2DUCA

Crystal structure of sars coronavirus main proteinase(3clpro)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
306
structure length
306
Chain Sequence
b'SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab
molecule tags Hydrolase
source organism Sars coronavirus
publication title SARS-CoV 3CL protease cleaves its C-terminal autoprocessing site by novel subsite cooperativity
pubmed doi rcsb
total genus 83
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2006-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2ducA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ducA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ducA02
3QWCH 1FUJA 3UPEA 1C4Y2 1CO7E 4YO9A 1E38B 1ZMNA 1TMTH 2GZ9A 1AGJA 3O8CA 2VIQA 4B73A 1O0DH 1TPPA 4A1XA 3ATIA 1NRQH 1O3JA 2QV1A 2FWWA 2NU2E 1O39A 1ZSKA 1O37A 4B2CA 3K6ZA 2HLCA 3BTDE 4ABJA 1LPGB 1UVSH 1QL8A 3P17H 5DKMA 1DT2A 4WMFA 1ELBA 1GVLA 3RXGA 3ELAH 2PSYA 2OD3B 3ESTA 3OY6U 1P8VC 4O03A 1CQQA 1TA6A 5EODA 3SW2B 3E6PH 3T2NA 2PSXA 3FZZA 5FCRA 2NU3E 1GL0E 1DITH 2ZDKA 3S7KB 1TBZH 1C5RA 3T26A 1TGCA 4U2WA 3SV7A 3ATMA 4IMQA 3TLOA 1TGBA 1GDQA 2GT8A 1O2XA 4B76A 1NTPA 3OTJE 1NN6A 1SSXA 5L2ZH 3RXRA 5EPNA 1IQFA 1LVOA 4CRCA 4HI3A 1AKSB 1QCPA 3S0NA 1QJ6B 1P2NA 3UR9A 1TMUH 1LPZB 2ZA5A 3STIA 1C1VH 1W14U 1MAYA 1LKBA 2OCVB 7LPRA 1HPGA 5C20A 2GMTC 2QN5T 1UTMA 3PMAB 2ZFRH 2ZTZA 4X6OA 1VCPA 5E0GA 3ATKA 3E0PB 2GMTB 1IHTH 5EOKA 2BVSH 2HVXA 3F1SB 4NGAH 1XUIA 2ANWA 3I78A 1GBMA 2AGEX 3FAOA 1FI8A 2VGCB 2RA3A 5PTPA 1P01A 2SNWA 2HNTF 5SGAE 2BY5X 1F0UA 1P06A 4UD9H 2ZFPH 2TGTA 4Y79A 4BNRA 5A2MH 1C4U2 5FX6A 2NWNA 2BQWB 4JYTA 1HUTH 2BDBA 3SU6A 4TPIZ 3BSQA 1EP5A 2ZTXA 1WCZA 2BOKA 2G4UA 4DY7B 3EA9A 2CHAB 4CHAB 5A8XA 2EA3A 4LZ1H 1SLUB 3MO3A 1LHCH 2Q6FA 1Q3XA 1K22H 1IOEA 2ZO3H 1CVWH 1U6QA 2FS9A 3O8BA 3VB7A 3E16B 3MH6A 4ASHA 1QRZA 2HALA 2R3YA 1Z8JB 4CRDA 1C5WB 1MCVA 1Y8TA 2XC4A 3BIUH 3RXFA 1C2EA 3SNDA 3PLBA 3MU1A 1CGHA 1ELCA 3HKJB 1Z1JA 5FPSA 2CXVA 4GPGA 1GJAB 4D9RA 1A61H 1OXGA 1WQSA 3NXPA 3PMJA 4B1TA 1EAUA 1YF4A 3KCGH 1AU8A 3ZZBA 1O5FH 2GZ8A 1EAXA 2A31A 1ELDE 2OINA 4UFGH 1WUNH 3LGTA 1ACBE 1G3DA 4Y7BA 1ZTKA 4NIYA 1E35B 3L33A 3MU0A 5GCHF 4BAKB 5DP6A 1BMLA 2XBYA 1D3TB 1HCGA 3LONA 1HBTH 1THSH 4JZDH 3V0XA 4AN7A 1O5BB 1CT4E 1GMDF 1ID5H 4UDWH 1GDNA 4BAHB 2BD7A 4AFZA 2PFEA 3V7TA 2H9TH 3AW1A 4TPYA 3A8AA 2PV9B 3ZZ8A 4D9QA 4OGXA 1QQ4A 1W0YH 2A4QA 3ATLA 2BY8X 4DVAU 1TPAE 2FOAA 3RLWH 2A5IA 3SZNA 1C5OH 4FUCA 2SGFE 6GCHF 2QXIA 3RC5A 3IG6B 4WF8A 4NZLA 1YPMH 2BDYA 3PYHA 3M3SA 1J17T 2FTLE 2A45B 2FM2A 1ABJH 3V12A 3UQVA 3DHKH 1P03A 1MQ5A 3IWMA 1D9IA 1GBDA 1EASA 1QY6A 2BD9A 4Y11E 3LC3A 2R3UA 2QF3A 4YTAA 1IQJA 2V3OH 1W3CA 1K1IA 3KL6A 1O3AA 4IN2A 4MTBA 3S9AA 3RXIA 4KELA 4MPWA 1EOJA 1XM1A 1FIZA 1HIAB 2R2MB 1AI8H 3SU5A 4A1VA 4WMDA 1EQ9A 2AFQB 3VPKA 1O2KA 2LPRA 1FLEE 1AQ7A 1LPKB 3ZZAA 1DY9A 1J16A 1O3GA 2ZDAH 2G5NA 5TCAA 2O9QA 1OWDA 1V2TT 1LCYA 3TU7H 1O3PB 1GCTB 3A7VA 2ZF0H 2XCNA 3QZQA 3GYMA 2C90B 5JPMH 4NIXA 2F9PA 5JB8S 1UTQA 3SGAE 1X7AC 1EJAA 2O8WA 2BLQA 3VEQB 1TNIA 1HAYB 5T6GA 3IITA 2BOHB 4SGAE 5TJXA 1KXDA 1OWEA 4XFQA 2FIRH 3LPRA 4YLUA 3SNAA 1BITA 1QGFA 4YOJA 2WPIS 5T6FA 2J92A 1DLEA 1A7SA 3BTEE 5EPYA 2PWXA 4X8SH 1BIOA 1O2PA 5FBIA 1RTFB 1AE5A 2O8UA 4ISHH 2P3UB 5GWZA 1MAXA 1S6HA 3BIVH 4IS5A 8GCHF 1FY8E 3TK5A 3KNXA 1PQAA 4BAOB 2Y7XA 1FY3A 1ETRH 1A1RA 3ZVDA 1P2IA 1BT7A 1YPKH 2Q6DA 2FOHA 3BEIB 1HGTH 2FXRA 3W95A 3GY6A 1MUEB 2QIQA 1ZTJA 2DE9A 4GLYA 1PQ7A 2OQ5A 3PTNA 1O2JA 1BRBE 4AORA 2ASUB 3UOUA 1WBGB 1O2OA 1BB0B 3MFJA 1SLWB 2PKAB 4X6MA 4Y8ZA 5GXPA 3OY5U 3KQBA 3M37A 2XC5A 1EZQA 4FUGA 1K1LA 1BHXF 1CE5A 1ANCA 2A4RA 4CBNA 1XUKA 2PTNA 1Z7KA 2UWPA 4FUHA 2WV5A 1CU1A 1DX5M 1KXEA 2ZC9H 5A8YA 2ZP0H 4ZROA 3BN9A 1LHFH 4MLFB 2FS8A 3BEFB 2FOCA 1J8AA 2FI5E 2GCHF 2VINA 3LKWA 1MKWH 1K28D 1BBRH 4ZMAH 2VIDA 1GBLA 1W10U 1UVOA 4NSVA 1P9SA 2UUYA 1LVMA 5DP4A 4ABBA 3F9FA 2W7SA 1G3BA 3UWJH 5DP5A 2V3HH 4U30A 1H9LB 5HYOA 1QIXB 2WPMS 2ZZUH 3V3MA 4KTUA 1GCDA 2UWOA 4FVBA 1QJ7B 4AGJA 1BTZA 2J2UA 1GG6B 3SUFA 4KTSA 1GBJA 1C1WH 3SV6A 1C1QA 1S0RA 1VR1H 1T8NA 1SGIB 4O3TA 1QRWA 1MTSA 1KXAA 1TQ0B 2G8TA 3MH5A 3P6ZB 1HNEE 4XSKU 2VWNA 4TY6A 1KY9A 2UUFB 2WPKS 4K3JA 1PPBH 3P92A 2VWOA 2XW9A 4ISLA 1V2KT 1CT2E 3AASA 2VIWA 1P3CA 1SBWA 5HM2A 2WYGA 3RXLA 1NT1A 3TH3H 1H9HE 9ESTA 1O2ZA 3PMHB 1TRNA 5C1UA 1AO5A 4AYYB 1GMDG 2ZCKP 3H7OA 2BLVA 1TRMA 1Y3XA 1DLKB 3BF6H 1DPOA 1KXFA 2C8ZB 4B2AA 1MTUA 1ANBA 2FTMA 6LPRA 2XWBI 4OS4A 2KAIB 4X1NU 3CS0A 1W8BH 1SFQB 3TGIE 1O2SA 1OPHB 1LMWB 2H2ZA 3MNCA 3E91A 3SN8A 4ISOA 1EXFA 3U69H 5GIBA 2BD3A 3PLPA 4AFQA 1FIWA 1HAVB 3QGNB 2VWMA 2FEQH 1J9CH 2WV4A 3TGJE 5F8XA 2VB0A 5LPFA 4NA7A 4Q7XA 1A5HA 1LHDH 3ZZ4A 3SI4H 1O3HA 3M7QA 3JZ2B 1DDJA 3NK8A 1A4WH 2SGPE 3E1XB 1BMMH 3ZV8A 4GUXA 2IOTA 2UUKB 3EDXB 5C2ZA 1CA8B 5EQSA 2P16A 1BTXA 1RIWB 4DG4A 1MCTA 1KXBA 3PLKA 1GL1A 4YM9A 1AIXH 3OX7U 3B23B 4H4FA 3ZZCA 4X8TH 1TWXB 2OBQA 1ZPBA 1O2UA 1FQ3A 3PMBB 1G32B 2ZG0H 1GHBF 2PW8H 2OC0A 2B5TB 1W11U 1QB6A 4WXIA 1KDQB 4YT6H 1A0JA 1C2HA 2B0FA 3RMNH 1C5LH 1F7ZA 3TJUA 3SJIA 3ODDA 1UCYE 2C4FH 1A2CH 3GCHC 3SV8A 2GGVB 