2DUYA

Crystal structure of competence protein comea-related protein from thermus thermophilus hb8
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
65
structure length
65
Chain Sequence
b'PLPQAQTPVSLNEASLEELMALPGIGPVLARRIVEGRPYARVEDLLKVKGIGPATLERLRPYLRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Competence protein ComEA-related protein
publication title Crystal structure of competence protein ComEA-related protein from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 18
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 2duyA00
3A0HU 4UB8U 5TISU 2DUYA 5GTHU 5B66U 5E79U 1S5LU 5H2FU 5KAFU 3KZIU 4UB6U 5KAIU 4IL6U 3WU2U 4PJ0U 3A0BU 2AXTU 5GTIU 5B5EU
chains in the Genus database with same CATH superfamily
3A0HU 4O3MA 5EWFA 2ZXIA 4EBEA 2FPLA 2Q4TA 2F8LA 5CWRA 5AK3A 1YT3A 4LZDA 5KFZA 3V7LA 3J81j 4UARA 1L3SA 3ICXA 1MQ3A 4RQ2A 5J2CA 2JZBB 2ZIUB 8ICQA 4KMOB 3NS1A 4MFFA 2R8GA 5AKXA 3MGIA 2F44A 1KSPA 2GLEA 5DLGA 2OHFA 4P4OA 3RRHA 4FS2A 4CRXA 3QYPA 3UXNA 3GDXA 1HUOA 3DDHA 2KVCA 1QCKA 3F5AA 2KZMA 3NGDA 1OW5A 1A76A 3KKAA 5KT6A 4O3PA 5FP0A 4YG2A 3LVWA 3WKAA 3OSNA 3QEAZ 3UQ2A 7ICVA 5ALSA 3PW5A 1QLNA 4UB1A 3SR6A 3MBYA 5EWEA 2YMPA 1TK0A 2IMWP 1XC9A 1T8EA 3PO4A 3RFAA 2JRZA 4K4GA 3V7KA 3HJEA 4ECYA 4Q8EA 2DPIA 4ECXA 1ZQJA 2VANA 1XO1A 2YX8A 5KFAA 2B21A 8ICFA 1RYUA 3I76A 4F91B 1VLBA 3S6JA 1ZQMA 4KN4A 2WF9A 4I2CA 2OEHA 3TQ1A 1C20A 1K1QA 4BWJA 2AGOA 4KLIA 3GILA 3RF9A 2FLNA 9ICXA 2G0AA 5L1JA 3PW2A 3H0LB 5AIAA 5KFJA 4XA5A 1SL0A 3SAHA 5AKGA 1KBUA 3HKZF 2PFQA 2WB1F 3ISDA 4IRCA 3MGHA 1D9FA 3L5KA 3SD7A 4DL3A 3E2EA 4DQQA 3QZ8A 4QZ9A 2R8KA 5ALQA 2YTUA 2W11A 2C2DA 2K4HA 3MGVA 1L6NA 7ICUA 5KFLA 2JXJA 2K8AA 1COKA 2XY6A 1JMSA 8ICEA 4DSKA 3C5GA 5AKYA 1PVRA 1ZQOA 3PV8A 9ICFA 9ICIA 2KMDA 2BPGA 3C23A 2E8PA 3RRGA 3R9KA 1Q3UA 1XWLA 2KD1A 2DKXA 7ICGA 5HP4A 5KFYA 4OD0A 4DFDA 1AQ6A 3MABA 3UQ0A 2W43A 4BXOA 2BGWA 5IIIA 8ICIA 2R8HA 1PZNA 4MEXA 3AU6A 3K1RB 1UT5A 2VIXA 1ED1A 4DSFA 4QZCA 4F92B 4Y2TA 4RQ5A 8ICUA 2HVIA 8ICTA 3AQEA 3LDAA 4ZH4A 4KLFA 3MDCA 3PX4A 4QZAA 2KICA 5ALXA 3NVYA 2BDUA 2ZG6A 4RU9A 1RPLA 5KG7A 5AM3A 3M6ZA 2KHVA 4RQ4A 4OJ5A 3JPOA 4U7CA 4USAA 1N48A 5KFRA 4F5NA 2E1EA 2K8CB 4O3OA 4QWCA 1CEZA 4CF3A 2RDIA 2KK0A 3MC1A 2WAQF 5DB9A 3RH4A 4MFCA 3IDWA 4DOCA 4RQMA 1L3TA 2G09A 1ZD2P 5DLFA 1N61A 4IQVA 3IHQB 3QUCA 5HNKA 2W3SA 3KZIU 3QU5A 2R8JA 4M6WB 2W9BB 4ED1A 3KOOA 8ICXA 2BKEA 3KBBA 3F5EA 5CR0A 3SAFA 2P66A 2IBKA 7ICQA 2MA1A 1M6YA 3IG8A 1RZTA 3RJEA 4F5PA 3QUQA 3BQ2A 3KHHA 5ALLA 2GOLA 1A6SA 1SB3C 2KEYA 1X2IA 5DBBA 3ZD9A 4UAZA 5AKEA 7ICLA 2KOBA 4PGQA 2BQRA 3TAPA 4M04A 4BUGA 3MDAA 2HI0A 4C8MA 3KFUF 4BXOB 4DL2A 3PMLA 1DRGA 4P4MA 4OJOA 3WK7A 2QKQA 2HHQA 4JMUA 1WWVA 4ECVA 4NM2A 7ICSA 5IIKA 4UB3A 5ALOA 3UPQA 3V72A 4R65A 4PZOA 8ICAA 4I27A 3UXPA 1RXWA 2HHUA 1Z00B 2AJQA 4Z6FA 5KFHA 4PHDA 1PK3A 4M47A 1SKWA 2DL0A 5J2IA 1ZQSA 4RZRA 8ICOA 3KD3A 7ICNA 1RG6A 4BJQA 2D3DA 1D8YA 4B9UA 5HMLA 9ICJA 3TAQA 4KX5A 2WF7A 5BPCA 2ZJ5A 2JGAA 2ZUCA 4I2JA 5A0LA 5ALVA 3PO5A 8ICBA 1TK5A 2ZIWA 5ALEA 1KW4A 4OJLA 1Z1BA 1TAUA 4RNOA 1ZQPA 3RR7A 5J29A 4DQSA 4NXZA 1L8OA 1UT8A 5J0WA 4KX3A 3RBDA 3QZ7A 9ICRA 3HX0A 4JK1A 5KAIU 1N5XA 5AK5A 2I6XA 4TUQA 5EWGA 3PVXA 3K1ZA 1ZQHA 1S0VA 5KFMA 2ZXHA 3OPXA 4F2SA 3KHGA 4HAIA 4CF4A 4LZGA 4KLUA 5IIOA 4X5VA 4XRHA 3HWTA 1RM6C 4NJ8A 4UB6U 4OO1J 5J0UA 2AGQA 3OHBA 3VCBA 2KSOB 2JMGA 1ZD5A 3PR4A 1NI3A 4UW9A 3QNMA 3M7DA 4Z6CA 3C2KA 4KLTA 4PHEA 1Z4OA 1U45A 1WG8A 2RP5A 2JHDA 2KIWA 4QW9A 5KT3A 4JV2A 4DFJA 2K4IA 4DS4A 3ZDEA 5BOLA 4M0AA 2RHFA 2KN7A 2ESEA 4IC9A 2E8NA 1KEJA 4RT3A 2IOHA 2H3FA 3WK6A 2WAQC 5AI8A 4IS7A 4ECUA 1ZQXA 2F76X 2C22A 3PX6A 1NZBA 9ICHA 5F3XB 1RQNA 3EUB2 5AI5A 2HHXA 3WK4A 2MUTB 8ICNA 3N4MB 4TQRA 1LB2B 2ZIVB 4EEYA 