2DUHA

Crystal structure of a green fluorescent protein variant s65t/h148n at ph 9.5
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
225
Chain Sequence
SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSNNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title Ultrafast excited-state dynamics in the green fluorescent protein variant S65T/H148D. 1. Mutagenesis and structural studies.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Luminescent protein
total genus 65
structure length 225
sequence length 226
ec nomenclature
pdb deposition date 2006-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 2duhA00
2DD9A 2FWQA 3CFFA 3DQJA 3O78A 2A47A 3P8UA 3GJ1A 4TZGA 4ZF5A 2DUHA 3OGOA 4Z4MA 3SSKA 1KYSA 4ZB1A 3LSAA 1EMBA 1MYWA 4ZIOA 3AKOA 4R6DA 3EVPA 4IK1A 4DXMA 3NT9A 5F9GA 1GFLA 5DQBA 2WURA 4W7RA 5FVFA 4W77A 4UTSA 4P1QA 2YDZA 4OGSA 4H3MA 2YE1A 3O77A 2C9IA 5DPGA 4W7DA 3UFZA 5FVIA 3DQ1A 4W7EA 4Q9WA 3SVCA 3U0NA 3DQ7A 3BXAA 2H5RA 1JC1A 3TMRA 3E5WA 4J89A 4KW4A 5HZUA 2H8QA 4W73A 4EN1A 2EMDA 4KF4A 3SVSA 3W1CA 4W6BA 3ST4A 3NEZA 4HQ8A 2QLIA 3E5VA 5LTPA 2AWLA 2GW4B 4Q7RA 3EK4A 4DXPA 2AHAA 1Q4AA 2ICRA 5HZOA 2EMOA 3DQ3A 4AS8A 5BTTB 3CBEA 3GEXA 5HGEA 5H88A 2AWJA 2A56B 2YFPA 3PJBA 3SG7A 4W6UA 5EXUA 1Q4EA 1MOUA 4EDOA 3EK7A 1B9CA 3ZUFA 4JFGA 2G2SB 3AI5A 3U0KA 2C9JA 3BX9A 1XMZA 2G16B 4H48A 2BTJA 5J2OA 3WLDA 4LQTA 3RWAA 4W6KA 2HJOA 4W6FA 3DQKA 1EMLA 4LJBA 5DU0A 4JC2A 2HQKA 4W6NA 4LJDA 4L1IA 4BDUA 3PJ7A 2G6XA 5EB6A 2OJKA 2ZO6A 5EJUA 3SVUA 1G7KA 4W69A 3ZULA 1EMMA 1CV7A 1HUYA 2B3PA 4XL5A 4R6BA 1Z1QA 2PXSA 4ORNA 2V4EB 2WISA 3H1OA 2DD7A 2H5QA 3U8AA 1ZUXA 2Z6XA 3BXBA 1EMFA 3EVRA 4IK8A 2WHTA 4DXQA 3KCTA 3LF3A 4KPIA 4GF6B 2ZMWA 4LJDC 2PXWA 4N3DA 1RMOA 5H89A 3WLCA 2AWKA 2GX2A 3U8CA 5DTYA 2B3QA 2OGRA 4W6CA 1KYRA 1EMGA 4IK4A 1XSSA 3ED8A 4HQCA 5DRGA 4W6HA 5DRFA 1OXDA 4W6MA 4XOWA 2Q57A 1QYQA 3SVDA 4IK9A 4W7FA 4W6TA 4XGYA 2HQZA 3SSPA 3LVAA 1ZGQA 4TZAA 3U0MA 2QLGB 1JC0A 4H3NA 4U2VA 3DQHA 2V4EC 2Q6PA 4W7XA 2Z6ZA 1QYOA 1YZWA 4W6DA 4RYSA 2VVIA 1EMEA 2YE0A 5AQBB 4W7CA 4ZF4A 1S6ZA 4XOVA 2A46A 3PIBA 4HQ9A 4LW5A 1QXTA 3DQIA 4OJ0A 1JBYA 2GX0A 4GESB 2IB6A 1YJ2A 4OQWA 3VK1A 5BQLA 3CFAA 3DQMA 4Q9XA 2Z6YA 2VADA 2QRFA 3SSTA 5LK4A 4EULA 5EB7A 3BXCA 4NWSA 3LS3A 3I19A 4DXOA 4KAGA 4KF5C 3DQLA 3DQUA 3DQ5A 1RMPA 2OTEA 2FL1A 2H5PA 2O2BA 3RWTA 1GL4A 4JF9A 2G6YA 5DQMA 3DQ9A 1Q73A 3DQNA 2POXA 4PPJA 1HCJA 3WCKA 5DPIA 3SG3A 3CB9A 1W7UA 2DUIA 1QYFA 2G5ZB 3DPZA 1XQMA 1Q4CA 4OHSA 4Q7UA 2Y0GA 3GB3A 2RH7A 5BTTA 1YJFA 5KTGA 3DPWA 2O29A 2QZ0A 3EVUA 3SSHA 3NEDA 3PJ5A 3NF0A 4KGEA 2AH8A 2GW3A 4GOBA 3SG2A 4DXNA 5T3IA 3EK8A 4W6RA 3SSLA 2VVJA 3GL4A 2QU1A 3EVVA 1Q4BA 2H6VA 2G3DB 3H1RA 4KEXA 3ST2A 5HZTA 1KP5A 4PFEA 1EMCA 3A8SA 3LA1A 3U0LA 4KGFA 2WHSA 2HCGA 4W75A 2HRSA 4EMQA 1YHIA 2OTBA 2IOVA 2V4EA 3CD1A 5H87A 3V3DA 2O24A 2A53B 3VHTB 1XAEA 2A54B 2EMNA 1YHGA 2DUFA 4EDSA 2FZUA 3OSQA 2H9WA 3DQDA 1XA9A 3LVDA 3EKHA 3K1KA 1QY3A 4DXIA 3CFHA 1RM9A 4DKMA 4ANJA 2A52B 4W6JA 4W6SA 4J88A 2Z1OA 2VZXA 3TMTA 5FVGA 2WSNA 4IK3A 4OY4A 3VHTA 4RYWA 3DQFA 4W7AA 4ZFSA 5LTQA 3SSYA 4L12A 2HPWA 3M24A 1YFPA 4L13A 2G3OA 4HVFA 5DTLA 2OKWA 4KF5A 3OSRA 3DQ6A 4H47A 3ADFA 3DQ8A 2JADA 2QLEA 3SRYA 3ST3A 4KW8A 5DY6A 4W76A 5EXCI 2WIQA 3SVOA 4LQUA 3UG0A 2OKYA 4P76A 4W6GA 2QLGA 4HE4A 1H4UA 3DQ4A 3IP2A 5HW9A 1F09A 3E5TA 1KYPA 3AI4A 3DQEA 4H3LA 3SV5A 5DTXA 3ZUJA 