2DVAA

Crystal structure of peanut lectin gal-beta-1,3-galnac-alpha-o-me (methyl-t-antigen) complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
232
structure length
232
Chain Sequence
b'AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactose-binding lectin
publication title Structural studies on peanut lectin complexed with disaccharides involving different linkages: further insights into the structure and interactions of the lectin
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 56
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2dvaA00
5SV8A 2ZGPA 2D3SA 3VKLA 2LTNA 1R1ZA 4P9WA 3ZVXA 1NXD1 3OY8A 3MW3A 4IQPA 4YGDA 2GMEA 1N47A 3OGGA 4YZ4A 3O0XA 2FHRA 5DZFA 2CYFA 2SBAA 2DYCA 3CNAA 1QGLA 2GNDA 2JKBA 1IS3A 4ISRA 5T55A 3WHUA 3NV1A 1AZDA 1HKDA 1NLSA 1KITA 4XXAA 4FPHA 3QCWA 3POWA 1MS9A 2ZMNA 1KDMA 3W59A 1G7YA 2ZMKA 3FFZA 4YFZA 4R9CA 1CQ9A 4Y1VA 3AXDA 5DXDA 1DQ5A 3ZYPA 4R9DA 5GLUA 1URXA 4Q27A 1GZCA 2D44A 1ZA4A 4Y24A 4ZKTB 3RMYA 2ZHMA 2DV9A 2ZGOA 1CONA 4XIKA 3HMYA 5T50A 3WG1A 4YGCA 4PQ9A 4BQ1A 2PHUA 1SLAA 2ZACA 4XIOA 2VW0A 3FLRA 2GDFA 5T54A 3LSEA 4FOYA 4YGEA 5EYYA 4LBQD 4FOWA 1SLLA 3AXEA 1HQLA 2V73A 2W52A 5T52A 2PHXA 1C1LA 3HN1A 2YROA 3AP7A 2A70A 5KXCA 1UKGA 1GV9A 3BOPA 4FPEA 2VH9A 1LHOA 3KM5A 5JLVA 1C1FA 4XBQA 4AGRA 4DS0A 1LGBA 4FPCA 4LBLA 1MS5A 2NP0A 1LOGA 4LBQA 1DQ4A 2A6VA 2P37A 3ENRA 3MEPA 4GA9A 2CTVA 3AP5A 5GLWA 3WDTA 2XG3A 1KQRA 1WLCA 4GWMA 3AJYA 3M2MA 4XMAA 3OJBA 3N7KA 5GALA 1PZ7A 1LOCA 3ASIA 5GZCA 2CNAA 4Z8BA 3O12A 4WVVA 5DZEA 1SCRA 2EXKA 2E7QA 5KXBA 1BXHA 1S0DA 3ZXKA 1KDKA 5IK5A 2GMMA 3BIWE 4OZXA 1LULA 1SACA 1QMJA 2V5YA 1DIWA 1SCSA 2FMDA 1W6PA 4FVVA 4CTEA 1MZ5A 1LOAA 1IKQA 3ZXLA 2D7FA 5FRAA 1QNWA 4M3CF 1I1EA 1A3KA 3C2UA 1AVBA 1QKQA 4MYEA 2ZGMA 1N1VA 1QOOA 1G9FA 2GN7A 4XJWA 1UZZA 3H0OA 3RSJA 2CWSA 3PVNA 3WCRA 1D0HA 1XQNA 3NV4A 4GKXA 1JYIA 1GZWB 1N1YA 4JRAA 1MACA 2EF6A 4K20A 1WW4A 1JW6A 1VALA 4BLJA 4AWDA 5KXDA 1WLDA 2D6PA 4R9BA 1FAYA 2DU1A 2NZ9A 3ILNA 3AP6A 1WBLA 4YLZA 4XJ9A 1H9PA 3APBA 1QOTA 4FPFA 4LBOA 4XHXA 3ZSMA 2RHPA 5JMCA 2DUQA 1ENRA 2PHWA 4UW3A 1G9DA 5H9RA 2D6OX 2ARXA 2WT0A 1FX5A 3AYAA 1WD3A 3LCPA 1WW7A 1IOAA 2JE7A 3PJQA 1LOEA 3FLTA 3OYWB 2NYYA 5IK4A 5GM0A 2ZMLA 2NM1A 1W6MB 4I30A 4LBKA 1DQ2A 1LCLA 1N1TA 2E7TA 2WKKA 1AJKA 1LHVA 4DRVA 2AREA 1Q8SA 3N7MA 5DG2A 2BQPA 4XJUA 4AVVA 3L2YA 1LU2A 5GLTA 4YW4A 2ZA9A 4KBBA 1O4ZA 4YM1A 3OPZA 3RRDA 4FOVA 1V6OA 3WDWA 2WJSA 4PBOA 4WVWA 5E89A 4RL7A 3ZXFA 2PHTA 4AVSA 1ULFA 3R4UA 3PVEA 4XILA 2YY1A 4F83A 1SFYA 4FPGA 2ZGSA 4LBMA 1GNZA 1KJLA 1UPSA 5JOZA 1DLLA 1LHWA 2DVGA 3IPVA 2YMZA 3N7LA 5EXOA 1FV3A 4XOGA 2AH2A 4Y22B 1QF3A 2ZGTA 3PVOA 3VKFC 2R1BA 4FOQA 3SLIA 3A0NA 2ZABA 3TB0A 3TAYA 1LOFC 4NO4A 1MZ6A 1LOFA 4UW4A 1QU0A 3Q9OA 1SLBA 4Q1RA 1CIWA 3NV2A 3T2TA 2WSVA 4XTMA 2UWAA 3ZXJA 1LJ7A 2KM2A 2VXRA 1N3OA 4XJ8A 1S0FA 2H0BA 2Q5TA 3FUQA 2AYHA 2ZZJA 5JOYA 1LGCA 3NWKA 2D3PA 1SLIA 1HQWA 3RMXA 3M3OA 4YW5A 3AJZA 4HANA 1S0GA 1QOSA 2P2KA 2WT1A 1AXZA 1JYCA 1C4RA 3WLUA 5JOXA 2EIGA 3ATGA 4M00A 1MVQA 4YFWA 4FPYA 3V0BB 1IS5A 1TEIA 2VY0A 4FPJA 1FNYA 1J1TA 3WG2A 4TYSA 3WUDA 5CA6A 1G9AA 4U2AA 4DPNA 3IPVB 5DUUA 5H9PA 2D6MA 4LBJA 2ZHKA 1GZWA 2UU8A 4BM8A 3R05A 3VKOA 4WV8A 1UAIA 3WDYA 3N35A 1MS1A 1Y7BA 4DRRA 2W39A 1CN1A 3ZSLA 3WV6A 3M1HA 3LSDA 2JD4A 2NMNA 3WDVA 4Y1ZA 5CAZA 5HCBA 2I2SA 2UWCA 4D69A 2GNBA 1S0JA 3V64A 1QDCA 2AGSA 5LK5A 1G8WA 1SLCA 4YM3A 1C57A 3D5OA 2DVFA 3UK9A 2DURA 1Q56A 2NN8A 1GSLA 2A5ZA 3A0KA 4H55A 4NOTA 4AGVA 3VUOA 1GICA 1VIWB 1G86A 2G4IA 2GMPA 3WZ1A 1LU1A 3OYWA 1DQ0A 4L8QA 3VKMA 3RS6A 2E51A 4Q2FA 4XMIA 1PZ8A 1W6NB 1U0AA 4ATEA 2ARBA 1GZ9A 1KJRA 1W6MA 2ERFA 2LALA 3WG4A 1JUIA 1KRIA 3AYCA 3B69A 3OBRA 4XZPA 4YW3A 3SH4A 4FP2A 2DTYA 3WDUA 2ZKNA 2A71A 4UW6A 2D6KA 3VV1A 3FLPA 5IUQA 3AX4A 5EYXA 1V6NA 3NV3A 1ULGA 4HL0A 2WSUA 2DUOA 4BOWA 1YXWA 1DFQA 4ZXKA 4YG0A 5H9SA 1LESA 5IT6A 4XJZA 1V6JA 2A3YA 3GNEA 1AX2A 4XHBA 2AR6A 3D6EA 4ATFA 1F9KA 2A3WA 4P14A 4Y22A 1WBFA 2GALA 5GLZA 4BMEA 2W08A 1IS4A 1CPMA 3W58A 1ULEA 3BTAA 