2DUKA

Crystal structure of ms0616
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
138
structure length
138
Chain Sequence
TRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFENQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MS0616
publication title Crystal structure of MS0616
rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 32
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature ec 3.6.1.52: Diphosphoinositol-polyphosphate diphosphatase.
pdb deposition date 2006-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2dukA00
4JZSA 3O8SA 3F13A 3FCMA 3O6ZA 3GRNA 1V8MA 2DSDA 5GHMA 3SONA 1V8IA 1V8TA 4HFQA 2Q9PA 5GHJA 2G73A 3GZ5A 5IW4A 1K26A 3GG6A 5LPGA 1IRYA 5FSMA 3MDIA 1TUMA 3HHJA 1VRLA 4ZG0A 3WHWA 4K6EA 5GHQA 4N1UA 1SJYA 5GHIA 3X0SA 1Q33A 2QJOA 1G9QA 4V14A 5ANSA 1OW2A 5C7QA 5IW5A 2ICKA 3ACAA 4ILQA 1G0SA 3Q91A 3P6YA 2B2KA 1X51A 2GT4A 3X0NA 1NFZA 3GZ8A 2B06A 3COUA 3SHDA 3KVHA 1X84A 2O5WA 3MCFA 1PPVA 1QVJA 1MP2A 1V8LA 4N1TA 1NFSA 3A6UA 1V8RA 1KTGA 2YVMA 3X0QA 2GB5A 1PPWA 1JRKA 2I6KA 1VC9A 3H95A 3HYQA 3G0QA 2I8TA 4S2VA 5DPKA 3X0OA 1XSCA 3A6SA 2DUKA 1V8SA 1XSAA 3EEUA 2R5WA 2CL3A 4IJXA 4YOQA 1VHZA 3ZR1A 3FFUA 5DDGA 3MGMA 5GHPA 5C8LA 3DUPA 2DSCA 5ANTA 2RRKA 5FSIA 2PNYA 2VNPA 5FSLA 3A6TA 3O69A 4YPHA 3Q2SA 5DEQA 1RRQA 4JZTA 3OGAA 3FJYA 5ANWA 3X0RA 1SOIA 2I8UA 3N9UA 1I9AA 3BHOA 3R03A 4MPOA 3E57A 1VCDA 4KTBA 5ISYA 1HZTA 1V8WA 3Q2TA 1PUQA 4KYXA 5FSKA 2FMLA 3O52A 5CFJA 1V8YA 2A8TA 3CNGA 4S2XA 3FSPA 2G74A 2J8QA 5FSNA 4DYWA 3X0MA 1XSBA 2O5FA 2PQVA 1Q54A 5BONA 2JVBA 3EF5A 3N77A 2ICJA 5DD4A 3X0PA 3X0LA 4ICKA 1V8NA 2A8PA 1MQWA 2QJTA 2AZWA 3F6AA 2YVOA 5BS6A 4C9WA 1KT9A 3Q1PA 1RRSA 4JZUA 1NQZA 4S2WA 2W4EA 3GWYA 3A6VA 2KDWA 3RH7A 3GZ6A 2QKMB 3L85A 1R67A 2DHOA 5FSOA 1VIQA 2YYHA 3X0JA 2VNQA 5GHNA 2XSQA 5CFIA 3AC9A 4S2YA 1F3YA 5ANVA 2YVPA 3X0IA 5HZXA 2GT2A 3EESA 4YPRA 1SZ3A 2A8QA 1VIUA 3I9XA 3O61A 2FVVA 3FK9A 2A6TA 4KG4A 2YVNA 5C7TA 3SMDA 1VK6A 5GHOA 1K2EA 1MQEA 4KG3A 2FKBA 