The crystal structure of enoyl-CoA hydratase complexed with octanoyl-CoA reveals the structural adaptations required for binding of a long chain fatty acid-CoA molecule.
pubmed doi rcsb
molecule tags Lyase
total genus 89
structure length 254
sequence length 259
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 1997-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 2dubA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2dubA01
3DJAA 3QREA 3T3WA 3HLN1 3TT6A 1ON9A 4U0GA 3QXIA 2ZL3A 4JOTA 2HW5A 3PE8A 3GF7A 1EF8A 2W3PA 2CE3A 2J5IB 1DUBA 1WDLA 2PPYA 4JJTA 1TG6A 4JWVA 1WDMA 1Y7OA 3MT6A 2F9IA 3PZKA 1K39A 1K32A 2DEOA 3GF3A 2BZRA 3U9SB 1EF9A 4KNPA 1FC7A 4G2RA 4RYFA 3IAVA 2PBPA 1UYSA 4ZDEA 2ZQQA 3QMJA 4L6WA 3GKBA 4Q1IA 3QK8A 2X24A 3H0QA 3TRRA 2ZL2A 2ZL4A 5G1RA 2J5IA 4FN7A 1PJHA 4KWBA 4DI1A 4U19A 3DORA 2GTRA 4JCTA 1FC6A 5E0NX 2Q35A 4RCNA 4FJWD 5KJPA 3M6NA 4ELSA 3MFMA 3JU1A 2WTBA 5CTCA 5DUCA 4K29A 3K8XA 1TYFA 3V5IA 4FZWC 5JBXA 5E0SH 3P85A 2VX2A 2VREA 1FCFA 3IBBA 2PG8A 5G1QA 1XO6A 3HP0A 2QQ3A 3K50A 3TDCA 3QXZA 3LAOA 3H0SA 3MYBA 4U0HA 4EMMA 3G64A 2J5GD 3BF0A 3R0OA 4KPKA 5DZKH 4JSBA 1XNWA 5JBWA 3OC7A 3WG5A 4EMLA 4YLHA 1EY3A 3TV5A 1VRGA 4GHNA 4I52A 1N6EA 3SWXA 1UIYA 2ZQRA 4FB8A 4I4ZA 3HE2A 5KDRB 3KQFA 4ZDDA 1HNUA 3Q7HA 1HZDA 4WYOB 1XX4A 1RJMA 4B3JA 3MOYA 2A7SA 1WZ8A 2J5SA 3GMAA 1RJNA 1PIXA 2Q34A 2C8TA 3T8AA 3FDUA 3QWDA 3U9RB 4WZ8B 4EMPA 4NNQA 2F6IA 1SZOA 4OG1A 4L8KA 5E0SA 3RRVA 3TLFA 1YG8A 5KDRA 4MI2A 4U18A 4B3IA 3HRXA 4FNDA 5INFA 2UZFA 3LKEA 3U9TB 3ZWBA 3PEAA 3TVUA 2Q2XA 4FN8A 4KD6A 3T8BA 5DTPA 3R9SA 1FC9A 1JXZA 4Q0GA 4QIIA 3Q1TA 5MGBA 3NJDA 4IZDA 4WCZA 3TT7A 4FNBA 1Q52A 4RYFH 3ST9A 1W2XA 3ZWAA 2DUBA 2VSUE 1XNVA 1Q51A 3T88A 4NEKA 2J5II 3L3SA 2EJ5A 3R9TA 1HNOA 4Z0MA 3KTJA 4I42A 3NJBA 1X0UA 4HNKA 3KTIA 1O8UA 4U1AA 3Q0GA 2FZSA 2F9IB 3FF6A 4ZDBA 1MJ3A 1UYTA 4ZDFA 3ZWCA 2J5GA 3M6MA 1XNYA 5CTBA 2FW2A 3V5EA 2VSUA 4JCQA 3TVWA 1UYRA 3OT6A 2X58A 1OD2A 4GM2A 1WDKA 1ON3A 2F9YB 1OD4A 5C9GA 1J7XA 4JYLA 3SLLA 1N6FA 5DU6A 2FBMA 3H02A 2VSUF 4K3WA 3ZW8A 3I47A 4OLQA 4ZDCA 3KTHA 5DKPA 1N6DA 5INGA 4JYJA 4HC8A 4K2NA 4OMRA 4JVTA 4JCRA 3BPPA 5DTWA 4IZBA 2F6QA 3Q0JA 3ISAA 3PGQA 4LK5A 