2DUBA

Enoyl-coa hydratase complexed with octanoyl-coa
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
259
structure length
254
Chain Sequence
b'NFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQDCYSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFKDH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-ENOYL-COA HYDRATASE
publication title The crystal structure of enoyl-CoA hydratase complexed with octanoyl-CoA reveals the structural adaptations required for binding of a long chain fatty acid-CoA molecule.
pubmed doi rcsb
molecule tags Lyase
total genus 89
structure length 254
sequence length 259
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 1997-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 2dubA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2dubA01
2VREA 3IBBA 2ZL0A 2A81A 3JU1A 3IB9A 2ZQQA 3R9QA 3KTGA 2F6QA 1XX4A 1WZ8A 3R9TA 3KTKA 1UYTA 3R6HA 4WYOB 4MOUA 3NJDA 3Q1TA 3H02A 3P2LA 1JXZA 3H0JA 2HW5A 3QXIA 4IZDA 4KNPA 3GLMA 1O8UA 4U0GA 4K29A 3L3SA 5G1RA 5IKLB 3U9TB 3LKEA 4YLHA 3HINA 3TRRA 2VSSF 3ISAA 4DI1A 3TVUA 3HP0A 5INIA 4JFCA 5DU8A 3KQFA 4B3HA 3T8BA 3FDUA 3K8XA 3PGQA 3QMJA 1X0UA 2DUBA 4K3WA 4ZDCA 1PJHA 3ST9A 4KWBA 1UYVA 3QREA 3T88A 4WZ8B 1RJMA 3R0OA 4I42A 5DL1A 3LAOA 4KPKA 4L8KA 1OD4A 4IZBA 2J5II 3U9SB 3FF6A 2J5GD 4JVTA 3H0UA 3HRXA 2DEOA 3H0QA 4JYJA 3OC7A 3I47A 4QIIA 2FBMA 1UYSA 3GKBA 3SWXA 3G64A 3MOYA 4OMRA 2BZRA 5E0NX 2NP9A 3PZKA 3GMAA 5JBXA 1OD2A 1FC7A 1HZDA 1Y7OA 2VSUF 3TT7A 3ZWCA 1J7XA 2FZSA 4MXIA 5C9GA 3RRVA 3K50A 2QQ3A 1UYRA 3MFMA 5E0SA 2FW2A 4JYLA 3TV5A 4HNKA 4FJWD 2W3PA 2Q2XA 5INGA 5DZKH 1DUBA 5DTPA 4U18A 4Z0MA 5FIFA 3QWDA 3Q7HA 1WDKA 2A7KA 3V5EA 3KTJA 4ELWA 4GHNA 4FZWA 5C90A 5DTWA 1TG6A 5JBWA 2VSSE 3KTIA 4ASIA 3QKAA 4F47A 1HNOA 1FC6A 1SG4A 4RCNA 1K39A 4I52A 5KJPA 2VX2A 3HE2A 3BPPA 4EMPA 4ZDBA 1DCIA 2CBYA 3BF0A 5CTCA 4U19A 2F9YA 3QXZA 1EF8A 2ZQRA 1TYFA 3MT6A 2J5SA 3M6MA 5G1QA 4U0GH 3QYRA 4FZWC 1XNVA 3MYBA 4RYFA 4EMLA 4JWVA 4JCQA 2C8TA 4FNDA 2ZL3A 1XO6A 2UZFA 4L6WA 3OMEA 3H81A 2J5IA 1YG8A 4Q0GA 5CTBA 1NZYA 4FB8A 3TZ3A 4KD6A 1FC9A 3IAVA 4NEKA 4WCZA 1WDMA 3WG5A 2D3TA 4LK5A 4U0HA 1EY3A 4B3JA 3H0SA 2PBPA 1VRGA 2J5IB 4I4ZA 2ZL2A 1NZYB 4JSBA 4OG1A 4ZU2A 