3MW2A 1S0EA 4W65A 1BZWA 3ZYRA 3M3CA 1EPWA 1SBEA 1V6MA 2YV8A 4Q26A 2JDZA 2D43A 2D6NA 3WG3A 5L73A 1LHUA 1Z0HA 1DYKA 4YW2A 1AX0A 1HDKA 1UX6A 3M3EA 4Y1XA 1DYPA 2ZGUA 4YG6A 4GALA 2GN3A 3D4KA 4CRQA 4TZDA 4FPOB 2E6VA 2XB6C 1VAVA 1LODA 4GXLA 4M01A 4AYUA 2AENA 1Q8PA 4DFSA 4ASMB 1AF9A 3V0AB 4AVTA 1LTEA 2R16A 3ZSKA 4C1WA 1APNA 1D2SA 5EWSA 2WQZC 5CBLA 2WNEA 1IKPA 1OFSA 3V0BA 2VW1A 5DG1A 2R0FA 3WCSA 5H9QA 1N1SA 1S0CA 5T5OA 3SISA 3V65A 1LEDA 3M3QA 4ISQA 2JJ6A 5FREA 2NMOA 1GANA 5F9TA 5JDBA 1WW6A 1GKBA 1W0PA 4PBPA 1ZM1A 3SNMA 1LEMA 3JU9A 2CWMA 3AYDA 1AXKA 2ZHLA 1W6OB 2ZHNA 4YZ2A 1BJQA 3O5SA 3A4UA 1DHKB 4XTPA 2DTWA 4Y26A 2W68A 3ILFA 4YZ1A 4JC1A 5DZGA 4UW5A 1WW5A 2AUYA 2CY6A 5IK7A 1BYHA 5T5JA 3POSA 1GLHA 1O4YA 2TEPA 4YM2A 4C1XA 1QNYA 5IK8A 1V6IA 3JUUA 1DQ1A 2DUPA 4BPZA 3O0WA 2DVAA 3FUOA 1W6QB 4LBNA 5E8AA 1DGLA 1MVEA 1W6NA 2OW4A 3AZYA 1UN1A 1AJOA 1JHNA 1FV2A 4FPLA 1ONAA 4PCRA 2SLIA 4ITCA 2A7AA 3N7JA 1GYKA 2PHRA 1PZ9A 4FQ4A 2ZGQA 2ZAAA 3B9CA 3RQ0A 5HCFA 4YZ3A 2Z42A 2WT2A 4P9YA 1VLNA 1VAMA 5DUXA 1S0BA 3ZSJA 3AP4A 1BKZA 2ZGKA 4P9XA 4FQZA 4XJAA 4YW1A 1CJPA 1LECA 2ZBJA 1CVNA 1JXNA 4YGBA 2EXHA 4M3CE 1F31A 4Y20B 4PF5A 1BQPA 3AZXA 2DWRA 2WLQA 1RIRA 1RINA 2A3XA 1OKQA 3T1MA 4RA0A 3USUB 2UURA 1HLCA 1MS8A 1Q8OA 2JECA 4YZ5A 5JOWA 4U36A 5DUWA 4XBLA 2EAKA 2A6YA 1LHNA 1MS3A 3ILRA 1FATA 2A6ZA 2ZGRA 4Q8LA 1SLTA 1A78A 1H30A 2EXJA 2ZGLA 3BODA 1FYUA 1N3QA 3OY8B 3B00A 5GJ6A 5DUVA 1H9WA 3AP9A 4Y1YA 1MS0A 5T5PA 1SBDA 1S1AA 2E53A 3IKWA 2UWBA 4Q1PA 4SLIA 1AX1A 2P34A 3ZPYA 2CL2A 4AGGA 3FBYA 5HCAA 1DBNA 1G9BA 2DVDA 4Q8KA 2YXSA 2C5DA 3WUCA 1WUVA 2EALA 2OUJA 1V6LA 3WDXA 5BYNA 1CPNA 3T1LA 1I3HA 2OVUA 3DGTA 1UZYA 3ZXEA 3V0AA 1RITA 4FP3A 5F5QA 4JCKA 2P3KA 3N3HA 4XDQA 1N3PA 3IN9A 3IMNA 1X50A 2DU0A 3VKNA 3WNXA 2PHFA 3UJOA 1ENSA 4GKYA 1V00A 3R4SA 5T5LA 2ES3A 1WCSA 2HYKA 5GLVA 1QDOA 4YG3A 1CR7A 4CZSA 2ENRA 3AZVA 3I8TA 1DZQA 1LENA 2PELA 5E88A 3INAA 3N36A 3QLQA 1LGNA 2P3IA 1IS6A 1JN2P 1W6OA 1Z78A 4XXPA 4K1ZA 2D3RA 2R0HA 3OBTA 1S0IA 4R9AA 1YIFA 5KXEA 4K21A 3O0VA 3KQRA 4WZFA 1UL9A 1Q8VA 1ENQA 1YRZA 3SH5A 4YM0A 4M3CA 1JOJA 2R49A 1GBGA 3UJQA 1WLWA 3GALA 1G9CA 1YO8A 5CB7A 3AYEA 4XE9A 2GNMA 5GZDA 3HR9A 3WHTA 1AXYA 1UMZA 4LBQB 3UL2A 2GNTA 4BMBA 3B01A 4Y1UA 3I4IA 2B7YA 1W6QA 4DQAA 1YYNA 3AZZA 4XYXA 2JE9A 5GZEA 3SITA 3IM0A 3WVJA 4K1YA 3AK0A 3DUIA 2EXIA 3PMEA 1YI7A 1WD4A 1F5FA 2VUAA 3AFKA 1GNHA 1MS4A 2D6LX 5GZGA 1W0OA 2A75A 2DVBA 5GZFA 2VW2A 5JVVA 4BLIA 1B09A 2VU9A 2P3JA 1W6PB 5CNAA 2OUHA 3RG0A 2C9AA 1ULCA 3MW4A 3AZWA 1FNZA 2A6WA 4Y20A 3POYA 1DQ6A 3B3QE 3MPPG 3U4XA 2ZGNA 1Q8QA 1LOBA 2YZ4A 2A6XA 1SBFA 1A8DA 1OQ1A 3USUA 1ULDA 2R1DA 1V6KA 4XBNA 3WOGA 1MR5A 1CESA 1JBCA 4FPKA 4M3CB 3SH3A 4GWNA 5AVAA
chains in the Genus database with same CATH superfamily
2QQWA 5I0UA 1COV3 2VZSA 2D93A 4P9WA 1H8TA 2WS91 3VHNA 3USSA 2XJTA 5BNNA 2GMEA 4YZ4A 1QJY1 2B39A 3N9PA 4QX3A 2CDPA 5KHKA 3DPRA 4CCMA 4BDVB 3DEMA 3JBG3 2GNDA 2HWE1 4LPLA 1IS3A 3PHMA 3FFQA 4ISRA 3NAPC 4UFHA 1DGWX 1EYBA 5FZ1A 3ES1A 1DP0A 1AL0G 4XXAA 4YSFA 1MS9A 1YI9A 1UNBA 1X8MA 1NA1C 4NIIA 5A3PA 3E1F1 4OI0A 1KDMA 3KT4A 3W59A 4BQ5A 1G7YA 4GH4C 2DCJA 3AXDA 3ZYPA 1DQ5A 1W39A 3DKWA 4R9DA 5FPZA 2KR2A 3DKQA 4LR4A 5IFPA 1GMMA 1GZCA 1ZA4A 2WL1A 1UOGA 4HSJA 1XNKA 1UKRA 2HWF2 3VBSC 1C3HA 1TME2 1ZBA2 1V9U3 5A3UA 2Z2SB 3MZHA 4PQ9A 2X10A 1HRI1 2PHUA 2V09A 2ZACA 4Q4W2 1FMD1 4XIOA 1ODNA 4P02B 3ES4A 1VRH2 4DXTA 3FC0A 4FOYA 4MGTA 4RFT0 4CCLA 5F6KA 1GZTA 1VBA1 4CDQB 4W50A 5F5IA 1D4M2 3BTZA 2V73A 2PHXA 4LHKA 5A6ZA 1C1LA 5F32A 2YROA 3LPGA 2A70A 5FJHA 1GV9A 1VBC1 1ASJ2 4LE4A 2FDGA 1U5YA 2VH9A 3VDDA 3RI8A 2GZWA 4XBQA 1COV2 3B94A 1AR81 4FXKB 1LGBA 1RUE3 2B42B 2HWB3 2CU5A 2BGOA 3WNLA 3L9JT 3KHBA 1SFPA 2XLGA 2DFCA 2P37A 5J3UA 3ZFFC 4B7KA 5BNPB 1LKNA 1Y4WA 2D97A 4EQVA 2XG3A 5FYHA 3NNGA 1RUI3 5APAA 3AJYA 3JBG2 3WNMA 3OJBA 3N7KA 4IEQA 3T2PA 1PZ7A 5HI0A 4QU2A 1W2UA 5LBFA 3ZN5A 1HRV3 3KWVA 5F3EA 5DZEA 5J09A 2YC0A 3ZFGB 2E7QA 4Q4Y1 1OBNA 1AR91 4IV1B 5IK5A 1QJX3 1O5UA 3H9AA 5EP9A 4CDWC 3T0DA 4DXSA 3J7HA 