1DCIA 1NZYB 4ELXA 1YG6A 4U0GH 5FIFA 2F9YA 5C90A 2VSSE 1SG4A 3QKAA 2IEXA 2D3TA 4MXIA 3TZ3A 4JCSA 3BEZA 5IKLB 5DZKA 5DU8A 1UYVA 5DU4A 3R6HA 3P2LA 4IZCA 3H0JA 3ZW9A 4ZU2A 2CBYA 4QFEA 5INIA 5FUSA 2A7KA 2A81A 4MOUA 4ASIA 5DUFA 3RSTA 2ZL0A 4FZWA 3P5MA 3KTGA 3KTKA 3HINA 1NZYA 2VSSA 4B3HA 5G1SA 3OMEA 3IB9A 3VIVA 3R9QA 3T89A 2NP9A 3H81A 4JFCA 4F47A 5DL1A 4ELWA 3H0UA 4QIJA 2VSUC 3GLMA 3QYRA 3RSIA 3N6RB 2VSSF 3STAA
chains in the Genus database with same CATH superfamily
3ADDA 3DJAA 3QREA 3T3WA 3HLN1 3TT6A 1ON9A 4U0GA 3QXIA 2ZL3A 4JOTA 2HW5A 3PE8A 3GF7A 1EF8A 2W3PA 2CE3A 2J5IB 1DUBA 1WDLA 2PPYA 4JJTA 1TG6A 4JWVA 1WDMA 1Y7OA 3MT6A 2F9IA 3PZKA 1K39A 1K32A 2DEOA 3GF3A 2BZRA 3U9SB 1EF9A 4KNPA 1FC7A 4G2RA 4RYFA 3IAVA 2PBPA 1UYSA 3A4MA 4ZDEA 2ZQQA 3QMJA 4L6WA 3GKBA 4Q1IA 3QK8A 2X24A 3H0QA 3TRRA 2ZL2A 2ZL4A 1UX4A 5G1RA 2J5IA 4FN7A 1PJHA 4KWBA 5HUQA 4DI1A 4U19A 3DORA 2GTRA 4JCTA 1FC6A 5E0NX 4RCNA 2Q35A 4FJWD 5KJPA 3M6NA 4ELSA 3MFMA 3JU1A 2WTBA 5CTCA 5DUCA 4K29A 3K8XA 1TYFA 3V5IA 4FZWC 5JBXA 5E0SH 3P85A 2VX2A 2VREA 1FCFA 3IBBA 3AM1A 2PG8A 5G1QA 1XO6A 4GEHB 3HP0A 2QQ3A 3K50A 3TDCA 3QXZA 3LAOA 3H0SA 3MYBA 4U0HA 4EMMA 3G64A 3ADBA 2J5GD 3BF0A 3R0OA 4KPKA 5DZKH 3IRBA 4JSBA 1XNWA 4NARA 5JBWA 3OC7A 3WG5A 4EMLA 4YLHA 1EY3A 3TV5A 1VRGA 4GHNA 4I52A 1N6EA 3SWXA 1UIYA 2ZQRA 4FB8A 3RQFA 4I4ZA 3HE2A 5KDRB 3KQFA 4ZDDA 1HNUA 3Q7HA 1HZDA 4WYOB 1XX4A 1RJMA 4B3JA 3MOYA 2A7SA 3BPTA 1WZ8A 2J5SA 3GMAA 1RJNA 1PIXA 2Q34A 2C8TA 3A4NA 3T8AA 3FDUA 3QWDA 3U9RB 4WZ8B 4EMPA 4NNQA 2F6IA 1SZOA 4OG1A 3ADCA 4L8KA 5E0SA 3RRVA 3TLFA 1YG8A 5KDRA 3A4LA 4MI2A 4U18A 4B3IA 3HRXA 4FNDA 5INFA 2UZFA 3LKEA 3U9TB 3ZWBA 3PEAA 3TVUA 2Q2XA 4FN8A 4KD6A 3T8BA 5DTPA 3R9SA 1FC9A 1JXZA 4Q0GA 4QIIA 3Q1TA 5MGBA 3NJDA 4IZDA 4WCZA 3TT7A 4FNBA 1Q52A 4RYFH 3ST9A 1W2XA 3ZWAA 2DUBA 2VSUE 1XNVA 1Q51A 3T88A 4NEKA 2J5II 3L3SA 2EJ5A 3R9TA 1HNOA 4Z0MA 3KTJA 4I42A 3NJBA 3L8JA 1X0UA 4HNKA 3KTIA 1O8UA 4U1AA 3Q0GA 2FZSA 3W8IB 3RQGA 3W8HB 2F9IB 3FF6A 4ZDBA 1MJ3A 1UYTA 4ZDFA 3ZWCA 2J5GA 3M6MA 4J2UA 1XNYA 5CTBA 2FW2A 3V5EA 2VSUA 4JCQA 3TVWA 1UYRA 3OT6A 2X58A 1OD2A 4GM2A 1WDKA 1ON3A 2F9YB 1OD4A 5C9GA 1J7XA 4JYLA 3SLLA 1N6FA 2YJGA 5DU6A 2FBMA 