4G2RA 4Q1IA 2VSUE 3STAA 3U9RB 1HNUA 3V5IA 4IZCA 4JOTA 4QIJA 2X24A 4OLQA 4ELSA 4B3IA 5DUFA 3TT6A 3PE8A 4JCSA 1WDLA 1Q52A 2Q35A 1PIXA 3SLLA 5MGBA 3P5MA 1Q51A 1N6FA 3PEAA 5DKPA 2F6IA 2IEXA 1ON9A 3ZWAA 1N6DA 2VSUA 2A7SA 3ZW8A 3T89A 3P85A 5FUSA 3DJAA 4FN8A 3M6NA 1RJNA 4EMMA 2J5GA 3GF3A 3TDCA 3RSTA 1W2XA 4QFEA 3HLN1 3VIVA 5E0SH 2CE3A 1XNYA 5DU6A 3N6RB 1SZOA 2GTRA 2VSUC 2PG8A 3TLFA 2WTBA 1UIYA 4NNQA 4JCTA 2F9YB 5DU4A 2VSSA 4JJTA 1FCFA 3BEZA 2EJ5A 3DORA 3TVWA 1N6EA 5DUCA 5INFA 4ZDDA 3OT6A 3Q0GA 2F9IA 4MI2A 1MJ3A 3T3WA 4ZDEA 3ZWBA 3R9SA 4U1AA 5KDRA 3ZW9A 1K32A 3NJBA 4FNBA 1EF9A 2PPYA 2Q34A 2F9IB 5DZKA 4ELXA 4FN7A 3Q0JA 5KDRB 4ZDFA 3KTHA 4K2NA 4JCRA 4GM2A 1XNWA 3RSIA 3GF7A 3QK8A 2X58A 3T8AA 4RYFH 1ON3A 1YG6A 4HC8A 5G1SA 2ZL4A
chains in the Genus database with same CATH superfamily
2VREA 1UX4A 3IBBA 2ZL0A 2A81A 3JU1A 3IB9A 2ZQQA 3R9QA 3KTGA 2F6QA 1XX4A 1WZ8A 3R9TA 3KTKA 1UYTA 3R6HA 4WYOB 4MOUA 3NJDA 3Q1TA 3H02A 3P2LA 1JXZA 3H0JA 2HW5A 3QXIA 3W8HB 2YJGA 4IZDA 4KNPA 3GLMA 1O8UA 4U0GA 4K29A 3L3SA 5G1RA 5IKLB 3U9TB 3LKEA 4YLHA 3HINA 3TRRA 2VSSF 3ISAA 1Y64B 3TVUA 4DI1A 3HP0A 3RQGA 3W8IB 5INIA 4JFCA 5DU8A 3A4NA 3BPTA 3KQFA 4B3HA 3T8BA 3FDUA 3K8XA 3PGQA 3QMJA 1X0UA 2DUBA 4K3WA 4ZDCA 4J2UA 1PJHA 3ST9A 4KWBA 1UYVA 3QREA 3T88A 4WZ8B 1RJMA 3R0OA 4I42A 5DL1A 3LAOA 4KPKA 4L8KA 1OD4A 4IZBA 2J5II 3U9SB 3FF6A 2J5GD 4JVTA 3H0UA 3HRXA 2DEOA 3H0QA 4JYJA 3OC7A 3I47A 4QIIA 2FBMA 1UYSA 3GKBA 3SWXA 3G64A 3MOYA 4OMRA 2BZRA 5E0NX 2NP9A 3PZKA 3GMAA 5JBXA 1OD2A 1FC7A 1HZDA 1Y7OA 2VSUF 3TT7A 3ZWCA 1J7XA 2FZSA 4MXIA 5C9GA 3RRVA 3K50A 2QQ3A 1UYRA 3A4MA 3MFMA 5E0SA 2FW2A 4JYLA 3TV5A 3L8IA 4HNKA 4FJWD 2W3PA 2Q2XA 5INGA 5DZKH 1DUBA 3A4LA 5DTPA 3RQFA 4U18A 3L8JA 4Z0MA 5FIFA 3QWDA 3Q7HA 1WDKA 2A7KA 3V5EA 3KTJA 4ELWA 4GHNA 4FZWA 5C90A 5DTWA 1TG6A 5JBWA 2VSSE 3AM1A 3KTIA 4ASIA 3QKAA 4F47A 1HNOA 1FC6A 1SG4A 4RCNA 1K39A 4I52A 5KJPA 2VX2A 3HE2A 3BPPA 4EMPA 4ZDBA 1DCIA 2CBYA 3BF0A 5CTCA 4U19A 2F9YA 3QXZA 1EF8A 2ZQRA 1TYFA 3MT6A 2J5SA 3M6MA 5G1QA 4U0GH 3QYRA 4FZWC 1XNVA 3AJMA 3MYBA 4RYFA 4EMLA 4JWVA 4JCQA 2C8TA 4FNDA 3RQEA 2ZL3A 1XO6A 3ADBA 4NARA 2UZFA 4L6WA 3OMEA 3H81A 2J5IA 1YG8A 4Q0GA 5CTBA 1NZYA 4FB8A 3TZ3A 4KD6A 1FC9A 3IAVA 4NEKA 4WCZA 1WDMA 