4PGXA 4UB4A 7ICHA 4YD1A 3SZ2A 4RQ7A 1ECWA 3T5LA 1SXEA 4F4ZA 4MF2A 1S77D 4YXJA 2F1IA 2LYAA 2H3ZA 1NK7A 2LI6A 1BPXA 5ALDA 3Q8RB 3WKBA 2A1JB 4QZBA 4DSJA 4J9QA 2HOFA 3DEEA 2K8BB 3NVZA 3QEBZ 1IXRA 2G06A 1NK8A 4YR3A 2M0NA 4O0IA 1JN3A 3GV8B 3GV5B 2JZBA 2ZIUA 5EE3A 5HHHA 3SAGA 4Q44A 4O3RA 2FPKA 3ETRA 5CB1A 2V4RA 4I2AA 3BDPA 2KZ3A 4P4PA 4Q43A 3TKAA 3SMVA 2FMQA 4O5EA 4FBTA 1QTMA 7ICRA 2FI1A 2KHQA 9ICUA 2NRZA 3O0FA 2HBLA 5ALUA 4UB2A 4ECQA 1D8BA 2W7PA 2LMRA 4F71A 2PKEA 2V4QA 2H3QA 3CP8A 3T79A 5AKHA 3V6KA 3F53A 4YCXA 5JTIA 7ICJA 3D2NA 3GZFA 3AUOA 1COOA 2Y0SF 1KTQA 1KDHA 5DQHA 3RB3A 4MF8A 1NJXA 4O3QA 3QUBA 2HHWA 2YY6A 2E8OA 4P0QB 4Z6DA 1ZQIA 4EBDA 5ALFA 4CGZA 4J9OA 1JRPA 1WYGA 4F72A 1X9SA 4YR2A 4EX7A 1HEKA 5DQGA 3H7IA 1ZQBA 2NRXA 4DO9A 1O08A 3FM9A 2ODGA 1ZQEA 4M9NA 8ICCA 4RQ8A 2ZJ8A 5AKZA 3H8WA 3K4GA 2FDRA 1B4FA 5D4BA 2EH9A 2BCUA 2PI4A 1NNLA 3H8MA 4GC7A 3C1YA 2KFZA 4XUSA 4US8A 3NTUA 5ALHA 4UASA 4KLLA 1ZQZA 4K4IA 1CRXA 2KVSA 4J9NA 5KG6A 3T5HA 3L4PA 3RJGA 2HHTA 2YQEA 4A8EA 1B43A 5AM0A 2ZIXB 4J9PA 9ICLA 4TUSA 4ICAA 2O6KA 4J9KA 4PL1A 3UMGA 4M9GA 4RQ1A 3SYZA 2NRWA 5J2JA 1BPZA 4PGYA 4QWDA 2J6TA 3SI8A 9ICPA 4Q8FA 1HUZA 4OJ6A 3M8RA 1Z4NA 3IV6A 1DK2A 5KFUA 3QU7A 2CPRA 3K75D 3DV9A 3KTQA 1D9DA 5AICA 5KNIA 1SZHA 5KFOA 4J9LA 4ED6A 1L7MA 4ELTA 1DGSA 8ICRA 4Y2SA 2G07A 4DWIA 1F0MA 4FZMA 1MSWD 9ICMA 8ICSA 4GXJA 3ZDBA 4CNQA 2JEIA 2K60A 3WU2U 1PVPA 4Y2PA 3H4DA 4CDGA 1FIQA 2P6UA 4UAWA 4DEZA 1V85A 4MEYA 5DBAA 4NLBA 4YD2A 3RH6A 2UVUA 8ICYA 1KFSA 5KFVA 4F4XA 4IRDA 4KLEA 1ZJNA 5EOZA 2WF5A 4O9MA 2CN1A 4CF5A 4IQTA 2HHVA 4B9SA 1XSLA 4JV1A 3CW2C 2E1FA 4NM1A 3GV7B 3Q8KA 9ICBA 1ZQLA 5KG3A 2EAOA 4YMMA 3BQ7A 1XSNA 1FFUA 3ISBA 1NZPA 5D46A 1JX4A 5KFNA 2P6RA 2AU0A 2HMXA 4R66A 2ZTEA 3ETLA 1BNOA 4NL9A 3JPNA 5AI6A 3PR5B 4RUCA 3RTVA 3PMNA 5DQIA 1DK3A 4YR0A 4PJ0U 2RLTA 4RNNA 5AKJA 4NWIA 4QJFB 4M6WA 2W9BA 8ICZA 1JXEA 1ZD4A 5KFCA 3C2MA 5J0XA 8ICWA 3LVVA 1ZQDA 4US9A 3NRZA 2PFOA 2YB1A 1BVSA 4QWEA 4C8OA 5CJ7A 3JPTA 4BX9C 2JEGA 4O3NA 3FYHA 5AK4A 2KJ9A 4IQUA 2FLLA 1ZQFA 1ZQWA 2W54A 2BCSA 4F93B 4Q45A 5KFQA 4ECZA 4YMNA 1SV0A 2KKVA 4BDPA 5E79U 5H2FU 1TFRA 1IV8A 2JV3A 1PVQA 2BR0A 1SL2A 3MFIA 1KLNA 3A0BU 3MR2A 4TUPA 4B9MA 5JUMA 3MR3A 4KITB 4B9VA 1A77A 7ICIA 1Z00A 3HW8A 1FEZA 5J0QA 9ICWA 2EZZA 1NK4A 2DF4B 2ZUBA 1B22A 1JIHA 5F9NA 1F44A 2Y1IA 4I2BA 4GFJA 3GIJA 1T7PA 3H0RB 3EZ5A 2ISPA 2EQYA 3ZI4A 3TANA 1VDVA 1V38A 2EDUA 2ZUDA 4QZ8A 3RJJA 5AKIA 4EZ9A 2QARB 2XVTA 4DFMA 1X9WA 5CA7A 1ZQYA 4J03A 1AROP 1KFDA 2K4EA 5ALIA 2HDOA 1BPYA 1ZQUA 2ISOA 1L7OA 3VC8A 5J0TA 3AEVA 2DPJA 4FO6A 1ZQCA 2H3VA 2Z7JA 5AI9A 4P0PB 3N7RC 5AM5A 2FJ6A 4F50A 4P2HA 4EELA 2BCRA 4F2RA 1S5LU 4E0DA 3HT3A 1UCVA 4PHAA 5J0YA 4QZGA 7ICMA 1LVHA 4KMUA 2AHOB 3TACB 3H4BA 2JH1A 4PPXA 3L3FX 2KG5A 4PHPA 4UAYA 2G5IB 2FLPA 1ZQTA 4ED0A 5T14A 4EENA 2AH5A 2VA8A 2OCEA 1QH9A 1X40A 2KSOA 3C28A 1T4GA 2EANA 3RJKA 1BPDA 5KFTA 5HR7A 1TK8A 3M9NB 1K1SA 4GXKA 2I1QA 2MRLA 2NYVA 4F4YA 4NLNA 4M2YA 4UQGA 3RR8A 3BS7A 3HKZC 1QSSA 3BJYA 3PSPA 5J2BA 5ALGA 2WB1C 3AMZA 4PL2A 4C8KA 2LPEA 4JWMA 8ICPA 1ZQ1C 3EPGA 2RQ5A 5KL8B 3OJUA 2OWOA 2DFLA 5DG8A 2W8KA 4DQRA 2HCFA 4IL6U 3EPIA 3LWMA 5HR6A 9ICGA 4ED3A 4KLOA 2MUTA 5KG0A 2IOFA 5EE1A 4NV0A 2ZIVA 3WKDA 4IQWA 4DL7A 4EYIB 3PY8A 2XGPA 5EE0A 2EAPA 3JPQA 2QB0B 3TADA 1NKCA 2KP7A 2AGPA 5TISU 2A1JA 3Q8LA 2VJ5A 3GIIA 3C2LA 4LJXA 2DKZA 2PI5A 4FZLA 3IM1A 5G5GA 5L1KA 1DOQA 9ICNA 4M9JA 4J9RA 4QIWF 1U47A 3BQTA 1BPBA 3NVWA 2M9NA 5CRXA 4JV0A 3UMBA 3BQ1A 1WUDA 3I28A 3PSTA 9ICAA 1ZQKA 1NKBA 2IA6A 4EX6A 4RNMA 1TE2A 8ICVA 2R18A 2LBOA 8ICMA 3RJHA 2KKPA 2HOQA 3WK8A 1ZQRA 1ZETA 8ICJA 5ALRA 1URJA 9ICVA 2LM1A 5DBCA 2H3IA 2EAMA 3MFHA 3D2QA 3CYMA 1S10A 4FBUA 4DOAA 1RDFA 5AHXA 1RYRA 1JI7A 2W55A 2VA2A 1IIPA 1O03A 