3H02A 2VSUF 3AJMA 4K3WA 3ZW8A 3I47A 4OLQA 4ZDCA 3KTHA 3RQEA 5DKPA 4HDTA 1N6DA 5INGA 4JYJA 4HC8A 2P63A 4K2NA 4OMRA 4JVTA 4JCRA 3BPPA 5DTWA 3O4XE 2F6QA 4IZBA 3Q0JA 3ISAA 3PGQA 4LK5A 1Y64B 1DCIA 1NZYB 4ELXA 1YG6A 4U0GH 5FIFA 2F9YA 5C90A 2VSSE 1SG4A 3QKAA 2IEXA 2D3TA 4MXIA 3TZ3A 4JCSA 3BEZA 5IKLB 5DZKA 5DU8A 1UYVA 5DU4A 3R6HA 3P2LA 4IZCA 3H0JA 3ZW9A 4ZU2A 2CBYA 4QFEA 5INIA 5FUSA 2A7KA 2A81A 4MOUA 4ASIA 5DUFA 3RSTA 2ZL0A 4FZWA 3P5MA 3KTGA 3KTKA 3HINA 1NZYA 2VSSA 4B3HA 5G1SA 3OMEA 3IB9A 3VIVA 1UX5A 3R9QA 3T89A 2NP9A 3H81A 4JFCA 4F47A 5DL1A 4ELWA 3H0UA 4QIJA 2VSUC 3L8IA 3GLMA 3QYRA 3RSIA 3N6RB 2VSSF 3STAA
chains in the Genus database with same CATH topology
3DJAA 3QREA 3T3WA 3HLN1 3TT6A 1ON9A 4U0GA 3QXIA 2ZL3A 4JOTA 2HW5A 3PE8A 3GF7A 1EF8A 2W3PA 2CE3A 2J5IB 1DUBA 1WDLA 2PPYA 4JJTA 1TG6A 4JWVA 1WDMA 1Y7OA 3MT6A 2F9IA 3PZKA 1K39A 1K32A 2DEOA 3GF3A 2BZRA 3U9SB 1EF9A 4KNPA 1FC7A 4G2RA 4RYFA 3IAVA 2PBPA 1UYSA 4ZDEA 2ZQQA 3QMJA 4L6WA 3GKBA 4Q1IA 3QK8A 2X24A 3H0QA 3TRRA 2ZL2A 2ZL4A 5G1RA 2J5IA 4FN7A 1PJHA 4KWBA 5HUQA 4DI1A 4U19A 3DORA 2GTRA 4JCTA 1FC6A 5E0NX 2Q35A 4RCNA 4FJWD 5KJPA 3M6NA 4ELSA 3MFMA 3JU1A 2WTBA 5CTCA 5DUCA 4K29A 3K8XA 1TYFA 3V5IA 4FZWC 5JBXA 5E0SH 3P85A 2VX2A 2VREA 1FCFA 3IBBA 2PG8A 5G1QA 1XO6A 3HP0A 2QQ3A 3K50A 3TDCA 3QXZA 3LAOA 3H0SA 3MYBA 4U0HA 4EMMA 3G64A 2J5GD 3BF0A 3R0OA 4KPKA 5DZKH 4JSBA 1XNWA 4NARA 5JBWA 3OC7A 3WG5A 4EMLA 4YLHA 1EY3A 3TV5A 1VRGA 4GHNA 4I52A 1N6EA 3SWXA 1UIYA 2ZQRA 4FB8A 4I4ZA 3HE2A 5KDRB 3KQFA 4ZDDA 1HNUA 3Q7HA 1HZDA 4WYOB 1XX4A 1RJMA 4B3JA 3MOYA 2A7SA 3BPTA 1WZ8A 2J5SA 3GMAA 1RJNA 1PIXA 2Q34A 2C8TA 3T8AA 3FDUA 3QWDA 3U9RB 4WZ8B 4EMPA 4NNQA 2F6IA 1SZOA 4OG1A 4L8KA 5E0SA 3RRVA 3TLFA 1YG8A 5KDRA 4MI2A 4U18A 4B3IA 3HRXA 4FNDA 5INFA 2UZFA 3LKEA 3U9TB 3ZWBA 3PEAA 3TVUA 2Q2XA 4FN8A 4KD6A 3T8BA 5DTPA 3R9SA 1FC9A 1JXZA 4Q0GA 4QIIA 3Q1TA 5MGBA 3NJDA 4IZDA 4WCZA 3TT7A 4FNBA 1Q52A 4RYFH 3ST9A 1W2XA 3ZWAA 2DUBA 2VSUE 1XNVA 1Q51A 3T88A 4NEKA 2J5II 3L3SA 2EJ5A 3R9TA 1HNOA 4Z0MA 3KTJA 4I42A 3NJBA 1X0UA 4HNKA 3KTIA 1O8UA 4U1AA 3Q0GA 2FZSA 2F9IB 3FF6A 4ZDBA 1MJ3A 1UYTA 4ZDFA 3ZWCA 2J5GA 3M6MA 4J2UA 1XNYA 5CTBA 2FW2A 3V5EA 2VSUA 4JCQA 3TVWA 