2DUBA

Enoyl-coa hydratase complexed with octanoyl-coa
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
259
structure length
254
Chain Sequence
NFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQDCYSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFKDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of enoyl-CoA hydratase complexed with octanoyl-CoA reveals the structural adaptations required for binding of a long chain fatty acid-CoA molecule.
pubmed doi rcsb
molecule tags Lyase
molecule keywords 2-ENOYL-COA HYDRATASE
total genus 89
structure length 254
sequence length 259
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 1997-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 2dubA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2dubA01
3RSIA 4JOTA 3SWXA 4B3IA 4FZWC 4GM2A 3T8AA 4Q0GA 5FUSA 2J5SA 1UYRA 3QREA 2VSSF 1EY3A 1FC9A 3R0OA 2DUBA 5DZKH 3TZ3A 3NJDA 4JWVA 3ZW8A 1WDLA 3OMEA 4IZBA 4MOUA 3Q7HA 3K8XA 5E0NX 3QXIA 2VX2A 4ELWA 1ON3A 3R9SA 3RRVA 5CTBA 5KDRA 2ZQRA 3HE2A 3QK8A 1SZOA 3VIVA 4EMMA 1PIXA 3HP0A 4LK5A 4QIIA 2Q34A 3KTKA 1XO6A 3QXZA 4HC8A 1N6FA 4U19A 2J5GA 2BZRA 4K3WA 4OMRA 3ZWBA 1SG4A 5DUCA 5KDRB 3T8BA 4GHNA 5MGBA 2Q2XA 3P85A 3OC7A 4NNQA 4JJTA 1DCIA 1HZDA 3QWDA 3PGQA 2F9YB 2ZL3A 3BF0A 1ON9A 3U9TB 2J5II 4IZDA 2DEOA 2VSUE 3KTHA 5DU8A 4ASIA 4U0HA 3I47A 1HNOA 1TG6A 1XNWA 1JXZA 3IB9A 3T89A 1K32A 4ZDCA 3Q0JA 3R9QA 1RJMA 2PPYA 3R9TA 2F9IB 5DL1A 2Q35A 5E0SA 3GKBA 1J7XA 3KTJA 1RJNA 4QFEA 2VSUC 2FZSA 3GLMA 2HW5A 5IKLB 4RYFA 2PBPA 2A81A 3FDUA 3PEAA 1W2XA 3LAOA 2D3TA 1Q52A 1OD4A 1VRGA 3M6MA 4ZDBA 3PZKA 3V5EA 4I42A 4JCQA 4I4ZA 4JCSA 3MYBA 1XNYA 4ZDDA 4MXIA 1NZYB 3N6RB 1FC6A 2UZFA 4IZCA 1HNUA 2ZL2A 3QYRA 4I52A 2VREA 4HNKA 3ST9A 4YLHA 3P5MA 3L3SA 2FBMA 5G1RA 3WG5A 1WZ8A 4JYLA 1YG6A 5G1QA 3U9SB 1EF9A 5FIFA 4G2RA 3SLLA 5C90A 5C9GA 2GTRA 1WDMA 3TVUA 3GF7A 2VSSE 4U18A 1N6DA 1K39A 3U9RB 3PE8A 1XX4A 3TT7A 2J5IA 4NEKA 3G64A 4MI2A 3TRRA 5INGA 2ZQQA 5DU4A 2CE3A 4KWBA 3LKEA 4Q1IA 3TLFA 3KQFA 2EJ5A 3Q0GA 4JFCA 5G1SA 3TVWA 3ZWCA 3NJBA 4QIJA 4JSBA 1WDKA 2J5IB 3Q1TA 4ELSA 3QMJA 3QKAA 3IBBA 2PG8A 5INFA 5KJPA 2W3PA 4L8KA 3KTIA 3TT6A 4EMLA 3MFMA 3TV5A 5DZKA 4OLQA 4KD6A 5DTWA 1N6EA 4JCTA 5DTPA 