3KCSA 4LJCA 3MGFA 4J8AA 4ZF3A 5EXBA 2QLHA 3SG4A 1F0BA 3ZTFA 1Z1PA 2H5OA 4W74A 5BT0A 2A50B 1W7SA 3DPXA 3DQCA 3SG5A 1EMAA 2WSOA 3EKJA 3SS0A 1UISA 3VICA 4KA9A 2G6EA 4W6AA 2HGYA 4Q7TA 4W6IA 4B30B 1RMMA 2DDDA 1BFPA 4ZBLA 3SVRA 1RRXA 3P28A 3G9AA 2ARLA 1EMKA 1JBZA 3S05A 4DKNA 4Z4KA 1GGXA 4JEOA 1OXEA 3LVCA 4JGEA 4B30A 2A48A 2DUGA 1MOVA 3DQOA 2QT2A 2VAEA 2ZMUA 1H6RA 3DQAA 1OXFA 4W6OA 3SG6A 3ST0A 2P4MA 5HBDA 2WHUA 2IE2A 4W72A 5DPHA 2AWMA 5LTRA 2DDCA 1Q4DA 4B5YA 4PPLA 3CD9A 4I2YA 3SVEA 4KW9A 3IR8A 2DUEA 2ZO7A 3SSVA 5EHUA 4W6PA 2IB5A 4AR7A 3SVBA 5EBJA 5DTZA 1W7TA 2HFCA 2HGDA 3M22A 2VVHA 3DQ2A 5FHVA 3W1DA 4W6LA 1YHHA 4PPKA 1C4FA 4ZINA 4IZNA 1ZGPA 4XVPA 3SVNA 3GJ2A 4RTCA 3U8PA 3LF4B 5HZSA 1ZGOA 5DPJA 3CGLA 3NT3A 4IK5A 4JRBA
chains in the Genus database with same CATH superfamily
2DD9A 2FWQA 3CFFA 3DQJA 3O78A 2A47A 3P8UA 3GJ1A 4TZGA 4ZF5A 2DUHA 3OGOA 4Z4MA 3SSKA 1KYSA 4ZB1A 3LSAA 1EMBA 1MYWA 4ZIOA 3AKOA 4R6DA 3EVPA 4IK1A 4DXMA 3NT9A 5F9GA 1GFLA 5DQBA 2WURA 4W7RA 5FVFA 4W77A 4UTSA 4P1QA 2YDZA 4OGSA 4H3MA 2YE1A 3O77A 2C9IA 5DPGA 4W7DA 3UFZA 5FVIA 3DQ1A 4W7EA 4Q9WA 3SVCA 3U0NA 3DQ7A 3BXAA 2H5RA 1JC1A 3TMRA 3E5WA 4J89A 4KW4A 5HZUA 2H8QA 4W73A 4EN1A 2EMDA 4KF4A 3SVSA 3W1CA 4W6BA 3ST4A 3NEZA 4HQ8A 2QLIA 3E5VA 5LTPA 2AWLA 2GW4B 4Q7RA 3EK4A 4DXPA 2AHAA 1Q4AA 2ICRA 5HZOA 2EMOA 3DQ3A 4AS8A 5BTTB 3CBEA 3GEXA 5HGEA 5H88A 2AWJA 2A56B 2YFPA 3PJBA 3SG7A 4W6UA 5EXUA 1Q4EA 1MOUA 4EDOA 3EK7A 1B9CA 3ZUFA 4JFGA 2G2SB 3AI5A 3U0KA 2C9JA 3BX9A 1XMZA 2G16B 4H48A 2BTJA 5J2OA 3WLDA 4LQTA 3RWAA 4W6KA 2HJOA 4W6FA 3DQKA 1EMLA 4LJBA 5DU0A 4JC2A 2HQKA 4W6NA 4LJDA 4L1IA 4BDUA 3PJ7A 2G6XA 5EB6A 2OJKA 2ZO6A 5EJUA 3SVUA 1G7KA 4W69A 3ZULA 1EMMA 1CV7A 1HUYA 2B3PA 4XL5A 4R6BA 1Z1QA 2PXSA 4ORNA 2V4EB 2WISA 3H1OA 2DD7A 2H5QA 3U8AA 1ZUXA 2Z6XA 3BXBA 1EMFA 3EVRA 4IK8A 2WHTA 4DXQA 3KCTA 3LF3A 4KPIA 4GF6B 2ZMWA 4LJDC 2PXWA 4N3DA 1RMOA 5H89A 3WLCA 2AWKA 2GX2A 3U8CA 5DTYA 2B3QA 2OGRA 4W6CA 1KYRA 1EMGA 4IK4A 1XSSA 3ED8A 4HQCA 5DRGA 4W6HA 5DRFA 1OXDA 4W6MA 4XOWA 2Q57A 1QYQA 3SVDA 4IK9A 4W7FA 4W6TA 4XGYA 2HQZA 3SSPA 3LVAA 1ZGQA 4TZAA 3U0MA 2QLGB 1JC0A 4H3NA 4U2VA 3DQHA 2V4EC 2Q6PA 4W7XA 2Z6ZA 1QYOA 1YZWA 4W6DA 4RYSA 2VVIA 1EMEA 2YE0A 5AQBB 4W7CA 4ZF4A 1S6ZA 4XOVA 2A46A 3PIBA 4HQ9A 4LW5A 1QXTA 3DQIA 4OJ0A 1JBYA 2GX0A 4GESB 2IB6A 1YJ2A 4OQWA 3VK1A 5BQLA 3CFAA 3DQMA 4Q9XA 2Z6YA 2VADA 2QRFA 3SSTA 5LK4A 4EULA 5EB7A 3BXCA 4NWSA 3LS3A 3I19A 4DXOA 4KAGA 4KF5C 3DQLA 3DQUA 3DQ5A 1RMPA 2OTEA 2FL1A 2H5PA 2O2BA 3RWTA 1GL4A 4JF9A 2G6YA 5DQMA 3DQ9A 1Q73A 3DQNA 2POXA 4PPJA 1HCJA 3WCKA 5DPIA 3SG3A 3CB9A 1W7UA 2DUIA 1QYFA 2G5ZB 3DPZA 1XQMA 1Q4CA 4OHSA 4Q7UA 2Y0GA 3GB3A 2RH7A 5BTTA 1YJFA 5KTGA 3DPWA 2O29A 2QZ0A 3EVUA 3SSHA 3NEDA 3PJ5A 3NF0A 4KGEA 2AH8A 2GW3A 4GOBA 3SG2A 4DXNA 5T3IA 3EK8A 4W6RA 3SSLA 2VVJA 3GL4A 2QU1A 3EVVA 1Q4BA 2H6VA 2G3DB 3H1RA 4KEXA 3ST2A 5HZTA 1KP5A 4PFEA 1EMCA 3A8SA 3LA1A 3U0LA 4KGFA 2WHSA 2HCGA 4W75A 2HRSA 4EMQA 1YHIA 2OTBA 2IOVA 2V4EA 3CD1A 5H87A 3V3DA 2O24A 2A53B 3VHTB 1XAEA 2A54B 2EMNA 1YHGA 2DUFA 4EDSA 2FZUA 3OSQA 2H9WA 3DQDA 1XA9A 3LVDA 3EKHA 3K1KA 1QY3A 4DXIA 3CFHA 1RM9A 4DKMA 4ANJA 2A52B 4W6JA 4W6SA 4J88A 2Z1OA 2VZXA 3TMTA 5FVGA 2WSNA 4IK3A 4OY4A 3VHTA 4RYWA 3DQFA 4W7AA 4ZFSA 5LTQA 3SSYA 4L12A 2HPWA 3M24A 1YFPA 4L13A 2G3OA 4HVFA 5DTLA 2OKWA 4KF5A 3OSRA 3DQ6A 4H47A 3ADFA 3DQ8A 2JADA 2QLEA 3SRYA 3ST3A 4KW8A 5DY6A 