1PPXA 4JZVA 1MR2A 2KDVA 3Q4IA 1VC8A 4NFXA 3ID9A 1Q27A 1V8UA 4NFWA 1HX3A 3DKUA 2B0VA 3I7VA 4C9XA 3J7Ye 3U53A 1GA7A 2DSBA 3ZR0A 1VHGA 3BAPA 1PUSA 1SU2A 3Q93A 5I8UA 4HVYA 1MUTA 2O1CA 3BM4A 1X83A 3EXQA 1KHZA 1V8VA 3MDGA 1RYAA 1MK1A 1PVFA 2A8RA 5ANUA 1NQYA 1U20A 1JKNA 3QSJA 3P5TA 1PUNA 3X0KA 3I7UA 2A8SA
chains in the Genus database with same CATH superfamily
4JZSA 3O8SA 3F13A 3FCMA 3O6ZA 3GRNA 1V8MA 2DSDA 5GHMA 3SONA 1V8IA 1V8TA 4HFQA 2Q9PA 5GHJA 2G73A 3GZ5A 5IW4A 1K26A 3GG6A 5LPGA 1IRYA 5FSMA 3MDIA 1TUMA 3HHJA 1VRLA 4J7GA 4ZG0A 3WHWA 4K6EA 5GHQA 4N1UA 1SJYA 5GHIA 3X0SA 1Q33A 2QJOA 1G9QA 4V14A 5ANSA 1OW2A 5C7QA 5IW5A 2ICKA 3ACAA 4ILQA 1G0SA 3Q91A 3P6YA 2B2KA 1X51A 2GT4A 3X0NA 1NFZA 2CZRA 2B06A 3GZ8A 3COUA 3SHDA 3KVHA 1X84A 2O5WA 3MCFA 1PPVA 1QVJA 1MP2A 1V8LA 4N1TA 1NFSA 3A6UA 1V8RA 1KTGA 2YVMA 3X0QA 2GB5A 1PPWA 1JRKA 2I6KA 1VC9A 3H95A 3HYQA 3G0QA 2I8TA 4S2VA 5DPKA 3X0OA 1XSCA 3A6SA 2DUKA 1V8SA 1XSAA 3EEUA 2R5WA 2CL3A 4IJXA 4YOQA 1VHZA 3ZR1A 3FFUA 5DDGA 3MGMA 5GHPA 4J7HA 5C8LA 3DUPA 2DSCA 5ANTA 2RRKA 5FSIA 2PNYA 2VNPA 5FSLA 3A6TA 3O69A 4YPHA 3Q2SA 5DEQA 1RRQA 4JZTA 3OGAA 3FJYA 5ANWA 3X0RA 1SOIA 2I8UA 3N9UA 1I9AA 3BHOA 3R03A 4MPOA 3E57A 1VCDA 4KTBA 5ISYA 1HZTA 1V8WA 3Q2TA 1PUQA 4KYXA 5FSKA 2FMLA 3O52A 5CFJA 1V8YA 2A8TA 3CNGA 4S2XA 3FSPA 2G74A 2J8QA 5FSNA 4DYWA 3X0MA 1XSBA 2O5FA 2PQVA 1Q54A 5BONA 2JVBA 3EF5A 3N77A 2ICJA 5DD4A 3X0PA 3X0LA 4ICKA 1V8NA 2A8PA 1MQWA 2QJTA 2AZWA 3F6AA 2YVOA 5BS6A 4C9WA 1KT9A 3Q1PA 1RRSA 4JZUA 1NQZA 4S2WA 2W4EA 3GWYA 3A6VA 2KDWA 3RH7A 3GZ6A 2QKMB 3L85A 1R67A 2DHOA 5FSOA 1VIQA 2YYHA 3X0JA 2VNQA 5GHNA 2XSQA 5CFIA 3AC9A 4S2YA 1F3YA 5ANVA 2YVPA 3X0IA 5HZXA 2GT2A 3EESA 4YPRA 1SZ3A 2A8QA 1VIUA 3I9XA 3O61A 2FVVA 3FK9A 2A6TA 4KG4A 2YVNA 5C7TA 3SMDA 1VK6A 5GHOA 1K2EA 1MQEA 4KG3A 2FKBA 1PPXA 4JZVA 1MR2A 2KDVA 3Q4IA 1VC8A 4NFXA 3ID9A 1Q27A 1V8UA 4NFWA 1HX3A 3DKUA 2B0VA 3I7VA 4C9XA 3J7Ye 3U53A 1GA7A 2DSBA 3ZR0A 1VHGA 3BAPA 1PUSA 1SU2A 3Q93A 5I8UA 4HVYA 1MUTA 2O1CA 3BM4A 1X83A 3EXQA 1KHZA 1V8VA 3MDGA 1RYAA 1MK1A 1PVFA 2A8RA 5ANUA 1NQYA 1U20A 1JKNA 3QSJA 3P5TA 1PUNA 3X0KA 3I7UA 2A8SA