3GMAA 4JYJA 3MOYA 4U0GH 4EMPA 4ZDFA 1OD2A 1Q51A 2NP9A 4FN7A 2FW2A 5DUFA 4B3JA 4ZU2A 3STAA 2J5GD 3H0QA 3T88A 3KTGA 1NZYA 1X0UA 5JBWA 3IAVA 3R6HA 4KNPA 5E0SH 1FCFA 2A7SA 4K2NA 2ZL4A 5JBXA 2ZL0A 3V5IA 4ELXA 3HLN1 5INIA 3H0UA 3DJAA 1UYVA 2CBYA 3MT6A 5DKPA 3BEZA 1UYSA 2A7KA 4JCRA 4FJWD 4FN8A 4WCZA 4KPKA 3H0SA 4FB8A 1TYFA 4FNBA 2F9IA 2F6QA 1YG8A 4WYOB 4WZ8B 4RCNA 3M6NA 4RYFH 3T3WA 4JVTA 4FNDA 4U0GA 3H02A 2QQ3A 4K29A 4OG1A 4F47A 2VSSA 4U1AA 3ISAA 1UIYA 2VSUA 2C8TA 5CTCA 3DORA 4DI1A 3TDCA 3JU1A 2F9YA 4B3HA 3H81A 2WTBA 3FF6A 4ZDEA 1XNVA 1UYTA 1PJHA 4FZWA 2VSUF 3H0JA 4Z0MA 3OT6A 2X24A 5DU6A 3K50A 3P2LA 3HRXA 1FC7A 2X58A 1MJ3A 3BPPA 2F6IA 4L6WA 3GF3A 3RSTA 1EF8A 1Y7OA 3ZWAA 1DUBA 1O8UA 2IEXA 3ZW9A 3HINA
chains in the Genus database with same CATH superfamily
3RSIA 4JOTA 3SWXA 4B3IA 4FZWC 4GM2A 3T8AA 4Q0GA 5FUSA 2J5SA 1UYRA 3QREA 2VSSF 1EY3A 3L8IA 1FC9A 3R0OA 2DUBA 5DZKH 3TZ3A 3NJDA 4JWVA 3ZW8A 1WDLA 3OMEA 4IZBA 3RQGA 4MOUA 3Q7HA 3K8XA 5E0NX 3QXIA 2VX2A 4ELWA 1ON3A 3R9SA 3RRVA 5CTBA 5KDRA 2ZQRA 3HE2A 3QK8A 1SZOA 3VIVA 4EMMA 1PIXA 3HP0A 4LK5A 5HUQA 4QIIA 2Q34A 3KTKA 1XO6A 3QXZA 4HC8A 1N6FA 4U19A 2J5GA 2BZRA 4NARA 4K3WA 4OMRA 3ZWBA 1SG4A 5DUCA 5KDRB 3T8BA 4GHNA 5MGBA 3O4XE 3A4MA 2Q2XA 3P85A 3OC7A 4NNQA 3AM1A 1DCIA 1HZDA 4JJTA 3QWDA 3PGQA 2F9YB 2ZL3A 3BF0A 2YJGA 2P63A 1ON9A 3U9TB 2J5II 4IZDA 2DEOA 2VSUE 3KTHA 5DU8A 4ASIA 4U0HA 3I47A 1HNOA 1TG6A 1XNWA 1JXZA 3IB9A 3T89A 1K32A 4ZDCA 3Q0JA 3R9QA 1RJMA 2PPYA 3R9TA 2F9IB 5DL1A 2Q35A 5E0SA 3GKBA 1J7XA 3RQFA 3KTJA 1RJNA 4QFEA 2VSUC 2FZSA 1UX5A 3GLMA 2HW5A 3ADDA 5IKLB 4RYFA 2PBPA 2A81A 3FDUA 3PEAA 1W2XA 3LAOA 2D3TA 1Q52A 1OD4A 1VRGA 3M6MA 4ZDBA 3PZKA 3V5EA 4I42A 4JCQA 4I4ZA 4JCSA 3MYBA 1XNYA 3ADBA 4ZDDA 4MXIA 1NZYB 3N6RB 3A4LA 1FC6A 2UZFA 4IZCA 1HNUA 2ZL2A 3QYRA 4I52A 2VREA 4HNKA 3ST9A 4J2UA 4YLHA 3P5MA 3A4NA 3L3SA 2FBMA 5G1RA 3WG5A 1WZ8A 4JYLA 1YG6A 5G1QA 3U9SB 1EF9A 5FIFA 4G2RA 3SLLA 5C90A 5C9GA 2GTRA 1WDMA 3TVUA 3GF7A 2VSSE 4U18A 1N6DA 1K39A 3U9RB 3PE8A 1XX4A 3TT7A 2J5IA 4NEKA 3G64A 3ADCA 4MI2A 3TRRA 5INGA 2ZQQA 5DU4A 2CE3A 4KWBA 3LKEA 4Q1IA 3TLFA 3KQFA 2EJ5A 3Q0GA 4JFCA 5G1SA 3TVWA 3ZWCA 3NJBA 4QIJA 4JSBA 1WDKA 2J5IB 3L8JA 3Q1TA 4ELSA 3QMJA 3QKAA 3IBBA 2PG8A 