4W76A 5EXCI 2WIQA 3SVOA 4LQUA 3UG0A 2OKYA 4P76A 4W6GA 2QLGA 4HE4A 1H4UA 3DQ4A 3IP2A 5HW9A 1F09A 3E5TA 1KYPA 3AI4A 3DQEA 4H3LA 3SV5A 5DTXA 3ZUJA 3KCSA 4LJCA 3MGFA 4J8AA 4ZF3A 5EXBA 2QLHA 3SG4A 1F0BA 3ZTFA 1Z1PA 2H5OA 4W74A 5BT0A 2A50B 1W7SA 3DPXA 3DQCA 3SG5A 1EMAA 2WSOA 3EKJA 3SS0A 1UISA 3VICA 4KA9A 2G6EA 4W6AA 2HGYA 4Q7TA 4W6IA 4B30B 1RMMA 2DDDA 1BFPA 4ZBLA 3SVRA 1RRXA 3P28A 3G9AA 2ARLA 1EMKA 1JBZA 3S05A 4DKNA 4Z4KA 1GGXA 4JEOA 1OXEA 3LVCA 4JGEA 4B30A 2A48A 2DUGA 1MOVA 3DQOA 2QT2A 2VAEA 2ZMUA 1H6RA 3DQAA 1OXFA 4W6OA 3SG6A 3ST0A 2P4MA 5HBDA 2WHUA 2IE2A 4W72A 5DPHA 2AWMA 5LTRA 2DDCA 1Q4DA 4B5YA 4PPLA 3CD9A 4I2YA 3SVEA 4KW9A 3IR8A 2DUEA 2ZO7A 3SSVA 5EHUA 4W6PA 2IB5A 4AR7A 3SVBA 5EBJA 5DTZA 1W7TA 2HFCA 2HGDA 3M22A 2VVHA 3DQ2A 5FHVA 3W1DA 4W6LA 1YHHA 4PPKA 1C4FA 4ZINA 4IZNA 1ZGPA 4XVPA 3SVNA 3GJ2A 4RTCA 3U8PA 3LF4B 5HZSA 1ZGOA 5DPJA 3CGLA 3NT3A 4IK5A 4JRBA
chains in the Genus database with same CATH topology
2DD9A 2FWQA 3CFFA 3DQJA 3O78A 2A47A 3P8UA 3GJ1A 4TZGA 4ZF5A 2DUHA 3OGOA 4Z4MA 3SSKA 1KYSA 4ZB1A 3LSAA 1EMBA 1MYWA 4ZIOA 3AKOA 4R6DA 3EVPA 4IK1A 4DXMA 3NT9A 5F9GA 1GFLA 5DQBA 2WURA 4W7RA 5FVFA 4W77A 4UTSA 4P1QA 2YDZA 4OGSA 4H3MA 2YE1A 3O77A 2C9IA 5DPGA 4W7DA 3UFZA 5FVIA 3DQ1A 4W7EA 4Q9WA 3SVCA 3U0NA 3DQ7A 3BXAA 2H5RA 1JC1A 3TMRA 3E5WA 4J89A 4KW4A 5HZUA 2H8QA 4W73A 4EN1A 2EMDA 4KF4A 3SVSA 3W1CA 4W6BA 3ST4A 3NEZA 4HQ8A 2QLIA 3E5VA 5LTPA 2AWLA 2GW4B 4Q7RA 3EK4A 4DXPA 2AHAA 1Q4AA 2ICRA 5HZOA 2EMOA 3DQ3A 4AS8A 5BTTB 3CBEA 3GEXA 5HGEA 5H88A 2AWJA 2A56B 2YFPA 3PJBA 3SG7A 4W6UA 5EXUA 1Q4EA 1MOUA 4EDOA 3EK7A 1B9CA 3ZUFA 4JFGA 2G2SB 3AI5A 3U0KA 2C9JA 3BX9A 1XMZA 2G16B 4H48A 2BTJA 5J2OA 3WLDA 4LQTA 3RWAA 4W6KA 2HJOA 4W6FA 3DQKA 1EMLA 4LJBA 5DU0A 4JC2A 2HQKA 4W6NA 4LJDA 4L1IA 4BDUA 3PJ7A 2G6XA 5EB6A 2OJKA 2ZO6A 5EJUA 3SVUA 1G7KA 4W69A 3ZULA 1EMMA 1CV7A 1HUYA 2B3PA 4XL5A 4R6BA 1Z1QA 2PXSA 4ORNA 2V4EB 2WISA 3H1OA 2DD7A 2H5QA 3U8AA 1ZUXA 2Z6XA 3BXBA 1EMFA 3EVRA 4IK8A 2WHTA 4DXQA 3KCTA 3LF3A 4KPIA 4GF6B 2ZMWA 4LJDC 2PXWA 4N3DA 1RMOA 5H89A 3WLCA 2AWKA 2GX2A 3U8CA 5DTYA 2B3QA 2OGRA 4W6CA 1KYRA 1EMGA 4IK4A 1XSSA 3ED8A 4HQCA 5DRGA 4W6HA 5DRFA 1OXDA 4W6MA 4XOWA 2Q57A 1QYQA 3SVDA 4IK9A 4W7FA 4W6TA 4XGYA 2HQZA 3SSPA 3LVAA 1ZGQA 4TZAA 3U0MA 2QLGB 1JC0A 4H3NA 4U2VA 3DQHA 2V4EC 2Q6PA 4W7XA 2Z6ZA 1QYOA 1YZWA 4W6DA 4RYSA 2VVIA 1EMEA 2YE0A 5AQBB 4W7CA 4ZF4A 1S6ZA 4XOVA 2A46A 3PIBA 4HQ9A 4LW5A 1QXTA 3DQIA 4OJ0A 1JBYA 2GX0A 4GESB 2IB6A 1YJ2A 4OQWA 3VK1A 5BQLA 3CFAA 3DQMA 4Q9XA 2Z6YA 2VADA 2QRFA 3SSTA 5LK4A 4EULA 5EB7A 3BXCA 4NWSA 3LS3A 3I19A 4DXOA 4KAGA 4KF5C 3DQLA 3DQUA 3DQ5A 1RMPA 2OTEA 2FL1A 2H5PA 2O2BA 3RWTA 1GL4A 4JF9A 2G6YA 5DQMA 3DQ9A 1Q73A 3DQNA 2POXA 4PPJA 1HCJA 3WCKA 5DPIA 3SG3A 3CB9A 1W7UA 2DUIA 1QYFA 2G5ZB 3DPZA 1XQMA 1Q4CA 4OHSA 4Q7UA 2Y0GA 3GB3A 2RH7A 5BTTA 1YJFA 5KTGA 3DPWA 2O29A 2QZ0A 3EVUA 3SSHA 3NEDA 3PJ5A 3NF0A 4KGEA 2AH8A 2GW3A 4GOBA 3SG2A 4DXNA 5T3IA 3EK8A 4W6RA 3SSLA 2VVJA 3GL4A 2QU1A 3EVVA 1Q4BA 2H6VA 2G3DB 3H1RA 4KEXA 3ST2A 5HZTA 1KP5A 4PFEA 1EMCA 3A8SA 3LA1A 3U0LA 4KGFA 2WHSA 2HCGA 4W75A 2HRSA 4EMQA 1YHIA 2OTBA 2IOVA 2V4EA 3CD1A 5H87A 3V3DA 2O24A 2A53B 3VHTB 1XAEA 2A54B 2EMNA 1YHGA 2DUFA 4EDSA 2FZUA 3OSQA 2H9WA 3DQDA 1XA9A 3LVDA 3EKHA 3K1KA 1QY3A 4DXIA 3CFHA 1RM9A 4DKMA 4ANJA 2A52B 4W6JA 4W6SA 4J88A 2Z1OA 2VZXA 3TMTA 5FVGA 2WSNA 4IK3A 4OY4A 3VHTA 4RYWA 3DQFA 4W7AA 4ZFSA 