5E2OA 3A7TA 1TGNA 1O3BA 2BDIA 1DWDH 4CH2B 1HAHH 5FBEA 1FY4A 5F03A 6CHAB 3KEEA 1GPZA 2C8XB 2BVXH 4A7IB 1O2LA 3P95A 4DIIH 3O8DA 5TCCA 1QA7A 5CE1A 1SGFG 3GY4A 2IPHA 2QXJA 3PWBA 1F92A 1AVGH 4SGBE 4WJG2 1SQTA 3SU0A 1QA0A 2HOBA 2AH4X 2G55A 1CHOG 1UK2A 1LHGH 2P3FH 4ZXXH 2QGRA 3LT3A 2XYAA 3PTBA 3TJNA 4K5ZA 5ESBA 4Y71A 4LK4A 1VITH 1QRXA 2ESTE 1HAZB 1Y59T 1NFYA 1Q31A 3ENSB 1GI5A 3T29A 1C9PA 1MTNB 1RTLA 4CRAA 7KMEH 1D4PB 1P04A 1TLDA 3VGCB 5A09A 1IQEA 1L4DA 2A7CA 1SL3A 3F6UH 3SHCH 3ZYDA 3SV9A 1G3CA 1XUGA 2ZU2A 4ABDA 1O3LA 1HJAB 2IJOB 1UTOA 1GBKA 1QBNA 1P2QA 3RDZA 1HAXB 4D76A 2BDGA 4X1RU 2A5AA 2A32A 2GZ7A 2OXSA 4UFFH 1T32A 3QO6A 2HRVA 2VNTA 4FUDA 3ZVEA 5EQQA 1GGDB 2RDLA 6CHAC 1HAGE 3T25A 2CMYA 2FOFA 1NRRH 1V2WT 3FZDA 1GI1A 3QK1A 4MQAA 1C1OA 4FXGH 3GCTF 3BTWE 2ZWLH 1A3BH 3R3GB 1GHBG 1E37B 3R0FA 2ZCLP 1L1NA 3VXFH 3SU4A 1ZGVA 4I8GA 4A92A 2ZU1A 5A0AE 2YNAA 4YOIA 2TGDA 8KME2 4WH6A 3T28A 5F8ZA 1EOLA 4U01A 4FUJA 4GHQA 1QBOA 1TAWA 2A4GA 1SGEE 4R0IA 3GOVB 2M5TA 2FX4A 3GY7A 5DGJA 1GBFA 3RXEA 1KTTB 1AVXA 4X2VA 4XOJA 1ELAA 1GJDB 1FZZA 2AS9A 2HGTH 1YCPK 4K8BA 1RD3B 2ZU5A 4ZAEA 1G2LA 1UO6A 1GBCA 4ZHMU 3SOSA 4ISIH 2G5VA 3FP6E 3UNQA 2OTVA 1P9UA 1KYNA 3CENA 4H42U 5HMAA 1UTJA 1V6DA 1YM0A 2OC8A 3LGIA 3TPIZ 1AVWA 3KQEA 1F5LA 3P8OA 1AWFH 3F9EA 3E90B 2BQ6B 2OP9A 4NFEA 4Q7ZA 1MKXH 4ABHA 1ZR0A 1DXPA 1ANEA 3MYWA 2H5DA 4GCHF 5EXMA 4Y10E 1Y5AT 2BXUH 1FPCH 1T4VH 4WY3A 2FYQA 2QXGA 1ELVA 1HAVA 4NA9H 1HJ9A 2GTBA 2O8TA 1AZZA 5BPEA 2OC7A 3RXTA 2Z3EA 4JYUH 1WYKA 1C9TA 2FOBA 3EA8A 2GCHG 2EC9H 4JK6A 1LTOA 5L30H 5DG6A 4IMZA 3H5CB 1GMHG 1S0QA 1C5VA 4B75A 2JKHA 1C2FA 1V2QT 1UVPA 2CF9H 2Z9IA 1SGNE 1EB2A 1A0HB 1L4ZA 1PPEE 4CBOA 1EZUC 4FUEA 1GJ8B 1GMCF 2FPZA 2BY7X 9LPRA 2Z9KA 1OWJA 1IQHA 2H6MA 1FDPA 1YPHC 3BTME 3I29A 3Q3XA 4CRFA 1SQOA 3SJ9A 1DOJA 5JBCS 1P2KA 1EKBB 4DGJA 5GCHG 1BJUA 1FY5A 5G4BA 2TGPZ 1SLVB 3TH4H 1AN1E 3LH3A 2Z3CA 3A80A 1FJSA 4XBCA 5CHAC 1FPHH 1P11E 1O32A 2BDCA 3SGQE 2D2DA 1PYTD 1TX6A 2GDDA 1GJCB 2Z94A 2R2WU 4UFEH 3ZZ3A 1JRSA 1W12U 1SGCA 1MTVA 5HGGA 3MH7A 3RXJA 2GD4B 3NUMA 3QDZB 4I8HA 1TIOA 2ZU4A 2OLGA 3RU4T 3UNSA 4IGDA 2AMDA 2BVRH 1V2VT 1QFKH 4D7FA 4X2WA 1XUFA 3UUZA 2Y7ZA 1GHAF 3A84A 4YLQH 3PV4A 2BTCE 2QF0A 1V2UT 1S6FA 2W26A 4CR5A 1QJ1B 3ZV9A 3NZIA 3STJA 2XCFA 1O2GH 1SGQE 4ABFA 1SGPE 2Z7FE 2ZHQH 3CS7A 1GJBB 1Y3VA 1O5CB 2FP7B 1C5QA 3PWCA 1RRKA 4DJZB 1AY6H 1ZHPA 1D3PB 1FN6A 1P10A 3LC5A 4KP0A 2ZFTA 2F91A 1YC0A 2BQ7B 3VB3A 3FANA 3RXKA 1TPSA 3M35A 1AUTC 4DIHH 1O30A 2BDHA 4AFUA 4FVDA 3QN7A 5CMXH 3VGCC 2Z9LA 1NY22 3M5MA 4AB9A 2ZPSA 1SOZA 3URCA 3RXPA 1O31A 1ANDA 4NIVA 1GJ5H 4F49A 2FO9A 2RG3A 4JMYA 3KQDA 4X6NA 1GVKB 4B2BA 1BA8B 1N1LA 3M3TA 1TMBH 1MBMA 1YPGH 3Q77A 1KIGH 2ZU3A 3QX5H 1TE0A 2HNTC 1SI5H 3RXBA 2VWLA 1QHRB 2BD8A 1K9OE 1HXEH 2AERH 2FOMB 1GI6A 1C5XB 1ESBA 4JCNA 1L1GA 2EI6A 1IQKA 5C1XA 1DY8A 2UUJB 3QGJA 3RXMA 2ZI2H 4WMEA 1C2JA 1FN8A 1O2MA 3FP7E 4UFDH 5BRRE 4GVUA 1C2GA 2ZQ1A 2Y5GA 1O36A 7GCHG 3RUOA 5DO4H 3TNSA 2FI4E 4ESTE 1EP6A 3F9HA 1TX7A 1F5RA 2ZTYA 2O8MA 1HV7A 1ZZZA 1LQEA 3I77A 5DK1A 4FUFA 1CGJE 3UNRA 1W7XH 4GHTA 3B9FH 3CP7A 4WWYA 1TOCB 1VJAU 2OC1A 3P8NA 4ABIA 2ZDVH 2ZDLA 4LOYH 1SB1H 3VB4A 1DVAH 2TPIZ 4HFPB 3L6PA 5LPEA 1CHOF 3A7WA 1C5SA 1O2NA 4WH8A 2ZNKH 1EPTA 1TNHA 2BD5A 4JYVH 1C5NH 1FONA 1OP2A 2QAAA 3BTFE 2V0BA 1KDQA 2VGCC 3BTQE 2QA9E 3Q3YA 4INKA 4IN1A 2Z6BD 2K7XA 1BHXB 2PLXA 3BG4C 1GVZA 2PKSC 4KKDA 1MTNC 1TRYA 1SQAA 2SGEE 2F3CE 1QL7A 1S82A 5E0JA 1NRPH 3TK6A 1PPCE 3G01A 4HZHA 1M9UA 2CF8H 1GHXH 2B7DH 1KXCA 3LGVA 3P8GA 1BTYA 5T3HA 1BMNH 4AG1A 1EAWA 2XBVA 3PROA 1SFIA 1ZHRA 2BLWA 1NC6A 1DE7H 2CGAA 4MG3A 1P2MA 1AWHB 1K1JA 3KIDU 4D7GA 3BTTE 2FZZA 2IN2A 2HPPH 3SHAH 1P3EA 3NPSA 1H1BA 4X0WU 2XC0A 1G37A 2GKVE 1LO6A 4ZH8A 1XVMA 4BXWA 2Y82A 1IHSH 1RFNA 2VH0A 4NWLA 3AW0A 3ZVFA 1GI3A 2ZPQA 2QXHA 1OWHA 4A5TS 4YOGA 3ITIA 4J2YB 3SU1A 1CA0C 3SUGA 1QB1A 1O34A 4FUBA 1UCYH 1EAIA 3QUMP 4K2YA 5EGMA 1CHGA 4F4OC 1DWCH 2LIZA 1TGTA 1AUJA 1GBBA 5LH8A 1PPGE 5FPYA 5K0HA 5AVDA 1PPHE 4K1EA 2ZGXH 2ANYA 1L0ZA 3UIRA 1W2KH 2SGAA 5F6MA 3TJOA 3ZZDA 2FOGA 2QC2A 3A85A 4HGCA 4TWYA 1XMNB 5HXFA 3MMGA 3V13A 1P2JA 2ODPA 1YCPM 1C1MA 1G2MA 1ZRBA 1VZQH 1JXPA 1PQ5A 1T8LA 3U9AH 3RM2H 4K1TA 4THNH 1O2WA 3MWIU 1B5GH 1GI9B 4AX9H 1FAXA 2A2XH 4E7NA 1MZDA 2BMGB 1C1SA 2BDAA 2VH6A 2FI3E 2VIVA 4Q7YA 1UVTH 2J38A 3M5NA 3GCHB 1O3EA 2DE8A 2GX4A 3AAUA 2BY9X 2GCTB 2A1DB 1YBWA 2BM2A 4MPVA 5AHGH 1GI4A 2F9UA 2VJ1A 2ZQ2A 1O3KA 2Z9JA 1DANH 3A88A 3FFGA 1MH0A 3ZVCA 3EYDA 1WOFA 2BD4A 1E34B 1DM4B 5IYTA 4X2YA 4MVNA 1UTNA 4ABEA 1NZQH 1OSSA 3TVJB 3KGPA 4ZKOU 3TK9A 1FV9A 4Y0ZE 1GHYH 4AOQA 2OUAA 3GDSA 1V2RT 1CGIE 1C2KA 2SGQE 2BX3A 2JETB 3P8FA 3VFEA 3U8RH 1GHAG 4NZQA 1YPJH 3GISB 3TNTA 1UK3A 1C5YB 2PGQB 1T4UH 2XTTB 3U8TH 1EPTC 1HDTH 1TB6H 4INLA 3SUDA 4U32A 2P8OC 1DWBH 4D8NA 2AIQA 2JH0D 1Y3WA 1ZPCA 1SC8U 4I8KA 4XE4A 3SORA 4MDSA 1TABE 4UEHH 2AMQA 2GVFA 1LQDB 4Q2KA 4JK5A 3BG8A 1HAIH 1AB9C 2JH5D 3LGYA 2BXTH 1P02A 2G00A 1O35A 1AB9B 4Z6AH 2A7HA 1VCWA 3RMLH 1S5SA 1S84A 1YLCA 1NRNH 2VVVA 2GV7A 2O8LA 3E0NB 8GCHG 1Z8GA 1MQ6A 3RU4D 2EI8A 3MO9A 1PYTC 3EBNA 5FAHA 3D23A 2V35A 