1QMJA 3FJSA 1JZ6A 3ACFA 1AR63 4MOAA 2VOXA 5FP9A 5ACA1 3GZEA 4QPIB 3PU8A 1RMU3 1V9U2 1UY0A 1G9FA 1CAUA 5C4WB 4G4FA 3PVNA 1PK6A 3RSJA 4GKXA 3SEPA 1JYIA 1POQA 2EF6A 1RVF3 4OVEA 5KXDA 1VALA 5FZDA 4QPGB 1WLDA 2FCUA 1Y9QA 3GBFA 3WEZA 1FPN3 3NVCA 4R9BA 4Q0VA 5FMOS 3AP6A 5A32B 2IFRA 2RVAA 4HPKB 3ZIXA 2HYXA 3IDAA 4XJ9A 3MUY1 5FZIA 4GWJA 4FPFA 3ZSMA 2QZ2A 1J58A 1XPWA 5FYSA 2DUQA 4PT6A 5B2GB 5K8SA 2D6OX 1UYYA 3BUCA 5ABJA 3LWCA 2WT0A 5DN2A 4CUBA 3AYAA 4HBNA 1WD3A 3LCPA 4QGLA 1WW7A 1HXS2 1VRBA 3TNPB 1GP4A 3PJQA 1QJU3 2YBKA 4H2AA 1RUI2 5IK4A 4LO7A 5GM0A 1W90A 1UYPA 3EYPA 3FX3A 3LEKA 4FXGB 4I30A 4NJ4A 1JYWA 1DQ2A 2I07B 4QM9A 1NUKA 1HRV2 5JCTA 3ELNA 4XUQA 2AREA 3AVSA 1Q8SA 2GP3A 1ZRCA 1WA6X 3C8XA 1S55A 5FZBA 4YW4A 4FTEA 4KU7A 4YM1A 3OPZA 3J26N 2HWD1 3RRDA 3LE0A 3WF3A 4JGYC 4WVWA 1H2MA 2GH8A 1AR62 1PIV3 1EAH3 2YFZA 4IE4A 2VCAA 1J59A 4KWUA 3KMHA 2ZX1A 2RS53 3AM2A 1RMU2 1GNZA 4FCAA 1KJLA 1UPSA 4XETA 5JOZA 3I3BA 2DVGA 3IPVA 2XOMA 1OD5A 4NHXA 4Y22B 1QF3A 3IIAA 1AR73 1J3QA 2BWAA 3TN91 3BVCA 2XDVA 3SCHA 2RR11 2VBBA 3K4AA 1UZVA 1MQTB 4A42A 4OQ9A 2YPDA 1PX3A 3KSCA 3OPTA 2WNVC 2Y6GA 4NO4A 4UW4A 2F4PA 4A6SA 1SLBA 4Q1RA 1UMHA 1CIWA 4HT1T 3NSTA 2KM2A 1YIPA 2BV4A 2VXRA 5K9YA 1XC6A 4XJ8A 2Q5TA 1H1IA 1Z7S1 2W95A 3FUQA 1K45A 2R30A 5A3WA 2D3PA 2MEV3 2GAUA 2DCKA 1H1AA 1HQWA 5FPAA 4AFCA 1VBB1 4JGZA 5LATA 1QJU2 1S0GA 3GM8A 3ZYGA 3B93A 3N9OA 1BEV3 1C8M3 4QX5A 3EJKA 5E16A 3S7IA 1MVQA 4JVAA 3LAGA 1PMJX 4IV3A 4ZS2A 2AZ5A 1IS5A 1H8VA 2JDPA 4FPJA 4K8FA 4F3JA 5I0RA 3V0BB 1FNYA 4EJRA 4IETA 5A1AA 4KGQA 4TYSA 2IXKA 5EHDA 4LNVA 5CA6A 3VHOA 3OF1A 4DPNA 4IEPA 3AC0A 1R1A1 2RDSA 3CU7A 1LB2A 5L19A 1ACCA 4OI4A 1PIV2 4KL1A 1EAH2 4N9HA 3R05A 3T30A 3VKOA 1HN1A 3E6BA 2XWJB 3VBOA 1UAIA 1SHWB 2RS52 2W91A 4JKLA 3WW3A 1Y7BA 4DUWA 2FQPA 2W39A 1C28A 4E27A 5IVFA 3ZSLA 1QXRA 2J1VA 2JG8A 4PIZA 4A44A 3AMPA 5C5UA 5FZAA 1OSGA 3PURA 4TLFA 2WNOA 3AL6A 5CAZA 1RUOA 2Y38A 1UOJA 2ORZA 5C6CA 1S0JA 4LHNA 4A41A 1W05A 1XU2A 5LK5A 4UFIA 4BCUA 3TEYA 4OI2A 5FYTA 2R043 1GSLA 2A5ZA 3VL8A 1O5LA 4GB33 2V72A 1JYNA 4QPYA 4AW7A 2F17A 1LU1A 3OYWA 4L8QA 2Q8EA 3ZXLA 4Q2FA 4ATEA 5BY5A 1W6NB 2ARBA 1KJRA 2B8MA 2ERFA 2VQAA 3UV9A 3WG4A 4PIYA 2BGPA 2WFF1 4OHYA 1YEWA 3AYCA 2MEV2 1B35B 1PGSA 4QD2A 5FY4A 2X53S 2R073 4FP2A 2XHKA 2ZKNA 2NQYA 2QKDA 3ACGA 4IL7A 4BXFA 4UW6A 3WT3A 1BEV2 1C8M2 3DYMA 2GP5A 3VV1A 3ZO0B 3FLPA 1BMV1 1BHGA 4NMIA 3SKJE 4KWJA 1GR3A 5EYXA 4B1LA 4P9LA 2QQNA 5F3IA 4B29A 2JG9B 3LD8A 2ATFA 5IVYA 2ZZQA 2ZCWA 2KD7A 4KBZA 4XF0A 5H9SA 5IT6A 1RUC1 2WUHA 4XJZA 1AYN3 1VBE3 4P14A 1WBFA 3IDCB 5HXMA 5K4LA 2VCCA 3C7OA 1IS4A 1BVVA 3VLBB 1JZ7A 5C3SA 3BU7A 3MW2A 4LHLA 1UZ0A 1VE0A 3J7MA 1EPWA 3RZZA 1XSQA 2VNRA 4Q26A 1OLMA 4GMP3 2D6NA 3WG3A 4W4ZA 1AX0A 4O9EA 3M3EA 5AC92 1UYZA 4BA6A 4BK5A 4TZDA 2X09A 4FPOB 2R042 3LIGA 4GXLA 3T4VA 4AYUA 4GB32 2VQ0A 4M01A 2AENA 4DMIA 5LEJA 3JQXA 3THPA 3WNKA 3NMBA 4XZUG 5JXHA 3RYRA 2OZJA 5J36A 1OD3A 4AVTA 5CFCA 4HFSA 1A8MA 1D2SA 2G9GA 1JUHA 2WO7A 2ZEZA 4NIAA 2VZTA 1IPSA 1PVC3 5LA0A 3SISA 4LXLA 3M3QA 2ZJCA 1K5MC 2ARCA 3UETA 2WN3A 2NMOA 1VPHA 2W46A 2ZEXA 4PBPA 1ZM1A 5JR7B 5A6YA 4I01A 1W8UA 2FDHA 3LEMA 2CWMA 3UYJA 1RUG1 1KFUL 4IE6A 2VUDA 4BQWA 1HQNA 3LDKA 3A4UA 4OI1A 1ND2B 2Y6KA 2B9VA 1IQAA 2CV6A 4ASKA 1AYN2 5DZGA 4ZU5A 4UW5A 5JI7A 1ENXA 2BPA2 2VZQA 3JD73 1YQCA 5BNOA 3X29B 4AI8A 1O91A 5IK7A 5FMCA 1GP5A 1SPPA 4AK3A 3POSA 4AQSA 1UY1A 4BQYA 2EVXA 2DBIA 3ECQA 2Y6HA 3H50A 4LT5A 3JUUA 3PMSA 4JDNA 5J96B 2Q8DA 3J9SA 3GJAA 4DXRA 2J1RA 3C7GA 1PMIA 4JAAA 4E2SA 5L7OC 1DGLA 4COVA 1JHNA 3GXUA 4QXCA 1PO21 2SLIA 4ITCA 4YPJA 1PO13 1PGL2 4LO5B 4C91A 2A7AA 5DABA 3W5MA 1GYKA 3RNSA 2ZGQA 2ZAAA 1GWKA 1OHFA 1STMA 3CLPA 2WO2A 4Q4W1 5HCFA 5F3CA 3CMGA 4S2FA 3ABZA 1VAMA 5DUXA 4XACA 1W28A 4P9XA 3WQBA 2BWCA 1LECA 5LCWL 3VBUB 1JXNA 3M70A 2OPWA 4OYUA 4QWNA 4YGBA 1PVC2 3ZYJB 3CO2A 1IZ3A 2L9LA 4PF5A 4E2GA 3AZXA 2FDFA 3AL5A 2CHHA 3JXSA 3NO8A 5AVPA 1OKQA 4RR3C 1W03A 4XABA 5F6LB 4XURA 1U5XA 5FQ0A 2WINB 2BFUL 1NZIA 5I8SA 5DUWA 4MV2A 1QXPA 2A6YA 2EAKA 1LHNA 