5LTQA 3SSYA 4L12A 2HPWA 3M24A 1YFPA 4L13A 2G3OA 4HVFA 5DTLA 2OKWA 4KF5A 3OSRA 3DQ6A 4H47A 3ADFA 3DQ8A 2JADA 2QLEA 3SRYA 3ST3A 4KW8A 5DY6A 4W76A 5EXCI 2WIQA 3SVOA 4LQUA 3UG0A 2OKYA 4P76A 4W6GA 2QLGA 4HE4A 1H4UA 3DQ4A 3IP2A 5HW9A 1F09A 3E5TA 1KYPA 3AI4A 3DQEA 4H3LA 3SV5A 5DTXA 3ZUJA 3KCSA 4LJCA 3MGFA 4J8AA 4ZF3A 5EXBA 2QLHA 3SG4A 1F0BA 3ZTFA 1Z1PA 2H5OA 4W74A 5BT0A 2A50B 1W7SA 3DPXA 3DQCA 3SG5A 1EMAA 2WSOA 3EKJA 3SS0A 1UISA 3VICA 4KA9A 2G6EA 4W6AA 2HGYA 4Q7TA 4W6IA 4B30B 1RMMA 2DDDA 1BFPA 4ZBLA 3SVRA 1RRXA 3P28A 3G9AA 2ARLA 1EMKA 1JBZA 3S05A 4DKNA 4Z4KA 1GGXA 4JEOA 1OXEA 3LVCA 4JGEA 4B30A 2A48A 2DUGA 1MOVA 3DQOA 2QT2A 2VAEA 2ZMUA 1H6RA 3DQAA 1OXFA 4W6OA 3SG6A 3ST0A 2P4MA 5HBDA 2WHUA 2IE2A 4W72A 5DPHA 2AWMA 5LTRA 2DDCA 1Q4DA 4B5YA 4PPLA 3CD9A 4I2YA 3SVEA 4KW9A 3IR8A 2DUEA 2ZO7A 3SSVA 5EHUA 4W6PA 2IB5A 4AR7A 3SVBA 5EBJA 5DTZA 1W7TA 2HFCA 2HGDA 3M22A 2VVHA 3DQ2A 5FHVA 3W1DA 4W6LA 1YHHA 4PPKA 1C4FA 4ZINA 4IZNA 1ZGPA 4XVPA 3SVNA 3GJ2A 4RTCA 3U8PA 3LF4B 5HZSA 1ZGOA 5DPJA 3CGLA 3NT3A 4IK5A 4JRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DD9 A;  2FWQ A;  3CFF A;  3DQJ A;  3O78 A;  2A47 A;  3P8U A;  3GJ1 A;  4TZG A;  4ZF5 A;  2DUH A;  3OGO A;  4Z4M A;  3SSK A;  1KYS A;  4ZB1 A;  3LSA A;  1EMB A;  1MYW A;  4ZIO A;  3AKO A;  4R6D A;  3EVP A;  4IK1 A;  4DXM A;  3NT9 A;  5F9G A;  1GFL A;  5DQB A;  2WUR A;  4W7R A;  5FVF A;  4W77 A;  4UTS A;  4P1Q A;  2YDZ A;  4OGS A;  4H3M A;  2YE1 A;  3O77 A;  2C9I A;  5DPG A;  4W7D A;  3UFZ A;  5FVI A;  3DQ1 A;  4W7E A;  4Q9W A;  3SVC A;  3U0N A;  3DQ7 A;  3BXA A;  2H5R A;  1JC1 A;  3TMR A;  3E5W A;  4J89 A;  4KW4 A;  5HZU A;  2H8Q A;  4W73 A;  4EN1 A;  2EMD A;  4KF4 A;  3SVS A;  3W1C A;  4W6B A;  3ST4 A;  3NEZ A;  4HQ8 A;  2QLI A;  3E5V A;  5LTP A;  2AWL A;  2GW4 B;  4Q7R A;  3EK4 A;  4DXP A;  2AHA A;  1Q4A A;  2ICR A;  5HZO A;  2EMO A;  3DQ3 A;  4AS8 A;  5BTT B;  3CBE A;  3GEX A;  5HGE A;  5H88 A;  2AWJ A;  2A56 B;  2YFP A;  3PJB A;  3SG7 A;  4W6U A;  5EXU A;  1Q4E A;  1MOU A;  4EDO A;  3EK7 A;  1B9C A;  3ZUF A;  4JFG A;  2G2S B;  3AI5 A;  3U0K A;  2C9J A;  3BX9 A;  1XMZ A;  2G16 B;  4H48 A;  2BTJ A;  5J2O A;  3WLD A;  4LQT A;  3RWA A;  4W6K A;  2HJO A;  4W6F A;  3DQK A;  1EML A;  4LJB A;  5DU0 A;  4JC2 A;  2HQK A;  4W6N A;  4LJD A;  4L1I A;  4BDU A;  3PJ7 A;  2G6X A;  5EB6 A;  2OJK A;  2ZO6 A;  5EJU A;  3SVU A;  1G7K A;  4W69 A;  3ZUL A;  1EMM A;  1CV7 A;  1HUY A;  2B3P A;  4XL5 A;  4R6B A;  1Z1Q A;  2PXS A;  4ORN A;  2V4E B;  2WIS A;  3H1O A;  2DD7 A;  2H5Q A;  3U8A A;  1ZUX A;  2Z6X A;  3BXB A;  1EMF A;  3EVR A;  4IK8 A;  2WHT A;  4DXQ A;  3KCT A;  3LF3 A;  4KPI A;  4GF6 B;  2ZMW A;  4LJD C;  2PXW A;  4N3D A;  1RMO A;  5H89 A;  3WLC A;  2AWK A;  2GX2 A;  3U8C A;  5DTY A;  2B3Q A;  2OGR A;  4W6C A;  1KYR A;  1EMG A;  4IK4 A;  1XSS A;  3ED8 A;  4HQC A;  5DRG A;  4W6H A;  5DRF A;  1OXD A;  4W6M A;  4XOW A;  2Q57 A;  1QYQ A;  3SVD A;  4IK9 A;  4W7F A;  4W6T A;  4XGY A;  2HQZ A;  3SSP A;  3LVA A;  1ZGQ A;  4TZA A;  3U0M A;  2QLG B;  1JC0 A;  4H3N A;  4U2V A;  3DQH A;  2V4E C;  2Q6P A;  4W7X A;  2Z6Z A;  1QYO A;  1YZW A;  4W6D A;  4RYS A;  2VVI A;  1EME A;  2YE0 A;  5AQB B;  4W7C A;  4ZF4 A;  1S6Z A;  4XOV A;  2A46 A;  3PIB A;  4HQ9 A;  4LW5 A;  1QXT A;  3DQI A;  4OJ0 A;  1JBY A;  2GX0 A;  4GES B;  2IB6 A;  1YJ2 A;  4OQW A;  3VK1 