1L8LA 4CE6A 1XNSA 1KKXA 3KZXA 2W7OA 4C4TA 3MR6A 2W9CB 4DOBA 3RAXA 8ICLA 4P0QA 4I2FA 3KKAC 1L3UA 5CHGA 4DL4A 9ICOA 4NY8A 1L3VA 2FE9A 2BPFA 4F5QA 3ZD8A 5KFPA 4C7YA 5BOMA 3TFSA 3UM9A 2F3NA 4RPXA 1UA1A 1L5UA 2EZYA 1WCNA 1J2MA 4RQ3A 3LWLA 1WCLA 1N63A 1MN8A 9ICKA 1Z19A 5ALYA 1UPHA 4I2GA 3Q8QB 1NK6A 5KT7A 3M9OB 3UMCA 1T94A 4KLQA 2NRVA 3QXGA 4KLHA 4F8RA 4KLDA 3BS5B 5JU5A 3V7JA 1ZYQA 4WJ3B 3EWAA 2ATLA 2JH7A 4NLZA 3WKCA 2HSZA 3IG5A 1OUQA 3PSFA 3PW4A 3QE9Y 1IG6A 2MSNA 3E0FA 4ED2A 2ZIXA 3IRUA 5G5HA 4ECSA 4UB8U 3D2SA 2W8LA 2FPMA 4I2EA 2W3RA 4QNLA 4DQPA 4FFDA 2V9WA 3GFKB 3N97B 1QQ7A 4KLJA 4UAVA 2ASDA 2Y9TA 4PZNA 4Y2UA 5J2HA 5GTIU 5J2DA 3SQIA 1ZRMA 4OCZA 4ED7A 3FC4A 1JXLA 2JEJA 4NL9C 1NKEA 4DSLA 3SV3A 4DSEA 1NOMA 2KNJA 2W03A 4XQ8A 4GC6A 4F4KA 1BGXT 3F2DA 2BQUA 1T3NA 3ZDCA 9ICEA 1U4BA 4KLMA 1MC8A 1S9FA 1S8OA 3I1YA 2PXIA 3QUTA 4DCCA 1P7DA 5KG4A 4FS1A 1RQLA 2HHSA 5D49A 3UXOA 4Y2QA 1RYSA 4Y2VA 5AKLA 4R8UB 2NV3A 3OSPA 4QZHA 3JPSA 2YN4A 4TQSA 1FO4A 3OGUA 1N62A 2C2RA 2IOFK 1Z1VA 2K4PA 3ALRA 1DGJA 4DSIA 3AM9A 3PNCA 4KN7A 2HW3A 2XIDA 2RDJA 3PZPA 1Q46A 1J2NA 2W9MA 4GLXA 5KFBA 5J0RA 5KT5A 4BGDA 4DL5A 5DGBA 5KFSA 2HBJA 2LHTA 4ECWA 5AM2A 1QQ5A 1LKYB 3GIKA 3QU4A 3Q8MA 2XCPA 1KFTA 5CEHA 4KTQA 4I29A 5J8YA 4R64A 4ECRA 4UAUA 4ECTA 3SEIA 3GQCA 4Y2RA 4YVZA 5KFXA 1XS9D 2QLTA 2BCQA 5KFIA 4Z6EA 4I2DA 1F5SA 4AYBF 1XU4A 3H8JA 1TAQA 5KT4A 2NO4A 4B6JA 2CXYA 4KLSA 1KL9A 1HJPA 4QZFA 5HMMA 3EYZA 2C28A 2JR5A 3NUQA 4ACOA 1QQ6A 3F2CA 5DG7A 7ICPA 1ZD3A 4U6PA 4RPYA 1ZQNA 1NK9A 2K89A 3JPRA 3V6HA 3F2BA 2J6SA 5J2EA 3LK9A 4RQNA 4J9MA 2XI9A 2D6FC 5F9LA 3T5JA 1UHUA 1JROA 4UATA 3RB0A 8ICGA 4DLEA 2NRTA 3RB6A 3EW9A 4JB3A 4EEKA 5KG2A 2I5HA 3THVA 4MFAA 3QX7A 1U9LA 2A1AA 1MQ2A 3WKEA 4ELVA 3N28A 2QARA 3SV4A 1BPEA 2F2AB 2Y0SC 4B9TA 1Q8KA 3OJSA 7ICTA 3Q8SB 1XO0A 4DF4A 2DUYA 5ALMA 2D8CA 1NK0A 2YMMA 4GIBA 2EZXA 3C5FA 3PW7A 2ZJAA 4P0PA 5KT2A 1CUKA 1ZJMA 4FE3A 3NASA 5AI4A 4DF8A 5HHIA 4O5KA 2BPCA 4ED8A 1N2XA 2KE7A 5AIBA 5C0YA 5AK6A 4IR9A 5DDMA 1KQQA 4UB5A 4FZNA 2WTFA 4C4RA 3TADC 2KZZA 1BNPA 1HIWA 3PW0A 5ALNA 3HP6A 4K4HA 2OM6A 5ALPA 4Y2YA 3TARA 3MR5A 4R63A 5L1IA 1L7PA 1ZQVA 5J0OA 3M1YA 4B9LA 4F3OA 4B9NA 3D6JA 2UVRA 2LYHA 4NLKA 4YQWA 3B0YA 3M9MB 3BZKA 1H38A 4J9SA 1B0XA 2OXOA 1GO3F 1XSPA 1CI4A 4C8LA 5AKKA 5K4LA 5C5JA 3G6VA 1X9MA 3KHRA 3RB4A 3TFRA 3BQ0A 1ZOLA 3G6YA 1K5OA 1SV4A 2JEFA 2H5XA 5L9XA 2OH2A 3JPPA 2AQ4A 1PUZA 2PFNA 4F4WA 4QW8A 4EBCA 5B66U 4GXIA 2KIVA 4EZ6A 3B0XA 3NRWA 2ASJA 4NLGA 1PK1A 3T5KA 5KFWA 2HBMA 4Y2XA 2AXTU 1MA7A 4YXMA 2KFNA 2WF8A 1SWVA 5DB7A 4MHVA 2F77X 3AL0B 1S0MA 5ALKA 3B9JA 2QB0A 4AYBC 1Z3EB 4UBBA 3N7PD 4DLGA 1DXSA 2XICA 2DQNB 2OYYA 3M6KA 4C80A 2DWQA 2IHMA 4KLGA 5KFGA 2N1RA 2HBKA 4G9BA 4QWBA 2C2EA 3GIMA 9ICCA 4F5OA 5JRTA 3C1ZA 5AM1A 5DGAA 5IIJA 3ED5A 3RAQA 2DBYA 1TVAA 2QB1A 5J2KA 1L7NA 3ORYA 4I2IA 5KAFU 1U49A 5J2GA 3E58A 2KV2A 1ZQQA 4EYHB 2BHNA 4TURA 3CRXA 4M9HA 3G6XA 2VJ4A 4O3SA 1ZRNA 1YZ6A 3IP4B 5KG5A 2ASLA 1SKSA 2W04A 5CP2A 1S76D 3ONNA 1T3QA 2E3TA 5IINA 2GH1A 3HPOA 4YMOA 4I28A 2MAXA 3NVVA 2GWSA 1NJZA 8ICKA 4RPZA 4I2HA 4DQIA 2UVWA 1X9XA 2FMPA 4G3IA 4O5CA 2ES6A 1N56A 4YFKA 2ALZA 2MU2A 2W9CA 1U48A 3RH5A 2BZFA 1PK1B 2YMLA 4DFPA 2RRDA 3ZDAA 1N60A 3OTQA 5EE9A 4C0ZA 4QWAA 7ICOA 1VJ5A 2YMQA 4C7ZA 3HRDD 3V6JA 5AM4A 2XY7A 1SXDA 2LYBA 3AN1A 4RQ0A 1OXJA 1J97A 4UBCA 1SGGA 2F8KA 2G08A 2PMZF 4LVSA 2L5YA 5J0SA 4M9LA 1TAMA 3WK9A 1V97A 5IILA 3KHLA 4C4SA 2I9GA 1ZXIA 3BS5A 3OHAA 3PX0A 5B5EU 4NLCA 5J2AA 4ELUA 2XY5A 2E5SA 2LM4A 2VKQA 1Y88A 5DKWA 3T3FA 2BCVA 1KRPA 2KJ5A 1TV9A 3FDSA 4BWMA 1IM4A 2XGQA 4QZIA 2LKYA 5KFEA 2UVVA 5KFKA 9ICQA 1Q3VA 3QU2A 4DFKA 4ZOHC 5KFDA 1WWUA 2PFPA 1D8LA 3QU9A 4RUAA 3SENA 2NO5A 4JUZA 2B0CA 5KTQA 2WHEA 3N7SC 2E8MA 5KFFA 2KTQA 