2DUYA

Crystal structure of competence protein comea-related protein from thermus thermophilus hb8
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
65
structure length
65
Chain Sequence
PLPQAQTPVSLNEASLEELMALPGIGPVLARRIVEGRPYARVEDLLKVKGIGPATLERLRPYLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of competence protein ComEA-related protein from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords Competence protein ComEA-related protein
total genus 18
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 2duyA00
5B66U 5TISU 5H2FU 5KAFU 4PJ0U 4IL6U 5GTHU 3WU2U 5KAIU 3A0BU 5GTIU 4UB8U 5B5EU 3KZIU 2AXTU 2DUYA 4UB6U 5E79U 1S5LU 3A0HU
chains in the Genus database with same CATH superfamily
4PHPA 4P0QA 5AI9A 1ZQKA 9ICIA 2KSOA 2UVRA 2MA1A 5ALTA 2BQ3A 2JZBB 2R8JA 5J2FA 2E3TA 5DBCA 1KLNA 5KG2A 4HYKA 3ISCA 4CF3A 4RQ3A 7ICHA 1SWVA 2KN7A 3PVXA 3C28A 4I2IA 4O5EA 3PX0A 5EOZA 2RRDA 2KK0A 5KG6A 3PSIA 4DSLA 1A76A 4EELA 5ALWA 4XA5A 4B9NA 1Z00A 2YMQA 2XGQA 3TAPA 5DKWA 1KL9A 3T5HA 2EAPA 4RNNA 2ZTEA 8ICSA 2KIWA 3RJEA 1HUZA 5ALDA 5H2FU 3V7KA 2YQEA 1ZQGA 1XWLA 2PMZC 2BCQA 4KLUA 2ZUCA 2C28A 2KJ5A 4GIBA 8ICCA 5B66U 1Z1BA 5ALXA 3PX6A 2P35A 1T3NA 2AJQA 2IA6A 4LJXA 5J2GA 1NJZA 3OHBA 1RYRA 2M0NA 2ASJA 2H5XA 5BOLA 3IV6A 1BPDA 5KFLA 4XQ8A 4EZ9A 4FZNA 3WK6A 4C80A 5L9XA 1GO3F 7ICMA 8ICUA 4FBTA 2DQNB 4RQ7A 3E2EA 3WU2U 1N61A 3GU3A 3QZ7A 1ZQWA 4F4WA 4Y2UA 7ICQA 2F3NA 4OJ5A 3GILA 1DGSA 4QZBA 4JK1A 3HWTA 4FZLA 1IM4A 1CUKA 1NK8A 2WTFA 2BCVA 2C22A 3MR5A 4DS4A 1LB2B 4C8KA 2LYAA 2XI9A 3IDWA 3H40A 4FBUA 3B0YA 3AEVA 2Y9TA 3K75D 1L8OA 3HPOA 4J9RA 4F92B 1S0OA 3CRXA 4RQ4A 2KFNA 1HJPA 4RPXA 3KTQA 1A77A 3E0FA 3V6HA 5DDMA 4NLKA 4YVZA 2PFOA 1JXEA 1J2MA 2DL0A 1P7DA 2V4RA 4DFPA 4QZAA 1QSYA 3KHHA 2ZUDA 1ZD5A 3RRHA 2LYBA 4I2DA 3QU4A 3QZ8A 2HHUA 2AH5A 1X42A 4F2SA 1HUOA 8ICGA 3QU5A 1V97A 2XY7A 1ZQSA 1WCLA 3CW2C 4JV1A 5AM1A 1ZQTA 4J9MA 5KFPA 2ZIXA 3NVWA 5ALEA 3GV8B 1XSLA 3PW5A 1F0MA 4UB2A 1S9FA 4QZ8A 1PVQA 5DQIA 4OJOA 3RB4A 4J03A 3SENA 2JH1A 2FJ6A 2KOBA 1MSWD 2EZXA 4FZMA 4RQMA 2OH2A 2ZXHA 1KEJA 1L5UA 1XU4A 1RG6A 3TAQA 4RQ6A 4DS5A 4Q8FA 2HHVA 2FLNA 4RQ5A 3KBBA 3EUB2 4DSFA 3HW8A 5ALZA 3LWLA 4ECQA 4ED7A 3QUTA 2IOHA 1S0NA 4Y2YA 4J9QA 4RUAA 4PHEA 8ICPA 2ZJ8A 5AM3A 1SB3C 1X6JA 4JUZA 4PL1A 4IRCA 3PSFA 2M9NA 5AM4A 5IILA 1D9FA 2W55A 1ZJMA 3UXPA 4DFKA 2R18A 2XIDA 5AM0A 2HOFA 4TUQA 2MU2A 4QWAA 2WAQC 3JPNA 5KL8B 2FLLA 2PFNA 5TZVA 4KLFA 5CWRA 3C29A 3TQ1A 2WB1F 3ALRA 3RAXA 9ICSA 8ICBA 3UM9A 4NLCA 4BXOA 2RQ5A 3TFSA 2C2EA 4UB8U 1NOMA 4X5VA 2HOIA 3N4MB 2VA2A 3RJHA 2HHXA 4C7ZA 5F3XB 3WK9A 3ZDEA 1RPLA 1T3QA 2LKYA 2F1HA 4I2JA 1ZQRA 3MGHA 2VIXA 3ED5A 3NASA 4O3QA 4JV0A 5DBBA 2IHMA 4KLGA 2D8CA 4OJLA 2KSOB 2HBLA 4KLEA 1ZQEA 4MHVA 4YD1A 3PO4A 5DB6A 3OTQA 4F2RA 2YB4A 2JEGA 3I1YA 4QZGA 5DG8A 1AROP 1KDHA 5KFBA 3C2LA 3SQIA 1QLNA 2CRXA 2IBKA 2HBKA 5DQHA 4YXMA 3AU2A 3Q8SB 1UCVA 3LVVA 1Z19A 3GIIA 3H4BA 2P6RA 1NK9A 3PR5B 3SAFA 3C1ZA 2N1RA 1N2XA 5KAIU 4F4XA 4TQRA 2KICA 2E8PA 1NK6A 4KITB 8ICWA 7ICEA 2KP7A 3EW9A 3MR2A 4DLGA 1OUQA 1ZD3A 1TAUA 2DUYA 3WK7A 1S77D 4DL3A 2ZIXB 5J2EA 4DL4A 1Q3VA 3JPTA 4NM1A 1N56A 3BS5B 1WCNA 4BWMA 1NJWA 1BVSA 3MBYA 2W03A 4UB6U 2FMPA 5KFMA 2LI6A 3QYPA 3ICXA 3LVWA 1J97A 1DOQA 1RM6C 4P0PA 4O3MA 5ALLA 1RXVA 1NKBA 4F5NA 5KFRA 2W9CA 3SYZA 1A6SA 1ZQIA 1UT8A 5ALPA 4US8A 3ZI4A 3IRUA 2J6SA 2ZIUA 4FFDA 3RRGA 1ZQQA 4CF5A 3NVZA 2Y0SC 1FIQA 4P0PB 2QLTA 2KKPA 3MR6A 4KLLA 4O3NA 3BS5A 5JRTA 5J0WA 4RPYA 1XO0A 2D6FC 1U48A 4F50A 4KX5A 5J2IA 1S0MA 4BGDA 5ALQA 3HT3A 5ALOA 4EEYA 1LVHA 5KG7A 5EE1A 3PW2A 3F53A 2W8KA 3JPPA 5AI4A 1ZQXA 4UAVA 3O0FA 4DLEA 5IIOA 4YP3A 4TUSA 1TE2A 3HJEA 5F9NA 3SI8A 4MEXA 1ECWA 4C8MA 5KAFU 3G6YA 1MQ2A 2F1JA 2KE7A 1S10A 2JRZA 3A0HU 