3WG5A 2D3TA 4LK5A 4U0HA 1EY3A 4B3JA 3H0SA 2PBPA 1VRGA 2J5IB 4I4ZA 2ZL2A 1NZYB 4JSBA 4OG1A 4ZU2A 4G2RA 4Q1IA 2VSUE 3STAA 3U9RB 1HNUA 4HDTA 3V5IA 4IZCA 4JOTA 4QIJA 2X24A 3ADCA 4OLQA 4ELSA 4B3IA 5DUFA 3TT6A 3PE8A 4JCSA 1WDLA 1Q52A 2Q35A 1PIXA 3SLLA 5MGBA 3P5MA 1Q51A 1N6FA 3PEAA 5DKPA 2F6IA 2IEXA 1ON9A 3ZWAA 1N6DA 5HUQA 2VSUA 2A7SA 3ZW8A 3T89A 3P85A 5FUSA 3DJAA 4FN8A 3M6NA 2P63A 1RJNA 4EMMA 2J5GA 3GF3A 3TDCA 3RSTA 1W2XA 3ADDA 4GEHB 4QFEA 3HLN1 3VIVA 3IRBA 5E0SH 2CE3A 1XNYA 5DU6A 3N6RB 1SZOA 2GTRA 2VSUC 2PG8A 3TLFA 2WTBA 1UIYA 4NNQA 4JCTA 2F9YB 5DU4A 2VSSA 4JJTA 1FCFA 3BEZA 2EJ5A 3DORA 3TVWA 1N6EA 5DUCA 5INFA 4ZDDA 1UX5A 3O4XE 3OT6A 3Q0GA 2F9IA 4MI2A 1MJ3A 3T3WA 4ZDEA 3ZWBA 3R9SA 4U1AA 5KDRA 3ZW9A 1K32A 3NJBA 4FNBA 1EF9A 2PPYA 2Q34A 2F9IB 5DZKA 4ELXA 4FN7A 3Q0JA 5KDRB 4ZDFA 3KTHA 4K2NA 4JCRA 4GM2A 1XNWA 3RSIA 3GF7A 3QK8A 2X58A 3T8AA 4RYFH 1ON3A 1YG6A 4HC8A 5G1SA 2ZL4A
chains in the Genus database with same CATH topology
2VREA 3IBBA 2ZL0A 2A81A 3JU1A 3IB9A 2ZQQA 3R9QA 3KTGA 2F6QA 1XX4A 1WZ8A 3R9TA 3KTKA 1UYTA 3R6HA 4WYOB 4MOUA 3NJDA 3Q1TA 3H02A 3P2LA 1JXZA 3H0JA 2HW5A 3QXIA 2YJGA 4IZDA 4KNPA 3GLMA 1O8UA 4U0GA 4K29A 3L3SA 5G1RA 5IKLB 3U9TB 3LKEA 4YLHA 3HINA 3TRRA 2VSSF 3ISAA 4DI1A 3TVUA 3HP0A 5INIA 4JFCA 5DU8A 3BPTA 3KQFA 4B3HA 3T8BA 3FDUA 3K8XA 3PGQA 3QMJA 1X0UA 2DUBA 4K3WA 4ZDCA 4J2UA 1PJHA 3ST9A 4KWBA 1UYVA 3QREA 3T88A 4WZ8B 1RJMA 3R0OA 4I42A 5DL1A 3LAOA 4KPKA 4L8KA 1OD4A 4IZBA 2J5II 3U9SB 3FF6A 2J5GD 4JVTA 3H0UA 3HRXA 2DEOA 3H0QA 4JYJA 3OC7A 3I47A 4QIIA 2FBMA 1UYSA 3GKBA 3SWXA 3G64A 3MOYA 4OMRA 2BZRA 5E0NX 2NP9A 3PZKA 3GMAA 5JBXA 1OD2A 1FC7A 1HZDA 1Y7OA 2VSUF 3TT7A 3ZWCA 1J7XA 2FZSA 4MXIA 5C9GA 3RRVA 3K50A 2QQ3A 1UYRA 3MFMA 5E0SA 2FW2A 4JYLA 3TV5A 4HNKA 4FJWD 2W3PA 2Q2XA 5INGA 5DZKH 1DUBA 5DTPA 4U18A 4Z0MA 5FIFA 3QWDA 3Q7HA 1WDKA 2A7KA 3V5EA 3KTJA 4ELWA 4GHNA 4FZWA 5C90A 5DTWA 1TG6A 5JBWA 2VSSE 3KTIA 4ASIA 3QKAA 4F47A 1HNOA 1FC6A 1SG4A 4RCNA 1K39A 4I52A 5KJPA 2VX2A 3HE2A 3BPPA 4EMPA 4ZDBA 1DCIA 2CBYA 3BF0A 5CTCA 4U19A 2F9YA 3QXZA 1EF8A 2ZQRA 1TYFA 3MT6A 2J5SA 3M6MA 5G1QA 4U0GH 3QYRA 4FZWC 1XNVA 3MYBA 4RYFA 4EMLA 4JWVA 4JCQA 2C8TA 4FNDA 2ZL3A 1XO6A 4NARA 2UZFA 4L6WA 3OMEA 3H81A 2J5IA 1YG8A 4Q0GA 5CTBA 