5INFA 5KJPA 2W3PA 4L8KA 3KTIA 3TT6A 4EMLA 3MFMA 3TV5A 5DZKA 4OLQA 4KD6A 5DTWA 1N6EA 4JCTA 3W8IB 5DTPA 3GMAA 4JYJA 3MOYA 4U0GH 4EMPA 4ZDFA 1OD2A 1Q51A 2NP9A 4FN7A 2FW2A 5DUFA 4B3JA 4ZU2A 3STAA 2J5GD 3H0QA 1UX4A 3T88A 3KTGA 1NZYA 1X0UA 5JBWA 3IAVA 3R6HA 4KNPA 5E0SH 1FCFA 2A7SA 4K2NA 2ZL4A 5JBXA 2ZL0A 3V5IA 4ELXA 3HLN1 5INIA 3H0UA 3DJAA 1UYVA 2CBYA 3MT6A 5DKPA 3BEZA 1UYSA 2A7KA 4JCRA 4FJWD 3RQEA 4FN8A 4WCZA 4KPKA 3H0SA 4FB8A 1TYFA 4FNBA 2F9IA 2F6QA 1YG8A 4WYOB 4WZ8B 4RCNA 3M6NA 4RYFH 3T3WA 3BPTA 4JVTA 4FNDA 4U0GA 3H02A 2QQ3A 4K29A 4OG1A 4F47A 2VSSA 4U1AA 3ISAA 1UIYA 2VSUA 2C8TA 5CTCA 3AJMA 3DORA 4DI1A 3TDCA 3JU1A 2F9YA 4B3HA 3H81A 2WTBA 3FF6A 4ZDEA 1XNVA 1UYTA 1PJHA 4HDTA 4FZWA 2VSUF 3IRBA 3H0JA 4Z0MA 3OT6A 2X24A 5DU6A 3K50A 3P2LA 4GEHB 3HRXA 1FC7A 2X58A 1MJ3A 3BPPA 2F6IA 4L6WA 3GF3A 3RSTA 3W8HB 1EF8A 1Y7OA 3ZWAA 1DUBA 1O8UA 2IEXA 1Y64B 3ZW9A 3HINA
chains in the Genus database with same CATH topology
3RSIA 4JOTA 3SWXA 4B3IA 4FZWC 4GM2A 3T8AA 4Q0GA 5FUSA 2J5SA 1UYRA 3QREA 2VSSF 1EY3A 1FC9A 3R0OA 2DUBA 5DZKH 3TZ3A 3NJDA 4JWVA 3ZW8A 1WDLA 3OMEA 4IZBA 4MOUA 3Q7HA 3K8XA 5E0NX 3QXIA 2VX2A 4ELWA 1ON3A 3R9SA 3RRVA 5CTBA 5KDRA 2ZQRA 3HE2A 3QK8A 1SZOA 3VIVA 4EMMA 1PIXA 3HP0A 4LK5A 5HUQA 4QIIA 2Q34A 3KTKA 1XO6A 3QXZA 4HC8A 1N6FA 4U19A 2J5GA 2BZRA 4NARA 4K3WA 4OMRA 3ZWBA 1SG4A 5DUCA 5KDRB 3T8BA 4GHNA 5MGBA 2Q2XA 3P85A 3OC7A 4NNQA 4JJTA 1DCIA 1HZDA 3QWDA 3PGQA 2F9YB 2ZL3A 3BF0A 2YJGA 1ON9A 3U9TB 2J5II 4IZDA 2DEOA 2VSUE 3KTHA 5DU8A 4ASIA 4U0HA 3I47A 1HNOA 1TG6A 1XNWA 1JXZA 3IB9A 3T89A 1K32A 4ZDCA 3Q0JA 3R9QA 1RJMA 2PPYA 3R9TA 2F9IB 5DL1A 2Q35A 5E0SA 3GKBA 1J7XA 3KTJA 1RJNA 4QFEA 2VSUC 2FZSA 3GLMA 2HW5A 5IKLB 4RYFA 2PBPA 2A81A 3FDUA 3PEAA 1W2XA 3LAOA 2D3TA 1Q52A 1OD4A 1VRGA 3M6MA 4ZDBA 3PZKA 3V5EA 4I42A 4JCQA 4I4ZA 4JCSA 3MYBA 1XNYA 4ZDDA 4MXIA 1NZYB 3N6RB 1FC6A 2UZFA 4IZCA 1HNUA 2ZL2A 3QYRA 4I52A 2VREA 4HNKA 3ST9A 4J2UA 4YLHA 3P5MA 3L3SA 2FBMA 5G1RA 3WG5A 1WZ8A 4JYLA 1YG6A 5G1QA 3U9SB 1EF9A 5FIFA 4G2RA 3SLLA 5C90A 5C9GA 2GTRA 1WDMA 3TVUA 3GF7A 2VSSE 4U18A 1N6DA 1K39A 3U9RB 3PE8A 1XX4A 3TT7A 2J5IA 4NEKA 3G64A 4MI2A 3TRRA 5INGA 2ZQQA 5DU4A 2CE3A 4KWBA 3LKEA 4Q1IA 3TLFA 3KQFA 2EJ5A 3Q0GA 4JFCA 5G1SA 3TVWA 3ZWCA 