chains in the Genus database with same CATH topology
4JZSA 3O8SA 3F13A 3FCMA 3O6ZA 3GRNA 1V8MA 2DSDA 5GHMA 3SONA 1V8IA 1V8TA 4HFQA 2Q9PA 5GHJA 2G73A 3GZ5A 5IW4A 1K26A 3GG6A 5LPGA 1IRYA 5FSMA 3MDIA 1TUMA 3HHJA 1VRLA 4J7GA 4ZG0A 3WHWA 4K6EA 5GHQA 4N1UA 1SJYA 5GHIA 3X0SA 1Q33A 2QJOA 1G9QA 4V14A 5ANSA 1OW2A 5C7QA 5IW5A 2ICKA 3ACAA 4ILQA 1G0SA 3Q91A 3P6YA 2B2KA 1X51A 2GT4A 3X0NA 1NFZA 2CZRA 2B06A 3GZ8A 3COUA 3SHDA 3KVHA 1X84A 2O5WA 3MCFA 1PPVA 1QVJA 1MP2A 1V8LA 4N1TA 1NFSA 3A6UA 1V8RA 1KTGA 2YVMA 3X0QA 2GB5A 1PPWA 1JRKA 2I6KA 1VC9A 3H95A 3HYQA 3G0QA 2I8TA 4S2VA 5DPKA 3X0OA 1XSCA 3A6SA 2DUKA 1V8SA 1XSAA 3EEUA 2R5WA 2CL3A 4IJXA 4YOQA 1VHZA 3ZR1A 3FFUA 5DDGA 3MGMA 5GHPA 4J7HA 5C8LA 3DUPA 2DSCA 5ANTA 2RRKA 5FSIA 2PNYA 2VNPA 5FSLA 3A6TA 3O69A 4YPHA 3Q2SA 5DEQA 1RRQA 4JZTA 3OGAA 3FJYA 5ANWA 3X0RA 1SOIA 2I8UA 3N9UA 1I9AA 3BHOA 3R03A 4MPOA 3E57A 1VCDA 4KTBA 5ISYA 1HZTA 1V8WA 3Q2TA 1PUQA 4KYXA 5FSKA 2FMLA 3O52A 5CFJA 1V8YA 2A8TA 3CNGA 4S2XA 3FSPA 2G74A 2J8QA 5FSNA 4DYWA 3X0MA 1XSBA 2O5FA 2PQVA 1Q54A 5BONA 2JVBA 3EF5A 3N77A 2ICJA 5DD4A 3X0PA 3X0LA 4ICKA 1V8NA 2A8PA 1MQWA 2QJTA 2AZWA 3F6AA 2YVOA 5BS6A 4C9WA 1KT9A 3Q1PA 1RRSA 4JZUA 1NQZA 4S2WA 2W4EA 3GWYA 3A6VA 2KDWA 3RH7A 3GZ6A 2QKMB 3L85A 1R67A 2DHOA 5FSOA 1VIQA 2YYHA 3X0JA 2VNQA 5GHNA 2XSQA 5CFIA 3AC9A 4S2YA 1F3YA 5ANVA 2YVPA 3X0IA 5HZXA 2GT2A 3EESA 4YPRA 1SZ3A 2A8QA 1VIUA 3I9XA 3O61A 2FVVA 3FK9A 2A6TA 4KG4A 2YVNA 5C7TA 3SMDA 1VK6A 5GHOA 1K2EA 1MQEA 4KG3A 2FKBA 1PPXA 4JZVA 1MR2A 2KDVA 3Q4IA 1VC8A 4NFXA 3ID9A 1Q27A 1V8UA 4NFWA 1HX3A 3DKUA 2B0VA 3I7VA 4C9XA 3J7Ye 3U53A 1GA7A 2DSBA 3ZR0A 1VHGA 3BAPA 1PUSA 1SU2A 3Q93A 5I8UA 4HVYA 1MUTA 2O1CA 3BM4A 1X83A 3EXQA 1KHZA 1V8VA 3MDGA 1RYAA 1MK1A 1PVFA 2A8RA 5ANUA 1NQYA 1U20A 1JKNA 3QSJA 3P5TA 1PUNA 3X0KA 3I7UA 2A8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZS A;  3O8S A;  