2DUOA

Crystal structure of vip36 exoplasmic/lumenal domain, ca2+-bound form
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
250
structure length
245
Chain Sequence
EHLKREHSLIKPYQGVGSSSMPLWDFQGSTILTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTIDWTKIEPSVNFLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vesicular integral-membrane protein VIP36
publication title Structural basis for recognition of high mannose type glycoproteins by mammalian transport lectin VIP36
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Protein transport
total genus 57
structure length 245
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2duoA01
4CRQA 1HKDA 5H9QA 4YW5A 4Y26A 2AUYA 1Q8QA 1SLLA 2YY1A 4Q2FA 5JOWA 3IM0A 2EXJA 4XZPA 2NMOA 4YM2A 3RMYA 5IK5A 3CNAA 1CESA 2SBAA 1N3PA 2AGSA 3IPVA 3ZPYA 3ZSLA 4FPJA 1W6QA 4U36A 1BJQA 1N47A 3RRDA 1V6NA 5KXCA 5DUWA 1LGBA 1WUVA 1W0OA 3WHTA 1H9WA 4M00A 2JE9A 1IOAA 2PHRA 2UWBA 4MYEA 2E53A 5GLUA 2PHUA 4AGGA 1LODA 2PELA 2ZAAA 3V65A 3D4KA 2C9AA 2EALA 4Q1RA 4CTEA 1DYPA 2XG3A 2A6VA 2ZZJA 4RA0A 4FPYA 3INAA 1KDKA 4Q8LA 1UAIA 2D43A 2CY6A 1JW6A 3BTAA 2A6XA 1DQ4A 3Q9OA 4FPGA 1GLHA 1KQRA 1MS0A 3N7JA 4YW2A 2D6LX 3UJOA 3BODA 4ZXKA 1ENRA 4F83A 1KJRA 2DVFA 2PHXA 2YXSA 3SH3A 1JUIA 4TZDA 4P9YA 2DV9A 3SH5A 1DGLA 1DIWA 2PHWA 3IPVB 3L2YA 2CWMA 4WVWA 5T50A 2VUAA 1W6QB 1A8DA 3N7KA 1LEMA 4YGCA 1FATA 4DQAA 1QDOA 4LBJA 2WSUA 4FQZA 1SLBA 1LGNA 4FPOB 2D6KA 2ZGRA 1AX0A 1FV2A 2E6VA 2GDFA 1MS4A 4XXAA 4M3CF 3VKOA 2P34A 1N1YA 1URXA 2VH9A 2HYKA 1OKQA 4XOGA 2D7FA 1MS5A 3A0KA 3RMXA 1G9CA 3NV3A 2R1BA 1LU1A 4FOVA 4AVTA 3RQ0A 3N35A 4XJZA 1UL9A 4YG3A 2AREA 2OUHA 1ZA4A 1W6PA 3RSJA 3FFZA 4XE9A 1S0GA 3T2TA 3T1MA 1MZ6A 4AVSA 4XMAA 5DG1A 4SLIA 5FREA 5JOYA 3HN1A 1S0FA 2LALA 4Y1VA 4YZ5A 2EAKA 4Q26A 5GM0A 5EYYA 2PHFA 1ULGA 3SITA 2ZMLA 1MVEA 3WDVA 4Y20A 3WDUA 1G9DA 4FPCA 1HQLA 1S0JA 1ULFA 4XXPA 3ZXKA 2GNTA 4FPHA 4YZ4A 4C1XA 4YM3A 2A75A 3A4UA 3OBTA 1JYIA 2ZGUA 4WZFA 5E88A 1AXYA 1V6OA 5KXBA 4XYXA 1LOCA 1SLTA 1LEDA 5T5JA 2OVUA 5GZCA 1DBNA 3AP9A 5T5OA 5SV8A 2NP0A 4FPKA 3ZYPA 2DWRA 2LTNA 4FQ4A 1QNYA 4XBQA 2AH2A 1LCLA 4YFZA 2GNDA 4YW4A 5GJ6A 3OBRA 5GALA 1VALA 1YI7A 4DPNA 3D6EA 4Q1PA 1W6PB 1CVNA 1QF3A 2YROA 1I3HA 2P3JA 1N1VA 5CBLA 3TAYA 3DGTA 1D2SA 4Y1XA 2A3YA 4FPLA 2ZKNA 3FUOA 1FAYA 4GKYA 4RL7A 3GALA 4BQ1A 3PVNA 2NZ9A 2WQZC 1UPSA 2ZBJA 4FOYA 4R9CA 3MW4A 2VW2A 3WNXA 1BQPA 3NV1A 4XIOA 2EF6A 1N3OA 5IK4A 2A5ZA 4XJAA 3WDTA 2XB6C 4H55A 1IKPA 1JOJA 1NLSA 2AENA 4Y20B 1LOEA 5JOXA 1AX1A 1S0EA 2V73A 4R9DA 4ASMB 1GV9A 2ZGKA 4ATEA 4LBNA 4YG0A 4JRAA 3WLUA 1FV3A 2Z42A 1FX5A 2H0BA 3OGGA 2E7TA 1WLWA 2JECA 1QOSA 4U2AA 5DZGA 3UK9A 1JN2P 1ENQA 4LBMA 1QOTA 5GZDA 2ZABA 2ZGOA 3AFKA 3FLRA 1WLDA 3VKLA 3WOGA 3WZ1A 5DUUA 3ZXEA 3AP4A 3D5OA 1UMZA 1KRIA 3B00A 4Y1ZA 3M1HA 1ONAA 3USUB 4YZ1A 5GZGA 2A71A 3B01A 3WUDA 2CNAA 2VY0A 2NN8A 5E89A 1GNZA 1X50A 1LULA 4LBQD 1GNHA 1MVQA 1ULEA 3AJZA 5KXDA 3ASIA 1APNA 1SACA 1SLIA 3WG1A 2W68A 1MS8A 1DHKB 1N1SA 3BIWE 2E7QA 1GICA 1C1LA 3N36A 2UWCA 2VW1A 3HR9A 4XMIA 1HLCA 1LOAA 5F5QA 1A3KA 2DUQA 3AP5A 2D6MA 2FHRA 4GKXA 5CAZA 3GNEA 1GYKA 4UW4A 1ZM1A 2R1DA 2R49A 4BM8A 4IQPA 3M2MA 4Y24A 1LHUA 4OZXA 3PVEA 3ZSJA 5CB7A 1W6OA 3I4IA 3POYA 4M01A 1W0PA 2ZGLA 1J1TA 1SCSA 3N7MA 2ZA9A 3IN9A 4K1YA 4ISQA 2I2SA 4UW6A 2NMNA 5HCFA 3APBA 3WV6A 1C4RA 3LSDA 2R16A 3IMNA 4M3CA 1BZWA 1ENSA 1IS5A 2R0HA 2ZHKA 1YYNA 2ZHNA 4LBQA 4PCRA 4CZSA 3U4XA 2GMMA 4LBKA 3N7LA 1LOBA 4DRRA 4XIKA 3W58A 1RITA 3VKMA 1AX2A 1UN1A 2CYFA 4HL0A 1GBGA 1YRZA 3B3QE 1GANA 2NM1A 1CPMA 3FLPA 4P14A 1UZZA 3AP7A 2UWAA 2CWSA 4GWMA 1FYUA 1LESA 3V64A 4M3CE 4XHXA 2ZMNA 1Z0HA 2DVGA 5LK5A 2A3XA 1QDCA 1W6OB 4YW3A 5IK8A 3WG3A 1SFYA 2GNBA 1V00A 1DLLA 4WV8A 5T54A 2FMDA 3ATGA 4YZ2A 1OFSA 2AYHA 5DXDA 1LOFA 1O4YA 1F9KA 4WVVA 1XQNA 3NV4A 2YZ4A 5GZFA 5FRAA 1FNZA 1DQ5A 4JCKA 3MEPA 2W08A 4YGDA 1G7YA 2P3IA 4M3CB 1RINA 2JD4A 2AR6A 2DU0A 5JOZA 3AZVA 1V6IA 4LBQB 1LHOA 2ZGQA 3O0XA 3LCPA 3V0AA 4XTMA 2R0FA 5DUXA 1IS4A 1V6LA 1HQWA 2OW4A 4UW3A 4HANA 1C1FA 1G9FA 2P37A 2JKBA 1SBEA 3AYAA 1FNYA 2ES3A 1AF9A 2YV8A 3AP6A 4FPFA 1YIFA 3NWKA 4YZ3A 5T55A 3JU9A 2ARXA 5H9SA 3ZSKA 2E51A 3R4SA 1CQ9A 3AYDA 3USUA 2JE7A 2DTWA 4UW5A 1BXHA 1GSLA 4LBOA 3V0BA 3AZWA 5IT6A 1W6MA 1WD4A 3MW2A 3ZXFA 2NYYA 1F5FA 2BQPA 2DVDA 1LHWA 1SBDA 4C1WA 1QMJA 3POWA 5EXOA 2A3WA 3ZYRA 1G9AA 3VV1A 2ZACA 4ITCA 4XJUA 4YLZA 1SLCA 4K20A 4PBPA 2ZGMA 1QU0A 1CN1A 4YGBA 5H9PA 2GALA 1AXKA 1QGLA 3H0OA 3QLQA 5GLVA 3SISA 2RHPA 4DRVA 1WCSA 4K1ZA 3V0AB 2D3PA 2GN7A 2ZGPA 4L8QA 4XHBA 4BPZA 2YMZA 3UJQA 1WW4A 4YG6A 4AYUA 5EWSA 1PZ9A 4FVVA 1G86A 4Y1UA 1SCRA 1TEIA 2A6WA 3WG4A 3ZVXA 1UZYA 4NOTA 1AJOA 1U0AA 1PZ8A 3W59A 1ULCA 3PVOA 2W39A 3BOPA 3POSA 1ULDA 1JXNA 3O5SA 5GLWA 2DURA 3C2UA 3NV2A 1JYCA 4YFWA 1MS9A 4I30A 4LBLA 3V0BB 2KM2A 1LENA 1RIRA 5DZFA 3VKFC 3QCWA 1W6MB 1YO8A 1N1TA 3HMYA 5GLTA 2ARBA 2A70A 1EPWA 2WT2A 2P3KA 5CA6A 2WSVA 1UX6A 1IS6A 5T5LA 1QOOA 2DVAA 1DQ1A 3IKWA 3AJYA 1VAMA 2A6ZA 1LGCA 5BYNA 2JDZA 3MPPG 1G8WA 3MW3A 1GZWA 5AVAA 3SLIA 3WCRA 4AWDA 5JDBA 4PQ9A 4YW1A 4FPEA 4R9BA 3WDXA 1BKZA 1Q56A 2WLQA 4BOWA 