2J6TA 2ZIWB 4DSEA 1ZYQA 1RXWA 3M9NB 2E1FA 1SKWA 2EAMA 2ZIUB 1KBUA 2K8CB 1JXLA 8ICZA 1JN3A 2PI5A 5HMLA 4I2GA 4QWBA 5EE0A 4DL6A 1Z4OA 1ZQ1C 1NJYA 3QXGA 2C2RA 2J6UA 3H0RB 1ZQCA 4UW9A 3C21A 5JTIA 4QZEA 2K8BB 1KFDA 4NLZA 1PUZA 3Q8LA 3GV7B 4EX7A 5HP4A 3JPQA 2K4PA 4AYBF 2FPLA 4Q45A 4KLIA 1T8EA 4I29A 2OHFA 4PL2A 5D49A 1RQNA 4EYHB 4MFFA 5T14A 5KFUA 2KVCA 1JX4A 3M1YA 2BCRA 4Z6CA 1ZQVA 4Y2VA 5ALJA 5IIJA 5JU5A 2UVVA 3MFIA 4YCXA 4EX6A 5AI8A 2YY6A 3OHAA 2MAXA 2BR0A 1SXDA 9ICBA 2XCAA 4NY8A 3V6JA 4DQPA 1DK2A 4I2BA 5C0YA 3PZPA 5KFSA 4TQSA 3SZ2A 4CDGA 7ICLA 2B0CA 9ICHA 1WWUA 1BPXA 2AHOB 1BNPA 4RPZA 3BS7A 8ICNA 2EZYA 4JWNA 3IG5A 2RLTA 1WUDA 4DFJA 5KT5A 2K8AA 3KZXA 4OJPA 4KLJA 1LV5A 1Z00B 5CHGA 2HI0A 5J8YC 4G9BA 1DRGA 8ICOA 4Y2JA 3UQ0A 3SAGA 2AGQA 1K1QA 3NVVA 1OXJA 1BNOA 1PK1A 2C2DA 2W11A 3QU7A 1JIHA 3WKAA 3D2NA 8ICEA 1L8LA 1TAMA 1ZQLA 3BZKA 4DL7A 3NUQA 4BXOB 4IR9A 3T5KA 2WF7A 1UPHA 4C8LA 2DBYA 7ICFA 1L7MA 5DG7A 3SR6A 2K4HA 2BPFA 4JWMA 3GFKB 2A1JB 2AXTU 3KD3A 2I6XA 7ICUA 3RH5A 1L7PA 3C5GA 2K4EA 4ELUA 1U9LA 4P2HA 3GDXA 4DCCA 1QSLA 5J0XA 5AKKA 2HSZA 2KHVA 9ICWA 4B9VA 4GXIA 3UQ2A 1F44A 3KFUF 4DQIA 2F8KA 1DK3A 3KKAC 1TV9A 3Q8QB 4U6PA 3PV8A 2WF9A 3MC1A 3BJYA 2ZJAA 5ALVA 4O3OA 2NYVA 3M6KA 3TANA 4KN4A 2ISOA 1A0PA 1X40A 2JEJA 3ZDAA 8ICLA 1NK7A 1K1SA 4I2FA 4I2HA 2W9MA 2ASLA 2E1EA 1WG8A 2R8KA 1KW4A 4F4YA 1TAQA 4J9SA 2QARB 2WHEA 5ALFA 3F2BA 5AI5A 2YTUA 2HVHA 2GWSA 1SKRA 4QW9A 4Z6DA 1Q3UA 2CXYA 5KG0A 2HHTA 2W04A 3DV9A 4DF4A 2G06A 2ISPA 2KD1A 1S97A 3MGIA 4B9SA 1SV0C 2P6UA 5ALMA 3HRDD 2F1IA 4WJ3B 2OXOA 1N60A 3T5JA 4RQNA 5DGAA 3LK9A 1JROA 2KVSA 4M6WA 3QE9Y 5KL1B 3M9OB 4FO6A 2QB0A 3FDSA 2W3SA 2BKEA 2NO5A 5J0RA 2HOQA 4FS2A 1FFVA 1IG6A 2DKZA 1DGJA 5KFHA 3TADC 1IIPA 4FS1A 3QEBZ 4J9LA 4QW8A 1LKYA 4KLOA 1V38A 4C4TA 2NO4A 4P0QB 1KN5A 2G09A 1FEZA 3EPIA 4DWIA 3T5LA 5CEHA 3RB3A 4F72A 2CN1A 4MF2A 4ELVA 2KJ8A 1UA0A 2OWOA 5EWGA 1COKA 4R65A 3JPRA 3CP8A 5G5GA 3PSPA 5KT4A 3WK5A 2L5YA 1L7OA 4QIWC 1PZNA 2VJ5A 2G07A 2JMGA 5J0QA 3G6VA 4ZH4A 2GH1A 3AQFA 4XUSA 8ICHA 1BPZA 5HMMA 3AL0B 4RZRA 4ECSA 3PSTA 3N28A 2ZIVA 1CRXA 1UQVA 3PR4A 2W9CB 4LZDA 1AQ6A 4EENA 1K5OA 4AP9A 2EH9A 4ED6A 3BQ7A 2ZXIA 4QWEA 4OJ6A 1URJA 4PGYA 5J2HA 2HW3A 1SXEA 4QZCA 4B9LA 3M7DA 2GLEA 3VCBA 3NRWA 4ACOA 4TURA 4GXKA 2HHSA 1XS9D 2JEIA 4I2CA 1XC9A 2LBOA 2V9WA 2ZUBA 1NI3A 5HR7A 1S5LU 9ICXA 4DFMA 3FM9A 4QIWF 3RJGA 4EBDA 5DLGA 5IIKA 1SGGA 1F5SA 2WAQF 1TFRA 2YMLA 4UASA 1IXRA 1N5WA 5AIAA 3F2DA 3DDHA 5ALUA 1JI7A 3V7LA 4CE6A 5DDYA 2W3RA 8ICYA 1X2IA 3HKZC 2KZ3A 4BX9C 4UB5A 2VA8A 2NRTA 4F93B 5KTQA 1QQ5A 5AKXA 1KFSA 3QUQA 4F3OA 3ZDCA 1NZBA 5DB9A 2WF8A 9ICUA 2HBMA 4QZHA 1KQQA 1U4BA 1SL0A 3C2MA 4ED8A 1MN8A 1JRPA 2KZMA 1ZOLA 5DB7A 3T3FA 8ICAA 4YR0A 1B22A 4NLBA 5DB8A 8ICRA 4DSKA 2ODGA 4QZ9A 5B5EU 3TI0A 1MA7A 2ALZA 4GFJA 3B9JA 4QZDA 3QU9A 3SV3A 2JEFA 4ED0A 3ISDA 5DGBA 4R66A 2IOFK 4EBCA 4IQUA 3M8SA 2BPGA 3FAHA 2W7OA 2MRLA 5DLFA 4UB3A 3EZ5A 3UMGA 8ICIA 3RH4A 2FDRA 3DEEA 2H3VA 5KG5A 5EWEA 1YT3A 5J0TA 3PY8A 4PGXA 1JUDA 3MR3A 3ORYA 3JPSA 4LZGA 3PX4A 2E5SA 3GQCA 4J9NA 1S8OA 7ICSA 2OM6A 2KJ9A 3CYMA 2V4QA 5JUMA 4C0ZA 2EQYA 2RP5A 2MUTB 1X9MA 5KT6A 4E0DA 3MFHA 1ZQDA 2KV2A 2AU0A 5DBAA 4NL9C 4ECYA 4B6JA 1X9SA 1ZQUA 1COOA 4NJ8A 3D2QA 4UAYA 1UA1A 1X9WA 3UXOA 1RDFA 3PW0A 4BDPA 2XICA 1D8BA 2KG5A 2Y1IA 5HHIA 2LM1A 2UVWA 1NNLA 4F91B 2F44A 2VKQA 4XRHA 4K4GA 2R8GA 1BPYA 3SEIA 2FMSA 3OSPA 3RB0A 2W43A 2NRZA 4F8RA 4Y2SA 9ICKA 1B0XA 4RUCA 3IN5A 2A1AA 3WKDA 4I27A 3H4DA 4M9HA 1HIWA 3GIJA 2ZJ5A 1JALA 2ZIWA 2YN4A 1SZPA 2HBJA 4PZOA 5AKGA 1VJ5A 4DSIA 5ALNA 3ZDDA 4JV2A 7ICJA 4O0IA 5KT7A 2PKEA 4EYIB 4NXZA 2FPMA 4C7YA 2LPEA 5HNKA 4PH5A 1NZPA 3QUBA 5KG3A 2OYYA 1QTMA 4M47A 2DPJA 5AKHA 3L3FX 4Z6EA 3RBEA 2FPKA 2Q0ZX 1YZ7A 5DQGA 