1UYRA 3OT6A 2X58A 1OD2A 4GM2A 1WDKA 1ON3A 2F9YB 1OD4A 5C9GA 1J7XA 4JYLA 3SLLA 1N6FA 2YJGA 5DU6A 2FBMA 3H02A 2VSUF 4K3WA 3ZW8A 3I47A 4OLQA 4ZDCA 3KTHA 5DKPA 4HDTA 1N6DA 5INGA 4JYJA 4HC8A 4K2NA 4OMRA 4JVTA 4JCRA 3BPPA 5DTWA 4IZBA 2F6QA 3Q0JA 3ISAA 3PGQA 4LK5A 1DCIA 1NZYB 4ELXA 1YG6A 4U0GH 5FIFA 2F9YA 5C90A 2VSSE 1SG4A 3QKAA 2IEXA 2D3TA 4MXIA 3TZ3A 4JCSA 3BEZA 5IKLB 5DZKA 5DU8A 1UYVA 5DU4A 3R6HA 3P2LA 4IZCA 3H0JA 3ZW9A 4ZU2A 2CBYA 4QFEA 5INIA 5FUSA 2A7KA 2A81A 4MOUA 4ASIA 5DUFA 3RSTA 2ZL0A 4FZWA 3P5MA 3KTGA 3KTKA 3HINA 1NZYA 2VSSA 4B3HA 5G1SA 3OMEA 3IB9A 3VIVA 3R9QA 3T89A 2NP9A 3H81A 4JFCA 4F47A 5DL1A 4ELWA 3H0UA 4QIJA 2VSUC 3GLMA 3QYRA 3RSIA 3N6RB 2VSSF 3STAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DJA A;  3QRE A;  3T3W A;  3HLN 1;  3TT6 A;  1ON9 A;  4U0G A;  3QXI A;  2ZL3 A;  4JOT A;  2HW5 A;  3PE8 A;  3GF7 A;  1EF8 A;  2W3P A;  2CE3 A;  2J5I B;  1DUB A;  1WDL A;  2PPY A;  4JJT A;  1TG6 A;  4JWV A;  1WDM A;  1Y7O A;  3MT6 A;  2F9I A;  3PZK A;  1K39 A;  1K32 A;  2DEO A;  3GF3 A;  2BZR A;  3U9S B;  1EF9 A;  4KNP A;  1FC7 A;  4G2R A;  4RYF A;  3IAV A;  2PBP A;  1UYS A;  4ZDE A;  2ZQQ A;  3QMJ A;  4L6W A;  3GKB A;  4Q1I A;  3QK8 A;  2X24 A;  3H0Q A;  3TRR A;  2ZL2 A;  2ZL4 A;  5G1R A;  2J5I A;  4FN7 A;  1PJH A;  4KWB A;  4DI1 A;  4U19 A;  3DOR A;  2GTR A;  4JCT A;  1FC6 A;  5E0N X;  2Q35 A;  4RCN A;  4FJW D;  5KJP A;  3M6N A;  4ELS A;  3MFM A;  3JU1 A;  2WTB A;  5CTC A;  5DUC A;  4K29 A;  3K8X A;  1TYF A;  3V5I A;  4FZW C;  5JBX A;  5E0S H;  3P85 A;  2VX2 A;  2VRE A;  1FCF A;  3IBB A;  2PG8 A;  5G1Q A;  1XO6 A;  3HP0 A;  2QQ3 A;  3K50 A;  3TDC A;  3QXZ A;  3LAO A;  3H0S A;  3MYB A;  4U0H A;  4EMM A;  3G64 A;  2J5G D;  3BF0 A;  3R0O A;  4KPK A;  5DZK H;  4JSB A;  1XNW A;  5JBW A;  3OC7 A;  3WG5 A;  4EML A;  4YLH A;  1EY3 A;  3TV5 A;  1VRG A;  4GHN A;  4I52 A;  1N6E A;  3SWX A;  1UIY A;  2ZQR A;  4FB8 A;  4I4Z A;  3HE2 A;  5KDR B;  3KQF A;  4ZDD A;  1HNU A;  3Q7H A;  1HZD A;  4WYO B;  1XX4 A;  1RJM A;  4B3J A;  3MOY A;  2A7S A;  1WZ8 A;  2J5S A;  3GMA A;  1RJN A;  1PIX A;  2Q34 A;  2C8T A;  3T8A A;  3FDU A;  3QWD A;  3U9R B;  4WZ8 B;  4EMP A;  4NNQ A;  2F6I A;  1SZO A;  4OG1 A;  4L8K A;  5E0S A;  3RRV A;  3TLF A;  1YG8 A;  5KDR A;  4MI2 A;  4U18 A;  4B3I A;  3HRX A;  4FND A;  5INF A;  2UZF A;  3LKE A;  3U9T B;  3ZWB A;  3PEA A;  3TVU A;  2Q2X A;  4FN8 A;  4KD6 A;  3T8B A;  5DTP A;  3R9S A;  1FC9 A;  1JXZ A;  4Q0G A;  4QII A;  3Q1T A;  5MGB A;  3NJD A;  4IZD A;  4WCZ A;  3TT7 A;  4FNB A;  1Q52 A;  4RYF H;  3ST9 A;  1W2X A;  3ZWA A;  2DUB A;  2VSU E;  1XNV A;  1Q51 A;  3T88 A;  4NEK A;  2J5I I;  3L3S A;  2EJ5 A;  3R9T A;  1HNO A;  4Z0M A;  3KTJ A;  4I42 A;  3NJB A;  1X0U A;  4HNK A;  3KTI A;  1O8U A;  4U1A A;  3Q0G A;  2FZS A;  2F9I B;  3FF6 A;  4ZDB A;  1MJ3 A;  1UYT A;  4ZDF A;  3ZWC A;  2J5G A;  3M6M A;  1XNY A;  5CTB A;  2FW2 A;  3V5E A;  2VSU A;  4JCQ A;  3TVW A;  1UYR A;  3OT6 A;  2X58 A;  1OD2 A;  4GM2 A;  1WDK A;  1ON3 A;  2F9Y B;  1OD4 A;  5C9G A;  1J7X A;  4JYL A;  3SLL A;  1N6F A;  5DU6 A;  2FBM A;  3H02 A;  2VSU F;  4K3W A;  3ZW8 A;  3I47 A;  4OLQ A;  4ZDC A;  3KTH A;  5DKP A;  1N6D A;  5ING A;  4JYJ A;  4HC8 A;  4K2N A;  4OMR A;  4JVT A;  4JCR A;  3BPP A;  5DTW A;  4IZB A;  2F6Q A;  3Q0J A;  3ISA A;  3PGQ A;  4LK5 A;  1DCI A;  1NZY B;  4ELX A;  1YG6 A;  4U0G H;  5FIF A;  2F9Y A;  5C90 A;  2VSS E;  1SG4 A;  3QKA A;  2IEX A;  2D3T A;  4MXI A;  3TZ3 A;  4JCS A;  3BEZ A;  5IKL B;  5DZK A;  5DU8 A;  1UYV A;  5DU4 A;  3R6H A;  3P2L A;  4IZC A;  3H0J A;  3ZW9 A;  4ZU2 A;  2CBY A;  4QFE A;  5INI A;  5FUS A;  2A7K A;  2A81 A;  4MOU A;  4ASI A;  5DUF A;  3RST A;  2ZL0 A;  4FZW A;  3P5M A;  3KTG A;  3KTK A;  3HIN A;  1NZY A;  2VSS A;  4B3H A;  5G1S A;  3OME A;  3IB9 A;  3VIV A;  3R9Q A;  3T89 A;  2NP9 A;  3H81 A;  4JFC A;  4F47 A;  5DL1 A;  4ELW A;  3H0U A;  4QIJ A;  2VSU C;  3GLM A;  3QYR A;  3RSI A;  3N6R B;  2VSS F;  3STA A; 
#chains in the Genus database with same CATH topology
 3ADD A;  3DJA A;  3QRE A;  3T3W A;  3HLN 1;  3TT6 A;  1ON9 A;  4U0G A;  3QXI A;  2ZL3 A;  4JOT A;  2HW5 A;  3PE8 A;  3GF7 A;  1EF8 A;  2W3P A;  2CE3 A;  2J5I B;  1DUB A;  1WDL A;  2PPY A;  4JJT A;  1TG6 A;  4JWV A;  1WDM A;  1Y7O A;  3MT6 A;  2F9I A;  3PZK A;  1K39 A;  1K32 A;  2DEO A;  3GF3 A;  2BZR A;  3U9S B;  1EF9 