4PH5A 1S0OA 1TKDA 3C29A 4YN4A 3BZCA 3Q8PB 4RQ6A 2GO7A 4OJPA 2XCAA 1LV5A 1A0PA 2ZTDA 4DS5A 5J8YC 4F5RA 5DB8A 1JUDA 9ICSA 3C21A 1RXVA 2ZTCA 3AU2A 5ALJA 3TI0A 2ZIWB 2F1JA 4Y2JA 5ALZA 2FMSA 1ZQGA 2A3VA 2Y1JA 2W9AA 5DB6A 3PSIA 4QZEA 4R8UA 5KL1B 4HYKA 4DL6A 3H40A 4YP3A 3FAHA 2VA3A 2F1HA 2R8IA 5GTHU 5AI0A 1SZPA 1NJYA 2A19A 1QSLA 2IHNA 2Y9UA 1SKRA 7ICFA 5DDYA 3IN5A 1ZQAA 4QZDA 2BDPA 3RBEA 3HILA 4AP9A 1N5WA 2HOIA 1X6JA 5L1LA 4CCHA 5ALTA 3CNHA 1LKYA 1SIJA 2G5HB 3H0MB 2XO7A 4C8NA 3M8SA 1UQVA 4IRKA 1SWWA 2YB4A 2DGZA 2P35A 2Q0ZX 4JWNA 2WFAA 1JALA 1QSYA 9ICTA 8ICHA 3H8SA 3GU3A 1S0NA 1S97A 1UA0A 1FFVA 5DG9A 7ICEA 2AQ0A 5KG1A 1X42A 5L1MA 2CRXA 3LYSA 3RJIA 1V9PA 2BQ3A 2B6GA 1NK5A 1KN5A 3WK5A 2KJ8A 2HVHA 3U26A 3ZDDA 1NJWA 1YZ7A 1C7YA 2XC9A 1X6IA 1SL1A 4IR1A 2J6UA 2PMZC 5J2FA 3AQFA 5ALWA 7ICKA 5TZVA 3RJFA 4QIWC 1X66A 1EXNA 3ISCA 2WF6A 5IIMA 5J0PA 1SV0C 4RT2A
chains in the Genus database with same CATH topology
3A0HU 4UB8U 5TISU 2DUYA 5GTHU 5B66U 5E79U 1S5LU 5H2FU 5KAFU 3KZIU 4UB6U 5KAIU 4IL6U 3WU2U 4PJ0U 3A0BU 2AXTU 5GTIU 5B5EU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0H U;  4UB8 U;  5TIS U;  2DUY A;  5GTH U;  5B66 U;  5E79 U;  1S5L U;  5H2F U;  5KAF U;  3KZI U;  4UB6 U;  5KAI U;  4IL6 U;  3WU2 U;  4PJ0 U;  3A0B U;  2AXT U;  5GTI U;  5B5E U; 
#chains in the Genus database with same CATH topology
 3A0H U;  4O3M A;  5EWF A;  2ZXI A;  4EBE A;  2FPL A;  2Q4T A;  2F8L A;  5CWR A;  5AK3 A;  1YT3 A;  4LZD A;  5KFZ A;  3V7L A;  3J81 j;  4UAR A;  1L3S A;  3ICX A;  1MQ3 A;  4RQ2 A;  5J2C A;  2JZB B;  2ZIU B;  8ICQ A;  4KMO B;  3NS1 A;  4MFF A;  2R8G A;  5AKX A;  3MGI A;  2F44 A;  1KSP A;  2GLE A;  5DLG A;  2OHF A;  4P4O A;  3RRH A;  4FS2 A;  4CRX A;  3QYP A;  3UXN A;  3GDX A;  1HUO A;  3DDH A;  2KVC A;  1QCK A;  3F5A A;  2KZM A;  3NGD A;  1OW5 A;  1A76 A;  3KKA A;  5KT6 A;  4O3P A;  5FP0 A;  4YG2 A;  3LVW A;  3WKA A;  3OSN A;  3QEA Z;  3UQ2 A;  7ICV A;  5ALS A;  3PW5 A;  1QLN A;  4UB1 A;  3SR6 A;  3MBY A;  5EWE A;  2YMP A;  1TK0 A;  2IMW P;  1XC9 A;  1T8E A;  3PO4 A;  3RFA A;  2JRZ A;  4K4G A;  3V7K A;  3HJE A;  4ECY A;  4Q8E A;  2DPI A;  4ECX A;  1ZQJ A;  2VAN A;  1XO1 A;  2YX8 A;  5KFA A;  2B21 A;  8ICF A;  1RYU A;  3I76 A;  4F91 B;  1VLB A;  3S6J A;  1ZQM A;  4KN4 A;  2WF9 A;  4I2C A;  2OEH A;  3TQ1 A;  1C20 A;  1K1Q A;  4BWJ A;  2AGO A;  4KLI A;  3GIL A;  3RF9 A;  2FLN A;  9ICX A;  2G0A A;  5L1J A;  3PW2 A;  3H0L B;  5AIA A;  5KFJ A;  4XA5 A;  1SL0 A;  3SAH A;  5AKG A;  1KBU A;  3HKZ F;  2PFQ A;  2WB1 F;  3ISD A;  4IRC A;  3MGH A;  1D9F A;  3L5K A;  3SD7 A;  4DL3 A;  3E2E A;  4DQQ A;  3QZ8 A;  4QZ9 A;  2R8K A;  5ALQ A;  2YTU A;  2W11 A;  2C2D A;  2K4H A;  3MGV A;  1L6N A;  7ICU A;  5KFL A;  2JXJ A;  2K8A A;  1COK A;  2XY6 A;  1JMS A;  8ICE A;  4DSK A;  3C5G A;  5AKY A;  1PVR A;  1ZQO A;  3PV8 A;  9ICF A;  9ICI A;  2KMD A;  2BPG A;  3C23 A;  2E8P A;  3RRG A;  3R9K A;  1Q3U A;  1XWL A;  2KD1 A;  2DKX A;  7ICG A;  5HP4 A;  5KFY A;  4OD0 A;  4DFD A;  1AQ6 A;  3MAB A;  3UQ0 A;  2W43 A;  4BXO A;  2BGW A;  5III A;  8ICI A;  2R8H A;  1PZN A;  4MEX A;  3AU6 A;  3K1R B;  1UT5 A;  2VIX A;  1ED1 A;  4DSF A;  4QZC A;  4F92 B;  4Y2T A;  4RQ5 A;  8ICU A;  2HVI A;  8ICT A;  3AQE A;  3LDA A;  4ZH4 A;  4KLF A;  3MDC A;  3PX4 A;  4QZA A;  2KIC A;  5ALX A;  3NVY A;  2BDU A;  2ZG6 A;  4RU9 A;  1RPL A;  5KG7 A;  5AM3 A;  3M6Z A;  2KHV A;  4RQ4 A;  4OJ5 A;  3JPO A;  4U7C A;  4USA A;  1N48 A;  5KFR A;  4F5N A;  2E1E A;  2K8C B;  4O3O A;  4QWC A;  1CEZ A;  4CF3 A;  2RDI A;  2KK0 A;  3MC1 A;  2WAQ F;  5DB9 A;  3RH4 A;  4MFC A;  3IDW A;  4DOC A;  4RQM A;  1L3T A;  2G09 A;  1ZD2 P;  5DLF A;  1N61 A;  4IQV A;  3IHQ B;  3QUC A;  