5KFWA 1ZQPA 4NWIA 4TUPA 4J9KA 1TK0A 4RQ1A 2UVUA 4YFKA 3PW7A 8ICXA 1KKXA 5CJ7A 8ICJA 4KTQA 2BQRA 4JB3A 4Y2TA 2NRWA 4RT2A 4RNMA 4PPXA 3NTUA 3RBDA 1RZTA 2AGPA 4CRXA 4QZIA 4DQRA 1ZQBA 4O3SA 2WF6A 4KN7A 5AHXA 5AI6A 2FI1A 9ICEA 3E58A 5K4LA 1J2NA 2YMMA 9ICPA 7ICNA 3HX0A 3ETRA 2JXJA 1OW5A 1C7YA 3QX7A 3R9KA 2G0AA 5AK3A 2ASDA 4BJQA 2P66A 1Q46A 4F4KA 3RB6A 2W8LA 4NLNA 1NKCA 2LM4A 5AKYA 3TADA 2DWQA 1XSPA 2B6GA 2XCPA 4KLDA 2EDUA 5J2JA 3H0MB 3V72A 7ICTA 4IR1A 4UB1A 4I2AA 2ZIVB 1KTQA 2G5HB 4US9A 2YX8A 3UMBA 5L1IA 4Y2RA 4YD2A 4DOAA 4PJ0U 1T94A 3WK4A 4ZOHC 3NGDA 1TVAA 3HKZF 5J0UA 5ALIA 2RDJA 9ICVA 5AKLA 5ALSA 5EWFA 4O9MA 5J2DA 3OGUA 1ZETA 2RHFA 3NS1A 2H3QA 4QZFA 4ECTA 4LVSA 4GXJA 1PK3A 5KFNA 2XC9A 4USAA 1IV8A 2FLPA 2JV3A 9ICNA 2KNJA 1FO4A 1N63A 2RDIA 4ED2A 4UBCA 8ICKA 1ZXIA 2EZZA 2LMRA 1SKSA 3Q8KA 7ICGA 5FP0A 2WF5A 2VJ4A 1ZQJA 5KFDA 1ED1A 4IRKA 7ICPA 1MC8A 2KTQA 1Z1VA 2ZG6A 3KHLA 5KFEA 3L4PA 3KHGA 3D2SA 3F2CA 3A0BU 5G5HA 9ICMA 3MDCA 5CRXA 5J0OA 3RF9A 3N7SC 2YMPA 4M9GA 3H8JA 4RU9A 1X6IA 4GC6A 3OJUA 1Z4NA 1FFUA 5KG4A 5KT3A 2WFAA 3RR7A 1SV0A 4EEKA 3FYHA 2HVIA 3PNCA 4GC7A 5KFIA 4ECRA 2A19A 4UAWA 2A3VA 1EXNA 4U7CA 4BUGA 3IG8A 4IQTA 4UAUA 3EWAA 5HR6A 2AGOA 4ECWA 3CNHA 3SV4A 2KIVA 3AM9A 5ALKA 1NK5A 1HEKA 2MSNA 4M04A 8ICFA 4C8OA 1T4GA 2D3DA 5CB1A 2PFQA 1ZQZA 5KFKA 5KFFA 3EPGA 1WYGA 5J2CA 1NK0A 1XO1A 4KX3A 1NKEA 5L1MA 5AM2A 4IQWA 5KFYA 2BQUA 4M9JA 2ZTDA 1S76D 3V6KA 7ICVA 1ZRMA 3TFRA 1SL1A 4K4HA 4NL9A 2ZTCA 2PMZF 5L1LA 3BDPA 4QNLA 3HILA 4RQ0A 5KFTA 2DKXA 3GIMA 4YQWA 5A0LA 2XGPA 3K4GA 2W9BB 4UBBA 1DXSA 1NK4A 2PFPA 4OD0A 3H0LB 3LDAA 4A8EA 8ICTA 1O08A 4OCZA 2DPIA 4MF8A 1Y88A 4Y2XA 9ICFA 4KLMA 2XY6A 2E8NA 4DF8A 2CPRA 2K4IA 5C5JA 2JH7A 4C4SA 2NRXA 3QNMA 1RQLA 5EE3A 5HHHA 3F5AA 2JGAA 1O03A 4ICAA 2OEHA 3RR8A 5J2AA 1VDVA 3NVYA 2H3ZA 5J0YA 1BPEA 7ICOA 3BZCA 2ESEA 4Q43A 1C20A 4DQSA 4M6WB 1ZRNA 5F9LA 1U49A 2I5HA 5DG9A 1U45A 2W9BA 4M0AA 5ALYA 4F5QA 5J0PA 1QQ6A 5IINA 4Z6FA 3D6JA 1RYUA 3C1YA 2BDPA 3OJSA 3T79A 2AQ0A 1ZQFA 1TK8A 3RJKA 2BCSA 4O5CA 3RAQA 3EYZA 2XO7A 4R8UA 4UQGA 5AI0A 9ICGA 4F5OA 4CCHA 1UHUA 5KG1A 4M2YA 4MFCA 3SAHA 4F5PA 1ZQMA 2K89A 4KLTA 1D8YA 4ECVA 2R8HA 5IIIA 3BQ0A 5D46A 4PGQA 3FC4A 1H38A 4P4OA 4Q8EA 5KFZA 2HCFA 1QQ7A 2BCUA 9ICJA 2GO7A 5AK6A 2KZZA 2YB1A 2ES6A 4RT3A 3IHQB 4CGZA 5J8YA 4YR2A 4PHDA 9ICRA 1ZD2P 4ED1A 3N7RC 2ATLA 3ISBA 5KT2A 2KHQA 5KNIA 1QH9A 3H8MA 2AQ4A 2Z7JA 3MDAA 1KRPA 1JMSA 4ECZA 4K4IA 2PXIA 3JPOA 3F5EA 2HHWA 2DGZA 1T7PA 2IHNA 3C2KA 1M6YA 4KLSA 3RTVA 3KKAA 3PO5A 3IP4B 4CF4A 5L1JA 5IIMA 5EE9A 4EBEA 5KFAA 3PW4A 1L3UA 1SWWA 3N7PD 4YN4A 4YMOA 3M6ZA 2LHTA 4KMOB 1V9PA 3WKBA 4C4RA 4R63A 3N97B 1VLBA 1KFTA 2IOFA 4FE3A 3C5FA 1V85A 3GZFA 2F77X 4RQ8A 1SZHA 4JMUA 4MEYA 2LYHA 2JHDA 5J29A 5J2BA 4DQQA 3RJJA 7ICKA 5KFOA 3I28A 3K1RB 4R8UB 1S0VA 1X66A 5GTHU 2PI4A 2EAOA 4QWDA 2XY5A 4P4PA 9ICTA 4ELTA 4YMMA 2I9GA 3AUOA 2KEYA 3G6XA 3PMLA 3BQ2A 3KZIU 3ZDBA 2E8MA 3J81j 9ICCA 2XVTA 3RFAA 5AICA 4UB4A 3LWMA 3IM1A 4P4MA 2VANA 5L1KA 2QB0B 2IMWP 3KHRA 4PHAA 4B9UA 3S6JA 5KFGA 2Y9UA 5ALHA 4O5KA 4IS7A 1CEZA 2QKQA 2NV3A 1L3TA 3C23A 1NJXA 3RJFA 4CNQA 5BOMA 5J0SA 4YMNA 2DFLA 1RYSA 3I76A 2W54A 3ETLA 5TISU 1SL2A 4F5RA 1ZQOA 4R64A 3RH6A 1L7NA 7ICIA 4AYBC 4DL2A 4M9LA 1BGXT 5E79U 2O6KA 1WWVA 1N62A 1B4FA 5AKIA 3Q8MA 5AK4A 2Y1JA 5CR0A 1TK5A 4IRDA 3RJIA 4UARA 2MUTA 5KFQA 1XNSA 5AKJA 3MABA 2QARA 3WKEA 4DO9A 3AQEA 3GV5B 3ZD9A 4KMUA 9ICAA 2KMDA 4Q44A 4BWJA 3QEAZ 3Q8PB 3U26A 5KFVA 4O3RA 2BHNA 2Y0SF 3OPXA 4F4ZA 2EANA 2HMXA 2B21A 4C8NA 1SV4A 5D4BA 2R8IA 1L3VA 4QJFB 5AIBA 1ZQYA 1D8LA 2F2AB 4NM2A 1PVPA 5KFXA 2K60A 2HDOA 1D9DA 3UPQA 4PZNA 1PVRA 4I2EA 3UMCA 4DL5A 5GTIU 1Q8KA 1YZ6A 3M9MB 4KLHA 3GIKA 3PMNA 4ECUA 2BDUA 3M8RA 2FMQA 4KLQA 4EZ6A 1U47A 