3NJBA 4QIJA 4JSBA 1WDKA 2J5IB 3Q1TA 4ELSA 3QMJA 3QKAA 3IBBA 2PG8A 5INFA 5KJPA 2W3PA 4L8KA 3KTIA 3TT6A 4EMLA 3MFMA 3TV5A 5DZKA 4OLQA 4KD6A 5DTWA 1N6EA 4JCTA 5DTPA 3GMAA 4JYJA 3MOYA 4U0GH 4EMPA 4ZDFA 1OD2A 1Q51A 2NP9A 4FN7A 2FW2A 5DUFA 4B3JA 4ZU2A 3STAA 2J5GD 3H0QA 3T88A 3KTGA 1NZYA 1X0UA 5JBWA 3IAVA 3R6HA 4KNPA 5E0SH 1FCFA 2A7SA 4K2NA 2ZL4A 5JBXA 2ZL0A 3V5IA 4ELXA 3HLN1 5INIA 3H0UA 3DJAA 1UYVA 2CBYA 3MT6A 5DKPA 3BEZA 1UYSA 2A7KA 4JCRA 4FJWD 4FN8A 4WCZA 4KPKA 3H0SA 4FB8A 1TYFA 4FNBA 2F9IA 2F6QA 1YG8A 4WYOB 4WZ8B 4RCNA 3M6NA 4RYFH 3T3WA 3BPTA 4JVTA 4FNDA 4U0GA 3H02A 2QQ3A 4K29A 4OG1A 4F47A 2VSSA 4U1AA 3ISAA 1UIYA 2VSUA 2C8TA 5CTCA 3DORA 4DI1A 3TDCA 3JU1A 2F9YA 4B3HA 3H81A 2WTBA 3FF6A 4ZDEA 1XNVA 1UYTA 1PJHA 4HDTA 4FZWA 2VSUF 3H0JA 4Z0MA 3OT6A 2X24A 5DU6A 3K50A 3P2LA 3HRXA 1FC7A 2X58A 1MJ3A 3BPPA 2F6IA 4L6WA 3GF3A 3RSTA 1EF8A 1Y7OA 3ZWAA 1DUBA 1O8UA 2IEXA 3ZW9A 3HINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RSI A;  4JOT A;  3SWX A;  4B3I A;  4FZW C;  4GM2 A;  3T8A A;  4Q0G A;  5FUS A;  2J5S A;  1UYR A;  3QRE A;  2VSS F;  1EY3 A;  1FC9 A;  3R0O A;  2DUB A;  5DZK H;  3TZ3 A;  3NJD A;  4JWV A;  3ZW8 A;  1WDL A;  3OME A;  4IZB A;  4MOU A;  3Q7H A;  3K8X A;  5E0N X;  3QXI A;  2VX2 A;  4ELW A;  1ON3 A;  3R9S A;  3RRV A;  5CTB A;  5KDR A;  2ZQR A;  3HE2 A;  3QK8 A;  1SZO A;  3VIV A;  4EMM A;  1PIX A;  3HP0 A;  4LK5 A;  4QII A;  2Q34 A;  3KTK A;  1XO6 A;  3QXZ A;  4HC8 A;  1N6F A;  4U19 A;  2J5G A;  2BZR A;  4K3W A;  4OMR A;  3ZWB A;  1SG4 A;  5DUC A;  5KDR B;  3T8B A;  4GHN A;  5MGB A;  2Q2X A;  3P85 A;  3OC7 A;  4NNQ A;  4JJT A;  1DCI A;  1HZD A;  3QWD A;  3PGQ A;  2F9Y B;  2ZL3 A;  3BF0 A;  1ON9 A;  3U9T B;  2J5I I;  4IZD A;  2DEO A;  2VSU E;  3KTH A;  5DU8 A;  4ASI A;  4U0H A;  3I47 A;  1HNO A;  1TG6 A;  1XNW A;  1JXZ A;  3IB9 A;  3T89 A;  1K32 A;  4ZDC A;  3Q0J A;  3R9Q A;  1RJM A;  2PPY A;  3R9T A;  2F9I B;  5DL1 A;  2Q35 A;  5E0S A;  3GKB A;  1J7X A;  3KTJ A;  1RJN A;  4QFE A;  2VSU C;  2FZS A;  3GLM A;  2HW5 A;  5IKL B;  4RYF A;  2PBP A;  2A81 A;  3FDU A;  3PEA A;  1W2X A;  3LAO A;  2D3T A;  1Q52 A;  1OD4 A;  1VRG A;  3M6M A;  4ZDB A;  3PZK A;  3V5E A;  4I42 A;  4JCQ A;  4I4Z A;  4JCS A;  