4GXLA 3WCSA 5GLZA 4GA9A 1QNWA 1WLCA 1VAVA 2VW0A 1KJLA 3B9CA 1JBCA 1Q8VA 3M3OA 2SLIA 3AYEA 2EXHA 3WVJA 4D69A 4AGRA 2ERFA 3AYCA 2D6NA 3M3EA 3JUUA 3VKNA 3OPZA 1KITA 1AVBA 1AZDA 3T1LA 1LECA 1CJPA 2DUOA 4Q8KA 1DQ0A 1DQ2A 3ZXJA 3FLTA 1A78A 1LOGA 1WBFA 4Q27A 5L73A 5JMCA 4P9XA 1V6JA 4AGVA 1W6NA 1OQ1A 5GZEA 5KXEA 1DYKA 1S0DA 3M3CA 1CPNA 2ZGNA 1LOFC 1S0IA 2A6YA 3AZXA 3B69A 3PMEA 4FP2A 3ILFA 3VUOA 2V5YA 4GALA 3KQRA 1B09A 2ZMKA 4DS0A 5JVVA 5IUQA 1GZWB 4P9WA 5F9TA 1WW6A 3UL2A 3O0WA 4PF5A 3A0NA 2DTYA 1MS3A 1WD3A 4BMBA 4YM0A 1H30A 1S1AA 2OUJA 2WNEA 3N3HA 3O0VA 4FP3A 4K21A 4XJ8A 1V6MA 3AXEA 4FOQA 1YXWA 1O4ZA 2DUPA 1Y7BA 2VXRA 3RG0A 2CL2A 1Q8PA 3SH4A 5IK7A 2G4IA 3R05A 2D6PA 1CIWA 1WW7A 4XJ9A 4W65A 1S0CA 4GWNA 4ATFA 4BLIA 1H9PA 1MR5A 3DUIA 1DQ6A 4XBNA 2CTVA 3WDYA 3ENRA 4TYSA 4XBLA 2WT1A 4Y22A 4Z8BA 3O12A 2WT0A 1LU2A 1W6NB 5DZEA 1WBLA 4DFSA 1LTEA 5T52A 2P2KA 3OY8A 4PBOA 4XILA 2GMEA 3I8TA 1Z78A 4ZKTB 2ZGSA 3KM5A 4XJWA 1CONA 2ZHMA 4AVVA 3AZZA 5CNAA 4JC1A 2W52A 3ZXLA 5E8AA 1C57A 2VU9A 4R9AA 3ILRA 1LJ7A 1NXD1 1V6KA 1LHVA 2DU1A 2WJSA 4XDQA 1S0BA 4NO4A 5T5PA 1PZ7A 5EYXA 2D3SA 3AZYA 3ILNA 1AXZA 4KBBA 1IKQA 1GKBA 3OYWA 5HCAA 1MACA 2ZGTA 1Q8SA 4BMEA 3AX4A 3WG2A 1IS3A 1JHNA 1AJKA 2C5DA 2JJ6A 3AXDA 1F31A 4XTPA 4Y22B 2UURA 2ENRA 3WDWA 3R4UA 4YGEA 1VLNA 2DVBA 3ZSMA 1SBFA 2GNMA 2EXKA 3OY8B 1D0HA 1HDKA 1CR7A 2WKKA 5HCBA 4YM1A 1GZCA 2D3RA 2Q5TA 3WHUA 3FUQA 5JLVA 1MS1A 1LHNA 1Q8OA 3WUCA 2ZHLA 1BYHA 1DFQA 1MZ5A 2EXIA 5DG2A 5H9RA 1QKQA 2D6OX 4FOWA 4Y1YA 3SNMA 2A7AA 1I1EA 1DZQA 4BLJA 2B7YA 2DYCA 2GMPA 3PJQA 4ISRA 1G9BA 2UU8A 3LSEA 1UKGA 3M3QA 3AK0A 3TB0A 2PHTA 3OJBA 3RS6A 2D44A 1N3QA 3OYWB 2TEPA 3FBYA 1KDMA 1WW5A 1GZ9A 1VIWB 5DUVA 2GN3A 1SLAA 2EIGA 1R1ZA
chains in the Genus database with same CATH superfamily
2ET1A 1HKDA 4UI9L 5FYBA 3FC0A 4AQ2A 1CAWB 1Q8QA 4D6SA 4Q2FA 3U14A 3IM0A 4LLFA 5HXMA 3PUQA 1T6GC 4XZPA 1UYPA 2NMOA 3RMYA 1AYN2 4AEDA 3VHRA 1O6UA 5CKQA 2JG8C 4DXTA 1GWKA 3IPVA 4XAEA 3CIHA 5E1RA 2J1VA 1BJQA 4QKBA 2WR9A 1RUG1 3KGLA 3PTRB 1WUVA 1NCQB 4J1XA 1CZSA 4WZCA 1DP0A 5FBZA 1W0NA 3WHTA 4DIQA 1QJY1 2JE9A 3BALA 3TRSB 4AAPA 4AGGA 1OOPC 3PUIA 4HXCA 1RUD3 4QWNA 3DKQA 1CAXB 2WO3A 4Q1RA 2RR11 1MEC1 2A6VA 2CU5A 4E2QA 4EN0A 5FQ0A 3VBUB 5FLHA 5F32A 1IPKA 3ACIA 2OPKA 1UAIA 1TME1 2ID4A 4Q8LA 3TYJA 4Q0UA 5BNQA 5KHJA 1JW6A 3OTFA 4QQ2A 5JIAA 4AI3A 4HPKB 4AR2A 3NKTA 1QJFA 4MLOA 5DAPA 3AB0A 3B93A 5FK7A 3UESA 1AR82 1NZIA 3BODA 4QPGC 3UJOA 4ZXKA 4URAA 5A3MA 1ENRA 1W8OA 2TBVA 3HNYM 3ST7A 4CP0A 1KJRA 2PN5A 4NWWA 2ADEA 3SH5A 2PHWA 5DDJ3 3L2YA 2OYZA 2CWMA 3CO2A 3A21A 2VZQA 2VUAA 5A3OA 5CKNA 5A70A 2GAUA 2CGOA 2HWE1 1D4VB 3THCA 5C4WC 1HB4A 2BOIA 4BK5A 1F4AA 1YEWA 4B4RA 1KGYA 2HWB1 2D6KA 1FV2A 2WNVB 2FMYA 4RHV2 2G9GA 3I3MA 1LR5A 2P34A 2FDFA 4XUPA 3LEMA 5HV4A 5FY8A 2YBPA 1S2BA 4XVHA 2XXZA 4NHKA 5JXJA 4TN7A 1OPMA 1EUTA 4ZHNA 1UL9A 2VNVA 1UIKA 4N8MA 2AREA 2OUHA 2WBKA 1ZA4A 2XQRA 1W6PA 2ARAA 1EAH1 1SHWB 2HEYF 5EP9A 4ZY9A 2DCZA 4OULA 4LEJA 2GU9A 3JBG1 1ASJ1 5FREA 5JOYA 1S0FA 1UOJA 1CAUB 3C7HA 5FMOL 4YZ5A 1FPN1 5GM0A 5BNOC 2HWD3 3QH7A 2LROA 1X33A 3N9PA 1MVEA 4QPIB 3WDVA 5FZLA 1STMA 3FFQA 5CFCB 2X09A 4XXPA 3VBOB 4YZ4A 4YVSB 1C5IA 1NE6A 5J96B 1EUUA 5LASA 3CBNA 3MHZA 1ZZ9A 3OBTA 3ZYBA 5FP7A 1W9WA 1PGSA 3CLPA 3LA7A 3VBHC 1AXYA 3K4AA 3KCXA 2D97A 3S5QA 1SLTA 1K5MB 5T5JA 2OVUA 3KMHA 5T5OA 5SV8A 3HQRA 3WW1A 3VZLA 4XBQA 4NAOA 1HB1A 4BJ0A 3T4HB 5ABJB 3OBRA 5GALA 1YI7A 4FT8A 5IAVA 3WINE 2TNFA 1QF3A 2HWC2 5FTTC 2P3JA 3PNAA 1J3RA 1HXS1 1D2SA 2QQWA 1RUG3 1CAVA 4QX1A 2A3YA 3WQ0A 2ZKNA 2Y34A 2ZX0A 3KCCA 4GKYA 4O9GA 5JZGA 5F37A 4P08A 3X29B 3VBRC 1IGOA 2ZBJA 3BPZA 2P6CA 2VW2A 4S2GA 1N3OA 2WZPP 4XJAA 4BQYA 1J83A 2ZX3A 2RR13 3AMNA 5A7WA 5I91A 3N9OA 4JTOA 3WXPA 2WQ4A 4IEOA 5JOXA 3ZFEC 1AX1A 4R9DA 1GV9A 2WRAA 5K0UA 4CDUA 5A3UA 4FTSA 3VBSC 2Z42A 3K2OA 3UV9A 1QJU1 1QOSA 3AL6A 4BQ3A 3RZKA 1QOTA 3WOGA 1H2MA 3AFKA 1WLDA 3NAPB 2FZ2A 3WZ1A 5DUUA 4H7LA 4MVTA 5F3EA 2MEV2 2YU2A 3M1HA 4LLOA 3D82A 3USUB 4MGKE 1XE0A 5FKBA 1D4M1 4PLOA 2VY0A 3WUDA 2NN8A 4MXWB 4COYA 2HWE3 3PVBB 3BTYA 3HN3A 2YGMA 1LULA 1REEA 5KXDA 1ULEA 3ASIA 3OPTA 3O7OA 1SLIA 3UETA 4D3WA 5I93A 2HWB3 5J3UA 1BBT2 2JICA 4QAWA 5IVCA 1RYYA 3DXTA 4PIXA 3N36A 4XFBA 2FD8A 4N43C 3G7DA 5F5QA 1G6NA 2DUQA 2D6MA 2CAUA 2YB7A 5CAZA 3WQ7A 1YWKA 1VMFA 4ES8A 2R49A 4BM8A 5CG8A 2QQJA 3M2MA 4Y24A 5A33B 1WA4A 3PIJA 1MPXA 3NNGA 1FXZA 1O4TA 4Q4Y1 4QD2A 2RS12 4KWUA 4RGAA 1J1TA 1BEV2 1SCSA 3GXUA 3N7MA 5FPBA 1H2KA 5FZFA 2WA3A 2JX9A 2XHKA 4YPJA 4ISQA 5A1FA 2R32A 4COZA 2WWJA 3LEGA 2QDRA 5HCFA 4A7YA 1C4RA 2WAOA 3LSDA 1Z7S1 2RS51 3IMNA 1XNDA 2Y6LA 2R0HA 1S4CA 2BNOA 4LBQA 1R081 5D21A 3KV9A 2GC3A 2WNUA 4KWKA 4XABA 1XSRA 2GC2A 3M4FA 4XIKA 4RR3B 2LUWA 4CSWA 3MV01 3SC7X 1Y4WA 4XFGA 4J6GA 3BPSA 2ZEZA 3I2DA 1YHFA 4OUMA 4NE9A 1IQDC 2MPFA 1CPMA 4P14A 2JXAA 4PDWA 5LBBA 4XPVA 3AP7A 5B2GB 2CWSA 2YC0A 5AFBA 1B35C 4IEYA 1UY3A 2V4VA 2ZMNA 1Z0HA 3OBAA 4A2UA 2A3XA 3OB8A 2XHNA 1SEFA 1W6OB 4AFMA 5BNPA 1HXS3 1V00A 3GCWA 4L92A 4WV8A 3DKWA 4YZ2A 5IHRA 4EZHA 2QNKA 1LOFA 5F39A 2BBVA 4CP2A 1CGPA 1W04A 3OUIA 1UU6A 4PF1A 1C8M3 2Y0IA 1SZBA 