4K69A 3GCTG 1O33A 1WTHD 1D3QB 1BOQA 1S81A 1NESE 3ZZ6A 1HAOH 1OWKA 1EJMA 1DUEA 1HYLA 1QL9A 4IW4E 3RMOH 2ZHDA 3UQOA 1QR3E 1CBWC 1JMOH 7GCHF 2WINI 5C67A 1GHWH 1GBTA 1ZJKA 2ILNA 3ZVBA 3GY2A 2FMJA 4I8LA 3LGUA 1OS8A 1S83A 3VXEH 2ULLA 5IDKA 1T8MA 1BTHH 3B8JA 4BANB 3SNCA 1P57B 4MPUA 1EB1H 1GI8B 1D3DB 2J4IA 3T27A 1UMAH 5ESTE 1MU8B 5DP3A 1Z6JH 1Y5BT 2BYAX 2KAIA 2WUBA 1J15A 1L1JA 1YKTA 1QBVH 4FU7A 2FLRH 2AYWA 3L3TA 2XBXA 2SFAA 1TNJA 1JWTA 1BBRK 1OKXA 3C1KA 1A5GH 3NKKA 1ETSH 1DXWA 5EG4A 5LPRA 1NU7B 3LH1A 1Z1IA 3QTOH 3HK6B 3U1IB 3T5FH 4B74A 1IQLA 1GJ9B 3DD2H 4YT7H 3SJ8A 1GBEA 1ZSJA 1YPLH 4X2XA 2G4TA 1V2ST 4DCDA 4NWKA 3U1JB 4RN6A 3UFAA 3E3TA 3GICB 2XXLA 3MU4A 1IQIA 2C3SA 4X8UH 1XUHA 3ATWA 1BUIA 2FODA 2Z3DA 2PKAA 2RA0A 4ABGA 3AAVA 3F68H 4MNVA 2PKSB 3KHVA 3RXDA 3GCOA 4I31A 3M3VA 1YPEH 1H4WA 2BHGA 3SJKA 3RXHA 4CRBA 1W0ZU 3U98H 2D1JA 1GWAA 1K2I1 1Z8RA 2ZFSA 2ODQA 1C1PA 3MHWU 3BTGE 1C2IA 2ANMH 3TJVA 5A8ZA 1ZHMA 3EE0B 2W5EA 1K1NA 1SPJA 4ABAA 2ZHFH 4XBBA 2SNVA 1NRSH 3EAJA 1V3XA 2B9LA 1W13U 5B6OA 1CT0E 4NIWA 1BRUP 1VITG 3LIWA 2FYRA 1GJ4H 1EZSC 3UWIA 1VGCC 2ZGHA 3RC6A 3AVZA 3SNBA 2ANKH 1LVBA 2Y80A 1O2RA 2F9OA 3SQEE 1K1OA 3GYLB 2A2QH 2F9NA 3HGNA 3HGPA 2YOLA 2DUCA 1V2MT 1C2LA 4IC5A 4INHA 1H9IE 4OS2A 1GBAA 2R0LA 2ZGCA 1TX8A 2ALPA 1A3EH 3D49H 1GMCG 2OBOA 1UHBB 4Y7AA 1ESAA 4BTTB 2NU0E 3TITA 2BZ6H 4VGCC 5DP7A 1BQYA 5FX5A 1AMHA 4NA8A 3UR6A 3RXVA 5EXLA 1MD8A 1O38A 1MKWK 1MKXK 1LDTT 3E8LA 5EXNA 5A0CA 1G36A 5AFZH 2D26C 1NM6A 1XXDA 2P8OB 3BTKE 2UWLA 2V6NA 3T62A 3A7ZA 1ARBA 2WPJS 2ZHEH 2ZECA 3BV9B 4A6LA 3OSYA 5FXLA 3TIUA 1GHVH 1HXFH 4CREA 1O3MA 3FP8E 1QB9A 1ZTLA 4TY7A 3Q00A 1SR5C 2OQUA 1HIAA 4Y8YA 1TPOA 2ZEBA 3URDA 3M5LA 1P2OA 5E2PA 1O5DH 1Z71A 2PTCE 2P94A 3ZZ7A 1O2VA 2BX4A 1C4V2 1C5UA 1GDUA 1BDAA 2PR3A 1FAKH 3UY9A 4XBDA 3WY8A 1IQMA 1ELGA 2B8OH 4E05H 5L2YH 3MU5A 3O8RA 3FVFB 1F0SA 3A7YA 1V2NT 2I6SA 3HKIB 1QQUA 3EGKH 2WPLS 1XVOA 2C8YB 2P59A 3K6YA 2ZDMA 2JETC 4QT8C 1D6RA 2FLBH 1F0TA 3M36A 1V2JT 4FU8A 4ZHLU 1MD7A 1JRTA 3ZZ5A 3VB6A 1F5KU 1C5ZB 4E06H 2C8WB 1SGTA 1TOMH 3RC4A 1O3FA 4OS5A 4ZKRU 1DS2E 5H4IB 3RXUA 1IAUA 1PFXC 3DA9B 4H6TA 1MZAA 1GMHF 2H9HA 1HLTH 5FPTA 4DURA 3JZ1B 1DFPA 3D65E 4Y8XA 1AZ8A 1JIMA 1KTSB 2ZHWH 4WXVA 1IQGA 2SGDE 2WPHS 2P3TB 1RJXB 2AEIH 4X1SU 3DUXH 2YNBA 1Z8IB 4JZIA 2JH6D 2NU4E 3SV2H 3S7HB 1TFXA 1ARCA 1MBQA 4GCHG 3SUEA 4K1SA 4BAQB 4BTIB 3D62A 1TONA 1YPHE 3MTYA 4MNXA 1RIWC 4Y0YE 1SLXB 2HPQH 8LPRA 4ZUHA 1EPTB 1ZYOA 1XXFA 4CR9A 5I46H 2Y5FA 4K8YA 1GJ7B 4TWWA 1AFQB 1OP8A 1NS3A 2W7UA 2ZGJA 2QCYA 3GY8A 2XRCA 4IBLH 1VJ9U 4X1QU 1C1TA 1THPB 1TBQH 3BEUA 5JYIA 1ETTH 7ESTE 1WV7H 2GV6A 2PHBA 3ODFA 1N8OC 1E36B 1SG8B 2TIOA 1H8IH 1SGFA 5C3NA 2F83A 4BOHA 5JBBS 3S9CA 4TYDA 3A7XA 2ZPRA 4ISNA 1RS0A 1SVPA 2G51A 3KQCA 4AG2A 2C93B 2ZFFH 5AF9H 1ELFA 2ZGBH 3GY3A 1SHHB 4O9VA 1OX1A 2EEKA 1C2MA 1OOKB 5J4SA 1SOTA 3LDXH 3MOCA 6GCHG 1PJPA 1TBRH 1CBWB 1EJNA 8ESTE 1Y5UT 2VVUA 2PUQH 1NO9H 4PROA 2ZDNA 3A89A 4BAMB 2TRMA 2XNIA 1GI7B 1D6WA 1XUJA 1Z6EA 1NFXA 4I33A 1JIRA 2K1QA 3TH2H 3SU2A 3UOPA 5EW2H 5AFYH 1BRAA 2BB4A 1RGQA 1BCUH 1GBHA 1C1RA 3VB5A 1EX3A 1BZXE 1JOUB 2R9PA 1DICA 2TBSA 2AGGX 1GBIA 4B71A 1UK4A 1UTLM 3TGKE 1J14A 2PGBB 3SQHE 1O2HA 5DP9A 4JZEH 3LU9B 1A0LA 3HATH 1QNJA 3NWUA 2F9BH 1MTWA 1P0SH 3K9XB 2J9NA 2CV3A 4OS6A 1ELTA 1TALA 3RXOA 2FESH 4GAWA 1UHBA 1GCTC 2GP9B 1SGDE 2F9VA 1H8DH 2ODYB 3MO6A 5F8TA 1UVUH 4LZ4B 3K2UA 4ZHAA 4DOQA 4RKJB 4DT7B 3SJOA 3MI4A 4X1PU 1L2EA 1Q2WA 1P12E 4WVPE 3GY5A 1HJ8A 1NROH 3SU3A 2VIPA 1PPZA 2R0KA 1ZSLA 3GDVA 3MU8A 1G30B 4H6SB 1XX9A 5E0HA 1WAYB 1A46H 2Q1JA 1G9IE 5ABWA 4CH8B 3S69A 2P93A 2VVCA 4OS7A 2J95A 1B0FA 1BTPA 2NU1E 3Q76A 1ORFA 4K60A 4JZFH 5ETXA 4A1TA 4UE7H 1BMAA 1GI0A 2A4OA 2PUXB 1ZPZA 1FMGA 3PO1B 1O3CA 1Y3YA 3ZYEA 2GT7A 2HNTE 1TYNA 2H1UA 5DPAA 1QTFA 1VGCB 3HPTB 1HFDA 1FXYA 3ZVGA 1CSOE 3S9BA 3QZRA 3KF2A 4KTCA 4GSOA 1F2SE 1YLDA 2AMPA 5LGOA 3EA7A 3RXSA 2P95A 4Q80A 2VU8E 1HJAC 1KLTA 3A8CA 4RSPA 5GPIB 4JZ1A 5EQRA 1P09A 1WQVH 1VCQA 1WSSH 4MPXA 1YP9A 1BJVA 4OS1A 1N6XA 1BBRE 3A81A 3SO3A 4MNYA 1HRTH 1C1UH 3NCLA 3H7TA 3UREA 1KLIH 1O5AB 1TNKA 1V2PT 4ZKNU 1AE8H 4KGAA 1MU6B 1SGRE 1DSUA 2GDEH 2H5CA 2FX6A 1S85A 4I32A 3BG4B 1TNGA 1O3OA 2J94A 4CRGA 3MNSA 2G81E 1ZGIA 1YGCH 3MH4A 2BZAA 1IQNA 3DT0H 3A83A 1C2DA 2RCEA 4I8JA 4Y76A 1AHTH 4IC6A 3RU4E 1AFQC 3SBKA 2AGIX 1OYQA 1A5IA 4X8VH 1DUAA 1OP0A 2CJIA 3U8OH 3Q3KA 1SHYA 1E0FD 2WUCA 3PB1E 1HAPH 1C1NA 2WYJA 2XWAA 2Y5HA 1WU1A 5EU8A 4AZ2B 1C5PA 1N8OB 2STBE 5K7RA 1HB0B 1ABIH 2QY0B 3RMMH 4I7YH 1THRH 2Y81A 2AIPA 5GDSH 2J34A 1GJ6A 1CA0B 1K21H 1UJ1A 4UONA 2D8WA 3SGBE 1G3EA 5CHAB 2FOEA 3HK3B 3A8DA 5T6DA 4ZXYH 3C27B 3RP2A 3ZVAA 5HM9A 1ZOMA 2LNCA 1O2IA 4AB8A 1EZXC 1K1PA 2A5KA 3UTUH 1KLJH 4Z0KA 1BTUA 1LKAA 1KSNA 1O3IA 3PM3A 3K65B 1Y3UA 5J4QA 1B0EA 2ALVA 1OYTH 1RXPA 4LXBH 4RKOB 1W7GH 1DSTA 2BLOA 3RXAA 3A82A 1NFWA 3LOXA 5JBTA 1T8OA 1YCPH 3LGWA 3LJJA 4AGKA 3SNEA 3DFLA 4E7RG 1V2OT 4OGYA 5JB9S 1NPMA 2BD2A 1EATA 4O3UA 1DWEH 5C1YA 1B7XB 1NFUA 1O2TA 4ZKSU 4BXSA 3OU0A 4X6PA 5A0BA 3A87A 4HTCH 1OWIA 1UCYK 1WTGH 1XKBC 1UTPA 1PQ8A 3OYPA 4NG9H 1O3NA 2XBWA 1ZRKA 1JBUH 1VITF 1TNLA 5C5NA 2H9EH 2ZKSA 1LHEH 5E8EH 2BY6X 3ZZ9A 1ELEE 2GCTC 4MNWA 1SGYE 1SMFE 3KN2A 1YYY1 2I6QA 1O5GH 3F9GA 1BRCE 2A0QB 2CN0H 3RM0H 2ZFQH 1FY1A 4O97A 1GG6C 1BTWA 4FUIA 2FDAA 3A86A 1ZMJA 1F0RA 4NFFA 4DW2U 5DJ7A 1AKSA 1GGDC 2HWLB 5GJ4B 1INCA 4AFSA 4Y6DA 5JDUB 3LJOA 1C5MD 3M7TA 3M61U 1T7CA 3BTHE 1O2YA 3QTVH 2A7JA 5I25A 1ZLRA 1ZMLA 1LVYA 3DFJA 3N7OA 5L6NH 1AD8H 4NCYA 4VGCB 3PO1C 1UTKA 2QYIA 1ZJDA 4YZUA 4FU9A 2W3KA 1N6YA 1TGSZ 4M7GA 5FHTA 1GHZA 3RXQA 5C5OA 3MNXA 1V2LT 2G52A 3GCNA 2Q6GA 2EI7A 3RLYH 1O2QA 1EUFA 3W94A 2STAE 1TQ7B 1TA2A 3M5OA 4YESB 4XDEA 3QLPH 4R8TB 1O5EH 5EW1H 1GI2A 2Z9GA 1FNIA 1O3DA 4J1YA 1AFEH 4BTUB 5JBAS 2Y6TA 3RXCA 1C5TA 3A8BA 1RTKA 2VIOA 1XKAC 2ZIQH 4AYVB 2ZCHP 2CHAC 3P70B 3SI3H 1NU9A 4CHAC 1QURH 3EQ0H 1PPFE 2TGAA 1K1MA 1P05A 3M7UA 6ESTA 2THFB 1T31A 5DP8A 5FCKA 3MNBA 4NSYA 1ESTA 3GDUA 1MMJN 2W3IA
chains in the Genus database with same CATH superfamily
3QWCH 1FUJA 3UPEA 4ACAA 1C4Y2 1CO7E 4YO9A 1E38B 1ZMNA 1TMTH 2GZ9A 1AGJA 2V7QD 3O8CA 2VIQA 4B73A 1O0DH 1TPPA 4A1XA 3ATIA 1NRQH 1O3JA 2QV1A 2FWWA 2NU2E 3WW7A 1O39A 1ZSKA 1O37A 4B2CA 3K6ZA 2HLCA 3BTDE 4ABJA 1LPGB 1UVSH 1QL8A 3P17H 2JJ1D 5DKMA 1DT2A 4WMFA 1ELBA 1GVLA 3RXGA 3ELAH 2PSYA 2OD3B 3ESTA 3OY6U 1P8VC 4O03A 1CQQA 1TA6A 5EODA 3SW2B 3E6PH 3T2NA 2PSXA 3FZZA 5FCRA 2NU3E 1GL0E 1DITH 2ZDKA 3S7KB 1TBZH 1C5RA 3T26A 1TGCA 4U2WA 3SV7A 3ATMA 4IMQA 3TLOA 1TGBA 1GDQA 2GT8A 3WWBA 1O2XA 4B76A 1NTPA 3OTJE 1NN6A 1SSXA 5L2ZH 4FOUC 3RXRA 5EPNA 1IQFA 1LVOA 4CRCA 4HI3A 1AKSB 1QCPA 3S0NA 1QJ6B 1P2NA 3UR9A 1TMUH 1LPZB 2ZA5A 3STIA 1C1VH 1W14U 1MAYA 1LKBA 2OCVB 7LPRA 1HPGA 5C20A 2GMTC 2QN5T 1UTMA 3PMAB 2ZFRH 2ZTZA 4X6OA 1VCPA 5E0GA 3ATKA 3E0PB 2GMTB 1IHTH 5EOKA 2BVSH 2HVXA 3F1SB 4NGAH 1XUIA 2ANWA 3I78A 1GBMA 2AGEX 3FAOA 1FI8A 2VGCB 2RA3A 2YMSB 5PTPA 1P01A 2SNWA 2HNTF 5SGAE 1W0JD 2BY5X 1F0UA 1P06A 4UD9H 2ZFPH 2TGTA 4Y79A 4BNRA 5A2MH 2M2AA 1C4U2 5FX6A 2NWNA 2BQWB 4JYTA 1HUTH 2BDBA 5HIZA 3SU6A 4TPIZ 3BSQA 1EP5A 2ZTXA 5KGOA 2JJ2D 1WCZA 2BOKA 2G4UA 4DY7B 3EA9A 2CHAB 4CHAB 5A8XA 4I86A 2KFWA 2EA3A 4LZ1H 1SLUB 3MO3A 1LHCH 2Q6FA 1Q3XA 1K22H 1IOEA 2ZO3H 1CVWH 1U6QA 2FS9A 3O8BA 3VB7A 3E16B 3MH6A 4ASHA 1QRZA 2HALA 2R3YA 1Z8JB 4CRDA 1C5WB 1MCVA 1Y8TA 2XC4A 3BIUH 3RXFA 1C2EA 3SNDA 2WSSD 3PLBA 4P00A 3MU1A 1CGHA 1ELCA 3HKJB 5EJLA 1Z1JA 5FPSA 2CXVA 4GPGA 1GJAB 4D9RA 1A61H 1OXGA 1WQSA 3NXPA 3PMJA 4RI0A 4B1TA 1EAUA 1YF4A 3KCGH 1AU8A 3ZZBA 1O5FH 2GZ8A 1EAXA 2A31A 1ELDE 2OINA 4UFGH 1WUNH 3LGTA 1ACBE 1G3DA 4Y7BA 1ZTKA 4NIYA 1E35B 3L33A 3MU0A 5GCHF 4BAKB 4Z1MD 5DP6A 1BMLA 2XBYA 1D3TB 1HCGA 3F0PA 1HBTH 3LONA 1THSH 4JZDH 3V0XA 1WXRA 4AN7A 1O5BB 1CT4E 1GMDF 1ID5H 4UDWH 1GDNA 4BAHB 2BD7A 4AFZA 1YLNA 2PFEA 3V7TA 2H9TH 3AW1A 4TPYA 3A8AA 2PV9B 3ZZ8A 4D9QA 4OGXA 1QQ4A 1W0YH 2A4QA 3ATLA 2BY8X 4DVAU 1TPAE 2FOAA 2YMSD 3RLWH 2A5IA 3SZNA 1C5OH 4FUCA 2J97A 3OEED 2SGFE 6GCHF 2QXIA 3RC5A 3IG6B 4WF8A 4NZLA 1YPMH 2BDYA 3PYHA 3M3SA 4DT4A 1J17T 2FTLE 2A45B 2FM2A 1ABJH 3V12A 3UQVA 3DHKH 1P03A 1MQ5A 3IWMA 1D9IA 1GBDA 1EASA 1QY6A 2BD9A 4Y11E 3LC3A 2R3UA 2QF3A 4YTAA 1IQJA 2V3OH 1W3CA 1K1IA 3KL6A 1O3AA 4IN2A 4MTBA 3S9AA 3RXIA 4KELA 4MPWA 1EOJA 1XM1A 1FIZA 1HIAB 2R2MB 1AI8H 3SU5A 4A1VA 4WMDA 1EQ9A 2AFQB 3VPKA 1O2KA 2LPRA 1FLEE 1AQ7A 1LPKB 3ZZAA 1DY9A 1J16A 1O3GA 2ZDAH 2G5NA 5TCAA 2O9QA 4FETA 1OWDA 1V2TT 1LCYA 3TU7H 1O3PB 1GCTB 3A7VA 2ZF0H 2XCNA 3QZQA 3GYMA 2C90B 5JPMH 4NIXA 2F9PA 5JB8S 2VBCA 1UTQA 3SGAE 1X7AC 1EJAA 2O8WA 2BLQA 3VEQB 1TNIA 1HAYB 5T6GA 2YMSC 3IITA 2BOHB 1FX0B 4SGAE 5TJXA 1KXDA 1OWEA 4XFQA 2FIRH 3LPRA 4YLUA 1SQRA 3SNAA 1NBME 1BITA 1QGFA 4YOJA 2WPIS 5T6FA 2J92A 1DLEA 1A7SA 3BTEE 5EPYA 2PWXA 4X8SH 1BIOA 1O2PA 5FBIA 1RTFB 1AE5A 2O8UA 3KQ5A 4ISHH 2P3UB 5GWZA 1MAXA 1S6HA 3BIVH 4IS5A 8GCHF 3KYGA 1FY8E 3TK5A 3KNXA 1PQAA 4BAOB 2Y7XA 1FY3A 1ETRH 1A1RA 3ZVDA 1P2IA 1BT7A 1YPKH 2Q6DA 2FOHA 3BEIB 1HGTH 2FXRA 3W95A 3GY6A 1MUEB 2QIQA 1ZTJA 2DE9A 4GLYA 1PQ7A 2OQ5A 3PTNA 1O2JA 1BRBE 2XOKD 4AORA 2ASUB 3UOUA 1WBGB 1O2OA 1BB0B 3MFJA 1SLWB 2PKAB 4X6MA 4Y8ZA 5GXPA 3OY5U 3KQBA 3M37A 2XC5A 1EZQA 4FUGA 1K1LA 1BHXF 1CE5A 1ANCA 2A4RA 4CBNA 1XUKA 2PTNA 1Z7KA 2UWPA 4FUHA 2WV5A 1CU1A 1DX5M 1KXEA 4B6FA 2J98A 2ZC9H 5A8YA 2ZP0H 4ZROA 3BN9A 1LHFH 4MLFB 2FS8A 3BEFB 2FOCA 2L6OA 1J8AA 2FI5E 2GCHF 2KM0A 2VINA 3LKWA 1MKWH 1K28D 1BBRH 4ZMAH 2VIDA 1GBLA 3PRDA 1W10U 1UVOA 4NSVA 1P9SA 2UUYA 1LVMA 5DP4A 4ABBA 3F9FA 2W7SA 1G3BA 3UWJH 5DP5A 2V3HH 4U30A 1H9LB 3OFND 5HYOA 1QIXB 2WPMS 2ZZUH 3V3MA 4KTUA 1GCDA 2UWOA 4FVBA 1QJ7B 4AGJA 4F55A 1BTZA 2J2UA 1GG6B 3SUFA 4KTSA 1GBJA 1C1WH 3SV6A 1C1QA 1S0RA 1VR1H 1T8NA 1SGIB 4O3TA 1QRWA 1MTSA 1KXAA 1TQ0B 2G8TA 3MH5A 3P6ZB 1HNEE 1E79D 4XSKU 2VWNA 4TY6A 1KY9A 2UUFB 2WPKS 4K3JA 1PPBH 3P92A 2VWOA 2XW9A 4ISLA 1V2KT 1CT2E 3AASA 2VIWA 1P3CA 1SBWA 5HM2A 2WYGA 3RXLA 1NT1A 3TH3H 1H9HE 9ESTA 1O2ZA 3PMHB 1TRNA 5C1UA 1AO5A 4AYYB 1GMDG 2ZCKP 3H7OA 2BLVA 1TRMA 1Y3XA 1DLKB 3BF6H 1DPOA 1KXFA 2C8ZB 4B2AA 3F2HA 1MTUA 1ANBA 2FTMA 6LPRA 2XWBI 4OS4A 1H8HD 2KAIB 4X1NU 3CS0A 1W8BH 1SFQB 2F43B 3TGIE 1NBMD 1O2SA 1OPHB 1LMWB 2H2ZA 3MNCA 3E91A 3SN8A 4ISOA 1EXFA 3U69H 