5HNK A;  2W3S A;  3KZI U;  3QU5 A;  2R8J A;  4M6W B;  2W9B B;  4ED1 A;  3KOO A;  8ICX A;  2BKE A;  3KBB A;  3F5E A;  5CR0 A;  3SAF A;  2P66 A;  2IBK A;  7ICQ A;  2MA1 A;  1M6Y A;  3IG8 A;  1RZT A;  3RJE A;  4F5P A;  3QUQ A;  3BQ2 A;  3KHH A;  5ALL A;  2GOL A;  1A6S A;  1SB3 C;  2KEY A;  1X2I A;  5DBB A;  3ZD9 A;  4UAZ A;  5AKE A;  7ICL A;  2KOB A;  4PGQ A;  2BQR A;  3TAP A;  4M04 A;  4BUG A;  3MDA A;  2HI0 A;  4C8M A;  3KFU F;  4BXO B;  4DL2 A;  3PML A;  1DRG A;  4P4M A;  4OJO A;  3WK7 A;  2QKQ A;  2HHQ A;  4JMU A;  1WWV A;  4ECV A;  4NM2 A;  7ICS A;  5IIK A;  4UB3 A;  5ALO A;  3UPQ A;  3V72 A;  4R65 A;  4PZO A;  8ICA A;  4I27 A;  3UXP A;  1RXW A;  2HHU A;  1Z00 B;  2AJQ A;  4Z6F A;  5KFH A;  4PHD A;  1PK3 A;  4M47 A;  1SKW A;  2DL0 A;  5J2I A;  1ZQS A;  4RZR A;  8ICO A;  3KD3 A;  7ICN A;  1RG6 A;  4BJQ A;  2D3D A;  1D8Y A;  4B9U A;  5HML A;  9ICJ A;  3TAQ A;  4KX5 A;  2WF7 A;  5BPC A;  2ZJ5 A;  2JGA A;  2ZUC A;  4I2J A;  5A0L A;  5ALV A;  3PO5 A;  8ICB A;  1TK5 A;  2ZIW A;  5ALE A;  1KW4 A;  4OJL A;  1Z1B A;  1TAU A;  4RNO A;  1ZQP A;  3RR7 A;  5J29 A;  4DQS A;  4NXZ A;  1L8O A;  1UT8 A;  5J0W A;  4KX3 A;  3RBD A;  3QZ7 A;  9ICR A;  3HX0 A;  4JK1 A;  5KAI U;  1N5X A;  5AK5 A;  2I6X A;  4TUQ A;  5EWG A;  3PVX A;  3K1Z A;  1ZQH A;  1S0V A;  5KFM A;  2ZXH A;  3OPX A;  4F2S A;  3KHG A;  4HAI A;  4CF4 A;  4LZG A;  4KLU A;  5IIO A;  4X5V A;  4XRH A;  3HWT A;  1RM6 C;  4NJ8 A;  4UB6 U;  4OO1 J;  5J0U A;  2AGQ A;  3OHB A;  3VCB A;  2KSO B;  2JMG A;  1ZD5 A;  3PR4 A;  1NI3 A;  4UW9 A;  3QNM A;  3M7D A;  4Z6C A;  3C2K A;  4KLT A;  4PHE A;  1Z4O A;  1U45 A;  1WG8 A;  2RP5 A;  2JHD A;  2KIW A;  4QW9 A;  5KT3 A;  4JV2 A;  4DFJ A;  2K4I A;  4DS4 A;  3ZDE A;  5BOL A;  4M0A A;  2RHF A;  2KN7 A;  2ESE A;  4IC9 A;  2E8N A;  1KEJ A;  4RT3 A;  2IOH A;  2H3F A;  3WK6 A;  2WAQ C;  5AI8 A;  4IS7 A;  4ECU A;  1ZQX A;  2F76 X;  2C22 A;  3PX6 A;  1NZB A;  9ICH A;  5F3X B;  1RQN A;  3EUB 2;  5AI5 A;  2HHX A;  3WK4 A;  2MUT B;  8ICN A;  3N4M B;  4TQR A;  1LB2 B;  2ZIV B;  4EEY A;  4PGX A;  4UB4 A;  7ICH A;  4YD1 A;  3SZ2 A;  4RQ7 A;  1ECW A;  3T5L A;  1SXE A;  4F4Z A;  4MF2 A;  1S77 D;  4YXJ A;  2F1I A;  2LYA A;  2H3Z A;  1NK7 A;  2LI6 A;  1BPX A;  5ALD A;  3Q8R B;  3WKB A;  2A1J B;  4QZB A;  4DSJ A;  4J9Q A;  2HOF A;  3DEE A;  2K8B B;  3NVZ A;  3QEB Z;  1IXR A;  2G06 A;  1NK8 A;  4YR3 A;  2M0N A;  4O0I A;  1JN3 A;  3GV8 B;  3GV5 B;  2JZB A;  2ZIU A;  5EE3 A;  5HHH A;  3SAG A;  4Q44 A;  4O3R A;  2FPK A;  3ETR A;  5CB1 A;  2V4R A;  4I2A A;  3BDP A;  2KZ3 A;  4P4P A;  4Q43 A;  3TKA A;  3SMV A;  2FMQ A;  4O5E A;  4FBT A;  1QTM A;  7ICR A;  2FI1 A;  2KHQ A;  9ICU A;  2NRZ A;  3O0F A;  2HBL A;  5ALU A;  4UB2 A;  4ECQ A;  1D8B A;  2W7P A;  2LMR A;  4F71 A;  2PKE A;  2V4Q A;  2H3Q A;  3CP8 A;  3T79 A;  5AKH A;  3V6K A;  3F53 A;  4YCX A;  5JTI A;  7ICJ A;  3D2N A;  3GZF A;  3AUO A;  1COO A;  2Y0S F;  1KTQ A;  1KDH A;  5DQH A;  3RB3 A;  4MF8 A;  1NJX A;  4O3Q A;  3QUB A;  2HHW A;  2YY6 A;  2E8O A;  4P0Q B;  4Z6D A;  1ZQI A;  4EBD A;  5ALF A;  4CGZ A;  4J9O A;  1JRP A;  1WYG A;  4F72 A;  1X9S A;  4YR2 A;  4EX7 A;  1HEK A;  5DQG A;  3H7I A;  1ZQB A;  2NRX A;  4DO9 A;  1O08 A;  3FM9 A;  2ODG A;  1ZQE A;  4M9N A;  8ICC A;  4RQ8 A;  2ZJ8 A;  5AKZ A;  3H8W A;  3K4G A;  2FDR A;  1B4F A;  5D4B A;  2EH9 A;  2BCU A;  2PI4 A;  1NNL A;  3H8M A;  4GC7 A;  3C1Y A;  2KFZ A;  4XUS A;  4US8 A;  3NTU A;  5ALH A;  4UAS A;  4KLL A;  1ZQZ A;  4K4I A;  1CRX A;  2KVS A;  4J9N A;  5KG6 A;  3T5H A;  3L4P A;  3RJG A;  2HHT A;  2YQE A;  4A8E A;  1B43 A;  5AM0 A;  2ZIX B;  4J9P A;  9ICL A;  4TUS A;  4ICA A;  2O6K A;  4J9K A;  4PL1 A;  3UMG A;  4M9G