1DQ5A 3ACGA 3UT0A 3MEPA 3POIA 4YGDA 4NHLA 2IVJA 1RUD2 3OUHA 5JPNB 1ZREA 2G19A 4YVWB 2JD4A 1GNYA 1WCKA 1NLQA 3KLSA 3ETQA 1NZCA 2B8MA 5LA9A 3PMSA 5CISA 1C1FA 1COV1 1UMIA 4YWAA 1NA1C 3AP6A 4OFGA 5LEJA 5AC92 4QM8A 2OKXA 4AQTA 1F2NA 3VZKA 1UZWA 4YZ3A 5T55A 2ARXA 3AVRA 4LK6A 5EZWA 3R4SA 3ZXGA 1CQ9A 4NAMA 3AYDA 3BB6A 3W9AA 1D4M3 5FY4A 1ZZ8A 2XDVA 3MDPA 3WF1A 3V0BA 1YUDA 1YJLA 5IT6A 3VHPA 4AVBA 4CU7A 4QXKA 3I49A 1SBDA 3POWA 5EXOA 2A3WA 2WINB 4CEWB 2E63A 1G9AA 4EWEA 3H8XA 4ITCA 3Q8AA 3J7NA 3DV8A 1HN1A 2VGDA 2PAEA 1SLCA 4K20A 5E6HA 5FZBA 2JDYA 4IV3A 2EA7A 1PO13 1OHFA 1QU0A 2D5HA 2D98A 4XDPA 5H9PA 4NHXA 4EN8B 2J1TA 1UOBA 1OI6A 1WMEA 2GN7A 2RV9A 2YMZA 3UJQA 4AF9A 2P4EA 4YG6A 4MO3M 2WNVC 2H0VA 2Y0OA 1SCRA 4Y1UA 4CPBD 2W1WA 3AKTA 3ZVXA 5A32A 2Y6HA 1VBE1 4B4PA 2DFBA 2OS2A 1UY4A 4QPWA 4P9LA 4XFIA 2WZR2 3WX5A 4LO6B 2W39A 4X6QB 2HBTA 4WM7A 1VP6A 3I2HA 2RS33 2XJQA 3M7AA 5C3OA 1H8TC 1XNKA 3O5SA 3C2UA 3POFA 4LOTA 1KS4A 1YQ5A 2WQ8A 5FP9A 2KM2A 3VZJA 3VKFC 2WL1A 1PMIA 2WNOA 4IL7A 5IVYA 2ZX4A 3HMYA 1R083 2ARBA 2A70A 4B1MA 1WA6X 2WFF2 4BXFA 3MIDA 3RYRA 4IEVA 2DVAA 4TWTA 1DQ1A 1NUKA 3AJYA 4IEPA 2JDZA 2QTWB 2VZRA 1W2NA 5EPAA 1OH4A 1RC6A 4FPEA 1BKZA 5L9BA 3WDXA 5ACA3 3P6BA 5CFCC 2I74A 4EE2A 1UO9A 2VOXA 1PMJX 3B9CA 1Q8VA 2RJKA 3ES1A 1W90A 4K40A 3D0SA 1HRI3 3P5BA 1OA2A 3SKVA 5FOJB 5IYYA 4JDMA 1KITA 1AVBA 1K5MC 4NIIA 3T1LA 1RUG2 2PFWA 1VBA1 1XU1A 3SQOA 3O1TA 4IE4A 1XNTA 1LNSA 1QJY2 1R64A 4YNIA 4Z82A 4Q27A 5L73A 5JMCA 4P9XA 1AL21 1V6JA 1OQ1A 1W6NA 1ZYBA 2RR12 1MEC2 1S0DA 4Q4V1 1CPNA 2CSGA 2PMWB 2Y60A 5FMDA 1ODMA 5FZOA 2ZS6B 1UNBA 3B5LB 3FHIB 3NVCA 5F7UA 4P02B 1JU3A 3BI3A 1AR93 4CXXA 3J7MA 4P9WA 1W8ZA 3UL2A 4D8MA 3JZVA 3R0RA 4PF5A 3MFAA 4IGOA 4BMBA 1ZRRA 2WNEA 3O0VA 5A3NA 3AXEA 4P9IA 4NROA 2EVXA 2C9KA 3HD8B 2XR4A 4DINB 1RJ7A 4C0HA 2HWE2 1QY4A 1D2QA 2BZDA 4AQ6A 4ATFA 4HSJA 4EV0A 2JG9B 2IXHA 5FUPA 4AI9A 1W2OA 4MH0E 4IGPA 5C9AA 2HWB2 2FZ1A 5BNNB 2C4XA 2XBO1 2FDIA 4KMQA 1LU2A 5J1XA 2XJSA 2R061 1CD3G 1OLQA 3WP4A 1DDLA 4XILA 3NQHA 3ZFGB 2JG8B 1AR73 5JI9A 1GP5A 2ZGSA 4NRMA 2QQVA 3B7MA 4XJWA 4EROA 4DUXA 4AVVA 1HB3A 5CNAA 4RD7A 1EAH2 4XFFA 3ZPOA 4AZZA 4AFAA 2W52A 1NOVA 3FMGA 4IEXA 5E8AA 1OOPB 1C57A 1PNFA 1WMFA 2VU9A 1RL3A 3JBG2 1ASJ2 2YHJA 5C3RA 1NXD1 1O5UA 2VMIA 1FPN2 2DU1A 5F3IA 2WJSA 4Y4YA 2PXJA 3VL8A 4XQ4A 2YGLA 2WN3A 2Q8OA 4DB5A 4PI2A 1RGSA 2JJ6A 1SFNA 1F31A 2VR4A 2W5FA 3OPWA 1PIV1 1U5XA 3R4UA 2XJRA 4YGEA 3ACFA 2DVBA 3HQUA 3H8UA 3ZSMA 1SBFA 3N4MA 1H4HA 4QXBA 4XUOA 5C8CB 2YG0A 4M4RA 1AR83 2AC1A 3AKQA 3QACA 4RR3C 2D3RA 4ASLA 2J1AA 4XETA 3WHUA 1LHNA 3E1F1 4RYDA 2JB8A 4Z2AA 2WUHA 2ZHLA 1HXS2 1MZ5A 2PQQA 4S2DA 4UFLA 5H9RA 4WM8B 1QKQA 4H2AA 5HPOA 4XFCA 3SNMA 1DZQA 4B7EA 1L7RA 4BQ2A 4A7KA 4ISRA 2C0ZA 4LQRA 2ZX2A 1JI6A 4KG8A 4HBNA 3W20A 3OJBA 2HBUA 3RS6A 3OYWB 1N3QA 5KC5A 1H2NA 3I54A 3VDDC 2JWPA 4QB6A 4JZRA 4NRQA 2WYFA 2WQZC 5CYYA 5JI7A 5HBAA 4YW5A 1QJU2 1SLLA 2AUYA 2YY1A 2ZTNA 1J3PA 4BU2A 1GWMA 2XJVA 1CWPA 5FUNA 4N53A 5BNOB 4CDQA 3JD71 1OQEA 3H7JA 4YW6A 2BFUS 1KD7A 4FPJA 1OA3A 5CVRA 1UXZA 5FZ6A 5A7QA 1HJGA 3NO8A 1D4M2 1VRBA 5IJRA 1H9WA 1Y3TA 3ZIWA 4E4SA 2UWBA 4JDNA 4OMCA 3CJIC 2PHUA 1JUHA 4A6OA 4DUVA 2ZAAA 4HZFA 3V65A 3J26N 2EALA 5F6LB 3VBHB 1REDA 2XJTA 2XBO3 2ZZJA 4G4FA 5FMBA 1KDKA 2PQSA 4MSVA 3HNMA 3CJXA 4JGZC 1UY0A 2D43A 5FYZA 4HLTA 5FYMA 1DQ4A 5L7OC 4FPGA 1ENXA 1KQRA 3N7JA 4YW2A 2D6LX 5FYYA 4IUGA 3O1PA 4I02A 1F35A 4KG0A 1TE1B 5KBFA 5LRSA 2GC0A 4Q4Y2 2PHXA 3VBRB 4CP9B 1JUIA 4PHZA 5FZHA 2NQYA 4TZDA 4NIHA 4V2VA 1DGLA 2HWC3 5FYHA 3P1IA 2WO2A 1VMJA 5T50A 1ZBE1 1W6QB 1A8DA 4CEYB 2BJSA 3J7HA 4FFGA 1ZBA1 5A80A 2EIEA 3ETPA 3THTA 2BGCA 4HOOA 4LBJA 1Z7S2 2RS52 2VTFA 4AE2A 1OLRA 1AX0A 1K3IA 3ACHA 1R082 3VBSB 2ILMA 3E6BA 3OGVA 3ABZA 4XXAA 5JMOA 2VCMA 2JDNA 3RZLA 1GOHA 5L36A 1UYXA 2D7FA 3ZN5A 3HEIA 4HVRA 4LKDA 1V9U1 4W6XA 3U75A 1G9CA 3NV3A 1LU1A 4AVTA 2HWF1 5DABA 3VD3A 4UWDA 2WFPA 4XJZA 4YW7A 5CZKA 1JU4A 4O65A 2O8OA 3WW3A 3UKVA 1NCRB 3KB5A 2X5IA 3HBZA 5F3GA 3VD9A 5D1IA 2I07B 1SMVA 3SXWA 3TEZA 2EAKA 4GMP1 4I3GA 4Q4W1 3FE5A 3N9MA 4N7IA 5IVBA 1NYWA 2RVAA 4JGYB 4GD4A 4N43B 4RFRB 1G9DA 3MFCA 1V0AA 3TEXA 4GJYA 1KS5A 1O91A 3ZXKA 2JIJA 1ZRIA 2GNTA 1NY71 3ZM8A 4E2SA 4FSJA 4LT5A 2F4PA 4EN7B 3QD6A 4Q5OA 1JYIA 3THDA 5E88A 2WO7A 4QDRA 4XYXA 2EIBA 4CCMA 1LEDA 4LE3A 5CKMA 5FIXA 1DBNA 3D0JA 4DO0A 4IV1B 1COV2 4FPKA 2DWRA 4JKLA 3JD73 2GNDA 4YW4A 1VAKA 1OC1A 5LY2A 5C8WA 4ZZ5A 2RS13 1CVNA 1I3HA 5J09A 1BEV3 1N1VA 3HAGA 3VLBB 2VZ3A 3TAYA 5D8AA 3OCPA 4FPLA 4QXHA 3FUOA 3IMMA 3ZN6B 4BQ1A 3GALA 5F1RA 2QQUA 2RM21 4OHVA 3PVNA 3TOJA 4AEDC 4AW7A 1UPSA 4CXWA 2N7GA 3LF7A 4XIOA 2GSYA 4ZU7A 2EF6A 2A5ZA 3WDTA 1VBD1 4CCLA 2KD7A 4H55A 1NLSA 2BGPA 3I7DA 4Y20B 1LOEA 4QM9A 3CZUA 5LRRA 3GZUC 4D6RA 4ASMB 1JZ6A 2ZGKA 3CEWA 3FHQA 1BCXA 4LHKA 2JG9C 2VULA 1FV3A 3MIGA 5EIYB 2H0BA 1WLWA 1JN2P 4A7ZA 5BNNC 1ND3A 1W8HA 4LBMA 4JKKA 4UF0B 4B3NA 1VBE2 3AP4A 1CX1A 2OQ6A 3IDAA 1H1IA 4AVAA 1KRIA 4W6WA 3ZFGC 1ZX5A 4TXWA 2R071 4YRDA 3B01A 4EYUA 4MGSA 1ZBE3 3IDCB 1ULPA 2P3YA 5E89A 3SKJE 2OPWA 1GNZA 1ZBA3 5JXGA 1GNHA 2D5FA 1OXCA 1APNA 3MYXA 3AMPA 4GIQA 4Y5Z0 