A;  4KNP A;  1FC7 A;  4G2R A;  4RYF A;  3IAV A;  2PBP A;  1UYS A;  3A4M A;  4ZDE A;  2ZQQ A;  3QMJ A;  4L6W A;  3GKB A;  4Q1I A;  3QK8 A;  2X24 A;  3H0Q A;  3TRR A;  2ZL2 A;  2ZL4 A;  1UX4 A;  5G1R A;  2J5I A;  4FN7 A;  1PJH A;  4KWB A;  5HUQ A;  4DI1 A;  4U19 A;  3DOR A;  2GTR A;  4JCT A;  1FC6 A;  5E0N X;  4RCN A;  2Q35 A;  4FJW D;  5KJP A;  3M6N A;  4ELS A;  3MFM A;  3JU1 A;  2WTB A;  5CTC A;  5DUC A;  4K29 A;  3K8X A;  1TYF A;  3V5I A;  4FZW C;  5JBX A;  5E0S H;  3P85 A;  2VX2 A;  2VRE A;  1FCF A;  3IBB A;  3AM1 A;  2PG8 A;  5G1Q A;  1XO6 A;  4GEH B;  3HP0 A;  2QQ3 A;  3K50 A;  3TDC A;  3QXZ A;  3LAO A;  3H0S A;  3MYB A;  4U0H A;  4EMM A;  3G64 A;  3ADB A;  2J5G D;  3BF0 A;  3R0O A;  4KPK A;  5DZK H;  3IRB A;  4JSB A;  1XNW A;  4NAR A;  5JBW A;  3OC7 A;  3WG5 A;  4EML A;  4YLH A;  1EY3 A;  3TV5 A;  1VRG A;  4GHN A;  4I52 A;  1N6E A;  3SWX A;  1UIY A;  2ZQR A;  4FB8 A;  3RQF A;  4I4Z A;  3HE2 A;  5KDR B;  3KQF A;  4ZDD A;  1HNU A;  3Q7H A;  1HZD A;  4WYO B;  1XX4 A;  1RJM A;  4B3J A;  3MOY A;  2A7S A;  3BPT A;  1WZ8 A;  2J5S A;  3GMA A;  1RJN A;  1PIX A;  2Q34 A;  2C8T A;  3A4N A;  3T8A A;  3FDU A;  3QWD A;  3U9R B;  4WZ8 B;  4EMP A;  4NNQ A;  2F6I A;  1SZO A;  4OG1 A;  3ADC A;  4L8K A;  5E0S A;  3RRV A;  3TLF A;  1YG8 A;  5KDR A;  3A4L A;  4MI2 A;  4U18 A;  4B3I A;  3HRX A;  4FND A;  5INF A;  2UZF A;  3LKE A;  3U9T B;  3ZWB A;  3PEA A;  3TVU A;  2Q2X A;  4FN8 A;  4KD6 A;  3T8B A;  5DTP A;  3R9S A;  1FC9 A;  1JXZ A;  4Q0G A;  4QII A;  3Q1T A;  5MGB A;  3NJD A;  4IZD A;  4WCZ A;  3TT7 A;  4FNB A;  1Q52 A;  4RYF H;  3ST9 A;  1W2X A;  3ZWA A;  2DUB A;  2VSU E;  1XNV A;  1Q51 A;  3T88 A;  4NEK A;  2J5I I;  3L3S A;  2EJ5 A;  3R9T A;  1HNO A;  4Z0M A;  3KTJ A;  4I42 A;  3NJB A;  3L8J A;  1X0U A;  4HNK A;  3KTI A;  1O8U A;  4U1A A;  3Q0G A;  2FZS A;  3W8I B;  3RQG A;  3W8H B;  2F9I B;  3FF6 A;  4ZDB A;  1MJ3 A;  1UYT A;  4ZDF A;  3ZWC A;  2J5G A;  3M6M A;  4J2U A;  1XNY A;  5CTB A;  2FW2 A;  3V5E A;  2VSU A;  4JCQ A;  3TVW A;  1UYR A;  3OT6 A;  2X58 A;  1OD2 A;  4GM2 A;  1WDK A;  1ON3 A;  2F9Y B;  1OD4 A;  5C9G A;  1J7X A;  4JYL A;  3SLL A;  1N6F A;  2YJG