1Z3EB 3HP6A 1KSPA 4M9NA 4HAIA 1ZQNA 4I28A 9ICLA 4YG2A 5AK5A 4Y2PA 5BPCA 1PK1B 1QSSA 2Q4TA 3QU2A 3Q8RB 3H8SA 4RQ2A 3K1ZA 4J9PA 8ICVA 5CA7A 5AM5A 2KKVA 2VA3A 4DSJA 3TARA 8ICQA 4B9TA 4Y2QA 3AU6A 3H8WA 2OCEA 2HHQA 3SMVA 1ZQHA 4GLXA 9ICQA 5AKEA 2A1JA 1CI4A 5KFJA 3TKAA 2H3FA 2BGWA 2JR5A 4F71A 3UXNA 3BQTA 2BPCA 2I1QA 5AKZA 1B43A 4UATA 1ZJNA 2E8OA 5ALGA 1L6NA 2F8LA 4DOBA 4NV0A 1UT5A 3V7JA 4DFDA 4UAZA 3QUCA 5KFCA 7ICRA 2H3IA 4G3IA 2F76X 2GOLA 1TKDA 4IQVA 2NRVA 3MGVA 2DF4B 4J9OA 1ZD4A 3TACB 3BQ1A 4ED3A 3KOOA 3ONNA 4O3PA 5ALRA 4QWCA 2KFZA 4NLGA 3LYSA 9ICOA 1BPBA 1QCKA 3H7IA 4IL6U 1N48A 3SD7A 1MQ3A 3VC8A 4IC9A 3OSNA 4YR3A 2W7PA 1X9XA 1L3SA 3B0XA 4YXJA 3WK8A 3AMZA 3NRZA 1SIJA 4DEZA 1XSNA 3THVA 2JZBA 2G5IB 4DOCA 3ZD8A 1ZQAA 4OO1J 4ECXA 5CP2A 2QB1A 5J2KA 4MFAA 3AN1A 4RNOA 2W9AA 2G08A 3L5KA 2BZFA 2WB1C 1N5XA 1LKYB 3WKCA 4B9MA 2FE9A 8ICMA
chains in the Genus database with same CATH topology
5B66U 5TISU 5H2FU 5KAFU 4PJ0U 4IL6U 5GTHU 3WU2U 5KAIU 3A0BU 5GTIU 4UB8U 5B5EU 3KZIU 2AXTU 2DUYA 4UB6U 5E79U 1S5LU 3A0HU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B66 U;  5TIS U;  5H2F U;  5KAF U;  4PJ0 U;  4IL6 U;  5GTH U;  3WU2 U;  5KAI U;  3A0B U;  5GTI U;  4UB8 U;  5B5E U;  3KZI U;  2AXT U;  2DUY A;  4UB6 U;  5E79 U;  1S5L U;  3A0H U; 
#chains in the Genus database with same CATH topology
 4PHP A;  4P0Q A;  5AI9 A;  1ZQK A;  9ICI A;  2KSO A;  2UVR A;  2MA1 A;  5ALT A;  2BQ3 A;  2JZB B;  2R8J A;  5J2F A;  2E3T A;  5DBC A;  1KLN A;  5KG2 A;  4HYK A;  3ISC A;  4CF3 A;  4RQ3 A;  7ICH A;  1SWV A;  2KN7 A;  3PVX A;  3C28 A;  4I2I A;  4O5E A;  3PX0 A;  5EOZ A;  2RRD A;  2KK0 A;  5KG6 A;  3PSI A;  4DSL A;  1A76 A;  4EEL A;  5ALW A;  4XA5 A;  4B9N A;  1Z00 A;  2YMQ A;  2XGQ A;  3TAP A;  5DKW A;  1KL9 A;  3T5H A;  2EAP A;  4RNN A;  2ZTE A;  8ICS A;  2KIW A;  3RJE A;  1HUZ A;  5ALD A;  5H2F U;  3V7K A;  2YQE A;  1ZQG A;  1XWL A;  2PMZ C;  2BCQ A;  4KLU A;  2ZUC A;  2C28 A;  2KJ5 A;  4GIB A;  8ICC A;  5B66 U;  1Z1B A;  5ALX A;  3PX6 A;  2P35 A;  1T3N A;  2AJQ A;  2IA6 A;  4LJX A;  5J2G A;  1NJZ A;  3OHB A;  1RYR A;  2M0N A;  2ASJ A;  2H5X A;  5BOL A;  3IV6 A;  1BPD A;  5KFL A;  4XQ8 A;  4EZ9 A;  4FZN A;  3WK6 A;  4C80 A;  5L9X A;  1GO3 F;  7ICM A;  8ICU A;  4FBT A;  2DQN B;  4RQ7 A;  3E2E A;  3WU2 U;  1N61 A;  3GU3 A;  3QZ7 A;  1ZQW A;  4F4W A;  4Y2U A;  7ICQ A;  2F3N A;  4OJ5 A;  3GIL A;  1DGS A;  4QZB A;  4JK1 A;  3HWT A;  4FZL A;  1IM4 A;  1CUK A;  1NK8 A;  2WTF A;  2BCV A;  2C22 A;  3MR5 A;  4DS4 A;  1LB2 B;  4C8K A;  2LYA A;  2XI9 A;  3IDW A;  3H40 A;  4FBU A;  3B0Y A;  3AEV A;  2Y9T A;  3K75 D;  1L8O A;  3HPO A;  4J9R A;  4F92 B;  1S0O A;  3CRX A;  4RQ4 A;  2KFN A;  1HJP A;  4RPX A;  3KTQ A;  1A77 A;  3E0F A;  3V6H A;  5DDM A;  4NLK A;  4YVZ A;  2PFO A;  1JXE A;  1J2M A;  2DL0 A;  1P7D A;  2V4R A;  4DFP A;  4QZA A;  1QSY A;  3KHH A;  2ZUD A;  1ZD5 A;  3RRH A;  2LYB A;  4I2D A;  3QU4 A;  3QZ8 A;  2HHU A;  2AH5 A;  1X42 A;  4F2S A;  1HUO A;  8ICG A;  3QU5 A;  1V97 A;  2XY7 A;  1ZQS A;  1WCL A;  3CW2 C;  4JV1 A;  5AM1 A;  1ZQT A;  4J9M A;  5KFP A;  2ZIX A;  3NVW A;  5ALE A;  3GV8 B;  1XSL A;  3PW5 A;  1F0M A;  4UB2 A;  1S9F A;  4QZ8 A;  1PVQ A;  5DQI A;  4OJO A;  3RB4 A;  4J03 A;  3SEN A;  2JH1 A;  2FJ6 A;  2KOB A;  1MSW D;  2EZX A;  4FZM A;  4RQM A;  2OH2 A;  2ZXH A;  1KEJ A;  1L5U A;  1XU4 A;  1RG6 A;  3TAQ A;  4RQ6 A;  4DS5 A;  4Q8F A;  2HHV A;  2FLN A;  4RQ5 A;  3KBB A;  3EUB 2;  4DSF A;  3HW8 A;  5ALZ A;  3LWL A;  4ECQ A;  4ED7 A;  3QUT A;  2IOH A;  1S0N A;  4Y2Y A;  4J9Q A;  4RUA A;  4PHE A;  8ICP A;  2ZJ8 A;  5AM3 A;  1SB3 C;  1X6J A;  4JUZ A;  4PL1 A;  4IRC A;  3PSF A;  2M9N A;  5AM4 A;  5IIL A;  1D9F