4I0AA 1A8MA 1XRUA 2WN2A 5JSPA 3MIFA 2W92A 3PL0A 3GJBA 5F2SA 3RZGA 4WVMB 3VHNA 3ZIXA 2BERA 3HR9A 4LE4A 4A45A 2QQPA 4CU8A 1E5HA 1NA1B 2FHRA 4QGNA 4QX3A 2IUWA 4NIDA 3B02A 2HWF3 2WLPA 1ZRCA 4DXSA 5EJ3A 4CVUA 1LHUA 4IE5A 4AHXA 1RMU1 4UFHA 2Y26A 4JTNA 3POYA 3KV6A 4TLFA 1PK6A 5AC93 1QJZA 2ZA9A 3U4SA 4GMP3 4Q4W3 5C8CC 2NMNA 1VBA2 1AYM1 3WV6A 3N9LA 2Y6JA 5I0UA 2DDUA 2YBSA 1BZWA 2L9LA 1ENSA 3ZFFA 2ZHKA 2QDNA 3U4XA 4PCRA 4DXZA 1AL22 2P17A 2XOMA 1GP4A 4WM8C 5DMYA 4Q4V2 4Q0PA 4XFHA 1PVXA 1RITA 4HK9A 1VE0A 1UN1A 4XUQA 1W03A 2CYFA 1GBGA 1UXXX 1UF2C 1YRZA 2NM1A 4URTA 4AI2A 4CDWB 2PHDA 4CCKA 1UZZA 2P6HA 4HK8A 1ZVFA 1FYUA 1H8TB 5KR7A 4M3CE 1W99A 1DLCA 4W50A 5FWEA 2QBXA 4BIFA 1SFYA 2GNBA 1DLLA 3OEBA 4OHXA 3RZHA 2WZR3 2FMDA 5T54A 1RUI1 3T30A 3LEIA 2AYHA 4EN9B 2RM23 3W21A 1RUNA 1O4YA 1F9KA 2QQNA 4LHNA 3NV4A 1HW5A 1YFUA 1NQJA 2JE8A 2WWUA 2WZEA 3GJAA 3H7YA 5FRAA 5IW0A 5IAXA 1VBD3 3NJZA 1PM7A 4RS5B 3WD5A 1G7YA 4LHLA 4M3CB 2VBBA 3S7EA 3FWEA 2AR6A 5JOZA 5LBCA 4HETA 1LHOA 1W3VA 2WFF3 2XBO2 2ZGQA 3POEA 3LCPA 4IEWA 4XUTA 3V0AA 1JOPA 2R0FA 5DUXA 2R062 2ET7A 4UW3A 4HANA 1XC6A 5FXVA 4LKFA 3E6DA 2P37A 2JKBA 4IEZA 3AFGA 4OZOA 1ST8A 1HX6A 1CZVA 2ES3A 1AF9A 4R52A 3SCFA 5I0SA 5JPMB 3GYDA 3HJRA 1UU5A 2E26A 3H1MA 3FZ3A 3ZSKA 1W2TA 3JU9A 5K0UC 4CDUC 4CUBA 1DYOA 1X8MA 5LA0A 2Y38A 5G05L 2DTWA 1T2XA 1BXHA 1GSLA 3AMQA 4LBOA 1H1MA 1W05A 1YQ8A 2XQXA 3EMRA 3MUZ1 1WD4A 1JYVA 2NYYA 4LA2A 2BQPA 4C1WA 4OHYA 4Y3OA 3UGFA 2RG4A 4IETA 5FMCA 1QJY3 5FZCA 5KC6A 2WABA 1H8VA 3O1UA 4BQ5A 3ZN4A 5A3LA 3I59B 2KR2A 4W6YA 1UW8A 1MEC3 2ZGMA 4CEYC 4N7UA 4AEKA 4QT6A 3FX3A 2Z4FA 1PIV2 4F8AA 1WCSA 3PU8A 4K1ZA 2D3PA 1TME3 3U0ZA 3WNLA 1F15A 1PZ9A 3K46A 1G86A 2VM9A 2VMEA 1RMU3 3WG4A 4BZ4A 3GM8A 3FBMA 5FPLA 4TSVA 4NIGA 4F7ZA 3SCHA 3J9SA 1ACCA 5DN2A 1A34A 5GLWA 2DURA 1AYM3 3GCXA 3OD0A 1MS9A 4I30A 5FYUA 1QJEA 1LENA 1NCRC 2YDEA 1W6MB 3LPGA 2XMLA 4MGIE 1OQDA 1YO8A 1U5YA 2JDHA 1AL0G 2MHFA 5IVVA 1HRV1 5CA6A 2P3KA 2DBIA 1W9TA 4X8NA 1IS6A 1RTVA 1ZRDA 1U5IA 3LWCA 3OSDA 1M4WA 5FYSA 2JDUA 2A73B 5CFDA 3EYPA 3OBZA 5FY1A 5BYNA 3T08A 3ECQA 1GZWA 4JGYC 4NPMA 1OLMA 1S2EA 5AVAA 4PQ9A 3T3YA 2ZJCA 3DYPA 3WCRA 4QDQA 2FDKA 2WLQA 3MO4A 4GXLA 3WCSA 4FXGB 3WW2A 4GA9A 5JR2A 2VMHA 3WT3A 1UKRA 1VAVA 2J1UA 2QZ3A 2WNUC 2C1FA 3JQXA 4Q0SA 3ZDSA 5J36A 2SLIA 2BDRA 3JD72 3S7IA 1EAH3 1IG3A 3AYCA 3BVCA 3AM2A 3T0BA 3ZFEA 3JUUA 1CJDA 1UMHA 1W9FA 1RUI3 3E5QA 3FHAA 4IV1C 1CJPA 1ASJ3 2O0OA 3JBG3 4HKLA 1QH6A 1XE7A 4PDWC 1FPN3 5FMOS 3RI8A 3RZMA 3ZYGA 2XLAA 1IZ3A 1LOGA 1F8VA 1PO21 4XC9A 2Y8KA 4R8HA 5FUIA 5BNPC 2Z69A 3NRUA 2V4AA 2C26A 3E5UA 3VZMA 2VVEA 4QX2A 3CQOA 5HXVA 5BUVA 2YFUA 5CADA 1RUC1 2ZGNA 1LOFC 3VBFA 4FP2A 2RMU1 3ILFA 2BEOA 2V5YA 3N9NA 4GALA 3KQRA 4DS0A 4CCEA 4LR4A 3DPRA 2B4KA 3EB7A 2Q30A 4KNCA 4QKDA 4RQPB 3RWNA 3L2HA 2RDQA 1WW6A 3UKNA 4CCNA 5A3TA 1FT9A 3LGRA 3ZSEA 2G1MA 5FLIA 1GMMA 4LIVA 1H30A 1HJFA 2XL7A 3NMBA 4XJ8A 4AAXA 3GZTB 4E27A 2PHLA 4CDXA 5IK7A 1CX4A 1ZBE2 2Q1MA 4QMAA 1RHI1 3WEZA 4KBZA 3R05A 3GHNA 4M4PA 4AK3A 1CIWA 1ZBA2 4XJ9A 4GWNA 5LB6A 4AVCA 4P5HA 4DNYA 2XL9A 3VDDB 3WDYA 3ENRA 4W4ZA 4XBLA 4MZUA 3O12A 3KT7A 4DFSA 5DZEA 4L97A 3WW4A 1NXMA 2P2KA 5FP8A 5T52A 3E6CC 3IAQA 1SPPA 3K3NA 1V9U2 4PBOA 2J1RA 1ND2A 2IFWA 3H1YA 4K9SA 2HWF2 4ZKTB 5ISLA 3F2ZA 5CG9A 3VDBA 1QJU3 2XLGA 3AZZA 4DEVA 4IE0A 4IV3C 1OMIA 3F95A 4KGGA 5I8YA 3ALQA 2VQ0A 1O8PA 3ZXLA 1H2LA 1PVC1 4INDA 1NX9A 3CJIB 4G3YC 4X8PA 4Q4X1 1LKNA 1V6KA 4Q4W2 1POV1 4P9JA 1S0BA 1PZ7A 4NWVA 5LZ6A 3IIAA 3MF9A 4HMZA 1AXZA 1C8NA 2VOVA 4KBBA 4JGZB 4DEQA 1HRV3 1IKQA 2Z79A 1B35A 2ZGTA 4WM7C 1Q8SA 1NY72 1W9SA 2O1QA 5I8SA 5IVJA 5L7OB 1TVGA 2C5DA 1GQHA 3NSTA 4Y22B 3WDWA 5BXXA 2UURA 5E16A 1CAWA 5FPVA 4XQWA 4COVA 1GQGA 2ZX1A 2EXKA 3OY8B 2WKKA 5HCBA 3RJRA 1YFWA 3MGUA 4B7KA 3PUSA 4Q4Y3 1SFPA 5JLVA 2VTXA 2UY8A 2HLEA 4Z92B 1NCQA 1Q8OA 4NR1A 1BYHA 3W5NA 2EXIA 4MV2A 2B46X 2K0GA 2W46A 1XU2A 5C70A 4FOWA 4Y1YA 4CDWC 2RM22 3SEEA 3FJSA 2R041 4BLJA 1CAXA 2JIGA 4KGQA 2RJ2A 4LIUA 1PO23 3WNMA 2LS6A 4QQPA 2UU8A 1Z7S3 2EIDA 2RS53 1UKGA 1VBD2 2GC1A 3AK0A 2OZJA 3TB0A 3VBUA 5FXWA 2V5DA 2F17A 2GP3A 2D44A 4FBFA 4OI4A 3WR0A 2TEPA 4HPKA 2GH2A 1KDMA 3V56A 1WW5A 1OBNA 1SDWA 5DUVA 2WIIB 3IKWA 4GH4B 4CRQA 4RS5C 1R091 3ORJA 1YQCA 4JDOA 5JOWA 3TEWA 4QXCA 3VZOA 1MQTA 2EXJA 4YM2A 5IK5A 4JQTA 4QX0A 3CNAA 1Y9GA 2SBAA 3DCQA 5APAA 3ZPYA 3T2QA 3VGIA 3KD4A 2E32A 1VBC1 1H0BA 1V6NA 3RRDA 1QEXA 2R072 2W94A 3ELNA 4Y5SA 4W8JA 1RUE1 5DUWA 3RFRA 3WNKA 1GQPA 1RHI3 2VPVA 2X8KA 4HG6B 4OLLA 2Y6FA 4N90A 5FZ7A 2VMCA 5EQUA 1ULOA 4M0NA 4EN6B 4LOSA 1LODA 2PELA 4P00B 3D4KA 4QB1A 2C9AA 1R1A1 2AACA 1CIYA 1DYPA 2XG3A 4GWIA 3RYKA 3INAA 1OT5A 5D2AA 4A6SA 3POBA 3OUJA 3BTAA 3AKRA 4ONUA 4FTEA 3Q9OA 1JZ2A 2VOTA 5C9AC 1TME2 4PLMA 5FZ8A 3EQEA 3IBMA 4LXLA 1COV3 1TQ5A 2F6BA 4GJZA 5BV6A 4B8EA 1RMU2 3GHMA 4JHZA 4XCBA 4OI1A 3GBGA 4AFDA 1DG6A 4AEDB 1RXGA 3WY6A 4E8CA 2YXSA 2AEZA 3SH3A 5C5UA 1CAUA 3I2OA 4P9YA 1DIWA 3IPVB 4WVWA 4QPIA 1POV3 1JMUB 2B45X 1AYM2 1FATA 3S30A 2E33A 1QDOA 4UBHA 3RVHA 4DQAA 5CFCA 3VBOA 2WSUA 2J42A 4DY5A 4YVSA 1SLBA 2Q8CA 5IWFA 4LO7A 4FAGA 2OQ7A 2E6VA 2GDFA 1MS4A 3OGJA 