A;  5DU6 A;  2FBM A;  3H02 A;  2VSU F;  3AJM A;  4K3W A;  3ZW8 A;  3I47 A;  4OLQ A;  4ZDC A;  3KTH A;  3RQE A;  5DKP A;  4HDT A;  1N6D A;  5ING A;  4JYJ A;  4HC8 A;  2P63 A;  4K2N A;  4OMR A;  4JVT A;  4JCR A;  3BPP A;  5DTW A;  3O4X E;  2F6Q A;  4IZB A;  3Q0J A;  3ISA A;  3PGQ A;  4LK5 A;  1Y64 B;  1DCI A;  1NZY B;  4ELX A;  1YG6 A;  4U0G H;  5FIF A;  2F9Y A;  5C90 A;  2VSS E;  1SG4 A;  3QKA A;  2IEX A;  2D3T A;  4MXI A;  3TZ3 A;  4JCS A;  3BEZ A;  5IKL B;  5DZK A;  5DU8 A;  1UYV A;  5DU4 A;  3R6H A;  3P2L A;  4IZC A;  3H0J A;  3ZW9 A;  4ZU2 A;  2CBY A;  4QFE A;  5INI A;  5FUS A;  2A7K A;  2A81 A;  4MOU A;  4ASI A;  5DUF A;  3RST A;  2ZL0 A;  4FZW A;  3P5M A;  3KTG A;  3KTK A;  3HIN A;  1NZY A;  2VSS A;  4B3H A;  5G1S A;  3OME A;  3IB9 A;  3VIV A;  1UX5 A;  3R9Q A;  3T89 A;  2NP9 A;  3H81 A;  4JFC A;  4F47 A;  5DL1 A;  4ELW A;  3H0U A;  4QIJ A;  2VSU C;  3L8I A;  3GLM A;  3QYR A;  3RSI A;  3N6R B;  2VSS F;  3STA A; 
#chains in the Genus database with same CATH homology
 3DJA A;  3QRE A;  3T3W A;  3HLN 1;  3TT6 A;  1ON9 A;  4U0G A;  3QXI A;  2ZL3 A;  4JOT A;  2HW5 A;  3PE8 A;  3GF7 A;  1EF8 A;  2W3P A;  2CE3 A;  2J5I B;  1DUB A;  1WDL A;  2PPY A;  4JJT A;  1TG6 A;  4JWV A;  1WDM A;  1Y7O A;  3MT6 A;  2F9I A;  3PZK A;  1K39 A;  1K32 A;  2DEO A;  3GF3 A;  2BZR A;  3U9S B;  1EF9 A;  4KNP A;  1FC7 A;  4G2R A;  4RYF A;  3IAV A;  2PBP A;  1UYS A;  4ZDE A;  2ZQQ A;  3QMJ A;  4L6W A;  3GKB A;  4Q1I A;  3QK8 A;  2X24 A;  3H0Q A;  3TRR A;  2ZL2 A;  2ZL4 A;  5G1R A;  2J5I A;  4FN7 A;  1PJH A;  4KWB A;  5HUQ A;  4DI1 A;  4U19 A;  3DOR A;  2GTR A;  4JCT A;  1FC6 A;  5E0N X;  2Q35 A;  4RCN A;  4FJW D;  5KJP A;  3M6N A;  4ELS A;  3MFM A;  3JU1 A;  2WTB A;  5CTC A;  5DUC A;  4K29 A;  3K8X A;  1TYF A;  3V5I A;  4FZW C;  5JBX A;  5E0S H;  3P85 A;  2VX2 A;  2VRE A;  1FCF A;  3IBB A;  2PG8 A;  5G1Q A;  1XO6 A;  3HP0 A;  2QQ3 A;  3K50 A;  3TDC A;  3QXZ A;  3LAO A;  3H0S A;  3MYB A;  4U0H A;  4EMM A;  3G64 A;  2J5G D;  3BF0 A;  3R0O A;  4KPK A;  5DZK H;  4JSB A;  1XNW A;  4NAR A;  5JBW A;  3OC7 A;  3WG5 A;  4EML A;  4YLH A;  1EY3 A;  3TV5 A;  1VRG A;  4GHN A;  4I52 A;  1N6E