A;  5BQL A;  3CFA A;  3DQM A;  4Q9X A;  2Z6Y A;  2VAD A;  2QRF A;  3SST A;  5LK4 A;  4EUL A;  5EB7 A;  3BXC A;  4NWS A;  3LS3 A;  3I19 A;  4DXO A;  4KAG A;  4KF5 C;  3DQL A;  3DQU A;  3DQ5 A;  1RMP A;  2OTE A;  2FL1 A;  2H5P A;  2O2B A;  3RWT A;  1GL4 A;  4JF9 A;  2G6Y A;  5DQM A;  3DQ9 A;  1Q73 A;  3DQN A;  2POX A;  4PPJ A;  1HCJ A;  3WCK A;  5DPI A;  3SG3 A;  3CB9 A;  1W7U A;  2DUI A;  1QYF A;  2G5Z B;  3DPZ A;  1XQM A;  1Q4C A;  4OHS A;  4Q7U A;  2Y0G A;  3GB3 A;  2RH7 A;  5BTT A;  1YJF A;  5KTG A;  3DPW A;  2O29 A;  2QZ0 A;  3EVU A;  3SSH A;  3NED A;  3PJ5 A;  3NF0 A;  4KGE A;  2AH8 A;  2GW3 A;  4GOB A;  3SG2 A;  4DXN A;  5T3I A;  3EK8 A;  4W6R A;  3SSL A;  2VVJ A;  3GL4 A;  2QU1 A;  3EVV A;  1Q4B A;  2H6V A;  2G3D B;  3H1R A;  4KEX A;  3ST2 A;  5HZT A;  1KP5 A;  4PFE A;  1EMC A;  3A8S A;  3LA1 A;  3U0L A;  4KGF A;  2WHS A;  2HCG A;  4W75 A;  2HRS A;  4EMQ A;  1YHI A;  2OTB A;  2IOV A;  2V4E A;  3CD1 A;  5H87 A;  3V3D A;  2O24 A;  2A53 B;  3VHT B;  1XAE A;  2A54 B;  2EMN A;  1YHG A;  2DUF A;  4EDS A;  2FZU A;  3OSQ A;  2H9W A;  3DQD A;  1XA9 A;  3LVD A;  3EKH A;  3K1K A;  1QY3 A;  4DXI A;  3CFH A;  1RM9 A;  4DKM A;  4ANJ A;  2A52 B;  4W6J A;  4W6S A;  4J88 A;  2Z1O A;  2VZX A;  3TMT A;  5FVG A;  2WSN A;  4IK3 A;  4OY4 A;  3VHT A;  4RYW A;  3DQF A;  4W7A A;  4ZFS A;  5LTQ A;  3SSY A;  4L12 A;  2HPW A;  3M24 A;  1YFP A;  4L13 A;  2G3O A;  4HVF A;  5DTL A;  2OKW A;  4KF5 A;  3OSR A;  3DQ6 A;  4H47 A;  3ADF A;  3DQ8 A;  2JAD A;  2QLE A;  3SRY A;  3ST3 A;  4KW8 A;  5DY6 A;  4W76 A;  5EXC I;  2WIQ A;  3SVO A;  4LQU A;  3UG0 A;  2OKY A;  4P76 A;  4W6G A;  2QLG A;  4HE4 A;  1H4U A;  3DQ4 A;  3IP2 A;  5HW9 A;  1F09 A;  3E5T A;  1KYP A;  3AI4 A;  3DQE A;  4H3L A;  3SV5 A;  5DTX A;  3ZUJ A;  3KCS A;  4LJC A;  3MGF A;  4J8A A;  4ZF3 A;  5EXB A;  2QLH A;  3SG4 A;  1F0B A;  3ZTF A;  1Z1P A;  2H5O A;  4W74 A;  5BT0 A;  2A50 B;  1W7S A;  3DPX A;  3DQC A;  3SG5 A;  1EMA A;  2WSO A;  3EKJ A;  3SS0 A;  1UIS A;  3VIC A;  4KA9 A;  2G6E A;  4W6A A;  2HGY A;  4Q7T A;  4W6I A;  4B30 B;  1RMM A;  2DDD A;  1BFP A;  4ZBL A;  3SVR A;  1RRX A;  3P28 A;  3G9A A;  2ARL A;  1EMK A;  1JBZ A;  3S05 A;  4DKN A;  4Z4K A;  1GGX A;  4JEO A;  1OXE A;  3LVC A;  4JGE A;  4B30 A;  2A48 A;  2DUG A;  1MOV A;  3DQO A;  2QT2 A;  2VAE A;  2ZMU A;  1H6R A;  3DQA A;  1OXF A;  4W6O A;  3SG6 A;  3ST0 A;  2P4M A;  5HBD A;  2WHU A;  2IE2 A;  4W72 A;  5DPH A;  2AWM A;  5LTR A;  2DDC A;  1Q4D A;  4B5Y A;  4PPL A;  3CD9 A;  4I2Y A;  3SVE A;  4KW9 A;  3IR8 A;  2DUE A;  2ZO7 A;  3SSV A;  5EHU A;  4W6P A;  2IB5 A;  4AR7 A;  3SVB A;  5EBJ A;  5DTZ A;  1W7T A;  2HFC A;  2HGD A;  3M22 A;  2VVH A;  3DQ2 A;  5FHV A;  3W1D A;  4W6L A;  1YHH A;  4PPK A;  1C4F A;  4ZIN A;  4IZN A;  1ZGP A;  4XVP A;  3SVN A;  3GJ2 A;  4RTC A;  3U8P A;  3LF4 B;  5HZS A;  1ZGO A;  5DPJ A;  3CGL A;  3NT3 A;  4IK5 A;  4JRB A; 
#chains in the Genus database with same CATH topology