4M3CF 3GBFA 2VH9A 2ZKLA 2FBEA 1OKQA 2HYKA 4XOGA 1WCDJ 1NT0A 1XXNA 2E9QA 2W87A 1X36A 3I2KA 3A0KA 3KF5A 1K5MA 5FQ0B 3LDBA 2ZOEB 4KI5M 5EHDA 4FOVA 2BFUL 2VCAA 2B42B 3HPNA 3G6JB 3RQ0A 3POGA 5ABJA 2DCYA 3LFMA 4QB2A 1WZXA 4GQ7A 4O7XA 4YG3A 5FZ3A 3VB9A 2X05A 3RSJA 1VRH1 2W3JA 3GBWA 3FFZA 3T2TA 5BPXA 2VE1A 1VBE3 4C90A 1W2AX 3T0DA 3JCIA 5DG1A 2XPJA 5AVPA 3HN1A 2W1UA 4Y1VA 1RUI2 2EAAA 3TBDA 2BRTA 5EYYA 3OG2A 1W3XA 2YPDA 1ULGA 4NPRA 5JUVA 1DCSA 2R043 5LBFA 3SITA 2B9VA 4BISA 4Z1VA 4QX5A 1KFUL 1U12A 5L9RA 3WDUA 5FPZA 4FPCA 4MX3A 1HQLA 1KEXA 1L7QA 2JDKA 1F5JA 1SG3A 3J7LA 1POQA 3MPBA 4C1XA 1XPWA 4KWJA 4YM3A 5F2WA 1W8FA 1E5RA 3QBQA 1HV0A 4B1LA 4FAHA 2PTMA 1V6OA 4Y4RA 1LOCA 1UQXA 1RUH1 4BDVB 2YU1A 1XYNA 2WWSA 3NAPA 3URFA 2VO5A 3CHXA 3BKZA 2YUEA 3ZYPA 1P8JA 3LE0A 3NNMA 3ZMOA 4BHPA 2LTNA 4YFZA 1QNYA 3BTXA 1LCLA 2AH2A 2W1SA 5GJ6A 1Q43A 2ZEXA 4NUBA 4OCTA 4Q1PA 1W6PB 3OOXA 4MXWA 3UGGA 1VBC3 3AMHA 2VZUA 5J98B 3DGTA 4RQPC 1RUE3 4XURA 2E31A 4NHMA 1CZTA 1C28A 2GP5A 1FAYA 4IEQA 2LM3A 2NZ9A 4N53C 3MI8A 1VBA3 4CDQC 1BQPA 4AOCA 3KV4A 5IK4A 4QKFA 2XB6C 5ERLA 3R6SA 3AKSA 3SHRA 4C91A 1E5SA 1AL23 4DZGA 3USSA 5FZGA 1S0EA 2V73A 4IDZA 4OUSA 4Q4V3 4ATEA 4E9KA 4YG0A 4JRAA 5A33A 5FPUA 4EWAA 1FMD1 1FX5A 3LEKA 3LA3A 3OGGA 2JECA 4U2AA 5A7SA 3UK9A 1X82A 5GZDA 3FLRA 2ZGOA 1AUYA 1QWRA 2JDAA 2QQKA 4MOAA 3S0MA 2VZOA 1EY2A 1K5JA 4K3UA 4RGGA 3ROUA 3D5OA 4ZU5A 3FN9A 4YZ1A 1DGRA 2A71A 1YQ2A 1DGWA 5EV7A 2PLV1 2XJPA 2VTXJ 3HT2A 4GULA 1X50A 2K9ZA 3HWJA 3VD7A 5FO9B 4LBQD 1CAVB 5IVFA 1SACA 3WG1A 2W68A 3PHMA 1MS8A 5JZGB 4QHOA 4JQRA 1DHKB 5C6CA 1N1SA 4A3ZA 1IPJA 3BIWE 2E7QA 4GWJA 1HRV2 2VW1A 4RR3A 4HN0A 1PGW1 4XMIA 3K4DA 5A7WB 1HLCA 2VQTA 3NJYA 1A3KA 3GNEA 3KT4A 2R063 4UW4A 4QPYA 4IQPA 1L3JA 4CDUB 5K0UB 2FDGA 4L0PA 3PVEA 3HIFA 5CB7A 1W6OA 5DQ0A 3C3VA 3I4IA 3WF4A 4Y5TA 4GMP0 4M01A 2ZGLA 3TNQA 4KU7A 2VUJA 5A6YA 5HCHA 3IN9A 4K1YA 3U78A 2VZ1A 3VN4A 5M0TA 4B4QA 3RNSA 5I0RA 4ZS3A 1U5ZA 1W8UA 2MNGA 3IIIA 3LDRA 2I2SA 4UW6A 4CXYA 1QJX1 2OIIA 3APBA 3P3NA 4LA3A 5F5IA 4CYDA 4IW3A 3KHBA 3BOWA 3S57A 2QUOA 4PLNA 4YVWA 5FY7A 1PO22 5F6KA 3KSCA 3RI9A 5L19A 1I5PA 2VOWA 2GMMA 2X5IC 1MZEA 5LATA 1XYPA 3TEYA 4LBKA 3N7LA 1LOBA 4UBGA 1RUC2 5FBJA 1DU3D 2OZ6A 2PYTA 2RMU2 3HT1A 2BYVE 4F3JA 1W8NA 3IDBB 3WP3A 1H1AA 2UYAA 3JB8A 2YFZA 3GZAA 2Q8DA 1AX2A 1PIV3 4AFCA 4MHUA 3PTYA 4Y33A 5K9YA 1GANA 1WMDA 4FFIA 1YQ6A 2UWAA 4FTBA 4GWMA 1TNFA 4N9IA 1LESA 3V64A 4XHXA 2Y6KA 1K45A 5EJZB 2DVGA 2QCSB 3H1WA 5LWBA 2GH8A 4GH4C 3U11A 3ATGA 1OFSA 1O3RA 3I97A 1RHI2 3UGHA 4BQWA 4CEWA 1HN0A 2W08A 1YC61 4CUAA 1BK0A 4I0BA 5FY9A 1XSQA 1RINA 4PIYA 2AEYA 2DU0A 3AZVA 1UYZA 1V6IA 4LBQB 4QGMA 4LHSA 3O0XA 4L2NA 1JTZX 4XTMA 3U07A 3LD8A 1W8TA 2WNUB 1HQWA 4OMDA 1FMD3 2BTVC 4ORFA 1JZ5A 3UYJA 1VBB1 4D7YA 4BE3A 3AYAA 3MIEA 4AEJA 4JVAA 5EJ1B 1YIFA 2Q1ZB 3NWKA 4PDWB 5DDJ1 5H9SA 2RDNA 3T0AA 4EZ4A 2ARCA 4LMFA 1PVC2 2PLV3 5F8PA 3TN91 4CU6A 5BNPB 4UW5A 4Q4X2 1ND3C 2O14A 4LO4B 3MW2A 4XF3A 5J7MA 4PIZA 1LHWA 1GZTA 4R4ZA 2IFRA 5IVEA 2R30A 1OF4A 3VV1A 2ZACA 2ZEYA 4RFT0 3S6PA 3H3ZA 4YLZA 5A6QA 5B4NA 3EXUA 4OYUA 1OH3A 4PBPA 4X6RB 1O3QA 5A7PA 1CN1A 1H4GA 2GALA 3H0OA 5GLVA 2KXLA 3QLQA 4XQDA 3SISA 1W8WA 2Q0AA 1QQP1 2J1SA 2ZGPA 4L8QA 4XHBA 3WNNA 2Z2SB 4AYUA 5EWSA 2CV6A 3L9JT 4FVVA 3MLLA 4B29A 1JYWA 3J8F1 1TEIA 2A6WA 3BUCA 5LEKA 1UZYA 4P9GA 2R6QA 4L11A 1AJOA 1U0AA 2WC2A 1PZ8A 5FK8A 4JX0A 5FZ1A 2K2SA 3W59A 5IFTA 4LO8A 3PVOA 5FZIA 3JQWA 1UIJA 1WWYA 2HWD1 3ACLA 1JXNA 4E4HA 1A6CA 1JOBA 1Y43B 2C24A 3NV2A 1QJX3 1JYCA 1WKYA 3CZJA 4FCAA 5FAXA 3WP6A 4BA6A 2Q8EA 4R4XA 3V0BB 2ZAHA 2R042 2KA3A 1YIPA 5A3WA 1PK6C 1W9YA 2VXJA 3MV11 2NLRA 5J37A 1ZZ6A 2QE3A 3MLKA 4ARXA 2WT2A 3UKTA 3H50A 5FCCA 5C3SA 2WSVA 3AL5A 5LY1A 2FDHA 2ORZA 1VAMA 2A6ZA 3MW3A 5JDBA 1QIQA 3SLIA 2B5HA 3T4VA 4IV3B 1BK1A 1HB2A 2FCVA 4AWDA 4YW1A 3ZFFC 4COWA 1V9U3 4K7JA 3K75B 4FXKB 1R092 4IEUA 1QNWA 4KWLA 1EV11 4MHRA 1KJLA 4QDSA 1JBCA 4QGLA 4CA9A 3LOBA 3WVJA 3M3OA 4D69A 1EP0A 2YC4A 4CPBA 1AHSA 5JCTA 2B9UA 3GDBA 5A32B 4QQOA 2D6NA 3M3EA 3VKNA 4CUCA 3GGLA 3WQ1A 1VBC2 3IDEA 4A4AA 1AZDA 2LRPA 3PUHA 1LECA 1RUE2 1EYBA 2JG9A 1WCQA 2DUOA 3LIHA 4NRPA 4WM7B 4CCDA 3LQCA 4NMIA 1DQ2A 1X7NA 5BNNA 5JWPA 3T09A 2XONA 5GZEA 2LW8A 1R1A2 5JSOA 3OGRA 3K77A 3M3CA 1UX7A 3AZXA 3PMEA 4HVQA 3ZFGA 2JG8A 2VZPA 3VUOA 1OURA 4D7SA 2ZEWA 1B09A 1HIXA 4NN0A 2HYXA 3MLJA 3VD5A 2VAUA 4NPLA 1VBB3 4IXLA 2Y64A 3D8CA 3Q8FA 5IUQA 4D6QA 5F9TA 2DBNA 1PM4A 1MQTB 2QQIA 3O0WA 2DTYA 4HN1A 3ZR5A 3H3UA 5IATA 2V72A 1OOPA 4YM0A 4EJRA 4FP3A 2OUJA 3A7QA 3FL7A 5JXIA 1V6MA 3U10A 2VD7A 3RG0A 1O4ZA 2DUPA 1Y7BA 2YPJA 4QHBA 2CL2A 4XFAA 3SH4A 3TN93 4UFIA 4ET7A 2G4IA 5KWRA 1BMV1 2D6PA 1WW7A 4W65A 1NQDA 3EJKA 1H9PA 1MR5A 3PDQA 1GOFA 4XBNA 2CTVA 2OXBA 3ZXDA 3ZYFA 4HSLA 1OF3A 3MUY1 2X29A 3ON7A 4TYSA 4NVPA 3A22A 4QPGA 4Z8BA 1Y9QA 1W6NB 1WBLA 4P5YA 1I6XA 4MGQA 3THPA 1QQP3 4YARA 5JZGC 5C8CA 1NAEA 5FZOB 3I8TA 5LA1A 2VVDA 2QZ2A 1KFXL 4JAAA 2BOJA 2W0XA 2OT7A 3J4UH 3K48A 3KM5A 3J8F3 3WSOA 2ZPXA 5LW9A 4BQ4A 5C4WA 2WO1A 3ZLIA 1REFA 2BVVA 4DXRA 5FDBA 3IT8A 1VRH2 4L99A 3BN6A 5I0TA 3PU3A 4WM8A 4XACA 3I2GA 4Z2WA 2VECA 