1NZYA 4FB8A 3TZ3A 4KD6A 1FC9A 3IAVA 4NEKA 4WCZA 1WDMA 3WG5A 2D3TA 4LK5A 4U0HA 1EY3A 4B3JA 3H0SA 2PBPA 1VRGA 2J5IB 4I4ZA 2ZL2A 1NZYB 4JSBA 4OG1A 4ZU2A 4G2RA 4Q1IA 2VSUE 3STAA 3U9RB 1HNUA 4HDTA 3V5IA 4IZCA 4JOTA 4QIJA 2X24A 4OLQA 4ELSA 4B3IA 5DUFA 3TT6A 3PE8A 4JCSA 1WDLA 1Q52A 2Q35A 1PIXA 3SLLA 5MGBA 3P5MA 1Q51A 1N6FA 3PEAA 5DKPA 2F6IA 2IEXA 1ON9A 3ZWAA 1N6DA 5HUQA 2VSUA 2A7SA 3ZW8A 3T89A 3P85A 5FUSA 3DJAA 4FN8A 3M6NA 1RJNA 4EMMA 2J5GA 3GF3A 3TDCA 3RSTA 1W2XA 4QFEA 3HLN1 3VIVA 5E0SH 2CE3A 1XNYA 5DU6A 3N6RB 1SZOA 2GTRA 2VSUC 2PG8A 3TLFA 2WTBA 1UIYA 4NNQA 4JCTA 2F9YB 5DU4A 2VSSA 4JJTA 1FCFA 3BEZA 2EJ5A 3DORA 3TVWA 1N6EA 5DUCA 5INFA 4ZDDA 3OT6A 3Q0GA 2F9IA 4MI2A 1MJ3A 3T3WA 4ZDEA 3ZWBA 3R9SA 4U1AA 5KDRA 3ZW9A 1K32A 3NJBA 4FNBA 1EF9A 2PPYA 2Q34A 2F9IB 5DZKA 4ELXA 4FN7A 3Q0JA 5KDRB 4ZDFA 3KTHA 4K2NA 4JCRA 4GM2A 1XNWA 3RSIA 3GF7A 3QK8A 2X58A 3T8AA 4RYFH 1ON3A 1YG6A 4HC8A 5G1SA 2ZL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VRE A;  3IBB A;  2ZL0 A;  2A81 A;  3JU1 A;  3IB9 A;  2ZQQ A;  3R9Q A;  3KTG A;  2F6Q A;  1XX4 A;  1WZ8 A;  3R9T A;  3KTK A;  1UYT A;  3R6H A;  4WYO B;  4MOU A;  3NJD A;  3Q1T A;  3H02 A;  3P2L A;  1JXZ A;  3H0J A;  2HW5 A;  3QXI A;  4IZD A;  4KNP A;  3GLM A;  1O8U A;  4U0G A;  4K29 A;  3L3S A;  5G1R A;  5IKL B;  3U9T B;  3LKE A;  4YLH A;  3HIN A;  3TRR A;  2VSS F;  3ISA A;  4DI1 A;  3TVU A;  3HP0 A;  5INI A;  4JFC A;  5DU8 A;  3KQF A;  4B3H A;  3T8B A;  3FDU A;  3K8X A;  3PGQ A;  3QMJ A;  1X0U A;  2DUB A;  4K3W A;  4ZDC A;  1PJH A;  3ST9 A;  4KWB A;  1UYV A;  3QRE A;  3T88 A;  4WZ8 B;  1RJM A;  3R0O A;  4I42 A;  5DL1 A;  3LAO A;  4KPK A;  4L8K A;  1OD4 A;  4IZB A;  2J5I I;  3U9S B;  3FF6 A;  2J5G D;  4JVT A;  3H0U A;  3HRX A;  2DEO A;  3H0Q A;  4JYJ A;  3OC7 A;  3I47 A;  4QII A;  2FBM A;  1UYS A;  3GKB A;  3SWX A;  3G64 A;  3MOY A;  4OMR A;  2BZR A;  5E0N X;  2NP9 A;  3PZK A;  3GMA A;  5JBX A;  1OD2 A;  1FC7 A;  1HZD A;  1Y7O A;  2VSU F;  3TT7 A;  3ZWC A;  1J7X A;  2FZS A;  4MXI A;  5C9G A;  3RRV A;  3K50 A;  2QQ3 A;  1UYR A;  3MFM A;  5E0S A;  2FW2 A;  4JYL A;  3TV5 A;  4HNK A;  4FJW D;  2W3P A;  2Q2X A;  5ING A;  5DZK H;  1DUB A;  5DTP A;  4U18 A;  4Z0M A;  5FIF A;  3QWD