3KV5A 4IERA 1MS3A 4RS5C 4Q8LA 2PTMA 4YGCA 4N43C 1H8TB 2Q4SA 2ZGLA 1OH4A 2PLV1 4UFJA 3MF9A 5BNNB 4DINB 3JD72 1SBDA 3IKWA 2E53A 3C7HA 1AX1A 3DPRB 5HCAA 3VDBA 3G6JB 3VD9A 1DBNA 2EIBA 4QX1A 4A3ZA 1CX1A 5FCCA 1ND3C 4XF9A 4Q8KA 1MEC1 5FPXA 5FY9A 1NQDA 3MLJA 5DQ0A 1CPNA 5C70A 1QEXA 2OVUA 3DGTA 1UZYA 1GQGA 4MH0E 1TMF3 1LAJA 2RE9A 3POIA 5FFOC 2XR4A 2P3KA 2ARAA 1ZRFA 1A6CA 3KT1A 5KBFA 1PO12 3GHMA 3URFA 1UW8A 3M7AA 2MHFA 3POBA 4WM7A 3WNXA 5FZOA 2X29A 4QKNA 5EQUA 3ZIWA 2BOIA 1WCSA 5GLVA 5J1XA 3CJIC 2ENRA 3AZVA 1Y9GA 4S2GA 4WVMB 5D21A 2VR4A 1UU5A 3QBQA 1W8OA 3N36A 2JDKA 3QLQA 4BHPA 4CEWA 1XNCA 2W9XA 5EZWA 1POV3 2P3IA 1IS6A 1W6OA 1R082 3DN7A 4NWWA 2DFBA 4XFBA 3J4UH 5DAVA 1S0IA 5C71A 2EIDA 3O0VA 4K21A 4NHMA 1KD7A 2WZR3 2QZ3A 1RUE1 2HWB1 2W1WA 5EV7A 5FV3A 4M3CA 3OG2A 3FMGA 3T08A 1GBGA 2JDHA 5D8AA 3W21A 3GALA 4MUVA 4GMP0 4QHBA 1G9CA 5CB7A 4XE9A 2GNMA 2LW8A 2H0VA 5CKMA 2GNTA 3TBDA 3R4DB 4AL9A 2ZX4A 3RWKX 4LK7A 4HMZA 4DQAA 4O61A 1HRV1 4D6QA 2XJSA 3C7EA 4IEYA 5GZEA 5I0SA 1OXCA 3MIHA 1X9PA 4QT6A 1QJX1 3CF6E 1YI7A 4CP1A 2P6CA 4X6QB 1T6GC 1XJAA 1Q43A 5EJZB 3AFKA 5FWEA 1GNHA 1TMF2 1OMIA 1W8ZA 2QDNA 2J7MA 4UFMA 3SMHA 2DVBA 2MNGA 2VW2A 2YPJA 2OPKA 2VU9A 3QH7A 4OUEA 3WW4A 1NT0A 3MW4A 4XC9A 2Z69A 1FNZA 1W2TA 2WLPA 1V70A 2BUKA 3LA7A 3VDCA 1RVF1 2ZGNA 3D8CA 2YU2A 1CAUB 2YZ4A 3ZR6A 1PK6B 4M4PA 5FO9B 1FPN1 1SBFA 2WBKA 1OQ1A 3USUA 1J83A 2IXHA 5FYVA 4GJZA 4KG8A 5FZ4A 4CA9A 1VMFA 3SH3A 4QQ2A 2XUEA 4CDQC 2A73B 5AVAA 1SFNA 2YB7A 1SDWA 3LGRA 3VKLA 4Z82A 4FBFA 2LTNA 3ZVXA 3N9QA 1NCQA 3H1WA 1P8JA 2WZR2 2IXIA 2YC4A 3MW3A 5FZHA 4AG4A 2J1SA 2JXAA 4IQPA 2WWUA 3LEIA 4X6RB 2R062 3O0XA 2SBAA 3MV11 5AFEA 1HIXA 2DYCA 1QGLA 3CNAA 3VHPA 2JKBA 2ETEA 3E97A 4UBGA 5EIYB 1ZREA 1NKGA 2K46A 5T55A 1J1LA 5FP3A 2JE8A 1NLSA 2JENA 4XFAA 5BNPC 2D98A 2XPJA 1XRUA 2VMEA 1GOFA 3ZMNA 3HQUA 3IMMA 1SG3A 2ZMNA 4OHZA 3B7MA 4QX8A 4H7MA 4EN6B 4YFZA 4IEOA 1H2LA 4R9CA 3POFA 4Y1VA 4OLLA 2V4AA 1URXA 4Q27A 2D44A 3ZFGC 3PIJA 4Y24A 3K2OA 4ZKTB 3VB9A 4IV1C 5LBBA 2PYTA 1CONA 3WG1A 4BQ1A 3RZLA 3IAQA 2Y6FA 4AEMA 3OGRA 2VW0A 4M4RA 2GDFA 5DDJ1 4ZS3A 1ODMA 3PU3A 4QPIC 2WWJA 4YGEA 1AR71 4LBQD 1XYPA 5C4WC 4FOWA 4NHYA 3AXEA 3RZKA 1EUTA 3KV4A 5KXCA 1KEXA 1UKGA 1UQXA 2DDUA 3BOPA 4QPGC 4ZY9A 5J37A 4HONA 3ZYHA 4NE9A 5C8CA 1LHOA 2BGCA 5JLVA 1C1FA 2XL7A 4AFAA 1O8PA 4HLTA 4CU8A 2HEVF 4CPBA 1RUH3 4LBLA 2ORXA 2ZEYA 1GQPA 3ACLA 2VVDA 3AP5A 5IVBA 1K12A 1W2AX 3PL0A 4QKFA 1KQRA 1OF3A 4GWMA 2RMU1 1LOCA 3ASIA 2CNAA 1BEV1 3VBRA 4Z8BA 5IVEA 1QQP2 4RSUA 3P3PA 5BUVA 4XQDA 4BJ0A 2GC3A 2VZUA 2H6CA 4LA2A 2OIIA 1BXHA 1KDKA 2HWC1 3LB9A 4OZXA 5CU1A 1LULA 4CEYB 2WYFA 1Q3EA 3D3AA 5FJKA 1QY4A 3ZYBA 4IV3B 4SBVA 3MI8A 1U5IA 4X8PA 2QE3A 5I93A 2JIGA 5IW0A 1QNWA 3C2UA 1M06G 1QKQA 3BN6A 2XJVA 2ZGMA 3NJYA 4MYEA 2GN7A 4N8MA 5FYMA 3UKVA 1CAXA 1OA3A 1UZZA 1POV0 2CWSA 3AMHA 2VMDA 1XQNA 4MADA 4AVCA 2LROA 2Z5WA 4AFBA 4K20A 1WW4A 2DCTA 3VBOB 2I74A 4QHZA 1K5JA 2D6PA 2WIIB 1FAYA 4LMFA 1ZRRA 2W87A 3ILNA 2JG8B 1CZTA 2FCTA 4NIHA 3NNMA 1H9PA 3NW4A 5A3OA 5FZEA 2EA7A 3OSDA 5EJ1B 4XHXA 4CU7A 5JMCA 1MQTC 2PAEA 3THCA 3CBNA 1UMIA 3NJZA 2WNUA 3MIBA 4AHYA 5FTTC 4UF0A 1RUH2 4CXYA 4CCKA 3VZNA 4CYDA 3OYWB 3JB8A 1TME3 3HQRA 2R071 4JDMA 5JSOA 1CIYA 3VDAA 4XQWA 3ZYFA 1AJKA 4H14A 2VMFA 3TOJA 1LHVA 1PNGA 4DRVA 3OGVA 1QXJA 2XKOA 4V1PA 3ZN4A 3NRUA 3N7MA 2BQPA 2E63A 4XJUA 5GLTA 1RJ8A 2C24A 3HNBM 1V6OA 2ET1A 3ZXFA 5HV0A 1IG0A 3IWZA 4RL7A 3H1YA 4AVSA 1ASJ3 4JGYA 4CDXA 1XXNA 2ZXQA 3PVEA 5CYYA 4D7TA 4FAGA 4XEZA 1AL21 1SFYA 1VBE1 2ZS6B 4QQLA 4LBMA 4MO3M 1GOHA 3ZSEA 3HT1A 4MGYE 2YMZA 1FV3A 4XOGA 4K9SA 2Q0AA 3AFGA 3T4HB 4Q4V1 3PVOA 4AR2A 3FHIB 3OPWA 3CZUA 1OA2A 4NRMA 3A0NA 3TWIA 1PGW2 3AKTA 1CZSA 4NHLA 3TAYA 3M3IA 1VAKA 3H7YA 2D40A 3HNMA 4ZXEA 2WNVA 3IDBB 4HETA 2BNNA 1OF4A 2PAKA 4AFMA 1X36A 3ZXJA 1N3OA 5I91A 1WMDA 4RGAA 2J1AA 2H0BA 2YGLA 2P3YA 5JOYA 1ZZCA 5KHGA 3HJRA 3GZTB 1TE1B 1W8NA 1OI6A 2WDBA 3VD5A 1WCKA 1VR3A 1QOSA 2WT1A 4QQHA 1H1MA 4QXBA 5EFUA 1JYCA 4NIDA 3OOXA 4PLOA 1AYM1 5FXVA 2EIGA 3ATGA 2C26A 3J8F3 