1LJ7A 3DYOA 3IB3A 2R073 1S55A 2VNGA 1J1LA 4O61A 4JRLA 1LHVA 4AG4A 5A3PA 4UXAA 1OUSA 4XZUG 1UCXA 4XDQA 1FOD1 2H6CA 5TSWA 5T5PA 1UZVA 5EYXA 2D3SA 3AZYA 2VBDA 4V2WA 1GKBA 3OYWA 2I45A 4BMEA 5FPAA 3TNPB 3WG2A 1IS3A 1JHNA 1W39A 5C9AB 3AXDA 5A7NA 2ENRA 3O1OA 3CDZB 4A3XA 3DEMA 1UD1A 4H7MA 5B4XA 1VLNA 4M0HA 1DZTA 1OKOA 4S2HA 4XUNA 5BNOA 3ZDVA 1D0HA 1RUH2 2DFCA 1EV13 3GZEA 3LA2A 4QU1A 4YM1A 1GZCA 3OF1A 4K8FA 5FYIA 5CFDC 5K7PA 3AMMA 3FUQA 2ZCWA 1TMF1 1YJKA 2VMGA 1MS1A 4G9SB 3RDIA 3SEPA 2Q4SA 3HVDA 1NLRA 4D7TA 3PLQA 5F5CA 4DUWA 3O1VA 1US3A 1DFQA 2XLFA 1JYTA 5DG2A 4DOUA 1C8M1 2V09A 4LITA 1I1EA 4PJYA 2GMPA 1I9RA 2NPIA 5A7OA 3VBHA 3HBKA 4PQQA 4NIAA 1JS9A 4CP1A 3RPQA 1D7PM 1XE8A 3K51A 1ALYA 4QQHA 1E57A 4LPLA 1RUOA 3FBYA 5FZMA 3OEAA 1SLAA 1J84A 2EIGA 1JH5A 4GB31 4EQVA 5L9VA 2JKXA 4ZS2A 5G04L 1EPZA 4K6BA 1FMD2 5F5AA 4Y26A 5H9QA 4D94A 1OA4A 4GAZA 1PGL1 1GFF2 4I0WB 5LA2A 3ZMNA 3VBRA 3MBWA 3ZR6A 1QH7A 3VBFC 4BH9A 4CP9A 3H8OA 1CESA 2IWGB 1N3PA 2AGSA 2Q1FA 4BWOA 4FI9A 5I0DA 3ZSLA 1W6QA 3ITQA 4MXVA 4U36A 4CEYA 1N47A 2TUNA 3DF0A 1JODA 3DPRC 1LGBA 2PLV2 1Q5OA 1W0OA 2WYSA 3N9QA 2WZ8A 4XF9A 5FY5A 4M00A 4CCCA 2DCKA 3LB9A 1IOAA 2PHRA 4MYEA 2E53A 3H42B 5GLUA 3VBSA 3WNOA 5CEHA 5KHGA 3VHOA 1DF0A 2VBPA 4CTEA 2XGXA 4IGQA 3NL1A 5FXXA 4CDXC 1PO11 2VQUA 4FPYA 4RA0A 4CUGA 4FFFA 3T2OA 1PGW2 1Y9MA 1VB4A 1J58A 1YNAA 1DGWX 2CY6A 4LKEA 2A6XA 2XH6A 1GLHA 1MS0A 1TG7A 4V1PA 3KT1A 4AI1A 4E2GA 1NCRA 3LZZA 2BBAA 4RSUA 2IXKA 4XF1A 4F83A 1WMXA 2WDBA 2DVFA 4HFSA 1POV0 4HKOA 4KU8A 4N53B 3CU7A 4CDQB 2DV9A 2RS31 3RJ2X 1ND2C 4IE7A 1DGRN 3N7KA 4UOJA 1YCIA 1OVPA 1LEMA 3A23A 3LPFA 4JGYA 2W95A 4N43A 1OD3A 2J1EA 3BU7A 1FOD3 3C7FA 3NNJA 1QJX2 4YGCA 1JZ8A 1RXFA 3S5AA 1O7FA 2JENA 3H3LA 4FQZA 1LGNA 4FPOB 4OUEA 2ZGRA 4EWDA 3VKOA 1Q3EA 3NJXA 1N1YA 1PHMA 1URXA 4JHTA 1JYNA 3AKPA 2XWJB 5DAQA 5FV3A 1MS5A 5FZAA 5DAVA 3RMXA 5ACA1 1RVF1 1ZZCA 4IV1A 2R1BA 1ODNA 3O1RA 3N35A 3RZZA 4AHWA 3LKJA 1HRI1 1S0GA 4XE9A 3T1MA 2BU9A 1MZ6A 1TMF3 4NHYA 4XMAA 4AVSA 2DF7A 3ZN6A 1L7LA 3BCWA 4SLIA 5JXHA 3RWKX 2LALA 2ETEA 2XVLA 4Q26A 4LK7A 2PHFA 2WS91 2VUDA 2UYBA 4RGKA 2ZMLA 2XVGA 4Y20A 3EBRA 1PMHX 1TNRA 1S0JA 1X8EA 4K8RB 1ULFA 1NCQC 1O8SA 2IXLA 4FPHA 5FY0A 5ANQA 2XUEA 2CGPA 1O59A 2A75A 1JZ3A 1UU4A 2BNMA 3K3OA 3A4UA 3KZ4C 4QHZA 1K12A 1IQAA 2ZGUA 3PURA 1AR91 3EO6A 4GB33 4WZFA 4QKNA 3H8RA 3QOPA 4IESA 5KXBA 4UF0A 1FI2A 5GZCA 3U1XA 2W1QA 3AP9A 2HEWF 1VBB2 3VBUC 2BP6A 5FLJA 2NP0A 5FP3A 4FQ4A 1IPSA 3PIGA 4DMIA 2FCUA 4MGTA 1J3QA 1VALA 4DPNA 3D6EA 1XBFA 2YROA 5DDJ2 1T6BX 5CBLA 5CU1A 2CGNA 4Y1XA 2IXCA 1RUJ1 3TN92 4OVEA 4RL7A 2X5IB 4SBVA 2DCJA 2D40A 4N9HA 5FZ9A 1MQTC 2VOKA 2XWBB 2CAVA 4FOYA 4R9CA 3MW4A 4ARYA 2X10A 3WNXA 3NV1A 1RUF1 3PJYA 4ZXEA 3WF0A 4WVMA 2FCTA 1IKPA 1JOJA 2AENA 4CE8A 1V70A 1AR61 2VJXA 3C8XA 1NA1A 3NNFA 1IG0A 3I3QA 1RUC3 3EHKA 3KWVA 4LBNA 1AR71 2VZTA 2RMU3 3WLUA 4COUA 3CL1A 2QJVA 5EFUA 1QQP2 2A1XA 2E7TA 3KQ4B 4LO5B 5DZGA 5T3NA 4CCOA 4XW3A 4D0QA 4FFHA 4DY3A 1ENQA 1AYN1 2ZZQA 2ZABA 3J8F2 1UY2A 3WQBA 3VKLA 2QKDA 5FPXA 3BU0A 3GF6A 4LUKA 3ZXEA 2BUKA 1UMZA 2BVBA 4OHWA 4I3PA 3B00A 5CIRA 4Y1ZA 5C3QA 1ONAA 5GZGA 5KXCA 4J25A 4OQ8A 2CNAA 1HQNA 2HWD2 3KV5A 3MF6A 2P1BA 4AXOA 1YFYA 4BB3A 2P5BA 2CHHA 1UWWA 3RGBA 5D8AB 3LDKA 4OHZA 1MVQA 4Z07A 3AJZA 1PX4A 3E97A 2ZXQA 5FYTA 2WNVA 1WGPA 1GICA 1C1LA 2K46A 2UWCA 2Y6GA 1H6XA 4IERA 5IFPA 5KHIA 4MGYE 4QPIC 1LOAA 1XNCA 4LUMA 2JEMA 3AP5A 1RVF3 4XCAA 4GKXA 5C71A 5FWJA 1GYKA 2VNRA 3CF6E 3IZOA 3VBOC 4AI0A 1ZM1A 2R1DA 4YVSC 5AFEA 4CDWA 5HV0A 4PI0A 1AR81 1H8TA 2YYOA 4OZXA 5DAWA 1PNGA 3ZSJA 1D0GA 1EV12 2PA7A 2IXJA 4UFKA 4XAAA 1ND3B 1W0PA 1F4HA 1US2A 2GZWA 5FYVA 5SV5A 5A6ZA 1E5IA 3I2FA 4ZPIA 1X9TA 2HJIA 4J1WA 1PVC3 2B39A 2RE9A 5ABJC 2WS93 1XJAA 2FDJA 3SMHA 4AI8A 4Q4X3 4RS5A 1O3TA 1I5ZA 2R16A 4M3CA 4FO9A 4AEMA 1IS5A 2ZHNA 1YYNA 4CZSA 4RHV1 3CMGA 4DRRA 2BGOA 3B94A 3W58A 4AHYA 4UFJA 3ZXAC 4TTGA 3VKMA 4KQ7A 1RJ8A 5LBEA 2VNOA 4JV4A 4HL0A 3B3QE 1GOGA 3FLPA 1C3HA 1UPIA 3VD4A 3D3AA 1GR3A 2CDOA 2RJLA 4ES9A 5LK5A 1QDCA 4YW3A 5IK8A 2O8QA 3DN7A 3WG3A 4BK4A 3U37A 2VVFA 1OUXA 1PK6B 1RUJ3 3MICA 3T2PA 1K42A 4XEZA 3NAPC 2H6BA 5DXDA 2VCCA 1ZZBA 4PT6A 4A42A 4QU2A 4WVVA 4CCJA 1XQNA 4MGZE 3Q8EA 1BMV2 2YZ4A 1BVVA 1RUF3 2VG9A 5GZFA 1FNZA 1IHMA 4JCKA 4I2OA 2PAMA 1LB2A 3I59A 1UYYA 3LAGA 2VMDA 3IWZA 1AR63 1S2KA 2P3IA 2XKOA 3C7OA 4Q0QA 3ZFFB 5C3PA 1YLLA 3I2JA 4WBBA 5KHKA 1IS4A 1V6LA 2VZSA 2IZWA 2OW4A 4KH9A 4UT5A 5FKCA 3WNPA 4AHZA 1J59A 1G9FA 1JZ7A 1SBEA 1R093 1AYN3 1NKGA 3NJVA 1FNYA 1TZOA 2YV8A 4FPFA 5I8TA 1ZZ7A 3ME2A 1GUIA 5FYCA 5DAXA 4H3WA 2HWC1 2E51A 1NE4A 5A1AA 3USUA 3MZHA 2JE7A 2J7MA 2IC1A 3AZWA 4O9EA 4ZONA 3ZYJB 1W6MA 3ZXFA 1XNAA 4ZZ8A 1F5FA 2DVDA 2BW8A 1FOD2 5KHHA 1QMJA 3ZYIB 3I3DA 3O14A 2YBKA 4Q29A 2G9FA 3K4ZA 1O5LA 5FZ4A 3ZYRA 3KVBA 4Q0VA 4XJUA 3C7GA 2BWCA 1R1A3 1SQ4A 4HONA 4QPGB 3ZX7A 4OQ9A 1GP6A 3M8LA 3ES4A 4YGBA 1W2UA 4A41A 1AXKA 1QGLA 4DRVA 1OPOA 4OI2A 2RHPA 4S2FA 3LOIA 3V0AB 2VC9A 3LFIA 4BPZA 1WW4A 2W9XA 2FQPA 2J22A 3NNLA 5FZDA 1WCUA 5FXZA 3WP5A 1UOFA 5C4WB 1VR3A 5JIUA 2QQLA 3WF2A 4NOTA 2EICA 3VDCA 2G9ZA 2VQAA 4HKWA 2MEV1 1TMF2 