A;  3Q7H A;  1WDK A;  2A7K A;  3V5E A;  3KTJ A;  4ELW A;  4GHN A;  4FZW A;  5C90 A;  5DTW A;  1TG6 A;  5JBW A;  2VSS E;  3KTI A;  4ASI A;  3QKA A;  4F47 A;  1HNO A;  1FC6 A;  1SG4 A;  4RCN A;  1K39 A;  4I52 A;  5KJP A;  2VX2 A;  3HE2 A;  3BPP A;  4EMP A;  4ZDB A;  1DCI A;  2CBY A;  3BF0 A;  5CTC A;  4U19 A;  2F9Y A;  3QXZ A;  1EF8 A;  2ZQR A;  1TYF A;  3MT6 A;  2J5S A;  3M6M A;  5G1Q A;  4U0G H;  3QYR A;  4FZW C;  1XNV A;  3MYB A;  4RYF A;  4EML A;  4JWV A;  4JCQ A;  2C8T A;  4FND A;  2ZL3 A;  1XO6 A;  2UZF A;  4L6W A;  3OME A;  3H81 A;  2J5I A;  1YG8 A;  4Q0G A;  5CTB A;  1NZY A;  4FB8 A;  3TZ3 A;  4KD6 A;  1FC9 A;  3IAV A;  4NEK A;  4WCZ A;  1WDM A;  3WG5 A;  2D3T A;  4LK5 A;  4U0H A;  1EY3 A;  4B3J A;  3H0S A;  2PBP A;  1VRG A;  2J5I B;  4I4Z A;  2ZL2 A;  1NZY B;  4JSB A;  4OG1 A;  4ZU2 A;  4G2R A;  4Q1I A;  2VSU E;  3STA A;  3U9R B;  1HNU A;  3V5I A;  4IZC A;  4JOT A;  4QIJ A;  2X24 A;  4OLQ A;  4ELS A;  4B3I A;  5DUF A;  3TT6 A;  3PE8 A;  4JCS A;  1WDL A;  1Q52 A;  2Q35 A;  1PIX A;  3SLL A;  5MGB A;  3P5M A;  1Q51 A;  1N6F A;  3PEA A;  5DKP A;  2F6I A;  2IEX A;  1ON9 A;  3ZWA A;  1N6D A;  2VSU A;  2A7S A;  3ZW8 A;  3T89 A;  3P85 A;  5FUS A;  3DJA A;  4FN8 A;  3M6N A;  1RJN A;  4EMM A;  2J5G A;  3GF3 A;  3TDC A;  3RST A;  1W2X A;  4QFE A;  3HLN 1;  3VIV A;  5E0S H;  2CE3 A;  1XNY A;  5DU6 A;  3N6R B;  1SZO A;  2GTR A;  2VSU C;  2PG8 A;  3TLF A;  2WTB A;  1UIY A;  4NNQ A;  4JCT A;  2F9Y B;  5DU4 A;  2VSS A;  4JJT A;  1FCF A;  3BEZ A;  2EJ5 A;  3DOR A;  3TVW A;  1N6E A;  5DUC A;  5INF A;  4ZDD A;  3OT6 A;  3Q0G A;  2F9I A;  4MI2 A;  1MJ3 A;  3T3W A;  4ZDE A;  3ZWB A;  3R9S A;  4U1A A;  5KDR A;  3ZW9 A;  1K32 A;  3NJB A;  4FNB A;  1EF9 A;  2PPY A;  2Q34 A;  2F9I B;  5DZK A;  4ELX A;  4FN7 A;  3Q0J A;  5KDR B;  4ZDF A;  3KTH A;  4K2N A;  4JCR A;  4GM2 A;  1XNW A;  3RSI A;  3GF7 A;  3QK8 A;  2X58 A;  3T8A A;  4RYF H;  1ON3 A;  1YG6 A;  4HC8 A;  5G1S A;  2ZL4 A; 
#chains in the Genus database with same CATH topology