3F13 A;  3FCM A;  3O6Z A;  3GRN A;  1V8M A;  2DSD A;  5GHM A;  3SON A;  1V8I A;  1V8T A;  4HFQ A;  2Q9P A;  5GHJ A;  2G73 A;  3GZ5 A;  5IW4 A;  1K26 A;  3GG6 A;  5LPG A;  1IRY A;  5FSM A;  3MDI A;  1TUM A;  3HHJ A;  1VRL A;  4ZG0 A;  3WHW A;  4K6E A;  5GHQ A;  4N1U A;  1SJY A;  5GHI A;  3X0S A;  1Q33 A;  2QJO A;  1G9Q A;  4V14 A;  5ANS A;  1OW2 A;  5C7Q A;  5IW5 A;  2ICK A;  3ACA A;  4ILQ A;  1G0S A;  3Q91 A;  3P6Y A;  2B2K A;  1X51 A;  2GT4 A;  3X0N A;  1NFZ A;  3GZ8 A;  2B06 A;  3COU A;  3SHD A;  3KVH A;  1X84 A;  2O5W A;  3MCF A;  1PPV A;  1QVJ A;  1MP2 A;  1V8L A;  4N1T A;  1NFS A;  3A6U A;  1V8R A;  1KTG A;  2YVM A;  3X0Q A;  2GB5 A;  1PPW A;  1JRK A;  2I6K A;  1VC9 A;  3H95 A;  3HYQ A;  3G0Q A;  2I8T A;  4S2V A;  5DPK A;  3X0O A;  1XSC A;  3A6S A;  2DUK A;  1V8S A;  1XSA A;  3EEU A;  2R5W A;  2CL3 A;  4IJX A;  4YOQ A;  1VHZ A;  3ZR1 A;  3FFU A;  5DDG A;  3MGM A;  5GHP A;  5C8L A;  3DUP A;  2DSC A;  5ANT A;  2RRK A;  5FSI A;  2PNY A;  2VNP A;  5FSL A;  3A6T A;  3O69 A;  4YPH A;  3Q2S A;  5DEQ A;  1RRQ A;  4JZT A;  3OGA A;  3FJY A;  5ANW A;  3X0R A;  1SOI A;  2I8U A;  3N9U A;  1I9A A;  3BHO A;  3R03 A;  4MPO A;  3E57 A;  1VCD A;  4KTB A;  5ISY A;  1HZT A;  1V8W A;  3Q2T A;  1PUQ A;  4KYX A;  5FSK A;  2FML A;  3O52 A;  5CFJ A;  1V8Y A;  2A8T A;  3CNG A;  4S2X A;  3FSP A;  2G74 A;  2J8Q A;  5FSN A;  4DYW A;  3X0M A;  1XSB A;  2O5F A;  2PQV A;  1Q54 A;  5BON A;  2JVB A;  3EF5 A;  3N77 A;  2ICJ A;  5DD4 A;  3X0P A;  3X0L A;  4ICK A;  1V8N A;  2A8P A;  1MQW A;  2QJT A;  2AZW A;  3F6A A;  2YVO A;  5BS6 A;  4C9W A;  1KT9 A;  3Q1P A;  1RRS A;  4JZU A;  1NQZ A;  4S2W A;  2W4E A;  3GWY A;  3A6V A;  2KDW A;  3RH7 A;  3GZ6 A;  2QKM B;  3L85 A;  1R67 A;  2DHO A;  5FSO A;  1VIQ A;  2YYH A;  3X0J A;  2VNQ A;  5GHN A;  2XSQ A;  5CFI A;  3AC9 A;  4S2Y A;  1F3Y A;  5ANV A;  2YVP A;  3X0I A;  5HZX A;  2GT2 A;  3EES A;  4YPR A;  1SZ3 A;  2A8Q A;  1VIU A;  3I9X A;  3O61 A;  2FVV A;  3FK9 