A;  3SWX A;  1UIY A;  2ZQR A;  4FB8 A;  4I4Z A;  3HE2 A;  5KDR B;  3KQF A;  4ZDD A;  1HNU A;  3Q7H A;  1HZD A;  4WYO B;  1XX4 A;  1RJM A;  4B3J A;  3MOY A;  2A7S A;  3BPT A;  1WZ8 A;  2J5S A;  3GMA A;  1RJN A;  1PIX A;  2Q34 A;  2C8T A;  3T8A A;  3FDU A;  3QWD A;  3U9R B;  4WZ8 B;  4EMP A;  4NNQ A;  2F6I A;  1SZO A;  4OG1 A;  4L8K A;  5E0S A;  3RRV A;  3TLF A;  1YG8 A;  5KDR A;  4MI2 A;  4U18 A;  4B3I A;  3HRX A;  4FND A;  5INF A;  2UZF A;  3LKE A;  3U9T B;  3ZWB A;  3PEA A;  3TVU A;  2Q2X A;  4FN8 A;  4KD6 A;  3T8B A;  5DTP A;  3R9S A;  1FC9 A;  1JXZ A;  4Q0G A;  4QII A;  3Q1T A;  5MGB A;  3NJD A;  4IZD A;  4WCZ A;  3TT7 A;  4FNB A;  1Q52 A;  4RYF H;  3ST9 A;  1W2X A;  3ZWA A;  2DUB A;  2VSU E;  1XNV A;  1Q51 A;  3T88 A;  4NEK A;  2J5I I;  3L3S A;  2EJ5 A;  3R9T A;  1HNO A;  4Z0M A;  3KTJ A;  4I42 A;  3NJB A;  1X0U A;  4HNK A;  3KTI A;  1O8U A;  4U1A A;  3Q0G A;  2FZS A;  2F9I B;  3FF6 A;  4ZDB A;  1MJ3 A;  1UYT A;  4ZDF A;  3ZWC A;  2J5G A;  3M6M A;  4J2U A;  1XNY A;  5CTB A;  2FW2 A;  3V5E A;  2VSU A;  4JCQ A;  3TVW A;  1UYR A;  3OT6 A;  2X58 A;  1OD2 A;  4GM2 A;  1WDK A;  1ON3 A;  2F9Y B;  1OD4 A;  5C9G A;  1J7X A;  4JYL A;  3SLL A;  1N6F A;  2YJG A;  5DU6 A;  2FBM A;  3H02 A;  2VSU F;  4K3W A;  3ZW8 A;  3I47 A;  4OLQ A;  4ZDC A;  3KTH A;  5DKP A;  4HDT A;  1N6D A;  5ING A;  4JYJ A;  4HC8 A;  4K2N A;  4OMR A;  4JVT A;  4JCR A;  3BPP A;  5DTW A;  4IZB A;  2F6Q A;  3Q0J A;  3ISA A;  3PGQ A;  4LK5 A;  1DCI A;  1NZY B;  4ELX A;  1YG6 A;  4U0G H;  5FIF A;  2F9Y A;  5C90 A;  2VSS E;  1SG4 A;  3QKA A;  2IEX A;  2D3T A;  4MXI A;  3TZ3 A;  4JCS A;  3BEZ A;  5IKL B;  5DZK A;  5DU8 A;  1UYV A;  5DU4 A;  3R6H A;  3P2L A;  4IZC A;  3H0J A;  3ZW9 A;  4ZU2 A;  2CBY A;  4QFE A;  5INI A;  5FUS A;  2A7K A;  2A81 A;  4MOU A;  4ASI A;  5DUF A;  3RST A;  2ZL0 A;  4FZW A;  3P5M A;  3KTG A;  3KTK A;  3HIN A;  1NZY A;  2VSS A;  4B3H A;  5G1S A;  3OME A;  3IB9 A;  3VIV A;  3R9Q A;  3T89 A;  2NP9 A;  3H81 A;  4JFC A;  4F47 A;  5DL1 A;  4ELW A;  3H0U A;  4QIJ A;  2VSU C;  3GLM A;  3QYR A;  3RSI A;  3N6R B;  2VSS F;  3STA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...