1B35C 1SQ4A 4CE8A 5LEKA 2Q30A 5A3TA 4LKDA 1L7QA 2GC2A 3KGZA 5FY5A 4AQTA 1TEIA 1H6YA 4UWDA 4CUAA 3I3DA 3RZHA 3WUDA 5A3NA 1RHI2 4U2AA 5FY8A 4MXVA 2LS6A 5DUUA 2EAAA 5K7PA 1UY4A 2ZHKA 1GZWA 2JG9C 2UU8A 1H4HA 3AMNA 5E1RA 2BW8A 4BM8A 2WRAA 4WV8A 1HB3A 1MS1A 2GU9A 3PTYA 5DAXA 1CN1A 1OC1A 3I2DA 4L11A 4IEUA 3VBFA 1W8HA 3M1HA 3WV6A 4IE0A 2Y0OA 5FZ6A 2FBEA 1T2XA 3GCWA 2NMNA 4QAWA 3WDVA 1HXS3 1O3QA 1LRHA 4CCDA 5BNOB 1XB9A 2UWCA 3VBHC 4D69A 4N7UA 1SPPB 1YJLA 4YM3A 1C57A 1OQDA 2W1SA 3D5OA 3UK9A 3A0KA 1Q56A 4H55A 1REEA 2Y8KA 4NOTA 4AXOA 3O1UA 2X5IA 3VUOA 1NY72 3ZLIA 1G86A 1UIKA 4P00B 4QHOA 1UXZA 1DQ0A 4BLJA 5F39A 2E51A 4XMIA 1H0BA 1PZ8A 2VTXJ 4LTAA 1GZ9A 2UY8A 4EE2A 2UYAA 1ULPA 1PX4A 2O14A 3B69A 4L0PA 3PIGA 4YW3A 2XVKA 4YVWA 2K2SA 2DTYA 3FE5A 3IZOA 1W9WA 4NR1A 4Q0SA 2A71A 4MSVA 1O3TA 2RM23 3BIEA 2Q1ZB 4K7JA 3J8F2 4IDZA 3AX4A 3UGGA 3ETPA 3NV3A 1UD1A 1ULGA 3UT0A 4XFGA 4D6RA 1ULOA 4BOWA 1YXWA 1DFQA 1LESA 1QJEA 1V6JA 4DXZA 3GNEA 4AEDB 4WM8B 4ATFA 1F9KA 2A3WA 5FQ0B 3E6CC 3PTRB 2W08A 1IPKA 2V4VA 5C3PA 3W58A 1ND2C 5FZ0A 4HK9A 1US2A 2PHLA 1ZBE3 5FLHA 3TEWA 1J84A 3CQOA 3M3CA 1SBEA 2PQSA 4EYUA 2JDZA 1R093 4Z92B 1E5SA 4CUGA 2VMCA 5FYUA 4N7IA 1LHUA 1Z0HA 2CGNA 5L73A 2FD8A 3HBZA 4Y1XA 2ZGUA 5A7NA 1HB4A 5BV6A 1VMJA 2E6VA 1QIQA 1ZZBA 2OYZA 3UESA 1Q8PA 2WO3A 4OMDA 4J1XA 5FOJB 2AEZA 4BQ4A 3GBGA 3TEZA 1LTEA 3ETQA 3ZSKA 4XUOA 4Q4X1 1APNA 5EWSA 2VZRA 4OHVA 5TSWA 5C33A 5CBLA 2WA4A 4KH9A 1IKPA 3RVHA 5K0UA 1OFSA 1U12A 5DG1A 4WM7B 3WCSA 5FZCA 5FZOB 3V65A 2XBO3 1LEDA 2RM22 5F9TA 1GANA 2OX0A 5JDBA 2FDKA 1WW6A 4UFKA 1H2NA 1W0PA 3VBUC 1QH6A 1EV11 1OH3A 3P6BA 3JU9A 5CKNA 5C3QA 5JR2A 3ORJA 3AYDA 2JWPA 2ZHLA 1W6OB 1F5JA 3H3LA 1D4VB 1OT5A 2BVBA 4XTPA 2YU1A 5FPLA 3HWJA 5LRRA 3ILFA 4AEJA 1UIJA 2WQ4A 3VZOA 2CGPA 1DYOA 1YHFA 4XF1A 3I54A 1WW5A 1F8VA 2ADEA 4QX7A 2NLRA 5JSPA 1BYHA 5D8AB 1EUUA 4EZHA 2VO5A 1GLHA 1H8TC 1AHSA 1RUD1 4K8RB 1ZBE2 1QNYA 2XQRA 4D7YA 3RDIA 5IK8A 5FYYA 2BFUS 5BNNC 4JHZA 1R092 2VULA 1DZRA 2B45X 2XVGA 5FO7B 1TZOA 3DPRC 4LBNA 3KV9A 1DGWA 5L7OA 1DGRA 1UN1A 3Q8FA 2FMYA 3WQ1A 4FPLA 2JIJA 4PCRA 3KLSA 2YYOA 1PMHX 4JTNA 5LK7B 4ARYA 4FT8A 3N7JA 2PHRA 4FQ4A 1NX9A 1OOPB 3VZKA 4TN7A 3A22A 4YZ3A 5LA2A 4FTSA 2ZX0A 2C4XA 1VLNA 4NAOA 4N53A 4PI0A 4WVZA 3ZSJA 5JZGB 4QMAA 1RUF3 3AP4A 4PDWB 1QH7A 1Y3TA 1CJPA 5A33A 2D5HA 1CVNA 3OD4A 2EXHA 1E5HA 5I8YA 1F4HA 2XBO2 3ZXGA 5FZKA 3U78A 1JZ5A 2FDIA 3BKZA 2DWRA 4CDUA 4QDQA 3W5NA 3USUB 1HLCA 1HB2A 1K3IA 5C3RA 4YZ5A 5AC93 4U36A 1W06A 4XBLA 3I2FA 1EP0A 3ILRA 1FATA 3LA3A 3NNFA 3HQXA 1DDLA 4BB3A 2EXJA 1NCQB 1FYUA 5GJ6A 5C9AB 4N43A 2HBTA 3ZM8A 3HIFA 4E4SA 2VJXA 1OPMA 2CL2A 5IYYA 2C5DA 4Y4YA 3TEXA 2AC1A 3WUCA 3WDXA 2OUJA 1V6LA 4D3WA 2JICA 4XFCA 3T1LA 5I8TA 3V0AA 3ZXEA 1VBD1 1I9RA 3ZDSA 4INDA 4AHXA 3IMNA 2WYSA 4W6YA 2VOTA 5D2AA 2DU0A 3K3NA 3VKNA 4JRLA 1MZEA 5SV5A 1ENSA 4R8HA 1JYTA 3R4SA 2ES3A 2TBVA 2HYKA 3UGFA 2VMIA 4CZSA 1CR7A 5IJRA 1ZRIA 1DZQA 1LENA 1RUF2 1YQ2A 2PELA 3CJIA 3VGIA 4CP9A 4OQ8A 4NAMA 1UPIA 1LGNA 3A21A 3ZFEA 4CP2A 1Z78A 2XLFA 1CJDA 1PK6C 2WZ8A 2RS13 2JEMA 1RUNA 1GNYA 3H8XA 4WZFA 1W04A 3ZMOA 1Q8VA 1ENQA 4BK4A 2VNGA 3BOWA 4HZFA 4YM0A 5FPBA 4EN8B 5C8CB 5IVCA 1JOJA 5DAWA 3UJQA 4DB5A 1DCSA 1WLWA 2PQQA 3B02A 4ZU7A 5FPVA 5JI9A 1UY2A 5GZDA 1FOD3 3BTXA 1UMZA 1IQDC 4Y5SA 5A7WA 3UL2A 4HXCA 3I4IA 1W6QA 3WXPA 3MLKA 3H7JA 4W6WA 2WS93 4JZRA 3BPZA 2JE9A 3IM0A 5F2SA 4LLOA 3DUIA 4A7KA 3VBRB 1QJY3 3PMEA 2XUMA 3KHCA 1BBT2 1F5FA 4LJHA 2VL4A 4TXWA 2HWE3 5GZGA 1TVGA 1W0OA 2A75A 3FL7A 5GZFA 4BLIA 3I2GA 3PUIA 3VD7A 4LKEA 2XJQA 2OUHA 3RG0A 3AZWA 4HVRA 2ZOEB 1GFF2 3OUJA 1DQ6A 2G1MA 1XBFA 4WZCA 3S5QA 1NXMA 2ZKLA 2IXLA 5M0TA 2A6XA 1RUJ2 1H6XA 4LOTA 2R1DA 3UGHA 4XBNA 1CESA 4FPKA 4GULA 3S30A 1WLTA 1HRI3 1R1ZA 1W3XA 2CDOA 2RS12 4COWA 5JIAA 2QTWB 3OY8A 4EROA 1N47A 3OGGA 5FYCA 1VBA3 1VJ2A 1S2BA 4K3UA 4LO4B 1GOGA 4RD7A 5KHJA 2CYFA 5CFDB 2HWF1 3MIGA 4LKSA 2WNUB 1TME1 1BVP1 1REFA 2Y0IA 1VBC3 1ZBA1 2DCZA 1FOD2 2IFWA 1AZDA 4AQ6A 4Z1VA 4KMQA 4FPHA 5DMYA 2X05A 3RZGA 2OS2A 2WS92 2PAMA 4OUMA 