 2VRE A;  1UX4 A;  3IBB A;  2ZL0 A;  2A81 A;  3JU1 A;  3IB9 A;  2ZQQ A;  3R9Q A;  3KTG A;  2F6Q A;  1XX4 A;  1WZ8 A;  3R9T A;  3KTK A;  1UYT A;  3R6H A;  4WYO B;  4MOU A;  3NJD A;  3Q1T A;  3H02 A;  3P2L A;  1JXZ A;  3H0J A;  2HW5 A;  3QXI A;  3W8H B;  2YJG A;  4IZD A;  4KNP A;  3GLM A;  1O8U A;  4U0G A;  4K29 A;  3L3S A;  5G1R A;  5IKL B;  3U9T B;  3LKE A;  4YLH A;  3HIN A;  3TRR A;  2VSS F;  3ISA A;  1Y64 B;  3TVU A;  4DI1 A;  3HP0 A;  3RQG A;  3W8I B;  5INI A;  4JFC A;  5DU8 A;  3A4N A;  3BPT A;  3KQF A;  4B3H A;  3T8B A;  3FDU A;  3K8X A;  3PGQ A;  3QMJ A;  1X0U A;  2DUB A;  4K3W A;  4ZDC A;  4J2U A;  1PJH A;  3ST9 A;  4KWB A;  1UYV A;  3QRE A;  3T88 A;  4WZ8 B;  1RJM A;  3R0O A;  4I42 A;  5DL1 A;  3LAO A;  4KPK A;  4L8K A;  1OD4 A;  4IZB A;  2J5I I;  3U9S B;  3FF6 A;  2J5G D;  4JVT A;  3H0U A;  3HRX A;  2DEO A;  3H0Q A;  4JYJ A;  3OC7 A;  3I47 A;  4QII A;  2FBM A;  1UYS A;  3GKB A;  3SWX A;  3G64 A;  3MOY A;  4OMR A;  2BZR A;  5E0N X;  2NP9 A;  3PZK A;  3GMA A;  5JBX A;  1OD2 A;  1FC7 A;  1HZD A;  1Y7O A;  2VSU F;  3TT7 A;  3ZWC A;  1J7X A;  2FZS A;  4MXI A;  5C9G A;  3RRV A;  3K50 A;  2QQ3 A;  1UYR A;  3A4M A;  3MFM A;  5E0S A;  2FW2 A;  4JYL A;  3TV5 A;  3L8I A;  4HNK A;  4FJW D;  2W3P A;  2Q2X A;  5ING A;  5DZK H;  1DUB A;  3A4L A;  5DTP A;  3RQF A;  4U18 A;  3L8J A;  4Z0M A;  5FIF A;  3QWD A;  3Q7H A;  1WDK A;  2A7K A;  3V5E A;  3KTJ A;  4ELW A;  4GHN A;  4FZW A;  5C90 A;  5DTW A;  1TG6 A;  5JBW A;  2VSS E;  3AM1 A;  3KTI A;  4ASI A;  3QKA A;  4F47 A;  1HNO A;  1FC6 A;  1SG4 A;  4RCN A;  1K39 A;  4I52 A;  5KJP A;  2VX2 A;  3HE2 A;  3BPP A;  4EMP A;  4ZDB A;  1DCI A;  2CBY A;  3BF0 A;  5CTC A;  4U19 A;  2F9Y A;  3QXZ A;  1EF8 A;  2ZQR A;  1TYF A;  3MT6 A;  2J5S A;  3M6M A;  5G1Q A;  4U0G H;  3QYR A;  4FZW C;  1XNV A;  3AJM A;  3MYB A;  4RYF A;  4EML A;  4JWV A;  4JCQ A;  2C8T A;  4FND A;  3RQE A;  2ZL3 A;  1XO6 A;  3ADB A;  4NAR A;  2UZF A;  4L6W A;  3OME A;  3H81 A;  2J5I A;  1YG8 A;  4Q0G A;  5CTB A;  1NZY A;  4FB8 A;  3TZ3 A;  4KD6 A;  1FC9 A;  3IAV A;  4NEK A;  4WCZ A;  1WDM A;  3WG5 A;  2D3T A;  4LK5 A;  4U0H A;  1EY3 A;  4B3J A;  3H0S A;  2PBP A;  1VRG A;  2J5I B;  4I4Z A;  2ZL2 A;  1NZY B;  4JSB A;  4OG1 A;  4ZU2 A;  4G2R A;  4Q1I A;  2VSU E;  3STA A;  3U9R B;  1HNU A;  4HDT A;  3V5I A;  4IZC A;  4JOT A;  4QIJ A;  2X24 A;  3ADC A;  4OLQ A;  4ELS A;  4B3I A;  5DUF