3MYB A;  1XNY A;  4ZDD A;  4MXI A;  1NZY B;  3N6R B;  1FC6 A;  2UZF A;  4IZC A;  1HNU A;  2ZL2 A;  3QYR A;  4I52 A;  2VRE A;  4HNK A;  3ST9 A;  4YLH A;  3P5M A;  3L3S A;  2FBM A;  5G1R A;  3WG5 A;  1WZ8 A;  4JYL A;  1YG6 A;  5G1Q A;  3U9S B;  1EF9 A;  5FIF A;  4G2R A;  3SLL A;  5C90 A;  5C9G A;  2GTR A;  1WDM A;  3TVU A;  3GF7 A;  2VSS E;  4U18 A;  1N6D A;  1K39 A;  3U9R B;  3PE8 A;  1XX4 A;  3TT7 A;  2J5I A;  4NEK A;  3G64 A;  4MI2 A;  3TRR A;  5ING A;  2ZQQ A;  5DU4 A;  2CE3 A;  4KWB A;  3LKE A;  4Q1I A;  3TLF A;  3KQF A;  2EJ5 A;  3Q0G A;  4JFC A;  5G1S A;  3TVW A;  3ZWC A;  3NJB A;  4QIJ A;  4JSB A;  1WDK A;  2J5I B;  3Q1T A;  4ELS A;  3QMJ A;  3QKA A;  3IBB A;  2PG8 A;  5INF A;  5KJP A;  2W3P A;  4L8K A;  3KTI A;  3TT6 A;  4EML A;  3MFM A;  3TV5 A;  5DZK A;  4OLQ A;  4KD6 A;  5DTW A;  1N6E A;  4JCT A;  5DTP A;  3GMA A;  4JYJ A;  3MOY A;  4U0G H;  4EMP A;  4ZDF A;  1OD2 A;  1Q51 A;  2NP9 A;  4FN7 A;  2FW2 A;  5DUF A;  4B3J A;  4ZU2 A;  3STA A;  2J5G D;  3H0Q A;  3T88 A;  3KTG A;  1NZY A;  1X0U A;  5JBW A;  3IAV A;  3R6H A;  4KNP A;  5E0S H;  1FCF A;  2A7S A;  4K2N A;  2ZL4 A;  5JBX A;  2ZL0 A;  3V5I A;  4ELX A;  3HLN 1;  5INI A;  3H0U A;  3DJA A;  1UYV A;  2CBY A;  3MT6 A;  5DKP A;  3BEZ A;  1UYS A;  2A7K A;  4JCR A;  4FJW D;  4FN8 A;  4WCZ A;  4KPK A;  3H0S A;  4FB8 A;  1TYF A;  4FNB A;  2F9I A;  2F6Q A;  1YG8 A;  4WYO B;  4WZ8 B;  4RCN A;  3M6N A;  4RYF H;  3T3W A;  4JVT A;  4FND A;  4U0G A;  3H02 A;  2QQ3 A;  4K29 A;  4OG1 A;  4F47 A;  2VSS A;  4U1A A;  3ISA A;  1UIY A;  2VSU A;  2C8T A;  5CTC A;  3DOR A;  4DI1 A;  3TDC A;  3JU1 A;  2F9Y A;  4B3H A;  3H81 A;  2WTB A;  3FF6 A;  4ZDE A;  1XNV A;  1UYT A;  1PJH A;  4FZW A;  2VSU F;  3H0J A;  4Z0M A;  3OT6 A;  2X24 A;  5DU6 A;  3K50 A;  3P2L A;  3HRX A;  1FC7 A;  2X58 A;  1MJ3 A;  3BPP A;  2F6I A;  4L6W A;  3GF3 A;  3RST A;  1EF8 A;  1Y7O A;  3ZWA A;  1DUB A;  1O8U A;  2IEX A;  3ZW9 A;  3HIN A; 
#chains in the Genus database with same CATH topology