A;  2A6T A;  4KG4 A;  2YVN A;  5C7T A;  3SMD A;  1VK6 A;  5GHO A;  1K2E A;  1MQE A;  4KG3 A;  2FKB A;  1PPX A;  4JZV A;  1MR2 A;  2KDV A;  3Q4I A;  1VC8 A;  4NFX A;  3ID9 A;  1Q27 A;  1V8U A;  4NFW A;  1HX3 A;  3DKU A;  2B0V A;  3I7V A;  4C9X A;  3J7Y e;  3U53 A;  1GA7 A;  2DSB A;  3ZR0 A;  1VHG A;  3BAP A;  1PUS A;  1SU2 A;  3Q93 A;  5I8U A;  4HVY A;  1MUT A;  2O1C A;  3BM4 A;  1X83 A;  3EXQ A;  1KHZ A;  1V8V A;  3MDG A;  1RYA A;  1MK1 A;  1PVF A;  2A8R A;  5ANU A;  1NQY A;  1U20 A;  1JKN A;  3QSJ A;  3P5T A;  1PUN A;  3X0K A;  3I7U A;  2A8S A; 
#chains in the Genus database with same CATH topology
 4JZS A;  3O8S A;  3F13 A;  3FCM A;  3O6Z A;  3GRN A;  1V8M A;  2DSD A;  5GHM A;  3SON A;  1V8I A;  1V8T A;  4HFQ A;  2Q9P A;  5GHJ A;  2G73 A;  3GZ5 A;  5IW4 A;  1K26 A;  3GG6 A;  5LPG A;  1IRY A;  5FSM A;  3MDI A;  1TUM A;  3HHJ A;  1VRL A;  4J7G A;  4ZG0 A;  3WHW A;  4K6E A;  5GHQ A;  4N1U A;  1SJY A;  5GHI A;  3X0S A;  1Q33 A;  2QJO A;  1G9Q A;  4V14 A;  5ANS A;  1OW2 A;  5C7Q A;  5IW5 A;  2ICK A;  3ACA A;  4ILQ A;  1G0S A;  3Q91 A;  3P6Y A;  2B2K A;  1X51 A;  2GT4 A;  3X0N A;  1NFZ A;  2CZR A;  2B06 A;  3GZ8 A;  3COU A;  3SHD A;  3KVH A;  1X84 A;  2O5W A;  3MCF A;  1PPV A;  1QVJ A;  1MP2 A;  1V8L A;  4N1T A;  1NFS A;  3A6U A;  1V8R A;  1KTG A;  2YVM A;  3X0Q A;  2GB5 A;  1PPW A;  1JRK A;  2I6K A;  1VC9 A;  3H95 A;  3HYQ A;  3G0Q A;  2I8T A;  4S2V A;  5DPK A;  3X0O A;  1XSC A;  3A6S A;  2DUK A;  1V8S A;  1XSA A;  3EEU A;  2R5W A;  2CL3 A;  4IJX A;  4YOQ A;  1VHZ A;  3ZR1 A;  3FFU A;  5DDG A;  3MGM A;  5GHP A;  4J7H A;  5C8L A;  3DUP A;  2DSC A;  5ANT A;  2RRK A;  5FSI A;  2PNY A;  2VNP A;  5FSL A;  3A6T A;  3O69 A;  4YPH A;  3Q2S A;  5DEQ A;  1RRQ A;  4JZT A;  3OGA A;  3FJY A;  5ANW A;  3X0R A;  1SOI A;  2I8U A;  3N9U A;  1I9A A;  3BHO A;  3R03 A;  4MPO A;  3E57 A;  1VCD A;  4KTB A;  5ISY A;  1HZT A;  1V8W A;  3Q2T A;  1PUQ A;  4KYX A;  5FSK A;  2FML A;  3O52 A;  5CFJ A;  