A;  4RQ1 A;  3SYZ A;  2NRW A;  5J2J A;  1BPZ A;  4PGY A;  4QWD A;  2J6T A;  3SI8 A;  9ICP A;  4Q8F A;  1HUZ A;  4OJ6 A;  3M8R A;  1Z4N A;  3IV6 A;  1DK2 A;  5KFU A;  3QU7 A;  2CPR A;  3K75 D;  3DV9 A;  3KTQ A;  1D9D A;  5AIC A;  5KNI A;  1SZH A;  5KFO A;  4J9L A;  4ED6 A;  1L7M A;  4ELT A;  1DGS A;  8ICR A;  4Y2S A;  2G07 A;  4DWI A;  1F0M A;  4FZM A;  1MSW D;  9ICM A;  8ICS A;  4GXJ A;  3ZDB A;  4CNQ A;  2JEI A;  2K60 A;  3WU2 U;  1PVP A;  4Y2P A;  3H4D A;  4CDG A;  1FIQ A;  2P6U A;  4UAW A;  4DEZ A;  1V85 A;  4MEY A;  5DBA A;  4NLB A;  4YD2 A;  3RH6 A;  2UVU A;  8ICY A;  1KFS A;  5KFV A;  4F4X A;  4IRD A;  4KLE A;  1ZJN A;  5EOZ A;  2WF5 A;  4O9M A;  2CN1 A;  4CF5 A;  4IQT A;  2HHV A;  4B9S A;  1XSL A;  4JV1 A;  3CW2 C;  2E1F A;  4NM1 A;  3GV7 B;  3Q8K A;  9ICB A;  1ZQL A;  5KG3 A;  2EAO A;  4YMM A;  3BQ7 A;  1XSN A;  1FFU A;  3ISB A;  1NZP A;  5D46 A;  1JX4 A;  5KFN A;  2P6R A;  2AU0 A;  2HMX A;  4R66 A;  2ZTE A;  3ETL A;  1BNO A;  4NL9 A;  3JPN A;  5AI6 A;  3PR5 B;  4RUC A;  3RTV A;  3PMN A;  5DQI A;  1DK3 A;  4YR0 A;  4PJ0 U;  2RLT A;  4RNN A;  5AKJ A;  4NWI A;  4QJF B;  4M6W A;  2W9B A;  8ICZ A;  1JXE A;  1ZD4 A;  5KFC A;  3C2M A;  5J0X A;  8ICW A;  3LVV A;  1ZQD A;  4US9 A;  3NRZ A;  2PFO A;  2YB1 A;  1BVS A;  4QWE A;  4C8O A;  5CJ7 A;  3JPT A;  4BX9 C;  2JEG A;  4O3N A;  3FYH A;  5AK4 A;  2KJ9 A;  4IQU A;  2FLL A;  1ZQF A;  1ZQW A;  2W54 A;  2BCS A;  4F93 B;  4Q45 A;  5KFQ A;  4ECZ A;  4YMN A;  1SV0 A;  2KKV A;  4BDP A;  5E79 U;  5H2F U;  1TFR A;  1IV8 A;  2JV3 A;  1PVQ A;  2BR0 A;  1SL2 A;  3MFI A;  1KLN A;  3A0B U;  3MR2 A;  4TUP A;  4B9M A;  5JUM A;  3MR3 A;  4KIT B;  4B9V A;  1A77 A;  7ICI A;  1Z00 A;  3HW8 A;  1FEZ A;  5J0Q A;  9ICW A;  2EZZ A;  1NK4 A;  2DF4 B;  2ZUB A;  1B22 A;  1JIH A;  5F9N A;  1F44 A;  2Y1I A;  4I2B A;  4GFJ A;  3GIJ A;  1T7P A;  3H0R B;  3EZ5 A;  2ISP A;  2EQY A;  3ZI4 A;  3TAN A;  1VDV A;  1V38 A;  2EDU A;  2ZUD A;  4QZ8 A;  3RJJ A;  5AKI A;  4EZ9 A;  2QAR B;  2XVT A;  4DFM A;  1X9W A;  5CA7 A;  1ZQY A;  4J03 A;  1ARO P;  1KFD A;  2K4E A;  5ALI A;  2HDO A;  1BPY A;  1ZQU A;  2ISO A;  1L7O A;  3VC8 A;  5J0T A;  3AEV A;  2DPJ A;  4FO6 A;  1ZQC A;  2H3V A;  2Z7J A;  5AI9 A;  4P0P B;  3N7R C;  5AM5 A;  2FJ6 A;  4F50 A;  4P2H A;  4EEL A;  2BCR A;  4F2R A;  1S5L U;  4E0D A;  3HT3 A;  1UCV A;  4PHA A;  5J0Y A;  4QZG A;  7ICM A;  1LVH A;  4KMU A;  2AHO B;  3TAC B;  3H4B A;  2JH1 A;  4PPX A;  3L3F X;  2KG5 A;  4PHP A;  4UAY A;  2G5I B;  2FLP A;  1ZQT A;  4ED0 A;  5T14 A;  4EEN A;  2AH5 A;  2VA8 A;  2OCE A;  1QH9 A;  1X40 A;  2KSO A;  3C28 A;  1T4G A;  2EAN A;  3RJK A;  1BPD A;  5KFT A;  5HR7 A;  1TK8 A;  3M9N B;  1K1S A;  4GXK A;  2I1Q A;  2MRL A;  2NYV A;  4F4Y A;  4NLN A;  4M2Y A;  4UQG A;  3RR8 A;  3BS7 A;  3HKZ C;  1QSS A;  3BJY A;  3PSP A;  5J2B A;  5ALG A;  2WB1 C;  3AMZ A;  4PL2 A;  4C8K A;  2LPE A;  4JWM A;  8ICP A;  1ZQ1 C;  3EPG A;  2RQ5 A;  5KL8 B;  3OJU A;  2OWO A;  2DFL A;  5DG8 A;  2W8K A;  4DQR A;  2HCF A;  4IL6 U;  3EPI A;  3LWM A;  5HR6 A;  9ICG A;  4ED3 A;  4KLO A;  2MUT A;  5KG0 A;  2IOF A;  5EE1 A;  4NV0 A;  2ZIV A;  3WKD A;  4IQW A;  4DL7 A;  4EYI B;  3PY8 A;  2XGP A;  5EE0 A;  2EAP A;  3JPQ A;  2QB0 B;  3TAD A;  1NKC A;  2KP7 A;  2AGP A;  5TIS U;  2A1J A;  3Q8L A;  2VJ5 A;  3GII A;  3C2L A;  4LJX A;  2DKZ A;  2PI5 A;  4FZL A;  3IM1 A;  5G5G A;  5L1K A;  1DOQ A;  9ICN A;  4M9J A;  4J9R A;  4QIW F;  1U47 A;  3BQT A;  1BPB A;  3NVW A;  2M9N A;  5CRX A;  4JV0 A;  3UMB A;  3BQ1 A;  1WUD A;  3I28 A;  3PST A;  9ICA A;  1ZQK A;  1NKB A;  2IA6 A;  4EX6 A;  4RNM A;  1TE2 A;  8ICV A;  2R18 A;  2LBO A;  8ICM A;  3RJH A;  2KKP A;  2HOQ A;  3WK8 A;  