A;  3TT6 A;  3PE8 A;  4JCS A;  1WDL A;  1Q52 A;  2Q35 A;  1PIX A;  3SLL A;  5MGB A;  3P5M A;  1Q51 A;  1N6F A;  3PEA A;  5DKP A;  2F6I A;  2IEX A;  1ON9 A;  3ZWA A;  1N6D A;  5HUQ A;  2VSU A;  2A7S A;  3ZW8 A;  3T89 A;  3P85 A;  5FUS A;  3DJA A;  4FN8 A;  3M6N A;  2P63 A;  1RJN A;  4EMM A;  2J5G A;  3GF3 A;  3TDC A;  3RST A;  1W2X A;  3ADD A;  4GEH B;  4QFE A;  3HLN 1;  3VIV A;  3IRB A;  5E0S H;  2CE3 A;  1XNY A;  5DU6 A;  3N6R B;  1SZO A;  2GTR A;  2VSU C;  2PG8 A;  3TLF A;  2WTB A;  1UIY A;  4NNQ A;  4JCT A;  2F9Y B;  5DU4 A;  2VSS A;  4JJT A;  1FCF A;  3BEZ A;  2EJ5 A;  3DOR A;  3TVW A;  1N6E A;  5DUC A;  5INF A;  4ZDD A;  1UX5 A;  3O4X E;  3OT6 A;  3Q0G A;  2F9I A;  4MI2 A;  1MJ3 A;  3T3W A;  4ZDE A;  3ZWB A;  3R9S A;  4U1A A;  5KDR A;  3ZW9 A;  1K32 A;  3NJB A;  4FNB A;  1EF9 A;  2PPY A;  2Q34 A;  2F9I B;  5DZK A;  4ELX A;  4FN7 A;  3Q0J A;  5KDR B;  4ZDF A;  3KTH A;  4K2N A;  4JCR A;  4GM2 A;  1XNW A;  3RSI A;  3GF7 A;  3QK8 A;  2X58 A;  3T8A A;  4RYF H;  1ON3 A;  1YG6 A;  4HC8 A;  5G1S A;  2ZL4 A; 
#chains in the Genus database with same CATH homology
 2VRE A;  3IBB A;  2ZL0 A;  2A81 A;  3JU1 A;  3IB9 A;  2ZQQ A;  3R9Q A;  3KTG A;  2F6Q A;  1XX4 A;  1WZ8 A;  3R9T A;  3KTK A;  1UYT A;  3R6H A;  4WYO B;  4MOU A;  3NJD A;  3Q1T A;  3H02 A;  3P2L A;  1JXZ A;  3H0J A;  2HW5 A;  3QXI A;  2YJG A;  4IZD A;  4KNP A;  3GLM A;  1O8U A;  4U0G A;  4K29 A;  3L3S A;  5G1R A;  5IKL B;  3U9T B;  3LKE A;  4YLH A;  3HIN A;  3TRR A;  2VSS F;  3ISA A;  4DI1 A;  3TVU A;  3HP0 A;  5INI A;  4JFC A;  5DU8 A;  3BPT A;  3KQF A;  4B3H A;  3T8B A;  3FDU A;  3K8X A;  3PGQ A;  3QMJ A;  1X0U A;  2DUB A;  4K3W A;  4ZDC A;  4J2U A;  1PJH A;  3ST9 A;  4KWB A;  1UYV A;  3QRE A;  3T88 A;  4WZ8 B;  1RJM A;  3R0O A;  4I42 A;  5DL1 A;  3LAO A;  4KPK A;  4L8K A;  1OD4 A;  4IZB A;  2J5I I;  3U9S B;  3FF6 A;  2J5G D;  4JVT A;  3H0U A;  3HRX A;  2DEO A;  3H0Q A;  4JYJ A;  3OC7 A;  3I47 A;  4QII A;  2FBM A;  1UYS A;  3GKB A;  3SWX A;  3G64 A;  3MOY A;  4OMR A;  2BZR A;  5E0N X;  2NP9 A;  3PZK A;  3GMA A;  5JBX A;  1OD2 A;  1FC7 A;  1HZD A;  1Y7O A;  2VSU F;  3TT7 A;  3ZWC A;  1J7X A;  2FZS A;  4MXI A;  5C9G A;  3RRV A;  3K50 A;  2QQ3 