 2DD9 A;  2FWQ A;  3CFF A;  3DQJ A;  3O78 A;  2A47 A;  3P8U A;  3GJ1 A;  4TZG A;  4ZF5 A;  2DUH A;  3OGO A;  4Z4M A;  3SSK A;  1KYS A;  4ZB1 A;  3LSA A;  1EMB A;  1MYW A;  4ZIO A;  3AKO A;  4R6D A;  3EVP A;  4IK1 A;  4DXM A;  3NT9 A;  5F9G A;  1GFL A;  5DQB A;  2WUR A;  4W7R A;  5FVF A;  4W77 A;  4UTS A;  4P1Q A;  2YDZ A;  4OGS A;  4H3M A;  2YE1 A;  3O77 A;  2C9I A;  5DPG A;  4W7D A;  3UFZ A;  5FVI A;  3DQ1 A;  4W7E A;  4Q9W A;  3SVC A;  3U0N A;  3DQ7 A;  3BXA A;  2H5R A;  1JC1 A;  3TMR A;  3E5W A;  4J89 A;  4KW4 A;  5HZU A;  2H8Q A;  4W73 A;  4EN1 A;  2EMD A;  4KF4 A;  3SVS A;  3W1C A;  4W6B A;  3ST4 A;  3NEZ A;  4HQ8 A;  2QLI A;  3E5V A;  5LTP A;  2AWL A;  2GW4 B;  4Q7R A;  3EK4 A;  4DXP A;  2AHA A;  1Q4A A;  2ICR A;  5HZO A;  2EMO A;  3DQ3 A;  4AS8 A;  5BTT B;  3CBE A;  3GEX A;  5HGE A;  5H88 A;  2AWJ A;  2A56 B;  2YFP A;  3PJB A;  3SG7 A;  4W6U A;  5EXU A;  1Q4E A;  1MOU A;  4EDO A;  3EK7 A;  1B9C A;  3ZUF A;  4JFG A;  2G2S B;  3AI5 A;  3U0K A;  2C9J A;  3BX9 A;  1XMZ A;  2G16 B;  4H48 A;  2BTJ A;  5J2O A;  3WLD A;  4LQT A;  3RWA A;  4W6K A;  2HJO A;  4W6F A;  3DQK A;  1EML A;  4LJB A;  5DU0 A;  4JC2 A;  2HQK A;  4W6N A;  4LJD A;  4L1I A;  4BDU A;  3PJ7 A;  2G6X A;  5EB6 A;  2OJK A;  2ZO6 A;  5EJU A;  3SVU A;  1G7K A;  4W69 A;  3ZUL A;  1EMM A;  1CV7 A;  1HUY A;  2B3P A;  4XL5 A;  4R6B A;  1Z1Q A;  2PXS A;  4ORN A;  2V4E B;  2WIS A;  3H1O A;  2DD7 A;  2H5Q A;  3U8A A;  1ZUX A;  2Z6X A;  3BXB A;  1EMF A;  3EVR A;  4IK8 A;  2WHT A;  4DXQ A;  3KCT A;  3LF3 A;  4KPI A;  4GF6 B;  2ZMW A;  4LJD C;  2PXW A;  4N3D A;  1RMO A;  5H89 A;  3WLC A;  2AWK A;  2GX2 A;  3U8C A;  5DTY A;  2B3Q A;  2OGR A;  4W6C A;  1KYR A;  1EMG A;  4IK4 A;  1XSS A;  3ED8 A;  4HQC A;  5DRG A;  4W6H A;  5DRF A;  1OXD A;  4W6M A;  4XOW A;  2Q57 A;  1QYQ A;  3SVD A;  4IK9 A;  4W7F A;  4W6T A;  4XGY A;  2HQZ A;  3SSP A;  3LVA A;  1ZGQ A;  4TZA A;  3U0M A;  2QLG B;  1JC0 A;  4H3N A;  4U2V A;  3DQH A;  2V4E C;  2Q6P A;  4W7X A;  2Z6Z A;  1QYO A;  1YZW A;  4W6D A;  4RYS A;  2VVI A;  1EME A;  2YE0 A;  5AQB B;  4W7C A;  4ZF4 A;  1S6Z A;  4XOV A;  2A46 A;  3PIB A;  4HQ9 A;  4LW5 A;  1QXT A;  3DQI A;  4OJ0 A;  1JBY A;  2GX0 A;  4GES B;  2IB6 A;  1YJ2 A;  4OQW A;  3VK1 A;  5BQL A;  3CFA A;  3DQM A;  4Q9X A;  2Z6Y A;  2VAD A;  2QRF A;  3SST A;  5LK4 A;  4EUL A;  5EB7 A;  3BXC A;  4NWS A;  3LS3 A;  3I19 A;  4DXO A;  4KAG A;  4KF5 C;  3DQL A;  3DQU A;  3DQ5 A;  1RMP A;  2OTE A;  2FL1 A;  2H5P A;  2O2B A;  3RWT A;  1GL4 A;  4JF9 A;  2G6Y A;  5DQM A;  3DQ9 A;  1Q73 A;  3DQN A;  2POX A;  4PPJ A;  1HCJ A;  3WCK A;  5DPI A;  3SG3 A;  3CB9 A;  1W7U A;  2DUI A;  1QYF A;  2G5Z B;  3DPZ A;  1XQM A;  1Q4C A;  4OHS A;  4Q7U A;  2Y0G A;  3GB3 A;  2RH7 A;  5BTT A;  1YJF A;  5KTG A;  3DPW A;  2O29 A;  2QZ0 A;  3EVU A;  3SSH A;  3NED A;  3PJ5 A;  3NF0 A;  4KGE A;  2AH8 A;  2GW3 A;  4GOB A;  3SG2 A;  4DXN A;  5T3I A;  3EK8 A;  4W6R A;  3SSL A;  2VVJ A;  3GL4 A;  2QU1 A;  3EVV A;  1Q4B A;  2H6V A;  2G3D B;  3H1R A;  4KEX A;  3ST2 A;  5HZT A;  1KP5 A;  4PFE A;  1EMC A;  3A8S A;  3LA1 A;  3U0L A;  4KGF A;  2WHS A;  2HCG A;  4W75 A;  2HRS A;  4EMQ A;  1YHI A;  2OTB A;  2IOV A;  2V4E A;  3CD1 A;  5H87 A;  3V3D A;  2O24 A;  2A53 B;  3VHT B;  1XAE A;  2A54 B;  2EMN A;  1YHG A;  2DUF A;  4EDS A;  2FZU A;  3OSQ A;  2H9W A;  3DQD A;  1XA9 A;  3LVD A;  3EKH A;  3K1K A;  1QY3 A;  4DXI A;  3CFH A;  1RM9 A;  4DKM A;  4ANJ A;  2A52 B;  4W6J A;  4W6S A;  4J88 A;  2Z1O A;  2VZX A;  3TMT A;  5FVG A;  2WSN A;  4IK3 A;  4OY4 A;  3VHT A;  4RYW A;  3DQF A;  4W7A A;  4ZFS A;  5LTQ A;  3SSY A;  4L12 A;  2HPW A;  3M24 A;  1YFP A;  4L13 A;  2G3O A;  4HVF A;  5DTL A;  2OKW A;  4KF5 A;  3OSR A;  3DQ6 A;  4H47 