1ZQR A;  1ZET A;  8ICJ A;  5ALR A;  1URJ A;  9ICV A;  2LM1 A;  5DBC A;  2H3I A;  2EAM A;  3MFH A;  3D2Q A;  3CYM A;  1S10 A;  4FBU A;  4DOA A;  1RDF A;  5AHX A;  1RYR A;  1JI7 A;  2W55 A;  2VA2 A;  1IIP A;  1O03 A;  1L8L A;  4CE6 A;  1XNS A;  1KKX A;  3KZX A;  2W7O A;  4C4T A;  3MR6 A;  2W9C B;  4DOB A;  3RAX A;  8ICL A;  4P0Q A;  4I2F A;  3KKA C;  1L3U A;  5CHG A;  4DL4 A;  9ICO A;  4NY8 A;  1L3V A;  2FE9 A;  2BPF A;  4F5Q A;  3ZD8 A;  5KFP A;  4C7Y A;  5BOM A;  3TFS A;  3UM9 A;  2F3N A;  4RPX A;  1UA1 A;  1L5U A;  2EZY A;  1WCN A;  1J2M A;  4RQ3 A;  3LWL A;  1WCL A;  1N63 A;  1MN8 A;  9ICK A;  1Z19 A;  5ALY A;  1UPH A;  4I2G A;  3Q8Q B;  1NK6 A;  5KT7 A;  3M9O B;  3UMC A;  1T94 A;  4KLQ A;  2NRV A;  3QXG A;  4KLH A;  4F8R A;  4KLD A;  3BS5 B;  5JU5 A;  3V7J A;  1ZYQ A;  4WJ3 B;  3EWA A;  2ATL A;  2JH7 A;  4NLZ A;  3WKC A;  2HSZ A;  3IG5 A;  1OUQ A;  3PSF A;  3PW4 A;  3QE9 Y;  1IG6 A;  2MSN A;  3E0F A;  4ED2 A;  2ZIX A;  3IRU A;  5G5H A;  4ECS A;  4UB8 U;  3D2S A;  2W8L A;  2FPM A;  4I2E A;  2W3R A;  4QNL A;  4DQP A;  4FFD A;  2V9W A;  3GFK B;  3N97 B;  1QQ7 A;  4KLJ A;  4UAV A;  2ASD A;  2Y9T A;  4PZN A;  4Y2U A;  5J2H A;  5GTI U;  5J2D A;  3SQI A;  1ZRM A;  4OCZ A;  4ED7 A;  3FC4 A;  1JXL A;  2JEJ A;  4NL9 C;  1NKE A;  4DSL A;  3SV3 A;  4DSE A;  1NOM A;  2KNJ A;  2W03 A;  4XQ8 A;  4GC6 A;  4F4K A;  1BGX T;  3F2D A;  2BQU A;  1T3N A;  3ZDC A;  9ICE A;  1U4B A;  4KLM A;  1MC8 A;  1S9F A;  1S8O A;  3I1Y A;  2PXI A;  3QUT A;  4DCC A;  1P7D A;  5KG4 A;  4FS1 A;  1RQL A;  2HHS A;  5D49 A;  3UXO A;  4Y2Q A;  1RYS A;  4Y2V A;  5AKL A;  4R8U B;  2NV3 A;  3OSP A;  4QZH A;  3JPS A;  2YN4 A;  4TQS A;  1FO4 A;  3OGU A;  1N62 A;  2C2R A;  2IOF K;  1Z1V A;  2K4P A;  3ALR A;  1DGJ A;  4DSI A;  3AM9 A;  3PNC A;  4KN7 A;  2HW3 A;  2XID A;  2RDJ A;  3PZP A;  1Q46 A;  1J2N A;  2W9M A;  4GLX A;  5KFB A;  5J0R A;  5KT5 A;  4BGD A;  4DL5 A;  5DGB A;  5KFS A;  2HBJ A;  2LHT A;  4ECW A;  5AM2 A;  1QQ5 A;  1LKY B;  3GIK A;  3QU4 A;  3Q8M A;  2XCP A;  1KFT A;  5CEH A;  4KTQ A;  4I29 A;  5J8Y A;  4R64 A;  4ECR A;  4UAU A;  4ECT A;  3SEI A;  3GQC A;  4Y2R A;  4YVZ A;  5KFX A;  1XS9 D;  2QLT A;  2BCQ A;  5KFI A;  4Z6E A;  4I2D A;  1F5S A;  4AYB F;  1XU4 A;  3H8J A;  1TAQ A;  5KT4 A;  2NO4 A;  4B6J A;  2CXY A;  4KLS A;  1KL9 A;  1HJP A;  4QZF A;  5HMM A;  3EYZ A;  2C28 A;  2JR5 A;  3NUQ A;  4ACO A;  1QQ6 A;  3F2C A;  5DG7 A;  7ICP A;  1ZD3 A;  4U6P A;  4RPY A;  1ZQN A;  1NK9 A;  2K89 A;  3JPR A;  3V6H A;  3F2B A;  2J6S A;  5J2E A;  3LK9 A;  4RQN A;  4J9M A;  2XI9 A;  2D6F C;  5F9L A;  3T5J A;  1UHU A;  1JRO A;  4UAT A;  3RB0 A;  8ICG A;  4DLE A;  2NRT A;  3RB6 A;  3EW9 A;  4JB3 A;  4EEK A;  5KG2 A;  2I5H A;  3THV A;  4MFA A;  3QX7 A;  1U9L A;  2A1A A;  1MQ2 A;  3WKE A;  4ELV A;  3N28 A;  2QAR A;  3SV4 A;  1BPE A;  2F2A B;  2Y0S C;  4B9T A;  1Q8K A;  3OJS A;  7ICT A;  3Q8S B;  1XO0 A;  4DF4 A;  2DUY A;  5ALM A;  2D8C A;  1NK0 A;  2YMM A;  4GIB A;  2EZX A;  3C5F A;  3PW7 A;  2ZJA A;  4P0P A;  5KT2 A;  1CUK A;  1ZJM A;  4FE3 A;  3NAS A;  5AI4 A;  4DF8 A;  5HHI A;  4O5K A;  2BPC A;  4ED8 A;  1N2X A;  2KE7 A;  5AIB A;  5C0Y A;  5AK6 A;  4IR9 A;  5DDM A;  1KQQ A;  4UB5 A;  4FZN A;  2WTF A;  4C4R A;  3TAD C;  2KZZ A;  1BNP A;  1HIW A;  3PW0 A;  5ALN A;  3HP6 A;  4K4H A;  2OM6 A;  5ALP A;  4Y2Y A;  3TAR A;  3MR5 A;  4R63 A;  5L1I A;  1L7P A;  1ZQV A;  5J0O A;  3M1Y A;  4B9L A;  4F3O A;  4B9N A;  3D6J A;  2UVR A;  2LYH A;  4NLK A;  4YQW A;  3B0Y A;  3M9M B;  3BZK A;  1H38 A;  4J9S A;  1B0X A;  2OXO A;  1GO3 F;  1XSP A;  1CI4 A;  4C8L A;  5AKK A;  5K4L A;  5C5J A;  3G6V A;  1X9M A;  3KHR A;  3RB4 A;  3TFR A;  3BQ0 A;  1ZOL