1V8Y A;  2A8T A;  3CNG A;  4S2X A;  3FSP A;  2G74 A;  2J8Q A;  5FSN A;  4DYW A;  3X0M A;  1XSB A;  2O5F A;  2PQV A;  1Q54 A;  5BON A;  2JVB A;  3EF5 A;  3N77 A;  2ICJ A;  5DD4 A;  3X0P A;  3X0L A;  4ICK A;  1V8N A;  2A8P A;  1MQW A;  2QJT A;  2AZW A;  3F6A A;  2YVO A;  5BS6 A;  4C9W A;  1KT9 A;  3Q1P A;  1RRS A;  4JZU A;  1NQZ A;  4S2W A;  2W4E A;  3GWY A;  3A6V A;  2KDW A;  3RH7 A;  3GZ6 A;  2QKM B;  3L85 A;  1R67 A;  2DHO A;  5FSO A;  1VIQ A;  2YYH A;  3X0J A;  2VNQ A;  5GHN A;  2XSQ A;  5CFI A;  3AC9 A;  4S2Y A;  1F3Y A;  5ANV A;  2YVP A;  3X0I A;  5HZX A;  2GT2 A;  3EES A;  4YPR A;  1SZ3 A;  2A8Q A;  1VIU A;  3I9X A;  3O61 A;  2FVV A;  3FK9 A;  2A6T A;  4KG4 A;  2YVN A;  5C7T A;  3SMD A;  1VK6 A;  5GHO A;  1K2E A;  1MQE A;  4KG3 A;  2FKB A;  1PPX A;  4JZV A;  1MR2 A;  2KDV A;  3Q4I A;  1VC8 A;  4NFX A;  3ID9 A;  1Q27 A;  1V8U A;  4NFW A;  1HX3 A;  3DKU A;  2B0V A;  3I7V A;  4C9X A;  3J7Y e;  3U53 A;  1GA7 A;  2DSB A;  3ZR0 A;  1VHG A;  3BAP A;  1PUS A;  1SU2 A;  3Q93 A;  5I8U A;  4HVY A;  1MUT A;  2O1C A;  3BM4 A;  1X83 A;  3EXQ A;  1KHZ A;  1V8V A;  3MDG A;  1RYA A;  1MK1 A;  1PVF A;  2A8R A;  5ANU A;  1NQY A;  1U20 A;  1JKN A;  3QSJ A;  3P5T A;  1PUN A;  3X0K A;  3I7U A;  2A8S A; 
#chains in the Genus database with same CATH homology
 4JZS A;  3O8S A;  3F13 A;  3FCM A;  3O6Z A;  3GRN A;  1V8M A;  2DSD A;  5GHM A;  3SON A;  1V8I A;  1V8T A;  4HFQ A;  2Q9P A;  5GHJ A;  2G73 A;  3GZ5 A;  5IW4 A;  1K26 A;  3GG6 A;  5LPG A;  1IRY A;  5FSM A;  3MDI A;  1TUM A;  3HHJ A;  1VRL A;  4J7G A;  4ZG0 A;  3WHW A;  4K6E A;  5GHQ A;  4N1U A;  1SJY A;  5GHI A;  3X0S A;  1Q33 A;  2QJO A;  1G9Q A;  4V14 A;  5ANS A;  1OW2 A;  5C7Q A;  5IW5 A;  2ICK A;  3ACA A;  4ILQ A;  1G0S A;  3Q91 A;  3P6Y A;  2B2K A;  1X51 A;  2GT4 A;  3X0N A;  1NFZ A;  2CZR A;  2B06 A;  3GZ8 A;  3COU A;  3SHD A;  3KVH A;  1X84 A;  2O5W A;  3MCF A;  1PPV A;  1QVJ A;  1MP2 A;  1V8L A;  4N1T A;  1NFS A;  3A6U A;  1V8R A;  