5GIBA 2BD3A 3PLPA 4AFQA 1FIWA 1HAVB 3QGNB 2VWMA 2FEQH 1J9CH 2WV4A 2IJD1 3TGJE 5F8XA 2VB0A 5LPFA 4NA7A 4Q7XA 1A5HA 1LHDH 3ZZ4A 3SI4H 1O3HA 3M7QA 3JZ2B 2PP6A 1DDJA 3NK8A 1A4WH 2SGPE 3E1XB 3F3BA 1BMMH 3ZV8A 4GUXA 2IOTA 2UUKB 3EDXB 5C2ZA 1CA8B 5EQSA 2P16A 1BTXA 1RIWB 4DG4A 1MCTA 1KXBA 3PLKA 1GL1A 4YM9A 1AIXH 3OX7U 3PRBA 3B23B 4H4FA 3ZZCA 4X8TH 1TWXB 2OBQA 1ZPBA 1O2UA 1OHHD 1FQ3A 3PMBB 1G32B 2ZG0H 1GHBF 2PW8H 2OC0A 2B5TB 1W11U 1QB6A 4M9FA 4WXIA 1KDQB 4YT6H 1A0JA 1C2HA 2B0FA 3RMNH 1C5LH 1F7ZA 3TJUA 3SJIA 3ODDA 1UCYE 2C4FH 1A2CH 3GCHC 3SV8A 2GGVB 5E2OA 3A7TA 1TGNA 1O3BA 2BDIA 1DWDH 4CH2B 1HAHH 5FBEA 1FY4A 5F03A 6CHAB 3KEEA 1GPZA 2C8XB 2BVXH 4A7IB 1O2LA 3EE7A 3P95A 3F0OA 4DIIH 3O8DA 5TCCA 1QA7A 5CE1A 1SGFG 3GY4A 2IPHA 2QXJA 3PWBA 1F92A 1AVGH 4SGBE 4WJG2 1SQTA 3SU0A 1QA0A 2HOBA 2AH4X 2G55A 1CHOG 1UK2A 1LHGH 3DSGA 2P3FH 4ZXXH 2QGRA 3LT3A 2XYAA 3PTBA 3TJNA 4K5ZA 5ESBA 4Y71A 4LK4A 1VITH 1QRXA 2ESTE 1HAZB 1Y59T 1NFYA 1Q31A 3ENSB 1GI5A 3T29A 1C9PA 1MTNB 1RTLA 4CRAA 7KMEH 1D4PB 1P04A 1TLDA 3VGCB 5A09A 1IQEA 1MABB 1L4DA 2A7CA 1SL3A 3F6UH 3SHCH 3ZYDA 3SV9A 1G3CA 1XUGA 2ZU2A 4ABDA 1O3LA 1HJAB 2IJOB 1UTOA 1GBKA 1QBNA 1P2QA 3RDZA 1HAXB 4D76A 2BDGA 4X1RU 2A5AA 2A32A 2GZ7A 2OXSA 4UFFH 1T32A 3QO6A 2HRVA 2VNTA 4FUDA 3ZVEA 5EQQA 1GGDB 2RDLA 6CHAC 1HAGE 3T25A 2CMYA 2FOFA 1NRRH 4OM9A 3ZIAD 1V2WT 3FZDA 1GI1A 3QK1A 4MQAA 1C1OA 4FXGH 3GCTF 3BTWE 2ZWLH 1A3BH 3R3GB 1GHBG 1E37B 1E1RD 3R0FA 2ZCLP 1L1NA 3VXFH 3SU4A 1ZGVA 4I8GA 4A92A 2ZU1A 5A0AE 2YNAA 4YOIA 2TGDA 8KME2 4WH6A 3T28A 5F8ZA 1EOLA 3AK5A 4U01A 4FUJA 4GHQA 1QBOA 1TAWA 2A4GA 1SGEE 4R0IA 3GOVB 2M5TA 2FX4A 3GY7A 5DGJA 1GBFA 3RXEA 1KTTB 1AVXA 4X2VA 4F48B 4XOJA 1ELAA 1GJDB 1FZZA 2AS9A 1VKYA 2HGTH 1YCPK 4K8BA 1RD3B 2ZU5A 4ZAEA 1G2LA 1UO6A 1GBCA 4ZHMU 3SOSA 4ISIH 2G5VA 3FP6E 3UNQA 2OTVA 1P9UA 1KYNA 3CENA 4H42U 5HMAA 2J5UA 1UTJA 1V6DA 1YM0A 2OC8A 3LGIA 3TPIZ 5B6LA 1AVWA 3KQEA 4YXWD 1F5LA 3P8OA 1AWFH 3UB0A 3F9EA 5C0UA 3E90B 3DSPA 2BQ6B 2OP9A 4NFEA 4Q7ZA 1MKXH 4ABHA 1ZR0A 1DXPA 1ANEA 3MYWA 2H5DA 4GCHF 5EXMA 4Y10E 1Y5AT 2BXUH 1FPCH 1T4VH 2LP6A 2EQNA 5GNDA 4WY3A 2FYQA 2QXGA 1ELVA 1HAVA 4NA9H 1HJ9A 2GTBA 2O8TA 1AZZA 5BPEA 2OC7A 3RXTA 2Z3EA 4JYUH 1WYKA 1C9TA 2FOBA 3EA8A 2GCHG 2EC9H 4JK6A 1LTOA 5L30H 5DG6A 4IMZA 3H5CB 1GMHG 1S0QA 1C5VA 4B75A 2JKHA 1C2FA 1V2QT 1UVPA 2CF9H 2Z9IA 1SGNE 1EB2A 1A0HB 1L4ZA 1PPEE 4CBOA 1EZUC 4FUEA 1GJ8B 1GMCF 2FPZA 2BY7X 9LPRA 2Z9KA 1OWJA 1IQHA 2H6MA 1FDPA 2WZQA 1YPHC 3BTME 2QE7D 3I29A 3Q3XA 4CRFA 1SQOA 3SJ9A 1DOJA 5JBCS 1P2KA 1EKBB 4DGJA 5GCHG 1BJUA 1FY5A 5G4BA 2TGPZ 1SLVB 3TH4H 1AN1E 3LH3A 2Z3CA 3A80A 5T1VA 1FJSA 4XBCA 5CHAC 1FPHH 1P11E 1O32A 2BDCA 3SGQE 2D2DA 1PYTD 1TX6A 2GDDA 1GJCB 2Z94A 3NRLA 2R2WU 4UFEH 3ZZ3A 1JRSA 1W12U 4Q63A 3CNRA 1SGCA 1MTVA 5HGGA 3MH7A 3FO8D 3RXJA 2GD4B 3NUMA 3QDZB 4I8HA 2QF5A 1TIOA 2ZU4A 2OLGA 3RU4T 3UNSA 4IGDA 2AMDA 2BVRH 1V2VT 1QFKH 4D7FA 4X2WA 1XUFA 3UUZA 2Y7ZA 1GHAF 5C94A 2KX4A 3A84A 4YLQH 3PV4A 2BTCE 2QF0A 1V2UT 1S6FA 2W26A 4CR5A 1QJ1B 2HLDD 3ZV9A 3NZIA 3STJA 2XCFA 1O2GH 1SGQE 4ABFA 5HIYA 1SGPE 2Z7FE 2ZHQH 3CS7A 1GJBB 1Y3VA 1O5CB 2FP7B 1C5QA 3PWCA 1RRKA 4DJZB 3PV5A 1AY6H 1ZHPA 1D3PB 1FN6A 1P10A 3LC5A 4KP0A 2ZFTA 2F91A 1YC0A 2BQ7B 3VB3A 3FANA 3RXKA 1TPSA 3M35A 1AUTC 4DIHH 1O30A 2BDHA 4AFUA 4FVDA 3QN7A 5CMXH 3VGCC 2Z9LA 2KZ4A 1NY22 3M5MA 4AB9A 2ZPSA 2K8IA 1SOZA 3URCA 3RXPA 1O31A 1ANDA 4NIVA 1GJ5H 4F49A 2FO9A 2RG3A 4JMYA 3KQDA 4X6NA 1GVKB 4B2BA 1BA8B 2WHXA 1N1LA 3N7DA 3M3TA 1TMBH 3DCLA 1MBMA 1YPGH 3Q77A 1KIGH 2ZU3A 3QX5H 1TE0A 2HNTC 1SI5H 3RXBA 2QF4A 4RT1A 2VWLA 1QHRB 2BD8A 1K9OE 1YY3A 1HXEH 2AERH 2FOMB 1GI6A 1C5XB 2K0QA 1ESBA 4JCNA 1L1GA 2EI6A 1IQKA 5C1XA 1DY8A 2UUJB 3QGJA 3RXMA 2ZI2H 4WMEA 1C2JA 1FN8A 1O2MA 3FP7E 4UFDH 5BRRE 4GVUA 1C2GA 2ZQ1A 4P02A 2Y5GA 1O36A 7GCHG 3RUOA 5DO4H 3TNSA 5CHBA 2FI4E 4ESTE 1EP6A 3F9HA 1TX7A 1F5RA 2ZTYA 2O8MA 1HV7A 1ZZZA 1LQEA 3I77A 5DK1A 4FUFA 1CGJE 2KCPA 3UNRA 1W7XH 4GHTA 3B9FH 3CP7A 4WWYA 1TOCB 1VJAU 2OC1A 3P8NA 4ABIA 2ZDVH 2ZDLA 4LOYH 1SB1H 3VB4A 1DVAH 2TPIZ 4HFPB 3L6PA 5LPEA 1CHOF 3A7WA 1C5SA 1O2NA 4WH8A 2ZNKH 3W1EA 1EPTA 1TNHA 2BD5A 4JYVH 1C5NH 1FONA 1OP2A 2QAAA 3BTFE 2V0BA 1KDQA 2VGCC 3BTQE 2QA9E 3Q3YA 4INKA 4IN1A 2Z6BD 2K7XA 1BHXB 2PLXA 3BG4C 1GVZA 2PKSC 4KKDA 1MTNC 1TRYA 1SQAA 2SGEE 2F3CE 1QL7A 1S82A 5E0JA 1NRPH 3TK6A 1PPCE 3G01A 4HZHA 1M9UA 2CF8H 1GHXH 3FOAA 2B7DH 1KXCA 3LGVA 3P8GA 1BTYA 5T3HA 1BMNH 4AG1A 1EAWA 2XBVA 3PROA 1SFIA 1ZHRA 2BLWA 1NC6A 2KCOA 1DE7H 2CGAA 4MG3A 1P2MA 1AWHB 1K1JA 3KIDU 4D7GA 3BTTE 2FZZA 2IN2A 2HPPH 3SHAH 1P3EA 3NPSA 1H1BA 4X0WU 2XC0A 1G37A 2GKVE 2W6JD 1LO6A 4ZH8A 1XVMA 4BXWA 2Y82A 1IHSH 1RFNA 2VH0A 4NWLA 3AW0A 3ZVFA 1GI3A 2ZPQA 2QXHA 1OWHA 4A5TS 4YOGA 3ITIA 4J2YB 3SU1A 1CA0C 3SUGA 1QB1A 1O34A 4FUBA 1BMFD 1UCYH 2WPDD 1EAIA 3QUMP 4K2YA 5EGMA 1CHGA 4F4OC 1DWCH 2LIZA 1TGTA 1AUJA 1GBBA 5LH8A 1PPGE 5FPYA 5K0HA 5AVDA 1PPHE 4K1EA 2ZGXH 2ANYA 2OK5A 1L0ZA 3UIRA 1W2KH 2SGAA 5F6MA 3TJOA 3ZZDA 2FOGA 2QC2A 3A85A 4HGCA 4TWYA 1XMNB 2L74A 5HXFA 3MMGA 3V13A 5HKKD 1P2JA 2ODPA 1YCPM 1C1MA 1G2MA 1ZRBA 1VZQH 1JXPA 1PQ5A 1T8LA 3U9AH 3RM2H 