 3RSI A;  4JOT A;  3SWX A;  4B3I A;  4FZW C;  4GM2 A;  3T8A A;  4Q0G A;  5FUS A;  2J5S A;  1UYR A;  3QRE A;  2VSS F;  1EY3 A;  3L8I A;  1FC9 A;  3R0O A;  2DUB A;  5DZK H;  3TZ3 A;  3NJD A;  4JWV A;  3ZW8 A;  1WDL A;  3OME A;  4IZB A;  3RQG A;  4MOU A;  3Q7H A;  3K8X A;  5E0N X;  3QXI A;  2VX2 A;  4ELW A;  1ON3 A;  3R9S A;  3RRV A;  5CTB A;  5KDR A;  2ZQR A;  3HE2 A;  3QK8 A;  1SZO A;  3VIV A;  4EMM A;  1PIX A;  3HP0 A;  4LK5 A;  5HUQ A;  4QII A;  2Q34 A;  3KTK A;  1XO6 A;  3QXZ A;  4HC8 A;  1N6F A;  4U19 A;  2J5G A;  2BZR A;  4NAR A;  4K3W A;  4OMR A;  3ZWB A;  1SG4 A;  5DUC A;  5KDR B;  3T8B A;  4GHN A;  5MGB A;  3O4X E;  3A4M A;  2Q2X A;  3P85 A;  3OC7 A;  4NNQ A;  3AM1 A;  1DCI A;  1HZD A;  4JJT A;  3QWD A;  3PGQ A;  2F9Y B;  2ZL3 A;  3BF0 A;  2YJG A;  2P63 A;  1ON9 A;  3U9T B;  2J5I I;  4IZD A;  2DEO A;  2VSU E;  3KTH A;  5DU8 A;  4ASI A;  4U0H A;  3I47 A;  1HNO A;  1TG6 A;  1XNW A;  1JXZ A;  3IB9 A;  3T89 A;  1K32 A;  4ZDC A;  3Q0J A;  3R9Q A;  1RJM A;  2PPY A;  3R9T A;  2F9I B;  5DL1 A;  2Q35 A;  5E0S A;  3GKB A;  1J7X A;  3RQF A;  3KTJ A;  1RJN A;  4QFE A;  2VSU C;  2FZS A;  1UX5 A;  3GLM A;  2HW5 A;  3ADD A;  5IKL B;  4RYF A;  2PBP A;  2A81 A;  3FDU A;  3PEA A;  1W2X A;  3LAO A;  2D3T A;  1Q52 A;  1OD4 A;  1VRG A;  3M6M A;  4ZDB A;  3PZK A;  3V5E A;  4I42 A;  4JCQ A;  4I4Z A;  4JCS A;  3MYB A;  1XNY A;  3ADB A;  4ZDD A;  4MXI A;  1NZY B;  3N6R B;  3A4L A;  1FC6 A;  2UZF A;  4IZC A;  1HNU A;  2ZL2 A;  3QYR A;  4I52 A;  2VRE A;  4HNK A;  3ST9 A;  4J2U A;  4YLH A;  3P5M A;  3A4N A;  3L3S A;  2FBM A;  5G1R A;  3WG5 A;  1WZ8 A;  4JYL A;  1YG6 A;  5G1Q A;  3U9S B;  1EF9 A;  5FIF A;  4G2R A;  3SLL A;  5C90 A;  5C9G A;  2GTR A;  1WDM A;  3TVU A;  3GF7 A;  2VSS E;  4U18 A;  1N6D A;  1K39 A;  3U9R B;  3PE8 A;  1XX4 A;  3TT7 A;  2J5I A;  4NEK A;  3G64 A;  3ADC A;  4MI2 A;  3TRR A;  5ING A;  2ZQQ A;  5DU4 A;  2CE3 A;  4KWB A;  3LKE A;  4Q1I A;  3TLF A;  3KQF A;  2EJ5 A;  3Q0G A;  4JFC A;  5G1S A;  3TVW A;  3ZWC A;  3NJB A;  4QIJ A;  4JSB A;  1WDK A;  2J5I B;  3L8J A;  3Q1T A;  4ELS A;  3QMJ A;  3QKA A;  3IBB A;  2PG8 A;  5INF A;  5KJP A;  2W3P A;  4L8K A;  3KTI A;  3TT6 A;  4EML A;  3MFM A;  3TV5 A;  5DZK A;  4OLQ A;  4KD6 A;  5DTW A;  1N6E A;  4JCT A;  3W8I B;  5DTP A;  3GMA A;  4JYJ A;  3MOY A;  4U0G H;  4EMP A;  4ZDF A;  1OD2 A;  1Q51 A;  2NP9 A;  4FN7 A;  2FW2 A;  5DUF A;  4B3J A;  4ZU2 