2E7AA 1ULCA 3KCYA 3BOPA 2BV4A 1ULDA 1XB9A 3NKGA 3POSA 1W28A 4A44A 1ZRFA 3WF3A 1NG0A 4GZ9A 5C7GA 2YC2A 3H9AA 4TLGA 4YFWA 1C8M2 4LJHA 4LBLA 1UY1A 3TWIA 1RIRA 4KL1A 5DZFA 2Y33A 1OSGA 3POJA 1BBT1 3QCWA 4C8DA 1VMHA 3KVAA 1N1TA 5GLTA 4RHV3 1JHJA 3MIBA 3VDAA 1EPWA 3CKHA 1XOYA 3O1MA 5A1LA 1UX6A 3JXSA 5T5LA 1QOOA 5HI0A 3BTZA 3BIEA 1LGCA 3NW4A 5C33A 3MPPG 4RQPA 1G8WA 3VZNA 5GKAC 1SDDB 4YVWC 4GB32 4R9BA 4BOWA 1Q56A 2JD9A 3B9IA 2Z5WA 5FFOC 1RB8G 1QXRA 1UOGA 4LNVA 2F4LA 5FZKA 1WLCA 5GLZA 3ZO0B 1JZ4A 2VW0A 1PGL2 5J48A 2QQMA 2RS11 4I09A 2VUCA 3AYEA 2EXHA 1BEV1 5JR7B 2ERFA 1VRH3 4AGRA 1XYOA 4I01A 2C6SA 3P3PA 3OPZA 4QX8A 4E4DX 1QXJA 2QFEA 5FO7B 4XF0A 2PAKA 4JKMA 5K4LA 2BPA2 4Q8KA 3VDDA 1DQ0A 3ZXJA 5C5TA 4OI0A 3FLTA 1A78A 1OLME 3I3BA 1OD5A 1WBFA 1C5HA 1YFXA 2IXIA 2QVSB 2W2IA 3KGZA 4XDOA 3AC0A 5ANNA 4AGVA 4LKSA 4HVOA 5JAXA 5KXEA 3VL9A 4YSFA 2R7EB 2RDSA 1DYKA 1PO12 1S0IA 1YI9A 2A6YA 3B69A 3OD4A 4WVZA 5LCWL 3C7EA 4E4ZA 4CEWC 2XKPA 3IAPA 2ZMKA 1GWLA 5JVVA 4NJ4A 5CFDB 1HV1A 4BIOA 2DCTA 3JB4C 1GZWB 2XVKA 3ZKYA 1RUH3 1OVSA 3A0NA 4BCUA 1W06A 1MS3A 4IE6A 1WD3A 2VL4A 1DZRA 2W91A 3CJIA 3N3HA 1S1AA 3R4DB 4K21A 3I2IA 3RYPA 4FOQA 1YXWA 3UNPA 2RS32 1BHGA 2QQOA 1Q8PA 2VXRA 3O1SA 1LRHA 1QHDA 1X9PA 3ZFEB 4UYBA 2BWAA 4BLIA 4QX7A 3AVSA 1S0CA 2WAAA 4JGZA 5FJHA 3DXUA 3DUIA 2JDPA 1DQ6A 2UY9A 2D93A 5L7OA 1RUD1 3Q8CA 2ADDA 2WT1A 4Y22A 1PX3A 2WT0A 5FZ0A 5F3CA 5FR3A 2WA4A 2HH9A 1LTEA 2VMFA 5D8AC 2X53S 5FJKA 4AQSA 3KF3A 4CU9A 1QXPA 3OY8A 3VBFB 5ACA2 1RVF2 1JYXA 2GMEA 4AFBA 1Z78A 5FO8B 5K8SA 1M06G 3BGAA 4H14A 4MUVA 4QQLA 1CONA 3DYMA 2ZHMA 3DPRB 4UAPA 4BYYA 5AC91 1HRI2 4JC1A 2MEV3 5FZEA 2XUMA 4RN5A 4E8DA 4ASKA 4C0BA 4R9AA 4LULA 1LAJA 3ILRA 3RZJA 3HQXA 4CDXB 2WS92 4NO4A 1ZNPA 3ZOIA 1BBT3 3LIGA 1XNBA 3ILNA 3M3IA 5BY5A 1VB2A 1MACA 5HCAA 4HT1T 1MZFA 3AX4A 4LTAA 1AJKA 2ORXA 1BLZA 4UFMA 4GH4A 4XTPA 1ZA7A 3Q8BA 1VPHA 1H6YA 3QH6A 4XF4A 3ZYHA 1AR92 1BVP1 4MG2A 2OX0A 1OFNA 1WLTA 3DECA 2GNMA 3M70A 1SPPB 1VJ2A 1HDKA 2BNNA 3I3EA 1CR7A 1ND2B 3BYWA 3E5XA 4META 1GU3A 2ATFA 5DPNA 2VCBA 4ZU4A 5LK7B 5FP4A 2Q5TA 2VZVA 3ZKUA 3KHCA 3MIHA 2WZR1 4YYOA 3PUAA 5FOBB 3WUCA 3W5MA 3KS7A 1RUJ2 3HNBM 2D6OX 2HEVF 2HKXA 1O3SA 3DL3A 5A6XA 2XJUA 2A7AA 3HOBA 4BQXA 4AL9A 2B7YA 2DYCA 3PJQA 2CDPA 2JDMA 2RDRA 1G9BA 2JB4A 1RUF2 3OGSA 4LORA 3LSEA 1KXGA 2AZ5A 3M3QA 2WFF1 5JSRA 2PHTA 1AR62 1UZ0A 4BXSV 2W47A 2IVIB 1B35B 4MADA 1GZ9A 1VIWB 2OA2A 3SCGA 4L9BA 1AR72 2GN3A 1R1ZA
chains in the Genus database with same CATH topology
2ET1A 1HKDA 4AQ2A 3FC0A 1CAWB 1Q8QA 4Q2FA 3IM0A 4LLFA 1T6GC 4XZPA 3RMYA 2NMOA 4AEDA 1AYN2 3VHRA 2JG8C 3IPVA 5E1RA 1BJQA 1RUG1 3KGLA 4J1XA 1WUVA 1NCQB 4WZCA 5FBZA 3WHTA 1QJY1 2JE9A 3BALA 3TRSB 4AGGA 1OOPC 1RUD3 1CAXB 4Q1RA 2RR11 1MEC1 2A6VA 4E2QA 4EN0A 5FQ0A 3VBUB 5FLHA 1IPKA 2OPKA 1UAIA 1TME1 4Q8LA 3TYJA 5BNQA 4Q0UA 5KHJA 1JW6A 3OTFA 4QQ2A 5JIAA 4AI3A 4HPKB 3NKTA 4MLOA 3AB0A 3B93A 3UJOA 1AR82 3BODA 4QPGC 5A3MA 4ZXKA 1ENRA 3ST7A 2TBVA 4CP0A 1KJRA 2PN5A 4NWWA 3SH5A 2PHWA 5DDJ3 3L2YA 2OYZA 2CWMA 3CO2A 2VUAA 2GAUA 2CGOA 2HWE1 1D4VB 5C4WC 4B4RA 2HWB1 2D6KA 1FV2A 2WNVB 2FMYA 4RHV2 2G9GA 1LR5A 2P34A 1S2BA 4NHKA 1OPMA 1UL9A 1UIKA 2AREA 2OUHA 1ZA4A 1W6PA 1EAH1 2HEYF 2DCZA 4OULA 4LEJA 2GU9A 3JBG1 1ASJ1 5FREA 5JOYA 1S0FA 5FMOL 1CAUB 4YZ5A 5BNOC 1FPN1 5GM0A 2HWD3 3QH7A 1X33A 1MVEA 4QPIB 3WDVA 3FFQA 5CFCB 4XXPA 3VBOB 4YZ4A 4YVSB 1C5IA 1NE6A 5J96B 1ZZ9A 3OBTA 3LA7A 1PGSA 3CLPA 3VBHC 1AXYA 3KCXA 2D97A 1SLTA 1K5MB 5T5JA 2OVUA 3KMHA 5T5OA 5SV8A 3WW1A 3VZLA 4XBQA 5ABJB 3OBRA 5GALA 1YI7A 4FT8A 3WINE 2TNFA 1QF3A 2HWC2 5FTTC 2P3JA 3PNAA 1J3RA 1HXS1 1D2SA 3WQ0A 1RUG3 1CAVA 2A3YA 2ZKNA 3KCCA 2ZX0A 4GKYA 4O9GA 5JZGA 3X29B 3VBRC 1IGOA 2ZBJA 3BPZA 2VW2A 4S2GA 1N3OA 2WZPP 4XJAA 2ZX3A 2RR13 3AMNA 5I91A 4JTOA 3WXPA 2WQ4A 4IEOA 5JOXA 3ZFEC 1AX1A 4R9DA 1GV9A 5K0UA 4CDUA 4FTSA 3VBSC 2Z42A 3UV9A 1QJU1 1QOSA 1QOTA 3WOGA 1H2MA 3AFKA 1WLDA 3NAPB 2FZ2A 3WZ1A 5DUUA 4H7LA 4MVTA 2MEV2 3M1HA 4LLOA 3D82A 3USUB 4MGKE 3WUDA 1D4M1 4PLOA 2VY0A 2NN8A 4MXWB 4COYA 2HWE3 3PVBB 2YGMA 1LULA 1REEA 5KXDA 1ULEA 3ASIA 3O7OA 1SLIA 4D3WA 5I93A 2HWB3 5J3UA 1BBT2 2JICA 4PIXA 3N36A 4XFBA 4N43C 3G7DA 5F5QA 1G6NA 2DUQA 2D6MA 2CAUA 5CAZA 3WQ7A 1YWKA 4ES8A 2R49A 4BM8A 5CG8A 3M2MA 4Y24A 5A33B 1WA4A 1FXZA 1O4TA 4Q4Y1 4QD2A 2RS12 4RGAA 1J1TA 1BEV2 1SCSA 3N7MA 1H2KA 2WA3A 2JX9A 2XHKA 4ISQA 2R32A 4COZA 5HCFA 2QDRA 4A7YA 1C4RA 3LSDA 1Z7S1 2RS51 3IMNA 1XNDA 2R0HA 2BNOA 4LBQA 1R081 2GC3A 2WNUA 4KWKA 2GC2A 3M4FA 4XIKA 4RR3B 2LUWA 4XFGA 4J6GA 3I2DA 1YHFA 4OUMA 2MPFA 1CPMA 4P14A 2JXAA 4PDWA 4XPVA 3AP7A 5B2GB 2CWSA 2YC0A 5AFBA 1B35C 4IEYA 4A2UA 2ZMNA 1Z0HA 2A3XA 1SEFA 1W6OB 4AFMA 5BNPA 1HXS3 1V00A 4L92A 4WV8A 3DKWA 4YZ2A 2QNKA 1LOFA 2BBVA 4CP2A 1CGPA 1UU6A 1C8M3 2Y0IA 1DQ5A 3MEPA 4YGDA 4NHLA 1RUD2 5JPNB 1ZREA 4YVWB 2JD4A 1WCKA 3KLSA 3ETQA 1NZCA 2B8MA 3PMSA 1C1FA 1COV1 1NA1C 3AP6A 4OFGA 5LEJA 5AC92 4QM8A 4AQTA 1F2NA 3VZKA 4YZ3A 5T55A 2ARXA 5EZWA 3ZXGA 3R4SA 1CQ9A 3AYDA 3BB6A 3W9AA 1D4M3 1ZZ8A 3MDPA 3V0BA 1YUDA 1YJLA 5IT6A 3VHPA 4AVBA 4QXKA 1SBDA 3POWA 5EXOA 2A3WA 2WINB 4CEWB 2E63A 1G9AA 4EWEA 4ITCA 