4K1TA 4THNH 1O2WA 3MWIU 1B5GH 3H09A 3KYFA 3OE7D 1GI9B 4AX9H 1FAXA 2A2XH 4E7NA 1MZDA 2BMGB 1C1SA 2BDAA 2VH6A 2FI3E 2VIVA 4Q7YA 1UVTH 2J38A 3M5NA 3GCHB 1O3EA 5EJZA 2DE8A 2GX4A 3AAUA 2BY9X 2GCTB 2A1DB 1YBWA 2BM2A 4MPVA 5AHGH 5F53A 1GI4A 2F9UA 2VJ1A 2ZQ2A 1O3KA 2Z9JA 1DANH 3A88A 3FFGA 1MH0A 3ZVCA 3EYDA 1WOFA 2BD4A 1E34B 1DM4B 5IYTA 5KEDA 4X2YA 4MVNA 1UTNA 4ABEA 1NZQH 1OSSA 1EFRD 3TVJB 3KGPA 4ZKOU 3TK9A 1FV9A 4Y0ZE 1GHYH 4AOQA 3F2FA 2OUAA 3GDSA 1V2RT 1CGIE 1C2KA 2SGQE 2BX3A 2JETB 3P8FA 3VFEA 3U8RH 1GHAG 4NZQA 1YPJH 3GISB 3TNTA 1UK3A 1C5YB 2PGQB 1T4UH 2XTTB 3U8TH 1EPTC 1HDTH 1TB6H 4INLA 3SUDA 4U32A 2P8OC 1DWBH 4D8NA 2AIQA 2JH0D 1Y3WA 1ZPCA 1SC8U 4I8KA 4XE4A 3SORA 4MDSA 1TABE 2V3MA 4UEHH 2AMQA 2GVFA 1LQDB 4Q2KA 4JK5A 3BG8A 1HAIH 1AB9C 2JH5D 3LGYA 2BXTH 1P02A 2G00A 1O35A 1AB9B 4Z6AH 2A7HA 1VCWA 3RMLH 3DSOA 1S5SA 1S84A 1YLCA 1NRNH 2VVVA 2GV7A 2O8LA 3E0NB 8GCHG 1Z8GA 1MQ6A 3RU4D 2EI8A 3MO9A 1PYTC 3EBNA 5FAHA 3D23A 2V35A 3F2GA 4K69A 3GCTG 1O33A 1WTHD 1D3QB 1BOQA 1S81A 1NESE 3ZZ6A 1HAOH 1OWKA 1EJMA 1DUEA 1HYLA 1QL9A 4IW4E 3RMOH 2ZHDA 3UQOA 1QR3E 1CBWC 1JMOH 7GCHF 2WINI 5C67A 1GHWH 1GBTA 1ZJKA 2ILNA 3ZVBA 1S6LA 3GY2A 2FMJA 4I8LA 3LGUA 1OS8A 1S83A 3VXEH 2ULLA 5IDKA 1T8MA 1BTHH 3B8JA 4BANB 3SNCA 2XNDD 1P57B 4MPUA 2RDEA 1EB1H 1GI8B 1D3DB 2J4IA 3T27A 1UMAH 5ESTE 1MU8B 5DP3A 1Z6JH 1Y5BT 2BYAX 2KAIA 2WUBA 1J15A 1L1JA 1YKTA 1QBVH 4FU7A 2FLRH 2AYWA 3L3TA 2XBXA 2SFAA 1TNJA 1JWTA 1BBRK 1OKXA 3C1KA 3U28C 1A5GH 3NKKA 1ETSH 1DXWA 5EG4A 5LPRA 1NU7B 3LH1A 1Z1IA 3QTOH 3HK6B 3U1IB 2IPQX 3T5FH 4B74A 1IQLA 3PV2A 1GJ9B 3DD2H 4YT7H 3SJ8A 1GBEA 1ZSJA 1YPLH 4X2XA 2G4TA 1V2ST 4DCDA 4NWKA 3U1JB 4RN6A 3UFAA 3E3TA 3GICB 2KCAA 1E1QD 2XXLA 3MU4A 1IQIA 2C3SA 4X8UH 1XUHA 3ATWA 1BUIA 2FODA 2Z3DA 2PKAA 2RA0A 4ABGA 3AAVA 3F68H 4MNVA 2PKSB 2J98B 3KHVA 3RXDA 3GCOA 4I31A 3M3VA 1YPEH 1H4WA 2BHGA 3SJKA 3RXHA 4CRBA 1W0ZU 3U98H 2D1JA 1GWAA 1K2I1 1Z8RA 2ZFSA 2ODQA 1C1PA 3MHWU 3BTGE 1C2IA 2ANMH 3TJVA 5A8ZA 1ZHMA 3EE0B 2W5EA 1K1NA 1SPJA 4ABAA 2ZHFH 4XBBA 2SNVA 1NRSH 3EAJA 1V3XA 2B9LA 1W13U 5B6OA 1CT0E 4NIWA 1BRUP 1VITG 3LIWA 2FYRA 1GJ4H 1EZSC 3UWIA 1VGCC 2HVYB 2ZGHA 3RC6A 3AVZA 3SNBA 2ANKH 3OTPA 1LVBA 2Y80A 4TT3D 1O2RA 2F9OA 3SQEE 1K1OA 3GYLB 2A2QH 4RT0A 2F9NA 3HGNA 3HGPA 2YOLA 5KECA 2DUCA 1V2MT 1C2LA 4IC5A 4INHA 1H9IE 4OS2A 1GBAA 1UW7A 2R0LA 2ZGCA 1TX8A 2ALPA 1A3EH 3D49H 1GMCG 2OBOA 1YWUA 1UHBB 4Y7AA 1ESAA 1SKYE 2NU0E 4BTTB 3TITA 2BZ6H 4VGCC 5DP7A 1BQYA 5FX5A 1AMHA 4NA8A 3UR6A 3RXVA 5EXLA 1MD8A 1O38A 1MKWK 1MKXK 1LDTT 3E8LA 5EXNA 5A0CA 1G36A 5AFZH 2D26C 1NM6A 1XXDA 2P8OB 3BTKE 2UWLA 2V6NA 3T62A 3A7ZA 1ARBA 2WPJS 2ZHEH 2ZECA 3BV9B 4A6LA 3OSYA 5FXLA 3TIUA 1GHVH 1HXFH 4CREA 1O3MA 3FP8E 1QB9A 1ZTLA 4TY7A 3Q00A 1SR5C 2OQUA 1HIAA 4Y8YA 1TPOA 2ZEBA 3URDA 3M5LA 1P2OA 1H8ED 5E2PA 1O5DH 1Z71A 2PTCE 2P94A 3ZZ7A 1O2VA 3N99A 2BX4A 1C4V2 1C5UA 1GDUA 1BDAA 2PR3A 1FAKH 3UY9A 4XD7D 4XBDA 3WY8A 1IQMA 1ELGA 2B8OH 4E05H 5L2YH 3MU5A 3O8RA 3FVFB 1F0SA 3A7YA 1V2NT 2CK3D 2I6SA 3HKIB 2GJGA 1QQUA 3EGKH 2WPLS 1XVOA 2C8YB 2P59A 3K6YA 2ZDMA 2JETC 4QT8C 1D6RA 2FLBH 1F0TA 3M36A 1V2JT 4FU8A 4Q4LA 4ZHLU 1MD7A 1JRTA 3ZZ5A 3VB6A 1F5KU 1C5ZB 4E06H 2C8WB 1SGTA 1TOMH 3RC4A 1O3FA 4OS5A 3UAIC 4ZKRU 1DS2E 5H4IB 3RXUA 1IAUA 1PFXC 3DA9B 4H6TA 1MZAA 1GMHF 2H9HA 1HLTH 5FPTA 4DURA 3JZ1B 1DFPA 3D65E 4Y8XA 1AZ8A 1JIMA 1KTSB 2ZHWH 4WXVA 2W6ID 1IQGA 2SGDE 2WPHS 2P3TB 1RJXB 2AEIH 4X1SU 5DSFA 3DUXH 4ZCNA 2YNBA 1Z8IB 4JZIA 2JH6D 2NU4E 3SV2H 3S7HB 1TFXA 1ARCA 1MBQA 4GCHG 4XRNA 3SUEA 4K1SA 4BAQB 4BTIB 3D62A 1TONA 1YPHE 3MTYA 4MNXA 1RIWC 4Y0YE 1SLXB 2HPQH 8LPRA 4ZUHA 1EPTB 5FL7D 1ZYOA 1XXFA 4CR9A 5I46H 2Y5FA 4K8YA 1GJ7B 4TWWA 1AFQB 1OP8A 1NS3A 2W7UA 2ZGJA 2QCYA 3GY8A 2XRCA 4IBLH 1VJ9U 4X1QU 1C1TA 1THPB 1TBQH 3BEUA 5JYIA 1ETTH 7ESTE 3VG8A 1WV7H 2GV6A 2PHBA 3ODFA 1N8OC 1E36B 1SG8B 2TIOA 1H8IH 3WWFA 1SGFA 5C3NA 2F83A 4BOHA 5JBBS 3S9CA 4TYDA 3A7XA 2ZPRA 4ISNA 1RS0A 1SVPA 2G51A 3KQCA 4AG2A 2C93B 2ZFFH 5AF9H 1ELFA 2ZGBH 3GY3A 1SHHB 4O9VA 3FN8A 1OX1A 2EEKA 1C2MA 1OOKB 5J4SA 1SOTA 3LDXH 3MOCA 6GCHG 1PJPA 1TBRH 1CBWB 1EJNA 8ESTE 1Y5UT 2VVUA 2PUQH 1NO9H 4PROA 2ZDNA 4ASUD 3A89A 4BAMB 2TRMA 2XNIA 2KR7A 1GI7B 1D6WA 1XUJA 1Z6EA 1NFXA 4I33A 1JIRA 4HG6A 2K1QA 3TH2H 3SU2A 3UOPA 5EW2H 5AFYH 1BRAA 2BB4A 2JDID 1RGQA 1BCUH 1GBHA 1C1RA 3VB5A 1EX3A 1BZXE 1JOUB 2R9PA 1DICA 2TBSA 2AGGX 1GBIA 4B71A 1UK4A 1UTLM 3TGKE 1K0HA 1J14A 2PGBB 3SQHE 1O2HA 5DP9A 4JZEH 3LU9B 1A0LA 3HATH 1QNJA 5IK2D 3NWUA 2F9BH 1MTWA 1P0SH 3K9XB 2J9NA 2CV3A 4OS6A 1ELTA 1TALA 3RXOA 2FESH 4GAWA 1UHBA 1GCTC 2GP9B 1SGDE 2F9VA 1H8DH 2ODYB 2F4LA 3MO6A 5F8TA 1UVUH 4LZ4B 5C0TA 3K2UA 4ZHAA 4DOQA 4RKJB 4DT7B 3SJOA 3MI4A 1W0KD 4X1PU 1L2EA 1QZ8A 1Q2WA 1P12E 4WVPE 3GY5A 1HJ8A 1NROH 3SU3A 2VIPA 1PPZA 2R0KA 1ZSLA 3GDVA 2RFKC 3MU8A 1G30B 4H6SB 1XX9A 5E0HA 1WAYB 1A46H 2Q1JA 5DN6D 1G9IE 5ABWA 4CH8B 3S69A 2P93A 2VVCA 4OS7A 2J95A 1B0FA 1BTPA 3FKSD 5CDFE 2NU1E 3Q76A 5C17A 1ORFA 4K60A 4JZFH 5ETXA 4A1TA 4UE7H 1BMAA 1GI0A 2A4OA 2PUXB 1ZPZA 3N7EA 1FMGA 3PO1B 1O3CA 1Y3YA 3ZYEA 2GT7A 2HNTE 1TYNA 2H1UA 5DPAA 1QTFA 1VGCB 3HPTB 3MQKC 