1VRH1 2ZMKA 3FFZA 4EN7B 4YVSA 3E5UA 1RB8G 3CDZB 2VGDA 1QJY2 2VVEA 5GLUA 5A3MA 1D4M1 1OFNA 5A80A 4NPRA 1W2OA 3MDPA 3ZFGA 2HWE2 2ZHMA 1R083 2DV9A 2NPIA 2XVLA 1ASJ1 4K6BA 3RGBA 3RMYA 4CEYC 4XIKA 3HMYA 3KZ4C 1JOPA 3M8LA 5L9RA 4IV3C 1COV1 1ZNPA 1YCIA 1L7LA 2BNMA 5HXVA 4C0HA 4JGYB 3FLRA 4CDXB 2AEYA 1DF0A 1OVSA 3EMRA 4AI3A 1S2EA 5EYYA 1X9TA 4QPIA 3T3YA 2RJKA 3KF3A 1G6NA 3IIIA 2ET7A 5ERLA 4PI2A 4Y5TA 3OTFA 4P9GA 3JBG1 2BU9A 3K4DA 5ACA3 1REDA 1UZWA 4QDRA 3VBOC 1OKOA 4FPEA 2JDMA 2W94A 3IBMA 3I3EA 3KM5A 2VOVA 4NRPA 4Q5OA 4QPGA 4TSVA 4BQ2A 2W5FA 5LRSA 1NCRA 1HRI2 2JG8C 1YJKA 4QQOA 1FMD2 3T0AA 3O1RA 2NP0A 5A32A 1D2QA 1YQ6A 3PUSA 4HPKA 4E8CA 1DQ4A 3ENRA 5FZFA 1X33A 4P5HA 1XNAA 2CTVA 2WNVB 3WDTA 5LBEA 1VBA2 1W9YA 1WLCA 4XMAA 3M2MA 5GKAC 2KXLA 5GALA 3B5LB 3RPQA 1VBC2 2MPFA 1RXGA 1V9U1 2GC1A 1WMEA 3CZJA 2VVFA 2WR9A 1VP6A 1SCRA 2XQXA 2EXKA 4GIQA 3H8UA 1JZ3A 4PJYA 4AI0A 1DLCA 4NIGA 4AHWA 5J7MA 2GMMA 3BIWE 4ZZ8A 2VD7A 1SACA 4ASLA 1YFXA 1NAEA 1DIWA 2FMDA 4FVVA 5JMOA 4CTEA 4OFGA 1EY2A 1MZ5A 4MXWA 2WFPA 2D7FA 5FRAA 4M3CF 4A2UA 5A70A 2DBNA 2J1TA 1I1EA 1A3KA 3HNYM 4KI5M 3WF1A 4BWOA 4LHSA 2Z79A 5C7GA 3VD3A 4ET7A 1W0NA 4L99A 4Q4Y2 1GZWB 2E26A 3C7FA 1MACA 4O65A 1AR92 3S7EA 3VDDB 2QQUA 1JW6A 2HEWF 2R063 3ZYIB 4AWDA 5JXGA 1HXS1 3VBFB 1E5RA 1US3A 1NG0A 2NZ9A 3PUQA 1RUI1 2WABA 5HV4A 3A23A 5EJ3A 2P5BA 4YLZA 2PHDA 5ACA2 5FBJA 4ZU4A 3S5AA 3D0SA 4PF1A 4AAPA 1X82A 3OEBA 3SCGA 3O1SA 4ORFA 1BCXA 2B4KA 5IVVA 2WZEA 3ON7A 2IWGB 2PHWA 4UW3A 4V2VA 4I09A 2ARXA 3M4FA 4RGKA 4XUTA 3TN93 3SC7X 5FUIA 1YQ5A 2P6HA 2X5IB 4R4XA 3VHRA 5AFBA 3GDBA 1IOAA 2RR13 2JX9A 3JCIA 3UNPA 1W8FA 1SMVA 1LOEA 3FLTA 2ID4A 1AR61 2NYYA 5FBZA 2NM1A 1OLQA 2R6QA 4AOCA 4LBKA 4NHKA 3WQ0A 1LCLA 1RMU1 2E7TA 3CKHA 4AE2A 2R32A 5FOBB 3TRSB 4YVWB 2WAAA 1RYYA 1XNTA 1F35A 3LFMA 1Z7S3 5CVRA 5DG2A 3RJ2X 4AVVA 1I5ZA 2ZA9A 1O4ZA 5FZ7A 4C8DA 1TNRA 4BQXA 2FCVA 1VBB3 3WDWA 4UFLA 4FO9A 1UYXA 3H3UA 1ULFA 3R4UA 2E33A 4RQPA 3NJXA 2YY1A 3DL3A 4LO8A 4FPGA 2ZGSA 3Q8CA 4Q0UA 2BYVE 4BH9A 1DLLA 1E57A 1LHWA 3HEIA 4COYA 4LE3A 4LUKA 2E32A 1ZRDA 3I3MA 2O8QA 4FOQA 5FP8A 2HWD2 3WINE 2ZABA 1QJU1 3TB0A 1D7PM 2DCYA 5ABJB 3LOIA 1LOFC 1EPZA 4LK6A 2BERA 3NAPA 3VN4A 1QQP3 4P5YA 5BNOC 1QU0A 4QU1A 3U11A 1ZA7A 3T2TA 4XTMA 2UWAA 3OUHA 4P9JA 1NA1A 3WQ7A 2W2IA 2AYHA 4GH4A 1LGCA 1R64A 1SLIA 4RN5A 3TN92 3M3OA 2RR12 1SZBA 4XFFA 4MGQA 4HANA 2B46X 1PIV1 1EAH1 3LFIA 3VBSA 1C4RA 3WLUA 3ZXAC 4M0NA 3PUAA 2XBO1 4M00A 2RS51 5FKBA 4BE3A 4UOJA 4E8DA 5ANNA 1B35A 5K0UB 2OA2A 2VY0A 1YWKA 1NQJA 1ST8A 1UX7A 2BVVA 3WP6A 1OA4A 3WG2A 1Z7S2 4IEXA 5F3GA 4LOSA 3LIHA 1G9AA 3IPVB 5H9PA 2QQKA 3E5QA 1VBB2 2QQPA 4NPLA 4O9GA 3JQWA 1RC6A 4QX2A 5FXWA 4DEVA 3EQEA 3NKGA 1I5PA 1YFYA 3PNAA 3DXTA 3WDYA 2J42A 2CGOA 2VG9A 4URTA 4DRRA 2VZOA 4IW3A 4E2QA 4AEDC 4WM8C 1JU4A 4FFHA 3ZR5A 2JDNA 3O1PA 4JQTA 2VZ3A 4GD4A 3GZUC 2MEV1 3ZFFA 1O3SA 1RUC3 2GNBA 1R1A2 1J3PA 2AGSA 3VBHA 2RJ2A 3OGSA 2DVFA 3DYOA 1C8M1 4LA3A 4AGVA 2GMPA 2ZPXA 1NYWA 4JGZB 5BXXA 3U37A 3GCXA 2GC0A 5CISA 3VKMA 5KXEA 5IAVA 1U0AA 2O0OA 1W6MA 5FUPA 1JUIA 1WWYA 4OMCA 2P1BA 3KF5A 1QHDA 2BDRA 4G9SB 4H7LA 1BK0A 3OBRA 4XZPA 4CDWA 1WCDJ 3SH4A 4HVQA 3PLQA 1DGRN 1PVXA 3BYWA 4LQRA 3FZ3A 2H6BA 4AEKA 1TG7A 3GYDA 5JAXA 4KWLA 4N53B 4HVOA 4EN0A 1Y9MA 3PDQA 4HN0A 4WM7C 5A33B 4RGGA 2E31A 2F4LA 1T6BX 2WSUA 1ZZ8A 1F2NA 5LY2A 2QBXA 3WD5A 1WCUA 2JDYA 3DYPA 2WFF2 1H4GA 3GF6A 4KNCA 4QX0A 2YGMA 4Y3OA 4YG0A 4CDUB 3V56A 4CP0A 4E4HA 4F8AA 2VTFA 4ES9A 5AC91 2A3YA 2BJSA 1AX2A 2RJLA 5IVJA 3BU0A 1RL3A 3D6EA 2VM9A 2YHJA 4XUNA 4B4QA 2R041 4GB31 1BMV2 1O59A 1CPMA 3POEA 2VNOA 5FZGA 3MLLA 4LITA 4ZONA 4W65A 1S0EA 1BZWA 1XOYA 5LA9A 1V6MA 4DZGA 2XMLA 1RUG3 4MVTA 3KVBA 1O3RA 2IVJA 2VCMA 2WQ8A 2VECA 2QFEA 4MHUA 5D8AC 1RUC2 2HKXA 2BBAA 4YW2A 4YWAA 1JH5A 4CRQA 1JS9A 5F37A 3OUIA 2XB6C 1YFUA 1LODA 3G7DA 4I0BA 3U07A 4D94A 4CCOA 4DFSA 1MPXA 2CAUA 4NROA 4ASMB 3V0AB 3HAGA 4S2DA 4GJYA 1RHI3 3KB5A 1FI2A 4C1WA 2R16A 2VNVA 4XUPA 5C3OA 3KCYA 3KCXA 2VW1A 1E5IA 1S2KA 2R0FA 2RG4A 5HBAA 1OOPC 3OGJA 1N1SA 