A;  2W55 A;  1ZJM A;  3UXP A;  4DFK A;  2R18 A;  2XID A;  5AM0 A;  2HOF A;  4TUQ A;  2MU2 A;  4QWA A;  2WAQ C;  3JPN A;  5KL8 B;  2FLL A;  2PFN A;  5TZV A;  4KLF A;  5CWR A;  3C29 A;  3TQ1 A;  2WB1 F;  3ALR A;  3RAX A;  9ICS A;  8ICB A;  3UM9 A;  4NLC A;  4BXO A;  2RQ5 A;  3TFS A;  2C2E A;  4UB8 U;  1NOM A;  4X5V A;  2HOI A;  3N4M B;  2VA2 A;  3RJH A;  2HHX A;  4C7Z A;  5F3X B;  3WK9 A;  3ZDE A;  1RPL A;  1T3Q A;  2LKY A;  2F1H A;  4I2J A;  1ZQR A;  3MGH A;  2VIX A;  3ED5 A;  3NAS A;  4O3Q A;  4JV0 A;  5DBB A;  2IHM A;  4KLG A;  2D8C A;  4OJL A;  2KSO B;  2HBL A;  4KLE A;  1ZQE A;  4MHV A;  4YD1 A;  3PO4 A;  5DB6 A;  3OTQ A;  4F2R A;  2YB4 A;  2JEG A;  3I1Y A;  4QZG A;  5DG8 A;  1ARO P;  1KDH A;  5KFB A;  3C2L A;  3SQI A;  1QLN A;  2CRX A;  2IBK A;  2HBK A;  5DQH A;  4YXM A;  3AU2 A;  3Q8S B;  1UCV A;  3LVV A;  1Z19 A;  3GII A;  3H4B A;  2P6R A;  1NK9 A;  3PR5 B;  3SAF A;  3C1Z A;  2N1R A;  1N2X A;  5KAI U;  4F4X A;  4TQR A;  2KIC A;  2E8P A;  1NK6 A;  4KIT B;  8ICW A;  7ICE A;  2KP7 A;  3EW9 A;  3MR2 A;  4DLG A;  1OUQ A;  1ZD3 A;  1TAU A;  2DUY A;  3WK7 A;  1S77 D;  4DL3 A;  2ZIX B;  5J2E A;  4DL4 A;  1Q3V A;  3JPT A;  4NM1 A;  1N56 A;  3BS5 B;  1WCN A;  4BWM A;  1NJW A;  1BVS A;  3MBY A;  2W03 A;  4UB6 U;  2FMP A;  5KFM A;  2LI6 A;  3QYP A;  3ICX A;  3LVW A;  1J97 A;  1DOQ A;  1RM6 C;  4P0P A;  4O3M A;  5ALL A;  1RXV A;  1NKB A;  4F5N A;  5KFR A;  2W9C A;  3SYZ A;  1A6S A;  1ZQI A;  1UT8 A;  5ALP A;  4US8 A;  3ZI4 A;  3IRU A;  2J6S A;  2ZIU A;  4FFD A;  3RRG A;  1ZQQ A;  4CF5 A;  3NVZ A;  2Y0S C;  1FIQ A;  4P0P B;  2QLT A;  2KKP A;  3MR6 A;  4KLL A;  4O3N A;  3BS5 A;  5JRT A;  5J0W A;  4RPY A;  1XO0 A;  2D6F C;  1U48 A;  4F50 A;  4KX5 A;  5J2I A;  1S0M A;  4BGD A;  5ALQ A;  3HT3 A;  5ALO A;  4EEY A;  1LVH A;  5KG7 A;  5EE1 A;  3PW2 A;  3F53 A;  2W8K A;  3JPP A;  5AI4 A;  1ZQX A;  4UAV A;  3O0F A;  4DLE A;  5IIO A;  4YP3 A;  4TUS A;  1TE2 A;  3HJE A;  5F9N A;  3SI8 A;  4MEX A;  1ECW A;  4C8M A;  5KAF U;  3G6Y A;  1MQ2 A;  2F1J A;  2KE7 A;  1S10 A;  2JRZ A;  3A0H U;  2J6T A;  2ZIW B;  4DSE A;  1ZYQ A;  1RXW A;  3M9N B;  2E1F A;  1SKW A;  2EAM A;  2ZIU B;  1KBU A;  2K8C B;  1JXL A;  8ICZ A;  1JN3 A;  2PI5 A;  5HML A;  4I2G A;  4QWB A;  5EE0 A;  4DL6 A;  1Z4O A;  1ZQ1 C;  1NJY A;  3QXG A;  2C2R A;  2J6U A;  3H0R B;  1ZQC A;  4UW9 A;  3C21 A;  5JTI A;  4QZE A;  2K8B B;  1KFD A;  4NLZ A;  1PUZ A;  3Q8L A;  3GV7 B;  4EX7 A;  5HP4 A;  3JPQ A;  2K4P A;  4AYB F;  2FPL A;  4Q45 A;  4KLI A;  1T8E A;  4I29 A;  2OHF A;  4PL2 A;  5D49 A;  1RQN A;  4EYH B;  4MFF A;  5T14 A;  5KFU A;  2KVC A;  1JX4 A;  3M1Y A;  2BCR A;  4Z6C A;  1ZQV A;  4Y2V A;  5ALJ A;  5IIJ A;  5JU5 A;  2UVV A;  3MFI A;  4YCX A;  4EX6 A;  5AI8 A;  2YY6 A;  3OHA A;  2MAX A;  2BR0 A;  1SXD A;  9ICB A;  2XCA A;  4NY8 A;  3V6J A;  4DQP A;  1DK2 A;  4I2B A;  5C0Y A;  3PZP A;  5KFS A;  4TQS A;  3SZ2 A;  4CDG A;  7ICL A;  2B0C A;  9ICH A;  1WWU A;  1BPX A;  2AHO B;  1BNP A;  4RPZ A;  3BS7 A;  8ICN A;  2EZY A;  4JWN A;  3IG5 A;  2RLT A;  1WUD A;  4DFJ A;  5KT5 A;  2K8A A;  3KZX A;  4OJP A;  4KLJ A;  1LV5 A;  1Z00 B;  5CHG A;  2HI0 A;  5J8Y C;  4G9B A;  1DRG A;  8ICO A;  4Y2J A;  3UQ0 A;  3SAG A;  2AGQ A;  1K1Q A;  3NVV A;  1OXJ A;  1BNO A;  1PK1 A;  2C2D A;  2W11 A;  3QU7 A;  1JIH A;  3WKA A;  3D2N A;  8ICE A;  1L8L A;  1TAM A;  1ZQL A;  3BZK A;  4DL7 A;  3NUQ A;  4BXO B;  4IR9 A;  3T5K A;  2WF7 A;  1UPH A;  4C8L A;  2DBY A;  7ICF A;  1L7M A;  5DG7 A;  3SR6 A;  2K4H A;  2BPF A;  4JWM A;  3GFK B;  2A1J B;  2AXT U;  3KD3 A;  2I6X A;  7ICU A;  3RH5 A;  1L7P A;  3C5G A;  2K4E A;  4ELU A;  1U9L A;  4P2H A;  3GDX A;  4DCC A;  1QSL A;  5J0X