A;  1UYR A;  3MFM A;  5E0S A;  2FW2 A;  4JYL A;  3TV5 A;  4HNK A;  4FJW D;  2W3P A;  2Q2X A;  5ING A;  5DZK H;  1DUB A;  5DTP A;  4U18 A;  4Z0M A;  5FIF A;  3QWD A;  3Q7H A;  1WDK A;  2A7K A;  3V5E A;  3KTJ A;  4ELW A;  4GHN A;  4FZW A;  5C90 A;  5DTW A;  1TG6 A;  5JBW A;  2VSS E;  3KTI A;  4ASI A;  3QKA A;  4F47 A;  1HNO A;  1FC6 A;  1SG4 A;  4RCN A;  1K39 A;  4I52 A;  5KJP A;  2VX2 A;  3HE2 A;  3BPP A;  4EMP A;  4ZDB A;  1DCI A;  2CBY A;  3BF0 A;  5CTC A;  4U19 A;  2F9Y A;  3QXZ A;  1EF8 A;  2ZQR A;  1TYF A;  3MT6 A;  2J5S A;  3M6M A;  5G1Q A;  4U0G H;  3QYR A;  4FZW C;  1XNV A;  3MYB A;  4RYF A;  4EML A;  4JWV A;  4JCQ A;  2C8T A;  4FND A;  2ZL3 A;  1XO6 A;  4NAR A;  2UZF A;  4L6W A;  3OME A;  3H81 A;  2J5I A;  1YG8 A;  4Q0G A;  5CTB A;  1NZY A;  4FB8 A;  3TZ3 A;  4KD6 A;  1FC9 A;  3IAV A;  4NEK A;  4WCZ A;  1WDM A;  3WG5 A;  2D3T A;  4LK5 A;  4U0H A;  1EY3 A;  4B3J A;  3H0S A;  2PBP A;  1VRG A;  2J5I B;  4I4Z A;  2ZL2 A;  1NZY B;  4JSB A;  4OG1 A;  4ZU2 A;  4G2R A;  4Q1I A;  2VSU E;  3STA A;  3U9R B;  1HNU A;  4HDT A;  3V5I A;  4IZC A;  4JOT A;  4QIJ A;  2X24 A;  4OLQ A;  4ELS A;  4B3I A;  5DUF A;  3TT6 A;  3PE8 A;  4JCS A;  1WDL A;  1Q52 A;  2Q35 A;  1PIX A;  3SLL A;  5MGB A;  3P5M A;  1Q51 A;  1N6F A;  3PEA A;  5DKP A;  2F6I A;  2IEX A;  1ON9 A;  3ZWA A;  1N6D A;  5HUQ A;  2VSU A;  2A7S A;  3ZW8 A;  3T89 A;  3P85 A;  5FUS A;  3DJA A;  4FN8 A;  3M6N A;  1RJN A;  4EMM A;  2J5G A;  3GF3 A;  3TDC A;  3RST A;  1W2X A;  4QFE A;  3HLN 1;  3VIV A;  5E0S H;  2CE3 A;  1XNY A;  5DU6 A;  3N6R B;  1SZO A;  2GTR A;  2VSU C;  2PG8 A;  3TLF A;  2WTB A;  1UIY A;  4NNQ A;  4JCT A;  2F9Y B;  5DU4 A;  2VSS A;  4JJT A;  1FCF A;  3BEZ A;  2EJ5 A;  3DOR A;  3TVW A;  1N6E A;  5DUC A;  5INF A;  4ZDD A;  3OT6 A;  3Q0G A;  2F9I A;  4MI2 A;  1MJ3 A;  3T3W A;  4ZDE A;  3ZWB A;  3R9S A;  4U1A A;  5KDR A;  3ZW9 A;  1K32 A;  3NJB A;  4FNB A;  1EF9 A;  2PPY A;  2Q34 A;  2F9I B;  5DZK A;  4ELX A;  4FN7 A;  3Q0J A;  5KDR B;  4ZDF A;  3KTH A;  4K2N A;  4JCR A;  4GM2 A;  1XNW A;  3RSI A;  3GF7 A;  3QK8 A;  2X58 A;  3T8A A;  4RYF H;  1ON3 A;  1YG6 A;  4HC8 A;  5G1S A;  2ZL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...