1AYN1 3W20A 3EBRA 4RYDA 2HEYF 4ISQA 4P9IA 3AB0A 4QGMA 4BYYA 4EZ4A 5JWPA 5JZGC 4XAAA 5FREA 2K9ZA 4PDWC 3F2ZA 2IXCA 1LEMA 5DAQA 3FHAA 2RS33 3VBUA 4XCBA 1J3RA 2EIEA 4J25A 1YUDA 2ZHNA 4GMP1 3ZFEB 2OQ7A 4HKOA 4FAHA 2QQJA 1UXXX 5DAPA 5FKCA 5FZMA 1BJQA 1LR5A 3QD6A 3O5SA 4MZUA 3J7LA 2DTWA 4E4DX 3SEEA 2FZ2A 2W68A 4A3XA 4QKBA 4YZ1A 1XE7A 3PUHA 4JC1A 1PGL1 4COUA 2CY6A 2AUYA 4JDOA 4XCAA 5CG9A 1MZFA 5C8WA 2FDJA 4HK8A 1WA4A 1XYOA 5T5JA 2IVIB 1O4YA 3P5BA 2PMWB 4YM2A 1NCQC 2XHNA 2Y6JA 4O7XA 2Y64A 5C9AC 1V6IA 1DQ1A 1RUG2 4A45A 2DUPA 5A7WB 4CVUA 3I3QA 3QH6A 1UOFA 3O0WA 4BPZA 3VD4A 1W6QB 1PHMA 1ZYBA 4XF4A 2WO1A 1PNFA 5E8AA 2XGXA 2OW4A 2PLV3 1PVC1 3AZYA 3DCQA 4UBHA 5CFCB 3I49A 1FV2A 4B4RA 2VPVA 3POGA 3Q8EA 4AVBA 2Q1MA 1QWRA 4PLNA 4UI9L 2YBPA 4B3NA 1MEC3 3K3OA 1XU1A 2Z42A 2WT2A 4H3WA 1W8WA 4P9YA 2OQ6A 4MLOA 4QXHA 3LA2A 4FFGA 5IWFA 1BKZA 2ZGKA 4XJAA 4FQZA 4YW1A 5T3NA 2W0XA 4D6SA 4DIQA 2BZDA 3UKTA 3KV6A 3VZLA 1PO22 3HT2A 1RIRA 3JD71 4E4ZA 5ISLA 1CAWA 4UYBA 4FFIA 4RA0A 5LB6A 4WVMA 5FYIA 4CCJA 4B7EA 2Y33A 5FMBA 2UURA 3HBKA 2RS32 1MS8A 4CCNA 1Q8OA 2JECA 5JOWA 2VMHA 2XJPA 2Y60A 3RFRA 4B4PA 2WAOA 1XE8A 1OUSA 1SLTA 1A78A 5A6XA 3OY8B 5CG8A 1N3QA 5HPOA 1V0AA 5DUVA 4CXXA 1H9WA 1WMXA 2QJVA 5C8CC 1PO11 5T5PA 3IB3A 4SLIA 3D0JA 2QQOA 2QNKA 1PM7A 3FBYA 2XL9A 4XAEA 2DVDA 3GHNA 5FYBA 3WP5A 3S0MA 2YXSA 1L3JA 2EALA 4B1MA 3O1VA 5FPUA 4BIFA 3MICA 1HJFA 2J1UA 5IHRA 1JHJA 1C5HA 5F5QA 2PLV2 3H1MA 3N3HA 4LUMA 1JODA 4YVSB 1R081 3VBRC 3CEWA 1N3PA 3ZX7A 1X50A 4L2NA 3NKTA 4COZA 1JI6A 2PHFA 3WSOA 2WWSA 5FZ9A 1SEFA 4GKYA 4M0HA 1MEC2 1NLQA 1V00A 2PXJA 1QDOA 1O8SA 3I8TA 1WMFA 1WGPA 3K46A 5E88A 3INAA 3AKSA 1JZ4A 4AI2A 4IESA 1JN2P 4XXPA 2WC2A 3MYXA 2R0HA 4R9AA 4QB1A 3NNLA 2CAVA 3ME2A 3KQRA 2P17A 4C90A 4AHZA 2YC2A 3LF7A 2R49A 4YYOA 2DF7A 4HOOA 1NCRB 3NL1A 1YO8A 3P3NA 1TMF1 5A7PA 3WNOA 4CXWA 2VBDA 4AZZA 3HR9A 4Y4RA 4AFDA 3MV01 1NZCA 3AMMA 3LDRA 2B7YA 4Y1UA 5FY1A 5CFDC 3KS7A 2WNUC 4XW3A 2QCSB 5LW9A 4NVPA 4JHTA 1HX6A 4JKMA 1RUE2 2HWB2 3SITA 2XJRA 4K1YA 3WVJA 2EXIA 3AKQA 4PLMA 2ADDA 2VUAA 3HPNA 1GU3A 4A6OA 2D6LX 3ZXDA 5JVVA 4AI9A 1POV1 4N9IA 1K5MA 2QUOA 2P3JA 5CNAA 4A7ZA 4V2WA 4CEWB 1ULCA 2GH2A 4MXWB 3U75A 3O1TA 1Y43B 2A6WA 2WZR1 4Y20A 1GUIA 3MPPG 3B3QE 3OB8A 1XNDA 1QJX2 2R061 3KCCA 1Q8QA 3ZN6A 2YDEA 2TNFA 1HV1A 5EPAA 4CDXC 1A8DA 4QM8A 3WOGA 1HV0A 1MR5A 5A6QA 4M3CB 3MUZ1 2Z4FA 4UXAA 1KGYA 4R52A 5SV8A 2ZGPA 2D3SA 5CIRA 3WNPA 2TUNA 5DDJ3 1NXD1 4NWVA 3GZAA 4CUCA 4YGDA 4ZHNA 1RVF2 2FHRA 3ACIA 1ZZ7A 3H42B 3OBZA 5DZFA 4GWIA 5FO8B 1FPN2 4HKWA 3BPSA 3NV1A 3WHUA 1HKDA 2W47A 2YG0A 3OCPA 1KITA 3QCWA 1ALYA 4MGSA 5FZ8A 3POWA 1WZXA 3U10A 5CADA 3BB6A 3RWNA 2VQTA 3NQHA 4LORA 4I2OA 1CQ9A 5DXDA 1S4CA 4BQ3A 5G04L 1GP6A 4MGIE 2AACA 4QB2A 2RMU3 5KR7A 2ZGOA 1IGOA 2QVSB 3K77A 1KXGA 2HJIA 4GAZA 1JU3A 1DZTA 5T50A 4CEYA 1VB4A 1SLAA 2WA3A 4RR3A 2HWC3 2QDRA 4RQPB 3LEGA 2WZPP 5T54A 3LSEA 4CPBD 5B4NA 1UCXA 2WN2A 4D8MA 1ZVFA 1NE4A 1SLLA 4DEQA 3N9LA 1HQLA 2IZWA 2W52A 3AMQA 5T52A 4RHV3 4RS5A 1OUXA 1WKYA 3AKPA 3AP7A 3HN1A 4TWTA 5F8PA 5L9BA 3VDDC 4E9KA 2JB4A 3MFAA 1TNFA 3CHXA 4OULA 2W92A 1QQP1 3VBFC 2CSGA 4AGRA 4DS0A 5DDJ2 3H8RA 4FPCA 2RDQA 1MS5A 1ND3A 1LOGA 3NAPB 4GQ7A 1BBT3 3MEPA 2A6VA 4LBQA 2ILMA 1L7RA 4GA9A 5GLWA 1AUYA 1AR72 1YLLA 4OUSA 4XVHA 3WF4A 1NA1B 3SXWA 5KHIA 3CL1A 3S6PA 4YW6A 1BLZA 4GH4B 3N9NA 2X5IC 5GZCA 1XYNA 2G9ZA 3I59A 3RZMA 3O12A 4IUGA 3GJBA 4Z07A 4WVVA 4FSJA 4LKFA 4KGGA 4NRQA 4YARA 3VZMA 3O7OA 5KXBA 2Y26A 1S0DA 3VBSB 2Q8OA 3T09A 3ZXKA 1W9SA 2ZEWA 4N90A 2I45A 2V5YA 4R4ZA 1SCSA 1RUJ3 3FBMA 1W6PA 5JXIA 4AQ2A 4YVWC 1LOAA 3RYPA 1IKQA 1UF2C 3WY6A 2Y6LA 1W9FA 3HOBA 4K40A 5FK7A 4IE7A 2RMU2 3F95A 4IEWA 1AVBA 2G19A 4XJWA 3ZPOA 1N1VA 1QOOA 3EXUA 3H0OA 3WCRA 1D0HA 3NV4A 1N1YA 1CAVA 4JRAA 4L9BA 1RUH1 2HWC2 2J1EA 4OCTA 4C0BA 5JIUA 2DU1A 2VAUA 3N4MA 1WBLA 4RHV2 5BPXA 1U5ZA 4LEJA 1AL23 3APBA 1QOTA 3AKRA 3MIEA 4LBOA 5FZ3A 3ZFFB 1YQ8A 4URAA 2JDAA 2RHPA 3MBWA 2VUJA 1ENRA 3VBHB 5ABJC 1G9DA 5H9RA 4KWKA 1FXZA 4Q4V3 1FX5A 1Q5OA 2P4EA 3CIHA 4J6GA 5CEHA 