A;  5AKK A;  2HSZ A;  2KHV A;  9ICW A;  4B9V A;  4GXI A;  3UQ2 A;  1F44 A;  3KFU F;  4DQI A;  2F8K A;  1DK3 A;  3KKA C;  1TV9 A;  3Q8Q B;  4U6P A;  3PV8 A;  2WF9 A;  3MC1 A;  3BJY A;  2ZJA A;  5ALV A;  4O3O A;  2NYV A;  3M6K A;  3TAN A;  4KN4 A;  2ISO A;  1A0P A;  1X40 A;  2JEJ A;  3ZDA A;  8ICL A;  1NK7 A;  1K1S A;  4I2F A;  4I2H A;  2W9M A;  2ASL A;  2E1E A;  1WG8 A;  2R8K A;  1KW4 A;  4F4Y A;  1TAQ A;  4J9S A;  2QAR B;  2WHE A;  5ALF A;  3F2B A;  5AI5 A;  2YTU A;  2HVH A;  2GWS A;  1SKR A;  4QW9 A;  4Z6D A;  1Q3U A;  2CXY A;  5KG0 A;  2HHT A;  2W04 A;  3DV9 A;  4DF4 A;  2G06 A;  2ISP A;  2KD1 A;  1S97 A;  3MGI A;  4B9S A;  1SV0 C;  2P6U A;  5ALM A;  3HRD D;  2F1I A;  4WJ3 B;  2OXO A;  1N60 A;  3T5J A;  4RQN A;  5DGA A;  3LK9 A;  1JRO A;  2KVS A;  4M6W A;  3QE9 Y;  5KL1 B;  3M9O B;  4FO6 A;  2QB0 A;  3FDS A;  2W3S A;  2BKE A;  2NO5 A;  5J0R A;  2HOQ A;  4FS2 A;  1FFV A;  1IG6 A;  2DKZ A;  1DGJ A;  5KFH A;  3TAD C;  1IIP A;  4FS1 A;  3QEB Z;  4J9L A;  4QW8 A;  1LKY A;  4KLO A;  1V38 A;  4C4T A;  2NO4 A;  4P0Q B;  1KN5 A;  2G09 A;  1FEZ A;  3EPI A;  4DWI A;  3T5L A;  5CEH A;  3RB3 A;  4F72 A;  2CN1 A;  4MF2 A;  4ELV A;  2KJ8 A;  1UA0 A;  2OWO A;  5EWG A;  1COK A;  4R65 A;  3JPR A;  3CP8 A;  5G5G A;  3PSP A;  5KT4 A;  3WK5 A;  2L5Y A;  1L7O A;  4QIW C;  1PZN A;  2VJ5 A;  2G07 A;  2JMG A;  5J0Q A;  3G6V A;  4ZH4 A;  2GH1 A;  3AQF A;  4XUS A;  8ICH A;  1BPZ A;  5HMM A;  3AL0 B;  4RZR A;  4ECS A;  3PST A;  3N28 A;  2ZIV A;  1CRX A;  1UQV A;  3PR4 A;  2W9C B;  4LZD A;  1AQ6 A;  4EEN A;  1K5O A;  4AP9 A;  2EH9 A;  4ED6 A;  3BQ7 A;  2ZXI A;  4QWE A;  4OJ6 A;  1URJ A;  4PGY A;  5J2H A;  2HW3 A;  1SXE A;  4QZC A;  4B9L A;  3M7D A;  2GLE A;  3VCB A;  3NRW A;  4ACO A;  4TUR A;  4GXK A;  2HHS A;  1XS9 D;  2JEI A;  4I2C A;  1XC9 A;  2LBO A;  2V9W A;  2ZUB A;  1NI3 A;  5HR7 A;  1S5L U;  9ICX A;  4DFM A;  3FM9 A;  4QIW F;  3RJG A;  4EBD A;  5DLG A;  5IIK A;  1SGG A;  1F5S A;  2WAQ F;  1TFR A;  2YML A;  4UAS A;  1IXR A;  1N5W A;  5AIA A;  3F2D A;  3DDH A;  5ALU A;  1JI7 A;  3V7L A;  4CE6 A;  5DDY A;  2W3R A;  8ICY A;  1X2I A;  3HKZ C;  2KZ3 A;  4BX9 C;  4UB5 A;  2VA8 A;  2NRT A;  4F93 B;  5KTQ A;  1QQ5 A;  5AKX A;  1KFS A;  3QUQ A;  4F3O A;  3ZDC A;  1NZB A;  5DB9 A;  2WF8 A;  9ICU A;  2HBM A;  4QZH A;  1KQQ A;  1U4B A;  1SL0 A;  3C2M A;  4ED8 A;  1MN8 A;  1JRP A;  2KZM A;  1ZOL A;  5DB7 A;  3T3F A;  8ICA A;  4YR0 A;  1B22 A;  4NLB A;  5DB8 A;  8ICR A;  4DSK A;  2ODG A;  4QZ9 A;  5B5E U;  3TI0 A;  1MA7 A;  2ALZ A;  4GFJ A;  3B9J A;  4QZD A;  3QU9 A;  3SV3 A;  2JEF A;  4ED0 A;  3ISD A;  5DGB A;  4R66 A;  2IOF K;  4EBC A;  4IQU A;  3M8S A;  2BPG A;  3FAH A;  2W7O A;  2MRL A;  5DLF A;  4UB3 A;  3EZ5 A;  3UMG A;  8ICI A;  3RH4 A;  2FDR A;  3DEE A;  2H3V A;  5KG5 A;  5EWE A;  1YT3 A;  5J0T A;  3PY8 A;  4PGX A;  1JUD A;  3MR3 A;  3ORY A;  3JPS A;  4LZG A;  3PX4 A;  2E5S A;  3GQC A;  4J9N A;  1S8O A;  7ICS A;  2OM6 A;  2KJ9 A;  3CYM A;  2V4Q A;  5JUM A;  4C0Z A;  2EQY A;  2RP5 A;  2MUT B;  1X9M A;  5KT6 A;  4E0D A;  3MFH A;  1ZQD A;  2KV2 A;  2AU0 A;  5DBA A;  4NL9 C;  4ECY A;  4B6J A;  1X9S A;  1ZQU A;  1COO A;  4NJ8 A;  3D2Q A;  4UAY A;  1UA1 A;  1X9W A;  3UXO A;  1RDF A;  3PW0 A;  4BDP A;  2XIC A;  1D8B A;  2KG5 A;  2Y1I A;  5HHI A;  2LM1 A;  2UVW A;  1NNL A;  4F91 B;  2F44 A;  2VKQ A;  4XRH A;  4K4G A;  2R8G A;  1BPY A;  3SEI A;  2FMS A;  3OSP A;  3RB0 A;  2W43 A;  2NRZ A;  4F8R A;  4Y2S A;  9ICK A;  1B0X A;  4RUC A;  3IN5 A;  2A1A A;  3WKD A;  4I27 A;  3H4D A;  4M9H A;  1HIW A;  3GIJ A;  2ZJ5 A;  1JAL A;  2ZIW A;  2YN4 A;  1SZP A;  2HBJ A;  4PZO A;  5AKG A;  1VJ5 A;  4DSI A;  5ALN A;  3ZDD A;  4JV2 