3DV8A 2VGDA 2PAEA 1SLCA 4K20A 4IV3A 2EA7A 1PO13 1OHFA 1QU0A 2D5HA 2D98A 5H9PA 4EN8B 1OI6A 1WMEA 2GN7A 2YMZA 3UJQA 4AF9A 4YG6A 2WNVC 2H0VA 2Y0OA 1SCRA 4Y1UA 3AKTA 3ZVXA 5A32A 1VBE1 4B4PA 2DFBA 4P9LA 4XFIA 2WZR2 3WX5A 4LO6B 2W39A 4X6QB 4WM7A 1VP6A 2RS33 2XJQA 3M7AA 1H8TC 1XNKA 3O5SA 3C2UA 1KS4A 2KM2A 3VZJA 3VKFC 2WL1A 1PMIA 4IL7A 2ZX4A 3HMYA 1R083 2ARBA 2A70A 2WFF2 3MIDA 3RYRA 4IEVA 2DVAA 4TWTA 1DQ1A 3AJYA 4IEPA 2JDZA 4FPEA 1RC6A 3WDXA 1BKZA 5ACA3 5CFCC 2I74A 2VOXA 3B9CA 1Q8VA 2RJKA 3ES1A 4K40A 3D0SA 1HRI3 1OA2A 5FOJB 4JDMA 1KITA 1AVBA 1K5MC 3T1LA 2PFWA 1RUG2 1VBA1 1XU1A 1QJY2 4YNIA 4Z82A 4Q27A 5L73A 5JMCA 4P9XA 1AL21 1V6JA 1OQ1A 1W6NA 1ZYBA 2RR12 1MEC2 1S0DA 4Q4V1 1CPNA 2ZS6B 3B5LB 3FHIB 3NVCA 1AR93 4P9WA 3UL2A 3JZVA 3R0RA 4PF5A 3MFAA 4BMBA 1ZRRA 2WNEA 3O0VA 3AXEA 4P9IA 2EVXA 3HD8B 4DINB 1RJ7A 4C0HA 2HWE2 1QY4A 1D2QA 4AQ6A 4ATFA 4HSJA 4EV0A 2JG9B 2IXHA 4MH0E 5C9AA 2HWB2 2FZ1A 5BNNB 2XBO1 1LU2A 2XJSA 2R061 1CD3G 1OLQA 3WP4A 1DDLA 4XILA 3ZFGB 2JG8B 1AR73 5JI9A 2ZGSA 3B7MA 4XJWA 4EROA 4AVVA 5CNAA 4RD7A 1EAH2 4XFFA 4AFAA 2W52A 1NOVA 3FMGA 4IEXA 5E8AA 1OOPB 1C57A 1PNFA 1WMFA 2VU9A 1RL3A 3JBG2 1ASJ2 2YHJA 1NXD1 1O5UA 2VMIA 1FPN2 2DU1A 2WJSA 4Y4YA 3VL8A 4XQ4A 2YGLA 2Q8OA 4DB5A 1RGSA 2JJ6A 1SFNA 1F31A 1PIV1 1U5XA 3R4UA 2XJRA 4YGEA 2DVBA 3H8UA 3ZSMA 1SBFA 3N4MA 1H4HA 5C8CB 1AR83 3AKQA 3QACA 4RR3C 2D3RA 4ASLA 4XETA 3WHUA 1LHNA 2ZHLA 1HXS2 1MZ5A 2PQQA 4S2DA 5H9RA 4WM8B 1QKQA 4XFCA 3SNMA 1DZQA 4B7EA 4A7KA 4ISRA 2C0ZA 2ZX2A 4KG8A 4HBNA 3OJBA 3RS6A 3OYWB 1N3QA 5KC5A 1H2NA 3I54A 3VDDC 2WQZC 5JI7A 5HBAA 4YW5A 1QJU2 1SLLA 2AUYA 2YY1A 2ZTNA 1J3PA 2XJVA 5BNOB 4N53A 4CDQA 3JD71 1OQEA 3H7JA 2BFUS 1KD7A 4FPJA 1OA3A 5CVRA 3NO8A 1D4M2 1H9WA 1Y3TA 3ZIWA 4E4SA 2UWBA 4JDNA 3CJIC 2PHUA 1JUHA 2ZAAA 4HZFA 3V65A 3J26N 2EALA 5F6LB 3VBHB 1REDA 2XJTA 2XBO3 2ZZJA 4G4FA 1KDKA 4MSVA 3CJXA 4JGZC 2D43A 4HLTA 1DQ4A 5L7OC 4FPGA 1ENXA 1KQRA 3N7JA 4YW2A 2D6LX 4I02A 4KG0A 1TE1B 5KBFA 5LRSA 2GC0A 4Q4Y2 2PHXA 3VBRB 1JUIA 2NQYA 4TZDA 1DGLA 2HWC3 5T50A 1ZBE1 1W6QB 1A8DA 4CEYB 1ZBA1 3THTA 2BGCA 4LBJA 1Z7S2 2RS52 4AE2A 1OLRA 1AX0A 1R082 3VBSB 2ILMA 3E6BA 4XXAA 5L36A 2D7FA 3ZN5A 4HVRA 1V9U1 4W6XA 1G9CA 3NV3A 1LU1A 4AVTA 2HWF1 4XJZA 2WFPA 2O8OA 3WW3A 3UKVA 1NCRB 3KB5A 2X5IA 3HBZA 5D1IA 2I07B 1SMVA 3SXWA 2EAKA 4GMP1 4I3GA 4Q4W1 3FE5A 4N7IA 1NYWA 4JGYB 4N43B 1G9DA 3MFCA 1KS5A 1O91A 3ZXKA 2GNTA 1NY71 4E2SA 4FSJA 4LT5A 2F4PA 4EN7B 3QD6A 1JYIA 5E88A 4XYXA 1LEDA 4LE3A 1DBNA 3D0JA 4IV1B 1COV2 4FPKA 2DWRA 3JD73 2GNDA 4YW4A 1VAKA 5C8WA 2RS13 1CVNA 1I3HA 5J09A 1BEV3 1N1VA 3HAGA 3VLBB 3TAYA 5D8AA 3OCPA 4FPLA 4BQ1A 3FUOA 3ZN6B 5F1RA 3GALA 2RM21 3TOJA 4OHVA 3PVNA 4AW7A 4AEDC 1UPSA 2N7GA 4XIOA 2GSYA 4ZU7A 2EF6A 2A5ZA 3WDTA 1VBD1 4H55A 1NLSA 3I7DA 4Y20B 1LOEA 4QM9A 5LRRA 3GZUC 4ASMB 2ZGKA 3CEWA 1BCXA 4LHKA 2JG9C 2VULA 1FV3A 3MIGA 2H0BA 1WLWA 1JN2P 4A7ZA 5BNNC 1ND3A 4B3NA 4LBMA 1VBE2 3AP4A 4AVAA 1H1IA 1KRIA 4W6WA 3ZFGC 1ZX5A 2R071 4YRDA 3B01A 1ZBE3 3IDCB 5E89A 1GNZA 1ZBA3 1GNHA 2D5FA 1APNA 3MYXA 3AMPA 4GIQA 4Y5Z0 4I0AA 1A8MA 1XRUA 5JSPA 3MIFA 4WVMB 3VHNA 3ZIXA 3HR9A 4LE4A 2QQPA 1NA1B 2FHRA 4QGNA 3B02A 2HWF3 2WLPA 1ZRCA 5EJ3A 1LHUA 4AHXA 1RMU1 2Y26A 4JTNA 3POYA 4TLFA 1PK6A 5AC93 1QJZA 2ZA9A 4GMP3 4Q4W3 5C8CC 2NMNA 1VBA2 1AYM1 3WV6A 5I0UA 1BZWA 3ZFFA 1ENSA 2ZHKA 2QDNA 3U4XA 4PCRA 4DXZA 1AL22 2P17A 4WM8C 4Q4V2 4Q0PA 4XFHA 1PVXA 1RITA 4HK9A 1UN1A 2CYFA 1GBGA 1YRZA 1UF2C 2NM1A 4AI2A 4URTA 4CDWB 2PHDA 1UZZA 4HK8A 1ZVFA 1FYUA 1H8TB 4M3CE 4BIFA 1SFYA 2GNBA 1DLLA 4OHXA 2WZR3 2FMDA 5T54A 1RUI1 4EN9B 2AYHA 1RUNA 2RM23 1O4YA 1F9KA 4LHNA 3NV4A 1HW5A 1YFUA 1NQJA 3H7YA 5FRAA 1VBD3 3NJZA 1PM7A 4RS5B 3WD5A 1G7YA 4LHLA 4M3CB 3S7EA 3FWEA 2AR6A 5JOZA 4HETA 1LHOA 2WFF3 2XBO2 2ZGQA 3LCPA 4IEWA 3V0AA 2R0FA 5DUXA 2R062 2ET7A 4UW3A 4HANA 3E6DA 2P37A 2JKBA 4IEZA 3AFGA 1HX6A 2ES3A 1AF9A 4R52A 3SCFA 5I0SA 5JPMB 3GYDA 1UU5A 3H1MA 3FZ3A 3ZSKA 3JU9A 5K0UC 4CDUC 1X8MA 2Y38A 2DTWA 1BXHA 1GSLA 3AMQA 4LBOA 1H1MA 1WD4A 2NYYA 4LA2A 2BQPA 4C1WA 4OHYA 4IETA 5KC6A 1QJY3 1H8VA 3ZN4A 5A3LA 3I59B 4W6YA 1UW8A 1MEC3 2ZGMA 4CEYC 4N7UA 4AEKA 4QT6A 3FX3A 1PIV2 4F8AA 1WCSA 4K1ZA 2D3PA 1TME3 3U0ZA 1PZ9A 1G86A 1RMU3 3WG4A 4BZ4A 3FBMA 4TSVA 4F7ZA 3SCHA 3J9SA 5GLWA 2DURA 1AYM3 3OD0A 1MS9A 4I30A 1LENA 1NCRC 2YDEA 1W6MB 4MGIE 1OQDA 1YO8A 1U5YA 2MHFA 1AL0G 1HRV1 5CA6A 2P3KA 4X8NA 1IS6A 1RTVA 1ZRDA 1U5IA 3LWCA 1M4WA 2A73B 5CFDA 5BYNA 3ECQA 1GZWA 4JGYC 5AVAA 3WCRA 4PQ9A 2ZJCA 2WLQA 4GXLA 3WCSA 4FXGB 3WW2A 4GA9A 2VMHA 3WT3A 1UKRA 1VAVA 2QZ3A 2WNUC 2C1FA 3JQXA 4Q0SA 3ZDSA 5J36A 2SLIA 3JD72 3S7IA 1EAH3 3AYCA 3AM2A 3ZFEA 3JUUA 1CJDA 1RUI3 3E5QA 4IV1C 1CJPA 1ASJ3 2O0OA 3JBG3 4HKLA 1QH6A 1XE7A 4PDWC 1FPN3 5FMOS 3RI8A 3ZYGA 2XLAA 1IZ3A 1LOGA 1F8VA 1PO21 4R8HA 5BNPC 2Z69A 3VZMA 5BUVA 3E5UA 2VVEA 5HXVA 5CADA 1RUC1 2ZGNA 1LOFC 3VBFA 4FP2A 2RMU1 3ILFA 2BEOA 2V5YA 4GALA 3KQRA 4DS0A 4LR4A 3DPRA 4KNCA 4RQPB 2Q30A 3RWNA 3L2HA 1WW6A 3UKNA 1FT9A 3LGRA 3ZSEA 5FLIA 1H30A 2XL7A 4XJ8A 3GZTB 4E27A 2PHLA 4CDXA 5IK7A 1CX4A 1ZBE2 2Q1MA 4QMAA 1RHI1 4AK3A 3R05A 3GHNA 1CIWA 1ZBA2 4XJ9A 4GWNA 4AVCA</