A;  3G6Y A;  1K5O A;  1SV4 A;  2JEF A;  2H5X A;  5L9X A;  2OH2 A;  3JPP A;  2AQ4 A;  1PUZ A;  2PFN A;  4F4W A;  4QW8 A;  4EBC A;  5B66 U;  4GXI A;  2KIV A;  4EZ6 A;  3B0X A;  3NRW A;  2ASJ A;  4NLG A;  1PK1 A;  3T5K A;  5KFW A;  2HBM A;  4Y2X A;  2AXT U;  1MA7 A;  4YXM A;  2KFN A;  2WF8 A;  1SWV A;  5DB7 A;  4MHV A;  2F77 X;  3AL0 B;  1S0M A;  5ALK A;  3B9J A;  2QB0 A;  4AYB C;  1Z3E B;  4UBB A;  3N7P D;  4DLG A;  1DXS A;  2XIC A;  2DQN B;  2OYY A;  3M6K A;  4C80 A;  2DWQ A;  2IHM A;  4KLG A;  5KFG A;  2N1R A;  2HBK A;  4G9B A;  4QWB A;  2C2E A;  3GIM A;  9ICC A;  4F5O A;  5JRT A;  3C1Z A;  5AM1 A;  5DGA A;  5IIJ A;  3ED5 A;  3RAQ A;  2DBY A;  1TVA A;  2QB1 A;  5J2K A;  1L7N A;  3ORY A;  4I2I A;  5KAF U;  1U49 A;  5J2G A;  3E58 A;  2KV2 A;  1ZQQ A;  4EYH B;  2BHN A;  4TUR A;  3CRX A;  4M9H A;  3G6X A;  2VJ4 A;  4O3S A;  1ZRN A;  1YZ6 A;  3IP4 B;  5KG5 A;  2ASL A;  1SKS A;  2W04 A;  5CP2 A;  1S76 D;  3ONN A;  1T3Q A;  2E3T A;  5IIN A;  2GH1 A;  3HPO A;  4YMO A;  4I28 A;  2MAX A;  3NVV A;  2GWS A;  1NJZ A;  8ICK A;  4RPZ A;  4I2H A;  4DQI A;  2UVW A;  1X9X A;  2FMP A;  4G3I A;  4O5C A;  2ES6 A;  1N56 A;  4YFK A;  2ALZ A;  2MU2 A;  2W9C A;  1U48 A;  3RH5 A;  2BZF A;  1PK1 B;  2YML A;  4DFP A;  2RRD A;  3ZDA A;  1N60 A;  3OTQ A;  5EE9 A;  4C0Z A;  4QWA A;  7ICO A;  1VJ5 A;  2YMQ A;  4C7Z A;  3HRD D;  3V6J A;  5AM4 A;  2XY7 A;  1SXD A;  2LYB A;  3AN1 A;  4RQ0 A;  1OXJ A;  1J97 A;  4UBC A;  1SGG A;  2F8K A;  2G08 A;  2PMZ F;  4LVS A;  2L5Y A;  5J0S A;  4M9L A;  1TAM A;  3WK9 A;  1V97 A;  5IIL A;  3KHL A;  4C4S A;  2I9G A;  1ZXI A;  3BS5 A;  3OHA A;  3PX0 A;  5B5E U;  4NLC A;  5J2A A;  4ELU A;  2XY5 A;  2E5S A;  2LM4 A;  2VKQ A;  1Y88 A;  5DKW A;  3T3F A;  2BCV A;  1KRP A;  2KJ5 A;  1TV9 A;  3FDS A;  4BWM A;  1IM4 A;  2XGQ A;  4QZI A;  2LKY A;  5KFE A;  2UVV A;  5KFK A;  9ICQ A;  1Q3V A;  3QU2 A;  4DFK A;  4ZOH C;  5KFD A;  1WWU A;  2PFP A;  1D8L A;  3QU9 A;  4RUA A;  3SEN A;  2NO5 A;  4JUZ A;  2B0C A;  5KTQ A;  2WHE A;  3N7S C;  2E8M A;  5KFF A;  2KTQ A;  4PH5 A;  1S0O A;  1TKD A;  3C29 A;  4YN4 A;  3BZC A;  3Q8P B;  4RQ6 A;  2GO7 A;  4OJP A;  2XCA A;  1LV5 A;  1A0P A;  2ZTD A;  4DS5 A;  5J8Y C;  4F5R A;  5DB8 A;  1JUD A;  9ICS A;  3C21 A;  1RXV A;  2ZTC A;  3AU2 A;  5ALJ A;  3TI0 A;  2ZIW B;  2F1J A;  4Y2J A;  5ALZ A;  2FMS A;  1ZQG A;  2A3V A;  2Y1J A;  2W9A A;  5DB6 A;  3PSI A;  4QZE A;  4R8U A;  5KL1 B;  4HYK A;  4DL6 A;  3H40 A;  4YP3 A;  3FAH A;  2VA3 A;  2F1H A;  2R8I A;  5GTH U;  5AI0 A;  1SZP A;  1NJY A;  2A19 A;  1QSL A;  2IHN A;  2Y9U A;  1SKR A;  7ICF A;  5DDY A;  3IN5 A;  1ZQA A;  4QZD A;  2BDP A;  3RBE A;  3HIL A;  4AP9 A;  1N5W A;  2HOI A;  1X6J A;  5L1L A;  4CCH A;  5ALT A;  3CNH A;  1LKY A;  1SIJ A;  2G5H B;  3H0M B;  2XO7 A;  4C8N A;  3M8S A;  1UQV A;  4IRK A;  1SWW A;  2YB4 A;  2DGZ A;  2P35 A;  2Q0Z X;  4JWN A;  2WFA A;  1JAL A;  1QSY A;  9ICT A;  8ICH A;  3H8S A;  3GU3 A;  1S0N A;  1S97 A;  1UA0 A;  1FFV A;  5DG9 A;  7ICE A;  2AQ0 A;  5KG1 A;  1X42 A;  5L1M A;  2CRX A;  3LYS A;  3RJI A;  1V9P A;  2BQ3 A;  2B6G A;  1NK5 A;  1KN5 A;  3WK5 A;  2KJ8 A;  2HVH A;  3U26 A;  3ZDD A;  1NJW A;  1YZ7 A;  1C7Y A;  2XC9 A;  1X6I A;  1SL1 A;  4IR1 A;  2J6U A;  2PMZ C;  5J2F A;  3AQF A;  5ALW A;  7ICK A;  5TZV A;  3RJF A;  4QIW C;  1X66 A;  1EXN A;  3ISC A;  2WF6 A;  5IIM A;  5J0P A;  1SV0 C;  4RT2 A; 
#chains in the Genus database with same CATH homology
 3A0H U;  4UB8 U;  5TIS U;  2DUY A;  5GTH U;  5B66 U;  5E79 U;  1S5L U;  5H2F U;  5KAF U;  3KZI U;  4UB6 U;  5KAI U;  4IL6 U;  3WU2 U;  4PJ0 U;  3A0B U;  2AXT U;  5GTI U;  5B5E U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...