A;  3STA A;  2J5G D;  3H0Q A;  1UX4 A;  3T88 A;  3KTG A;  1NZY A;  1X0U A;  5JBW A;  3IAV A;  3R6H A;  4KNP A;  5E0S H;  1FCF A;  2A7S A;  4K2N A;  2ZL4 A;  5JBX A;  2ZL0 A;  3V5I A;  4ELX A;  3HLN 1;  5INI A;  3H0U A;  3DJA A;  1UYV A;  2CBY A;  3MT6 A;  5DKP A;  3BEZ A;  1UYS A;  2A7K A;  4JCR A;  4FJW D;  3RQE A;  4FN8 A;  4WCZ A;  4KPK A;  3H0S A;  4FB8 A;  1TYF A;  4FNB A;  2F9I A;  2F6Q A;  1YG8 A;  4WYO B;  4WZ8 B;  4RCN A;  3M6N A;  4RYF H;  3T3W A;  3BPT A;  4JVT A;  4FND A;  4U0G A;  3H02 A;  2QQ3 A;  4K29 A;  4OG1 A;  4F47 A;  2VSS A;  4U1A A;  3ISA A;  1UIY A;  2VSU A;  2C8T A;  5CTC A;  3AJM A;  3DOR A;  4DI1 A;  3TDC A;  3JU1 A;  2F9Y A;  4B3H A;  3H81 A;  2WTB A;  3FF6 A;  4ZDE A;  1XNV A;  1UYT A;  1PJH A;  4HDT A;  4FZW A;  2VSU F;  3IRB A;  3H0J A;  4Z0M A;  3OT6 A;  2X24 A;  5DU6 A;  3K50 A;  3P2L A;  4GEH B;  3HRX A;  1FC7 A;  2X58 A;  1MJ3 A;  3BPP A;  2F6I A;  4L6W A;  3GF3 A;  3RST A;  3W8H B;  1EF8 A;  1Y7O A;  3ZWA A;  1DUB A;  1O8U A;  2IEX A;  1Y64 B;  3ZW9 A;  3HIN A; 
#chains in the Genus database with same CATH homology
 3RSI A;  4JOT A;  3SWX A;  4B3I A;  4FZW C;  4GM2 A;  3T8A A;  4Q0G A;  5FUS A;  2J5S A;  1UYR A;  3QRE A;  2VSS F;  1EY3 A;  1FC9 A;  3R0O A;  2DUB A;  5DZK H;  3TZ3 A;  3NJD A;  4JWV A;  3ZW8 A;  1WDL A;  3OME A;  4IZB A;  4MOU A;  3Q7H A;  3K8X A;  5E0N X;  3QXI A;  2VX2 A;  4ELW A;  1ON3 A;  3R9S A;  3RRV A;  5CTB A;  5KDR A;  2ZQR A;  3HE2 A;  3QK8 A;  1SZO A;  3VIV A;  4EMM A;  1PIX A;  3HP0 A;  4LK5 A;  5HUQ A;  4QII A;  2Q34 A;  3KTK A;  1XO6 A;  3QXZ A;  4HC8 A;  1N6F A;  4U19 A;  2J5G A;  2BZR A;  4NAR A;  4K3W A;  4OMR A;  3ZWB A;  1SG4 A;  5DUC A;  5KDR B;  3T8B A;  4GHN A;  5MGB A;  2Q2X A;  3P85 A;  3OC7 A;  4NNQ A;  4JJT A;  1DCI A;  1HZD A;  3QWD A;  3PGQ A;  2F9Y B;  2ZL3 A;  3BF0 A;  2YJG A;  1ON9 A;  3U9T B;  2J5I I;  4IZD A;  2DEO A;  2VSU E;  3KTH A;  5DU8 A;  4ASI A;  4U0H A;  3I47 A;  1HNO A;  1TG6 A;  1XNW A;  1JXZ A;  3IB9 A;  3T89 A;  1K32 A;  4ZDC A;  3Q0J A;  3R9Q A;  1RJM A;  2PPY A;  3R9T A;  2F9I B;  5DL1 A;  2Q35 A;  5E0S A;  3GKB A;  1J7X A;  3KTJ A;  1RJN A;  4QFE A;  2VSU C;  2FZS A;  3GLM A;  2HW5 A;  5IKL B;  