A;  7ICJ A;  4O0I A;  5KT7 A;  2PKE A;  4EYI B;  4NXZ A;  2FPM A;  4C7Y A;  2LPE A;  5HNK A;  4PH5 A;  1NZP A;  3QUB A;  5KG3 A;  2OYY A;  1QTM A;  4M47 A;  2DPJ A;  5AKH A;  3L3F X;  4Z6E A;  3RBE A;  2FPK A;  2Q0Z X;  1YZ7 A;  5DQG A;  5KFW A;  1ZQP A;  4NWI A;  4TUP A;  4J9K A;  1TK0 A;  4RQ1 A;  2UVU A;  4YFK A;  3PW7 A;  8ICX A;  1KKX A;  5CJ7 A;  8ICJ A;  4KTQ A;  2BQR A;  4JB3 A;  4Y2T A;  2NRW A;  4RT2 A;  4RNM A;  4PPX A;  3NTU A;  3RBD A;  1RZT A;  2AGP A;  4CRX A;  4QZI A;  4DQR A;  1ZQB A;  4O3S A;  2WF6 A;  4KN7 A;  5AHX A;  5AI6 A;  2FI1 A;  9ICE A;  3E58 A;  5K4L A;  1J2N A;  2YMM A;  9ICP A;  7ICN A;  3HX0 A;  3ETR A;  2JXJ A;  1OW5 A;  1C7Y A;  3QX7 A;  3R9K A;  2G0A A;  5AK3 A;  2ASD A;  4BJQ A;  2P66 A;  1Q46 A;  4F4K A;  3RB6 A;  2W8L A;  4NLN A;  1NKC A;  2LM4 A;  5AKY A;  3TAD A;  2DWQ A;  1XSP A;  2B6G A;  2XCP A;  4KLD A;  2EDU A;  5J2J A;  3H0M B;  3V72 A;  7ICT A;  4IR1 A;  4UB1 A;  4I2A A;  2ZIV B;  1KTQ A;  2G5H B;  4US9 A;  2YX8 A;  3UMB A;  5L1I A;  4Y2R A;  4YD2 A;  4DOA A;  4PJ0 U;  1T94 A;  3WK4 A;  4ZOH C;  3NGD A;  1TVA A;  3HKZ F;  5J0U A;  5ALI A;  2RDJ A;  9ICV A;  5AKL A;  5ALS A;  5EWF A;  4O9M A;  5J2D A;  3OGU A;  1ZET A;  2RHF A;  3NS1 A;  2H3Q A;  4QZF A;  4ECT A;  4LVS A;  4GXJ A;  1PK3 A;  5KFN A;  2XC9 A;  4USA A;  1IV8 A;  2FLP A;  2JV3 A;  9ICN A;  2KNJ A;  1FO4 A;  1N63 A;  2RDI A;  4ED2 A;  4UBC A;  8ICK A;  1ZXI A;  2EZZ A;  2LMR A;  1SKS A;  3Q8K A;  7ICG A;  5FP0 A;  2WF5 A;  2VJ4 A;  1ZQJ A;  5KFD A;  1ED1 A;  4IRK A;  7ICP A;  1MC8 A;  2KTQ A;  1Z1V A;  2ZG6 A;  3KHL A;  5KFE A;  3L4P A;  3KHG A;  3D2S A;  3F2C A;  3A0B U;  5G5H A;  9ICM A;  3MDC A;  5CRX A;  5J0O A;  3RF9 A;  3N7S C;  2YMP A;  4M9G A;  3H8J A;  4RU9 A;  1X6I A;  4GC6 A;  3OJU A;  1Z4N A;  1FFU A;  5KG4 A;  5KT3 A;  2WFA A;  3RR7 A;  1SV0 A;  4EEK A;  3FYH A;  2HVI A;  3PNC A;  4GC7 A;  5KFI A;  4ECR A;  2A19 A;  4UAW A;  2A3V A;  1EXN A;  4U7C A;  4BUG A;  3IG8 A;  4IQT A;  4UAU A;  3EWA A;  5HR6 A;  2AGO A;  4ECW A;  3CNH A;  3SV4 A;  2KIV A;  3AM9 A;  5ALK A;  1NK5 A;  1HEK A;  2MSN A;  4M04 A;  8ICF A;  4C8O A;  1T4G A;  2D3D A;  5CB1 A;  2PFQ A;  1ZQZ A;  5KFK A;  5KFF A;  3EPG A;  1WYG A;  5J2C A;  1NK0 A;  1XO1 A;  4KX3 A;  1NKE A;  5L1M A;  5AM2 A;  4IQW A;  5KFY A;  2BQU A;  4M9J A;  2ZTD A;  1S76 D;  3V6K A;  7ICV A;  1ZRM A;  3TFR A;  1SL1 A;  4K4H A;  4NL9 A;  2ZTC A;  2PMZ F;  5L1L A;  3BDP A;  4QNL A;  3HIL A;  4RQ0 A;  5KFT A;  2DKX A;  3GIM A;  4YQW A;  5A0L A;  2XGP A;  3K4G A;  2W9B B;  4UBB A;  1DXS A;  1NK4 A;  2PFP A;  4OD0 A;  3H0L B;  3LDA A;  4A8E A;  8ICT A;  1O08 A;  4OCZ A;  2DPI A;  4MF8 A;  1Y88 A;  4Y2X A;  9ICF A;  4KLM A;  2XY6 A;  2E8N A;  4DF8 A;  2CPR A;  2K4I A;  5C5J A;  2JH7 A;  4C4S A;  2NRX A;  3QNM A;  1RQL A;  5EE3 A;  5HHH A;  3F5A A;  2JGA A;  1O03 A;  4ICA A;  2OEH A;  3RR8 A;  5J2A A;  1VDV A;  3NVY A;  2H3Z A;  5J0Y A;  1BPE A;  7ICO A;  3BZC A;  2ESE A;  4Q43 A;  1C20 A;  4DQS A;  4M6W B;  1ZRN A;  5F9L A;  1U49 A;  2I5H A;  5DG9 A;  1U45 A;  2W9B A;  4M0A A;  5ALY A;  4F5Q A;  5J0P A;  1QQ6 A;  5IIN A;  4Z6F A;  3D6J A;  1RYU A;  3C1Y A;  2BDP A;  3OJS A;  3T79 A;  2AQ0 A;  1ZQF A;  1TK8 A;  3RJK A;  2BCS A;  4O5C A;  3RAQ A;  3EYZ A;  2XO7 A;  4R8U A;  4UQG A;  5AI0 A;  9ICG A;  4F5O A;  4CCH A;  1UHU A;  5KG1 A;  4M2Y A;  4MFC A;  3SAH A;  4F5P A;  1ZQM A;  2K89 A;  4KLT A;  1D8Y A;  4ECV A;  2R8H A;  5III A;  3BQ0 A;  5D46 A;  4PGQ A;  3FC4 A;  1H38 A;  4P4O A;  4Q8E A;  5KFZ A;  2HCF A;  1QQ7 A;  2BCU A;  9ICJ A;  2GO7 A;  5AK6 A;  2KZZ A;  2YB1 A;  2ES6 A;  4RT3 A;  3IHQ B;  4CGZ A;  5J8Y A;  4YR2 A;  4PHD A;  