A;  3ADF A;  3DQ8 A;  2JAD A;  2QLE A;  3SRY A;  3ST3 A;  4KW8 A;  5DY6 A;  4W76 A;  5EXC I;  2WIQ A;  3SVO A;  4LQU A;  3UG0 A;  2OKY A;  4P76 A;  4W6G A;  2QLG A;  4HE4 A;  1H4U A;  3DQ4 A;  3IP2 A;  5HW9 A;  1F09 A;  3E5T A;  1KYP A;  3AI4 A;  3DQE A;  4H3L A;  3SV5 A;  5DTX A;  3ZUJ A;  3KCS A;  4LJC A;  3MGF A;  4J8A A;  4ZF3 A;  5EXB A;  2QLH A;  3SG4 A;  1F0B A;  3ZTF A;  1Z1P A;  2H5O A;  4W74 A;  5BT0 A;  2A50 B;  1W7S A;  3DPX A;  3DQC A;  3SG5 A;  1EMA A;  2WSO A;  3EKJ A;  3SS0 A;  1UIS A;  3VIC A;  4KA9 A;  2G6E A;  4W6A A;  2HGY A;  4Q7T A;  4W6I A;  4B30 B;  1RMM A;  2DDD A;  1BFP A;  4ZBL A;  3SVR A;  1RRX A;  3P28 A;  3G9A A;  2ARL A;  1EMK A;  1JBZ A;  3S05 A;  4DKN A;  4Z4K A;  1GGX A;  4JEO A;  1OXE A;  3LVC A;  4JGE A;  4B30 A;  2A48 A;  2DUG A;  1MOV A;  3DQO A;  2QT2 A;  2VAE A;  2ZMU A;  1H6R A;  3DQA A;  1OXF A;  4W6O A;  3SG6 A;  3ST0 A;  2P4M A;  5HBD A;  2WHU A;  2IE2 A;  4W72 A;  5DPH A;  2AWM A;  5LTR A;  2DDC A;  1Q4D A;  4B5Y A;  4PPL A;  3CD9 A;  4I2Y A;  3SVE A;  4KW9 A;  3IR8 A;  2DUE A;  2ZO7 A;  3SSV A;  5EHU A;  4W6P A;  2IB5 A;  4AR7 A;  3SVB A;  5EBJ A;  5DTZ A;  1W7T A;  2HFC A;  2HGD A;  3M22 A;  2VVH A;  3DQ2 A;  5FHV A;  3W1D A;  4W6L A;  1YHH A;  4PPK A;  1C4F A;  4ZIN A;  4IZN A;  1ZGP A;  4XVP A;  3SVN A;  3GJ2 A;  4RTC A;  3U8P A;  3LF4 B;  5HZS A;  1ZGO A;  5DPJ A;  3CGL A;  3NT3 A;  4IK5 A;  4JRB A; 
#chains in the Genus database with same CATH homology
 2DD9 A;  2FWQ A;  3CFF A;  3DQJ A;  3O78 A;  2A47 A;  3P8U A;  3GJ1 A;  4TZG A;  4ZF5 A;  2DUH A;  3OGO A;  4Z4M A;  3SSK A;  1KYS A;  4ZB1 A;  3LSA A;  1EMB A;  1MYW A;  4ZIO A;  3AKO A;  4R6D A;  3EVP A;  4IK1 A;  4DXM A;  3NT9 A;  5F9G A;  1GFL A;  5DQB A;  2WUR A;  4W7R A;  5FVF A;  4W77 A;  4UTS A;  4P1Q A;  2YDZ A;  4OGS A;  4H3M A;  2YE1 A;  3O77 A;  2C9I A;  5DPG A;  4W7D A;  3UFZ A;  5FVI A;  3DQ1 A;  4W7E A;  4Q9W A;  3SVC A;  3U0N A;  3DQ7 A;  3BXA A;  2H5R A;  1JC1 A;  3TMR A;  3E5W A;  4J89 A;  4KW4 A;  5HZU A;  2H8Q A;  4W73 A;  4EN1 A;  2EMD A;  4KF4 A;  3SVS A;  3W1C A;  4W6B A;  3ST4 A;  3NEZ A;  4HQ8 A;  2QLI A;  3E5V A;  5LTP A;  2AWL A;  2GW4 B;  4Q7R A;  3EK4 A;  4DXP A;  2AHA A;  1Q4A A;  2ICR A;  5HZO A;  2EMO A;  3DQ3 A;  4AS8 A;  5BTT B;  3CBE A;  3GEX A;  5HGE A;  5H88 A;  2AWJ A;  2A56 B;  2YFP A;  3PJB A;  3SG7 A;  4W6U A;  5EXU A;  1Q4E A;  1MOU A;  4EDO A;  3EK7 A;  1B9C A;  3ZUF A;  4JFG A;  2G2S B;  3AI5 A;  3U0K A;  2C9J A;  3BX9 A;  1XMZ A;  2G16 B;  4H48 A;  2BTJ A;  5J2O A;  3WLD A;  4LQT A;  3RWA A;  4W6K A;  2HJO A;  4W6F A;  3DQK A;  1EML A;  4LJB A;  5DU0 A;  4JC2 A;  2HQK A;  4W6N A;  4LJD A;  4L1I A;  4BDU A;  3PJ7 A;  2G6X A;  5EB6 A;  2OJK A;  2ZO6 A;  5EJU A;  3SVU A;  1G7K A;  4W69 A;  3ZUL A;  1EMM A;  1CV7 A;  1HUY A;  2B3P A;  4XL5 A;  4R6B A;  1Z1Q A;  2PXS A;  4ORN A;  2V4E B;  2WIS A;  3H1O A;  2DD7 A;  2H5Q A;  3U8A A;  1ZUX A;  2Z6X A;  3BXB A;  1EMF A;  3EVR A;  4IK8 A;  2WHT A;  4DXQ A;  3KCT A;  3LF3 A;  4KPI A;  4GF6 B;  2ZMW A;  4LJD C;  2PXW A;  4N3D A;  1RMO A;  5H89 A;  3WLC A;  2AWK A;  2GX2 A;  3U8C A;  5DTY A;  2B3Q A;  2OGR A;  4W6C A;  1KYR A;  1EMG A;  4IK4 A;  1XSS A;  3ED8 A;  4HQC A;  5DRG A;  4W6H A;  5DRF A;  1OXD A;  4W6M A;  4XOW A;  2Q57 A;  1QYQ A;  3SVD A;  4IK9 A;  4W7F A;  4W6T A;  