4RYF A;  2PBP A;  2A81 A;  3FDU A;  3PEA A;  1W2X A;  3LAO A;  2D3T A;  1Q52 A;  1OD4 A;  1VRG A;  3M6M A;  4ZDB A;  3PZK A;  3V5E A;  4I42 A;  4JCQ A;  4I4Z A;  4JCS A;  3MYB A;  1XNY A;  4ZDD A;  4MXI A;  1NZY B;  3N6R B;  1FC6 A;  2UZF A;  4IZC A;  1HNU A;  2ZL2 A;  3QYR A;  4I52 A;  2VRE A;  4HNK A;  3ST9 A;  4J2U A;  4YLH A;  3P5M A;  3L3S A;  2FBM A;  5G1R A;  3WG5 A;  1WZ8 A;  4JYL A;  1YG6 A;  5G1Q A;  3U9S B;  1EF9 A;  5FIF A;  4G2R A;  3SLL A;  5C90 A;  5C9G A;  2GTR A;  1WDM A;  3TVU A;  3GF7 A;  2VSS E;  4U18 A;  1N6D A;  1K39 A;  3U9R B;  3PE8 A;  1XX4 A;  3TT7 A;  2J5I A;  4NEK A;  3G64 A;  4MI2 A;  3TRR A;  5ING A;  2ZQQ A;  5DU4 A;  2CE3 A;  4KWB A;  3LKE A;  4Q1I A;  3TLF A;  3KQF A;  2EJ5 A;  3Q0G A;  4JFC A;  5G1S A;  3TVW A;  3ZWC A;  3NJB A;  4QIJ A;  4JSB A;  1WDK A;  2J5I B;  3Q1T A;  4ELS A;  3QMJ A;  3QKA A;  3IBB A;  2PG8 A;  5INF A;  5KJP A;  2W3P A;  4L8K A;  3KTI A;  3TT6 A;  4EML A;  3MFM A;  3TV5 A;  5DZK A;  4OLQ A;  4KD6 A;  5DTW A;  1N6E A;  4JCT A;  5DTP A;  3GMA A;  4JYJ A;  3MOY A;  4U0G H;  4EMP A;  4ZDF A;  1OD2 A;  1Q51 A;  2NP9 A;  4FN7 A;  2FW2 A;  5DUF A;  4B3J A;  4ZU2 A;  3STA A;  2J5G D;  3H0Q A;  3T88 A;  3KTG A;  1NZY A;  1X0U A;  5JBW A;  3IAV A;  3R6H A;  4KNP A;  5E0S H;  1FCF A;  2A7S A;  4K2N A;  2ZL4 A;  5JBX A;  2ZL0 A;  3V5I A;  4ELX A;  3HLN 1;  5INI A;  3H0U A;  3DJA A;  1UYV A;  2CBY A;  3MT6 A;  5DKP A;  3BEZ A;  1UYS A;  2A7K A;  4JCR A;  4FJW D;  4FN8 A;  4WCZ A;  4KPK A;  3H0S A;  4FB8 A;  1TYF A;  4FNB A;  2F9I A;  2F6Q A;  1YG8 A;  4WYO B;  4WZ8 B;  4RCN A;  3M6N A;  4RYF H;  3T3W A;  3BPT A;  4JVT A;  4FND A;  4U0G A;  3H02 A;  2QQ3 A;  4K29 A;  4OG1 A;  4F47 A;  2VSS A;  4U1A A;  3ISA A;  1UIY A;  2VSU A;  2C8T A;  5CTC A;  3DOR A;  4DI1 A;  3TDC A;  3JU1 A;  2F9Y A;  4B3H A;  3H81 A;  2WTB A;  3FF6 A;  4ZDE A;  1XNV A;  1UYT A;  1PJH A;  4HDT A;  4FZW A;  2VSU F;  3H0J A;  4Z0M A;  3OT6 A;  2X24 A;  5DU6 A;  3K50 A;  3P2L A;  3HRX A;  1FC7 A;  2X58 A;  1MJ3 A;  3BPP A;  2F6I A;  4L6W A;  3GF3 A;  3RST A;  1EF8 A;  1Y7O A;  3ZWA A;  1DUB A;  1O8U A;  2IEX A;  3ZW9 A;  3HIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...