1HFDA 1FXYA 3ZVGA 1CSOE 3S9BA 3QZRA 3KF2A 3GS9A 4KTCA 4GSOA 1F2SE 1YLDA 2AMPA 5LGOA 3EA7A 3RXSA 2LELA 2P95A 2EY4C 2VU8E 1HJAC 1KLTA 4Q80A 3A8CA 4RSPA 5GPIB 4JZ1A 5EQRA 1P09A 1WQVH 1VCQA 1WSSH 4MPXA 1YP9A 1BJVA 4OS1A 1N6XA 1BBRE 3A81A 3SO3A 4MNYA 1HRTH 1C1UH 3NCLA 3H7TA 3OEHD 3UREA 1KLIH 1O5AB 1TNKA 1V2PT 4ZKNU 1AE8H 4KGAA 1MU6B 1SGRE 1DSUA 2GDEH 2H5CA 2FX6A 1S85A 4I32A 3BG4B 1TNGA 1O3OA 2J94A 4CRGA 3MNSA 2G81E 1ZGIA 1WDIA 1YGCH 3MH4A 2BZAA 3SZEA 1IQNA 3DT0H 3A83A 1C2DA 2RCEA 4I8JA 4Y76A 1AHTH 4IC6A 3RU4E 1AFQC 4B6EA 3SBKA 2AGIX 1OYQA 1A5IA 4X8VH 1DUAA 1OP0A 2CJIA 3U8OH 3Q3KA 1SHYA 1E0FD 2WUCA 3PB1E 1HAPH 1C1NA 2WYJA 2XWAA 2Y5HA 1WU1A 5EU8A 4AZ2B 1C5PA 1N8OB 5EIYA 2STBE 5K7RA 1HB0B 1ABIH 2QY0B 5EJ1A 3RMMH 4I7YH 1THRH 2Y81A 2AIPA 5GDSH 2J34A 1GJ6A 1CA0B 1K21H 1UJ1A 4UONA 2D8WA 3SGBE 1G3EA 5CHAB 2FOEA 3HK3B 3A8DA 5T6DA 4ZXYH 3C27B 3RP2A 3ZVAA 5HM9A 1ZOMA 2LNCA 1O2IA 4AB8A 1EZXC 1K1PA 2A5KA 3UTUH 1KLJH 4Z0KA 1BTUA 1LKAA 1KSNA 1O3IA 3PM3A 3K65B 1Y3UA 5J4QA 1B0EA 2ALVA 1OYTH 1RXPA 4LXBH 4RKOB 1W7GH 1DSTA 2BLOA 3RXAA 3A82A 1NFWA 3LOXA 5JBTA 1T8OA 1YCPH 1KMHB 3LGWA 3LJJA 4AGKA 3SNEA 3DFLA 4E7RG 1V2OT 4OGYA 5JB9S 1NPMA 2BD2A 1EATA 4O3UA 1DWEH 5C1YA 1B7XB 1NFUA 1O2TA 4ZKSU 4BXSA 3OU0A 4X6PA 5A0BA 3A87A 4HTCH 1OWIA 1UCYK 1WTGH 1XKBC 1UTPA 4ACBA 3SYJA 1PQ8A 3OYPA 4NG9H 1O3NA 4AC9A 2XBWA 1ZRKA 1JBUH 1VITF 2KCYA 1TNLA 5C5NA 2H9EH 2ZKSA 1LHEH 5E8EH 2BY6X 3ZZ9A 1ELEE 2GCTC 4MNWA 1SGYE 1SMFE 3KN2A 1YYY1 2I6QA 1O5GH 3F9GA 1BRCE 2A0QB 2CN0H 3RM0H 2ZFQH 1FY1A 4O97A 1GG6C 1BTWA 4FUIA 2FDAA 3A86A 1ZMJA 1F0RA 4NFFA 4DW2U 5DJ7A 1AKSA 1GGDC 2HWLB 5GJ4B 1INCA 4AFSA 4Y6DA 2AHME 5JDUB 3LJOA 1C5MD 3M7TA 2JIZD 3M61U 1T7CA 3BTHE 1O2YA 3QTVH 2A7JA 2WV9A 5I25A 1ZLRA 1ZMLA 1LVYA 3DFJA 1COWD 3N7OA 5L6NH 1AD8H 4NCYA 4VGCB 3PO1C 1UTKA 2QYIA 1ZJDA 4YZUA 4FU9A 2W3KA 1N6YA 1TGSZ 4M7GA 4TSFD 5FHTA 1GHZA 3RXQA 5C5OA 3MNXA 1V2LT 2G52A 3GCNA 2Q6GA 2EI7A 3RLYH 1O2QA 1EUFA 3W94A 2STAE 1TQ7B 1TA2A 3M5OA 4YESB 4XDEA 3QLPH 4R8TB 1O5EH 5EW1H 1GI2A 2Z9GA 1FNIA 1O3DA 4J1YA 1AFEH 4BTUB 5JBAS 2Y6TA 3RXCA 1C5TA 3A8BA 1RTKA 2VIOA 1XKAC 2ZIQH 4AYVB 2ZCHP 2CHAC 3P70B 3SI3H 1NU9A 4CHAC 1QURH 3EQ0H 1PPFE 2TGAA 1K1MA 1P05A 3M7UA 6ESTA 2THFB 3OAAD 1T31A 5DP8A 5FCKA 3MNBA 4NSYA 1ESTA 3GDUA 1MMJN 2W3IA
chains in the Genus database with same CATH topology
3QWCH 1FUJA 3UPEA 1C4Y2 1CO7E 4YO9A 1E38B 1ZMNA 1TMTH 2GZ9A 1AGJA 3O8CA 2VIQA 4B73A 1O0DH 1TPPA 4A1XA 3ATIA 1NRQH 1O3JA 2QV1A 2FWWA 2NU2E 1O39A 1ZSKA 1O37A 4B2CA 3K6ZA 2HLCA 3BTDE 4ABJA 1LPGB 1UVSH 1QL8A 3P17H 5DKMA 1DT2A 4WMFA 1ELBA 1GVLA 3RXGA 3ELAH 2PSYA 2OD3B 3ESTA 3OY6U 1P8VC 4O03A 1CQQA 1TA6A 5EODA 3SW2B 3E6PH 3T2NA 2PSXA 3FZZA 5FCRA 2NU3E 1GL0E 1DITH 2ZDKA 3S7KB 1TBZH 1C5RA 3T26A 1TGCA 4U2WA 3SV7A 3ATMA 4IMQA 3TLOA 1TGBA 1GDQA 2GT8A 1O2XA 4B76A 1NTPA 3OTJE 1NN6A 1SSXA 5L2ZH 3RXRA 5EPNA 1IQFA 1LVOA 4CRCA 4HI3A 1AKSB 1QCPA 3S0NA 1QJ6B 1P2NA 3UR9A 1TMUH 1LPZB 2ZA5A 3STIA 1C1VH 1W14U 1MAYA 1LKBA 2OCVB 7LPRA 1HPGA 5C20A 2GMTC 2QN5T 1UTMA 3PMAB 2ZFRH 2ZTZA 4X6OA 1VCPA 5E0GA 3ATKA 3E0PB 2GMTB 1IHTH 5EOKA 2BVSH 2HVXA 3F1SB 4NGAH 1XUIA 2ANWA 3I78A 1GBMA 2AGEX 3FAOA 1FI8A 2VGCB 2RA3A 5PTPA 1P01A 2SNWA 2HNTF 5SGAE 2BY5X 1F0UA 1P06A 4UD9H 2ZFPH 2TGTA 4Y79A 4BNRA 5A2MH 1C4U2 5FX6A 2NWNA 2BQWB 4JYTA 1HUTH 2BDBA 3SU6A 4TPIZ 3BSQA 1EP5A 2ZTXA 1WCZA 2BOKA 2G4UA 4DY7B 3EA9A 2CHAB 4CHAB 5A8XA 2EA3A 4LZ1H 1SLUB 3MO3A 1LHCH 2Q6FA 1Q3XA 1K22H 1IOEA 2ZO3H 1CVWH 1U6QA 2FS9A 3O8BA 3VB7A 3E16B 3MH6A 4ASHA 1QRZA 2HALA 2R3YA 1Z8JB 4CRDA 1C5WB 1MCVA 1Y8TA 2XC4A 3BIUH 3RXFA 1C2EA 3SNDA 3PLBA 3MU1A 1CGHA 1ELCA 3HKJB 1Z1JA 5FPSA 2CXVA 4GPGA 1GJAB 4D9RA 1A61H 1OXGA 1WQSA 3NXPA 3PMJA 4B1TA 1EAUA 1YF4A 3KCGH 1AU8A 3ZZBA 1O5FH 2GZ8A 1EAXA 2A31A 1ELDE 2OINA 4UFGH 1WUNH 3LGTA 1ACBE 1G3DA 4Y7BA 1ZTKA 4NIYA 1E35B 3L33A 3MU0A 5GCHF 4BAKB 5DP6A 1BMLA 2XBYA 1D3TB 1HCGA 3LONA 1HBTH 1THSH 4JZDH 3V0XA 4AN7A 1O5BB 1CT4E 1GMDF 1ID5H 4UDWH 1GDNA 4BAHB 2BD7A 4AFZA 2PFEA 3V7TA 2H9TH 3AW1A 4TPYA 3A8AA 2PV9B 3ZZ8A 4D9QA 4OGXA 1QQ4A 1W0YH 2A4QA 3ATLA 2BY8X 4DVAU 1TPAE 2FOAA 3RLWH 2A5IA 3SZNA 1C5OH 4FUCA 2SGFE 6GCHF 2QXIA 3RC5A 3IG6B 4WF8A 4NZLA 1YPMH 2BDYA 3PYHA 3M3SA 1J17T 2FTLE 2A45B 2FM2A 1ABJH 3V12A 3UQVA 3DHKH 1P03A 1MQ5A 3IWMA 1D9IA 1GBDA 1EASA 1QY6A 2BD9A 4Y11E 3LC3A 2R3UA 2QF3A 4YTAA 1IQJA 2V3OH 1W3CA 1K1IA 3KL6A 1O3AA 4IN2A 4MTBA 3S9AA 3RXIA 4KELA 4MPWA 1EOJA 1XM1A 1FIZA 1HIAB 2R2MB 1AI8H 3SU5A 4A1VA 4WMDA 1EQ9A 2AFQB 3VPKA 1O2KA 2LPRA 1FLEE 1AQ7A 1LPKB 3ZZAA 1DY9A 1J16A 1O3GA 2ZDAH 2G5NA 5TCAA 2O9QA 1OWDA 1V2TT 1LCYA 3TU7H 1O3PB 1GCTB 3A7VA 2ZF0H 2XCNA 3QZQA 3GYMA 2C90B 5JPMH 4NIXA 2F9PA 5JB8S 1UTQA 3SGAE 1X7AC 1EJAA 2O8WA 2BLQA 3VEQB 1TNIA 1HAYB 5T6GA 3IITA 2BOHB 4SGAE 5TJXA 1KXDA 1OWEA 4XFQA 2FIRH 3LPRA 4YLUA 3SNAA 1BITA 1QGFA 4YOJA 2WPIS 5T6FA 2J92A 1DLEA 1A7SA 3BTEE 5EPYA 2PWXA 4X8SH 1BIOA 1O2PA 5FBIA 1RTFB 1AE5A 2O8UA 4ISHH 2P3UB 5GWZA 1MAXA 1S6HA 3BIVH 4IS5A 8GCHF 1FY8E 3TK5A 3KNXA 1PQAA 4BAOB 2Y7XA 1FY3A 1ETRH 1A1RA 3ZVDA 1P2IA 1BT7A 1YPKH 2Q6DA 2FOHA 3BEIB 1HGTH 2FXRA 3W95A 3GY6A 1MUEB 