9ICR A;  1ZD2 P;  4ED1 A;  3N7R C;  2ATL A;  3ISB A;  5KT2 A;  2KHQ A;  5KNI A;  1QH9 A;  3H8M A;  2AQ4 A;  2Z7J A;  3MDA A;  1KRP A;  1JMS A;  4ECZ A;  4K4I A;  2PXI A;  3JPO A;  3F5E A;  2HHW A;  2DGZ A;  1T7P A;  2IHN A;  3C2K A;  1M6Y A;  4KLS A;  3RTV A;  3KKA A;  3PO5 A;  3IP4 B;  4CF4 A;  5L1J A;  5IIM A;  5EE9 A;  4EBE A;  5KFA A;  3PW4 A;  1L3U A;  1SWW A;  3N7P D;  4YN4 A;  4YMO A;  3M6Z A;  2LHT A;  4KMO B;  1V9P A;  3WKB A;  4C4R A;  4R63 A;  3N97 B;  1VLB A;  1KFT A;  2IOF A;  4FE3 A;  3C5F A;  1V85 A;  3GZF A;  2F77 X;  4RQ8 A;  1SZH A;  4JMU A;  4MEY A;  2LYH A;  2JHD A;  5J29 A;  5J2B A;  4DQQ A;  3RJJ A;  7ICK A;  5KFO A;  3I28 A;  3K1R B;  4R8U B;  1S0V A;  1X66 A;  5GTH U;  2PI4 A;  2EAO A;  4QWD A;  2XY5 A;  4P4P A;  9ICT A;  4ELT A;  4YMM A;  2I9G A;  3AUO A;  2KEY A;  3G6X A;  3PML A;  3BQ2 A;  3KZI U;  3ZDB A;  2E8M A;  3J81 j;  9ICC A;  2XVT A;  3RFA A;  5AIC A;  4UB4 A;  3LWM A;  3IM1 A;  4P4M A;  2VAN A;  5L1K A;  2QB0 B;  2IMW P;  3KHR A;  4PHA A;  4B9U A;  3S6J A;  5KFG A;  2Y9U A;  5ALH A;  4O5K A;  4IS7 A;  1CEZ A;  2QKQ A;  2NV3 A;  1L3T A;  3C23 A;  1NJX A;  3RJF A;  4CNQ A;  5BOM A;  5J0S A;  4YMN A;  2DFL A;  1RYS A;  3I76 A;  2W54 A;  3ETL A;  5TIS U;  1SL2 A;  4F5R A;  1ZQO A;  4R64 A;  3RH6 A;  1L7N A;  7ICI A;  4AYB C;  4DL2 A;  4M9L A;  1BGX T;  5E79 U;  2O6K A;  1WWV A;  1N62 A;  1B4F A;  5AKI A;  3Q8M A;  5AK4 A;  2Y1J A;  5CR0 A;  1TK5 A;  4IRD A;  3RJI A;  4UAR A;  2MUT A;  5KFQ A;  1XNS A;  5AKJ A;  3MAB A;  2QAR A;  3WKE A;  4DO9 A;  3AQE A;  3GV5 B;  3ZD9 A;  4KMU A;  9ICA A;  2KMD A;  4Q44 A;  4BWJ A;  3QEA Z;  3Q8P B;  3U26 A;  5KFV A;  4O3R A;  2BHN A;  2Y0S F;  3OPX A;  4F4Z A;  2EAN A;  2HMX A;  2B21 A;  4C8N A;  1SV4 A;  5D4B A;  2R8I A;  1L3V A;  4QJF B;  5AIB A;  1ZQY A;  1D8L A;  2F2A B;  4NM2 A;  1PVP A;  5KFX A;  2K60 A;  2HDO A;  1D9D A;  3UPQ A;  4PZN A;  1PVR A;  4I2E A;  3UMC A;  4DL5 A;  5GTI U;  1Q8K A;  1YZ6 A;  3M9M B;  4KLH A;  3GIK A;  3PMN A;  4ECU A;  2BDU A;  3M8R A;  2FMQ A;  4KLQ A;  4EZ6 A;  1U47 A;  1Z3E B;  3HP6 A;  1KSP A;  4M9N A;  4HAI A;  1ZQN A;  4I28 A;  9ICL A;  4YG2 A;  5AK5 A;  4Y2P A;  5BPC A;  1PK1 B;  1QSS A;  2Q4T A;  3QU2 A;  3Q8R B;  3H8S A;  4RQ2 A;  3K1Z A;  4J9P A;  8ICV A;  5CA7 A;  5AM5 A;  2KKV A;  2VA3 A;  4DSJ A;  3TAR A;  8ICQ A;  4B9T A;  4Y2Q A;  3AU6 A;  3H8W A;  2OCE A;  2HHQ A;  3SMV A;  1ZQH A;  4GLX A;  9ICQ A;  5AKE A;  2A1J A;  1CI4 A;  5KFJ A;  3TKA A;  2H3F A;  2BGW A;  2JR5 A;  4F71 A;  3UXN A;  3BQT A;  2BPC A;  2I1Q A;  5AKZ A;  1B43 A;  4UAT A;  1ZJN A;  2E8O A;  5ALG A;  1L6N A;  2F8L A;  4DOB A;  4NV0 A;  1UT5 A;  3V7J A;  4DFD A;  4UAZ A;  3QUC A;  5KFC A;  7ICR A;  2H3I A;  4G3I A;  2F76 X;  2GOL A;  1TKD A;  4IQV A;  2NRV A;  3MGV A;  2DF4 B;  4J9O A;  1ZD4 A;  3TAC B;  3BQ1 A;  4ED3 A;  3KOO A;  3ONN A;  4O3P A;  5ALR A;  4QWC A;  2KFZ A;  4NLG A;  3LYS A;  9ICO A;  1BPB A;  1QCK A;  3H7I A;  4IL6 U;  1N48 A;  3SD7 A;  1MQ3 A;  3VC8 A;  4IC9 A;  3OSN A;  4YR3 A;  2W7P A;  1X9X A;  1L3S A;  3B0X A;  4YXJ A;  3WK8 A;  3AMZ A;  3NRZ A;  1SIJ A;  4DEZ A;  1XSN A;  3THV A;  2JZB A;  2G5I B;  4DOC A;  3ZD8 A;  1ZQA A;  4OO1 J;  4ECX A;  5CP2 A;  2QB1 A;  5J2K A;  4MFA A;  3AN1 A;  4RNO A;  2W9A A;  2G08 A;  3L5K A;  2BZF A;  2WB1 C;  1N5X A;  1LKY B;  3WKC A;  4B9M A;  2FE9 A;  8ICM A; 
#chains in the Genus database with same CATH homology
 5B66 U;  5TIS U;  5H2F U;  5KAF U;  4PJ0 U;  4IL6 U;  5GTH U;  3WU2 U;  5KAI U;  3A0B U;  5GTI U;  4UB8 U;  5B5E U;  3KZI U;  2AXT U;  2DUY A;  4UB6 U;  5E79 U;  1S5L U;  3A0H U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...