4XGY A;  2HQZ A;  3SSP A;  3LVA A;  1ZGQ A;  4TZA A;  3U0M A;  2QLG B;  1JC0 A;  4H3N A;  4U2V A;  3DQH A;  2V4E C;  2Q6P A;  4W7X A;  2Z6Z A;  1QYO A;  1YZW A;  4W6D A;  4RYS A;  2VVI A;  1EME A;  2YE0 A;  5AQB B;  4W7C A;  4ZF4 A;  1S6Z A;  4XOV A;  2A46 A;  3PIB A;  4HQ9 A;  4LW5 A;  1QXT A;  3DQI A;  4OJ0 A;  1JBY A;  2GX0 A;  4GES B;  2IB6 A;  1YJ2 A;  4OQW A;  3VK1 A;  5BQL A;  3CFA A;  3DQM A;  4Q9X A;  2Z6Y A;  2VAD A;  2QRF A;  3SST A;  5LK4 A;  4EUL A;  5EB7 A;  3BXC A;  4NWS A;  3LS3 A;  3I19 A;  4DXO A;  4KAG A;  4KF5 C;  3DQL A;  3DQU A;  3DQ5 A;  1RMP A;  2OTE A;  2FL1 A;  2H5P A;  2O2B A;  3RWT A;  1GL4 A;  4JF9 A;  2G6Y A;  5DQM A;  3DQ9 A;  1Q73 A;  3DQN A;  2POX A;  4PPJ A;  1HCJ A;  3WCK A;  5DPI A;  3SG3 A;  3CB9 A;  1W7U A;  2DUI A;  1QYF A;  2G5Z B;  3DPZ A;  1XQM A;  1Q4C A;  4OHS A;  4Q7U A;  2Y0G A;  3GB3 A;  2RH7 A;  5BTT A;  1YJF A;  5KTG A;  3DPW A;  2O29 A;  2QZ0 A;  3EVU A;  3SSH A;  3NED A;  3PJ5 A;  3NF0 A;  4KGE A;  2AH8 A;  2GW3 A;  4GOB A;  3SG2 A;  4DXN A;  5T3I A;  3EK8 A;  4W6R A;  3SSL A;  2VVJ A;  3GL4 A;  2QU1 A;  3EVV A;  1Q4B A;  2H6V A;  2G3D B;  3H1R A;  4KEX A;  3ST2 A;  5HZT A;  1KP5 A;  4PFE A;  1EMC A;  3A8S A;  3LA1 A;  3U0L A;  4KGF A;  2WHS A;  2HCG A;  4W75 A;  2HRS A;  4EMQ A;  1YHI A;  2OTB A;  2IOV A;  2V4E A;  3CD1 A;  5H87 A;  3V3D A;  2O24 A;  2A53 B;  3VHT B;  1XAE A;  2A54 B;  2EMN A;  1YHG A;  2DUF A;  4EDS A;  2FZU A;  3OSQ A;  2H9W A;  3DQD A;  1XA9 A;  3LVD A;  3EKH A;  3K1K A;  1QY3 A;  4DXI A;  3CFH A;  1RM9 A;  4DKM A;  4ANJ A;  2A52 B;  4W6J A;  4W6S A;  4J88 A;  2Z1O A;  2VZX A;  3TMT A;  5FVG A;  2WSN A;  4IK3 A;  4OY4 A;  3VHT A;  4RYW A;  3DQF A;  4W7A A;  4ZFS A;  5LTQ A;  3SSY A;  4L12 A;  2HPW A;  3M24 A;  1YFP A;  4L13 A;  2G3O A;  4HVF A;  5DTL A;  2OKW A;  4KF5 A;  3OSR A;  3DQ6 A;  4H47 A;  3ADF A;  3DQ8 A;  2JAD A;  2QLE A;  3SRY A;  3ST3 A;  4KW8 A;  5DY6 A;  4W76 A;  5EXC I;  2WIQ A;  3SVO A;  4LQU A;  3UG0 A;  2OKY A;  4P76 A;  4W6G A;  2QLG A;  4HE4 A;  1H4U A;  3DQ4 A;  3IP2 A;  5HW9 A;  1F09 A;  3E5T A;  1KYP A;  3AI4 A;  3DQE A;  4H3L A;  3SV5 A;  5DTX A;  3ZUJ A;  3KCS A;  4LJC A;  3MGF A;  4J8A A;  4ZF3 A;  5EXB A;  2QLH A;  3SG4 A;  1F0B A;  3ZTF A;  1Z1P A;  2H5O A;  4W74 A;  5BT0 A;  2A50 B;  1W7S A;  3DPX A;  3DQC A;  3SG5 A;  1EMA A;  2WSO A;  3EKJ A;  3SS0 A;  1UIS A;  3VIC A;  4KA9 A;  2G6E A;  4W6A A;  2HGY A;  4Q7T A;  4W6I A;  4B30 B;  1RMM A;  2DDD A;  1BFP A;  4ZBL A;  3SVR A;  1RRX A;  3P28 A;  3G9A A;  2ARL A;  1EMK A;  1JBZ A;  3S05 A;  4DKN A;  4Z4K A;  1GGX A;  4JEO A;  1OXE A;  3LVC A;  4JGE A;  4B30 A;  2A48 A;  2DUG A;  1MOV A;  3DQO A;  2QT2 A;  2VAE A;  2ZMU A;  1H6R A;  3DQA A;  1OXF A;  4W6O A;  3SG6 A;  3ST0 A;  2P4M A;  5HBD A;  2WHU A;  2IE2 A;  4W72 A;  5DPH A;  2AWM A;  5LTR A;  2DDC A;  1Q4D A;  4B5Y A;  4PPL A;  3CD9 A;  4I2Y A;  3SVE A;  4KW9 A;  3IR8 A;  2DUE A;  2ZO7 A;  3SSV A;  5EHU A;  4W6P A;  2IB5 A;  4AR7 A;  3SVB A;  5EBJ A;  5DTZ A;  1W7T A;  2HFC A;  2HGD A;  3M22 A;  2VVH A;  3DQ2 A;  5FHV A;  3W1D A;  4W6L A;  1YHH A;  4PPK A;  1C4F A;  4ZIN A;  4IZN A;  1ZGP A;  4XVP A;  3SVN A;  3GJ2 A;  4RTC A;  3U8P A;  3LF4 B;  5HZS A;  1ZGO A;  5DPJ A;  3CGL A;  3NT3 A;  4IK5 A;  4JRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...