2QIQA 1ZTJA 2DE9A 4GLYA 1PQ7A 2OQ5A 3PTNA 1O2JA 1BRBE 4AORA 2ASUB 3UOUA 1WBGB 1O2OA 1BB0B 3MFJA 1SLWB 2PKAB 4X6MA 4Y8ZA 5GXPA 3OY5U 3KQBA 3M37A 2XC5A 1EZQA 4FUGA 1K1LA 1BHXF 1CE5A 1ANCA 2A4RA 4CBNA 1XUKA 2PTNA 1Z7KA 2UWPA 4FUHA 2WV5A 1CU1A 1DX5M 1KXEA 2ZC9H 5A8YA 2ZP0H 4ZROA 3BN9A 1LHFH 4MLFB 2FS8A 3BEFB 2FOCA 1J8AA 2FI5E 2GCHF 2VINA 3LKWA 1MKWH 1K28D 1BBRH 4ZMAH 2VIDA 1GBLA 1W10U 1UVOA 4NSVA 1P9SA 2UUYA 1LVMA 5DP4A 4ABBA 3F9FA 2W7SA 1G3BA 3UWJH 5DP5A 2V3HH 4U30A 1H9LB 5HYOA 1QIXB 2WPMS 2ZZUH 3V3MA 4KTUA 1GCDA 2UWOA 4FVBA 1QJ7B 4AGJA 1BTZA 2J2UA 1GG6B 3SUFA 4KTSA 1GBJA 1C1WH 3SV6A 1C1QA 1S0RA 1VR1H 1T8NA 1SGIB 4O3TA 1QRWA 1MTSA 1KXAA 1TQ0B 2G8TA 3MH5A 3P6ZB 1HNEE 4XSKU 2VWNA 4TY6A 1KY9A 2UUFB 2WPKS 4K3JA 1PPBH 3P92A 2VWOA 2XW9A 4ISLA 1V2KT 1CT2E 3AASA 2VIWA 1P3CA 1SBWA 5HM2A 2WYGA 3RXLA 1NT1A 3TH3H 1H9HE 9ESTA 1O2ZA 3PMHB 1TRNA 5C1UA 1AO5A 4AYYB 1GMDG 2ZCKP 3H7OA 2BLVA 1TRMA 1Y3XA 1DLKB 3BF6H 1DPOA 1KXFA 2C8ZB 4B2AA 1MTUA 1ANBA 2FTMA 6LPRA 2XWBI 4OS4A 2KAIB 4X1NU 3CS0A 1W8BH 1SFQB 3TGIE 1O2SA 1OPHB 1LMWB 2H2ZA 3MNCA 3E91A 3SN8A 4ISOA 1EXFA 3U69H 5GIBA 2BD3A 3PLPA 4AFQA 1FIWA 1HAVB 3QGNB 2VWMA 2FEQH 1J9CH 2WV4A 3TGJE 5F8XA 2VB0A 5LPFA 4NA7A 4Q7XA 1A5HA 1LHDH 3ZZ4A 3SI4H 1O3HA 3M7QA 3JZ2B 1DDJA 3NK8A 1A4WH 2SGPE 3E1XB 1BMMH 3ZV8A 4GUXA 2IOTA 2UUKB 3EDXB 5C2ZA 1CA8B 5EQSA 2P16A 1BTXA 1RIWB 4DG4A 1MCTA 1KXBA 3PLKA 1GL1A 4YM9A 1AIXH 3OX7U 3B23B 4H4FA 3ZZCA 4X8TH 1TWXB 2OBQA 1ZPBA 1O2UA 1FQ3A 3PMBB 1G32B 2ZG0H 1GHBF 2PW8H 2OC0A 2B5TB 1W11U 1QB6A 4WXIA 1KDQB 4YT6H 1A0JA 1C2HA 2B0FA 3RMNH 1C5LH 1F7ZA 3TJUA 3SJIA 3ODDA 1UCYE 2C4FH 1A2CH 3GCHC 3SV8A 2GGVB 5E2OA 3A7TA 1TGNA 1O3BA 2BDIA 1DWDH 4CH2B 1HAHH 5FBEA 1FY4A 5F03A 6CHAB 3KEEA 1GPZA 2C8XB 2BVXH 4A7IB 1O2LA 3P95A 4DIIH 3O8DA 5TCCA 1QA7A 5CE1A 1SGFG 3GY4A 2IPHA 2QXJA 3PWBA 1F92A 1AVGH 4SGBE 4WJG2 1SQTA 3SU0A 1QA0A 2HOBA 2AH4X 2G55A 1CHOG 1UK2A 1LHGH 2P3FH 4ZXXH 2QGRA 3LT3A 2XYAA 3PTBA 3TJNA 4K5ZA 5ESBA 4Y71A 4LK4A 1VITH 1QRXA 2ESTE 1HAZB 1Y59T 1NFYA 1Q31A 3ENSB 1GI5A 3T29A 1C9PA 1MTNB 1RTLA 4CRAA 7KMEH 1D4PB 1P04A 1TLDA 3VGCB 5A09A 1IQEA 1L4DA 2A7CA 1SL3A 3F6UH 3SHCH 3ZYDA 3SV9A 1G3CA 1XUGA 2ZU2A 4ABDA 1O3LA 1HJAB 2IJOB 1UTOA 1GBKA 1QBNA 1P2QA 3RDZA 1HAXB 4D76A 2BDGA 4X1RU 2A5AA 2A32A 2GZ7A 2OXSA 4UFFH 1T32A 3QO6A 2HRVA 2VNTA 4FUDA 3ZVEA 5EQQA 1GGDB 2RDLA 6CHAC 1HAGE 3T25A 2CMYA 2FOFA 1NRRH 1V2WT 3FZDA 1GI1A 3QK1A 4MQAA 1C1OA 4FXGH 3GCTF 3BTWE 2ZWLH 1A3BH 3R3GB 1GHBG 1E37B 3R0FA 2ZCLP 1L1NA 3VXFH 3SU4A 1ZGVA 4I8GA 4A92A 2ZU1A 5A0AE 2YNAA 4YOIA 2TGDA 8KME2 4WH6A 3T28A 5F8ZA 1EOLA 4U01A 4FUJA 4GHQA 1QBOA 1TAWA 2A4GA 1SGEE 4R0IA 3GOVB 2M5TA 2FX4A 3GY7A 5DGJA 1GBFA 3RXEA 1KTTB 1AVXA 4X2VA 4XOJA 1ELAA 1GJDB 1FZZA 2AS9A 2HGTH 1YCPK 4K8BA 1RD3B 2ZU5A 4ZAEA 1G2LA 1UO6A 1GBCA 4ZHMU 3SOSA 4ISIH 2G5VA 3FP6E 3UNQA 2OTVA 1P9UA 1KYNA 3CENA 4H42U 5HMAA 1UTJA 1V6DA 1YM0A 2OC8A 3LGIA 3TPIZ 1AVWA 3KQEA 1F5LA 3P8OA 1AWFH 3F9EA 3E90B 2BQ6B 2OP9A 4NFEA 4Q7ZA 1MKXH 4ABHA 1ZR0A 1DXPA 1ANEA 3MYWA 2H5DA 4GCHF 5EXMA 4Y10E 1Y5AT 2BXUH 1FPCH 1T4VH 4WY3A 2FYQA 2QXGA 1ELVA 1HAVA 4NA9H 1HJ9A 2GTBA 2O8TA 1AZZA 5BPEA 2OC7A 3RXTA 2Z3EA 4JYUH 1WYKA 1C9TA 2FOBA 3EA8A 2GCHG 2EC9H 4JK6A 1LTOA 5L30H 5DG6A 4IMZA 3H5CB 1GMHG 1S0QA 1C5VA 4B75A 2JKHA 1C2FA 1V2QT 1UVPA 2CF9H 2Z9IA 1SGNE 1EB2A 1A0HB 1L4ZA 1PPEE 4CBOA 1EZUC 4FUEA 1GJ8B 1GMCF 2FPZA 2BY7X 9LPRA 2Z9KA 1OWJA 1IQHA 2H6MA 1FDPA 1YPHC 3BTME 3I29A 3Q3XA 4CRFA 1SQOA 3SJ9A 1DOJA 5JBCS 1P2KA 1EKBB 4DGJA 5GCHG 1BJUA 1FY5A 5G4BA 2TGPZ 1SLVB 3TH4H 1AN1E 3LH3A 2Z3CA 3A80A 1FJSA 4XBCA 5CHAC 1FPHH 1P11E 1O32A 2BDCA 3SGQE 2D2DA 1PYTD 1TX6A 2GDDA 1GJCB 2Z94A 2R2WU 4UFEH 3ZZ3A 1JRSA 1W12U 1SGCA 1MTVA 5HGGA 3MH7A 3RXJA 2GD4B 3NUMA 3QDZB 4I8HA 1TIOA 2ZU4A 2OLGA 3RU4T 3UNSA 4IGDA 2AMDA 2BVRH 1V2VT 1QFKH 4D7FA 4X2WA 1XUFA 3UUZA 2Y7ZA 1GHAF 3A84A 4YLQH 3PV4A 2BTCE 2QF0A 1V2UT 1S6FA 2W26A 4CR5A 1QJ1B 3ZV9A 3NZIA 3STJA 2XCFA 1O2GH 1SGQE 4ABFA 1SGPE 2Z7FE 2ZHQH 3CS7A 1GJBB 1Y3VA 1O5CB 2FP7B 1C5QA 3PWCA 1RRKA 4DJZB 1AY6H 1ZHPA 1D3PB 1FN6A 1P10A 3LC5A 4KP0A 2ZFTA 2F91A 1YC0A 2BQ7B 3VB3A 3FANA 3RXKA 1TPSA 3M35A 1AUTC 4DIHH 1O30A 2BDHA 4AFUA 4FVDA 3QN7A 5CMXH 3VGCC 2Z9LA 1NY22 3M5MA 4AB9A 2ZPSA 1SOZA 3URCA 3RXPA 1O31A 1ANDA 4NIVA 1GJ5H 4F49A 2FO9A 2RG3A 4JMYA 3KQDA 4X6NA 1GVKB 4B2BA 1BA8B 1N1LA 3M3TA 1TMBH 1MBMA 1YPGH 3Q77A 1KIGH 2ZU3A 3QX5H 1TE0A 2HNTC 1SI5H 3RXBA 2VWLA 1QHRB 2BD8A 1K9OE 1HXEH 2AERH 2FOMB 1GI6A 1C5XB 1ESBA 4JCNA 1L1GA 2EI6A 1IQKA 5C1XA 1DY8A 2UUJB 3QGJA 3RXMA 2ZI2H 4WMEA 1C2JA 1FN8A 1O2MA 3FP7E 4UFDH 5BRRE 4GVUA 1C2GA 2ZQ1A 2Y5GA 1O36A 7GCHG 3RUOA 5DO4H 3TNSA 2FI4E 4ESTE 1EP6A 3F9HA 1TX7A 1F5RA 2ZTYA 2O8MA 1HV7A 1ZZZA 1LQEA 3I77A 5DK1A 4FUFA 1CGJE 3UNRA 1W7XH 4GHTA 3B9FH 3CP7A 4WWYA 1TOCB 1VJAU 2OC1A 3P8NA 4ABIA 2ZDVH 2ZDLA 4LOYH 1SB1H 3VB4A 1DVAH 2TPIZ 4HFPB 3L6PA 5LPEA 1CHOF 3A7WA 1C5SA 1O2NA 4WH8A 2ZNKH 1EPTA 1TNHA 2BD5A 4JYVH 1C5NH 1FONA 1OP2A 2QAAA 3BTFE 2V0BA 1KDQA 2VGCC 3BTQE 2QA9E 3Q3YA 4INKA 4IN1A 2Z6BD 2K7XA 1BHXB 2PLXA 3BG4C 1GVZA 2PKSC 4KKDA 1MTNC 1TRYA 1SQAA 2SGEE 2F3CE 1QL7A 1S82A