1KTG A;  2YVM A;  3X0Q A;  2GB5 A;  1PPW A;  1JRK A;  2I6K A;  1VC9 A;  3H95 A;  3HYQ A;  3G0Q A;  2I8T A;  4S2V A;  5DPK A;  3X0O A;  1XSC A;  3A6S A;  2DUK A;  1V8S A;  1XSA A;  3EEU A;  2R5W A;  2CL3 A;  4IJX A;  4YOQ A;  1VHZ A;  3ZR1 A;  3FFU A;  5DDG A;  3MGM A;  5GHP A;  4J7H A;  5C8L A;  3DUP A;  2DSC A;  5ANT A;  2RRK A;  5FSI A;  2PNY A;  2VNP A;  5FSL A;  3A6T A;  3O69 A;  4YPH A;  3Q2S A;  5DEQ A;  1RRQ A;  4JZT A;  3OGA A;  3FJY A;  5ANW A;  3X0R A;  1SOI A;  2I8U A;  3N9U A;  1I9A A;  3BHO A;  3R03 A;  4MPO A;  3E57 A;  1VCD A;  4KTB A;  5ISY A;  1HZT A;  1V8W A;  3Q2T A;  1PUQ A;  4KYX A;  5FSK A;  2FML A;  3O52 A;  5CFJ A;  1V8Y A;  2A8T A;  3CNG A;  4S2X A;  3FSP A;  2G74 A;  2J8Q A;  5FSN A;  4DYW A;  3X0M A;  1XSB A;  2O5F A;  2PQV A;  1Q54 A;  5BON A;  2JVB A;  3EF5 A;  3N77 A;  2ICJ A;  5DD4 A;  3X0P A;  3X0L A;  4ICK A;  1V8N A;  2A8P A;  1MQW A;  2QJT A;  2AZW A;  3F6A A;  2YVO A;  5BS6 A;  4C9W A;  1KT9 A;  3Q1P A;  1RRS A;  4JZU A;  1NQZ A;  4S2W A;  2W4E A;  3GWY A;  3A6V A;  2KDW A;  3RH7 A;  3GZ6 A;  2QKM B;  3L85 A;  1R67 A;  2DHO A;  5FSO A;  1VIQ A;  2YYH A;  3X0J A;  2VNQ A;  5GHN A;  2XSQ A;  5CFI A;  3AC9 A;  4S2Y A;  1F3Y A;  5ANV A;  2YVP A;  3X0I A;  5HZX A;  2GT2 A;  3EES A;  4YPR A;  1SZ3 A;  2A8Q A;  1VIU A;  3I9X A;  3O61 A;  2FVV A;  3FK9 A;  2A6T A;  4KG4 A;  2YVN A;  5C7T A;  3SMD A;  1VK6 A;  5GHO A;  1K2E A;  1MQE A;  4KG3 A;  2FKB A;  1PPX A;  4JZV A;  1MR2 A;  2KDV A;  3Q4I A;  1VC8 A;  4NFX A;  3ID9 A;  1Q27 A;  1V8U A;  4NFW A;  1HX3 A;  3DKU A;  2B0V A;  3I7V A;  4C9X A;  3J7Y e;  3U53 A;  1GA7 A;  2DSB A;  3ZR0 A;  1VHG A;  3BAP A;  1PUS A;  1SU2 A;  3Q93 A;  5I8U A;  4HVY A;  1MUT A;  2O1C A;  3BM4 A;  1X83 A;  3EXQ A;  1KHZ A;  1V8V A;  3MDG A;  1RYA A;  1MK1 A;  1PVF A;  2A8R A;  5ANU A;  1NQY A;  1U20 A;  1JKN A;  3QSJ A;  3P5T A;  1PUN A;  3X0K A;  3I7U A;  2A8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...