3K48A 4FTBA 2JE7A 2UYBA 3I2HA 3FHQA 4IE5A 1D0GA 4EWAA 2ZMLA 3L2HA 4EWDA 1W6MB 3E5XA 2ZX2A 1N1TA 2WKKA 4BU2A 4CDWB 1UO9A 2UY9A 2BOJA 2W3JA 5FYZA 4L97A 2K0GA 4LIVA 4PQQA 3L2YA 1LU2A 2BRTA 4HN1A 3DECA 3ALQA 3PVBB 4KBBA 3WF2A 1CAXB 4FOVA 5K0UC 1NOVA 1PGW1 4JTOA 2WJSA 2LRPA 4PBOA 5E89A 5HCHA 2PHTA 5FMOL 2VE1A 2R072 1TQ5A 4XILA 3O1OA 2LM3A 1AYM3 1NLRA 4F83A 4AAXA 4CDQA 1O4TA 1FMD3 3N7LA 4QGNA 2XONA 5EXOA 2AH2A 4I0AA 4YNIA 5J98B 2ZGTA 3VKFC 2R1BA 4LULA 3SLIA 1H2KA 2O8OA 4NN0A 1JOBA 3EB7A 4G3YC 1DU3D 3MF6A 3U0ZA 4UF0B 2YFUA 1MZ6A 4AI1A 1LOFA 3SHRA 1AL22 3K51A 1VBE2 1FT9A 4S2HA 4BZ4A 5BNPA 2BNOA 3Q9OA 1AR83 3NV2A 4IXLA 1OURA 2WSVA 1W3VA 5G05L 4LLFA 1LJ7A 2FZ1A 3IAPA 5IATA 2XXZA 1S0FA 5DPNA 3DF0A 4Q4V2 2ZZJA 4DO0A 3NWKA 3PJYA 1RHI1 3MPBA 3OEAA 4CCEA 4IGQA 4JGZC 3RMXA 3SQOA 4YW5A 4YW7A 3AJZA 4ZPIA 1YNAA 1HJGA 2P2KA 1AXZA 3ITQA 1LNSA 2JB8A 4IV1A 5JOXA 3EHKA 5KC6A 1CX4A 2D5FA 1RTVA 2R7EB 2VOKA 3FWEA 2VBPA 3LZZA 2V5DA 2YUEA 4FPYA 4Q4Y3 1AR93 1RJ7A 4YFWA 3T2OA 4DY5A 1A34A 3VZJA 1J1TA 5CZKA 1CWPA 4GZ9A 2RS31 4N53C 4XDOA 3MIDA 4ES8A 2D6MA 2VMGA 5C4WA 4LBJA 1OLME 2E9QA 5IFTA 2QQLA 3KQ4B 4YRDA 1XE0A 4D7SA 5LBCA 4CU9A 5A7SA 1AYM2 3Q8AA 1NY71 4MHRA 3N35A 4CDUC 4JV4A 2XWBB 2X8KA 4XPVA 3ROUA 1K42A 3LSDA 5LASA 2JD4A 1C8NA 3C3VA 4WM8A 4Y1ZA 4AEDA 5J48A 3LOBA 5HCBA 4EWEA 1OPOA 2I2SA 1M4WA 4ARXA 3IDEA 4QDSA 4X8NA 3V64A 1QDCA 4XQ4A 1W9TA 1G8WA 1SLCA 1WCQA 2E7AA 2DURA 2NN8A 4J1WA 1KS5A 4MG2A 2B5HA 3J8F1 3WW1A 1GICA 1VIWB 2G4IA 4UT5A 5F1RA 3WZ1A 1JMUB 1AR82 2VZ1A 3RS6A 2IUWA 3NNJA 4TTGA 2LALA 5A1FA 5FUNA 2PN5A 4DUVA 3THDA 5JPNB 1CGPA 5F5CA 1GWMA 1W99A 4AF9A 3WDUA 2VTXA 3LDBA 3MGUA 4A7YA 1ZZ6A 3I2JA 5BNQA 1VMHA 3RZJA 3MHZA 4FI9A 2ZX3A 4META 2D6KA 5F2WA 3KD4A 5IUQA 4Y33A 1V6NA 3JZVA 4HL0A 3B9IA 4Q29A 5C5TA 2DUOA 2J22A 3R6SA 5JUVA 3HVDA 2HWD3 5FR3A 2F6BA 4Q4X3 4I3PA 4ZXKA 4P08A 1CAWB 3I2IA 3SKVA 3ZOIA 5FLJA 1GWLA 2AR6A 2Q1FA 4Y22A 4B8EA 4QQPA 4HKLA 2GALA 5FY0A 3ZFEC 5GLZA 4BMEA 1CZVA 1MQTA 1ULEA 1ZX5A 1EV13 3BTAA 1UY3A 2VUCA 3ZYRA 2A1XA 2YV8A 4EV0A 1GQHA 3S57A 2HLEA 2D43A 2JD9A 2W1QA 5FAXA 4AVAA 4UAPA 1JYVA 1DYKA 3QOPA 1HDKA 1UX6A 4YG6A 1DYPA 4JKKA 1F15A 4GALA 2GN3A 3D4KA 2HH9A 4LO6B 2XH6A 4DUXA 5KWRA 2RM21 5D1IA 4I3GA 3RYKA 3GGLA 1VAVA 1XNBA 2JKXA 5KHHA 4BXSV 1AF9A 1RUD3 3U14A 5CFCC 3KT7A 1JZ8A 4I0WB 2C6SA 3SCFA 4OZOA 3R0RA 2WQZC 2WNEA 1HW5A 2BBVA 4I02A 3V0BA 3BTYA 2VXJA 5H9QA 1S0CA 1OLRA 4KG0A 5T5OA 4MX3A 5F5AA 1OOPA 2W1UA 3WNNA 1O7FA 2JJ6A 2B9UA 5JZGA 1HN0A 2VC9A 3U1XA 2OKXA 1OVPA 1GKBA 3DV8A 3SNMA 4CSWA 1ZBE1 3QACA 4PDWA 4DOUA 4MGZE 1AXKA 1R1A3 4Q4X2 1R091 4QPWA 1YFWA 4YZ2A 4CCCA 1DHKB 2LUWA 4QXKA 1NE6A 4Y26A 3DXUA 2RDRA 3ACHA 4EN9B 1IHMA 4Q0QA 1KRIA 2KA3A 1ZZ9A 5FP4A 5IAXA 2OXBA 2TEPA 1EV12 3E6DA 4C1XA 1RXFA 1DG6A 1HB1A 2C0ZA 5C9AA 5FWJA 4XDPA 3TNQA 2BTVC 2DVAA 3FUOA 4JQRA 2XKPA 1QJFA 5FLIA 1MVEA 1W6NA 4W8JA 1AJOA 3HD8B 1ONAA 3LKJA 3N9MA 4ONUA 4LIUA 2BP6A 4ZZ5A 4KQ7A 4Q0PA 4L92A 5FXZA 1PZ9A 5A7OA 5JXJA 3B9CA 3RQ0A 1RUD2 2WFF3 3CJXA 4YVSC 1K5MB 1SDDB 1S0BA 5A7QA 4KU8A 4HSLA 3WR0A 3O1MA 4MGKE 4PHZA 2IC1A 2ZBJA 1VBD3 5I0TA 4D0QA 4M3CE 4DNYA 1F31A 2JG9A 4Y20B 1X8EA 4PIXA 4CU6A 3BCWA 1BQPA 5L36A 5L7OB 2WLQA 3J7NA 2C1FA 1RINA 2A3XA 5FZLA 1O6UA 3ZN6B 3T1MA 1BK1A 5B4XA 5FDBA 3ZDVA 3WF0A 3H8OA 4Z2WA 1C5IA 2OT7A 5CKQA 5FXXA 3W9AA 1KFXL 5FP7A 3ZKYA 3KGLA 3NJVA 4F7ZA 3U4SA 4BIOA 3T2QA 4QKDA 3MIFA 2A6ZA 2RDNA 2ZGRA 4XHBA 3UKNA 3BODA 1H30A 2VQUA 3T0BA 5JPMB 3B00A 4Y5Z0 3AP9A 3EO6A 3I97A 3JB4C 3HN3A 4Y1YA 3OD0A 1MS0A 3H3ZA 3RI9A 4W6XA 3POJA 1S1AA 3ST7A 4FFFA 1NCRC 2UWBA 4Q1PA 2P34A 5FIXA 3ZPYA 2N7GA 4AGGA 4DY3A 1G9BA 5LA1A 4IGOA 3FN9A 1UU6A 1W2NA 1WUVA 2RV9A 5JSRA 5BYNA 1PM4A 3BGAA 3MFCA 1I3HA 1RUF1 2BEOA 3BALA 4RFRB 4WBBA 1RITA 2VZPA 5I0DA 1JZ2A 1IG3A 2EICA 4FP3A 2HBUA 4JCKA 3WP4A 5E6HA 3A7QA 2Y34A 2QQMA 1X7NA 2VCBA 4XDQA 3I2OA 4IEZA 1QJZA 2ZTNA 3IN9A 5LY1A 4IGPA 2VOWA 4A4AA 4TLGA 2PA7A 4JX0A 3UJOA 5T5LA 5LZ6A 2O1QA 4YG3A 2IXJA 4CEWC 1I6XA 1KS4A 1VB2A 4RR3B 5ANQA 1VBD2 1YC61 3RJRA 3WX5A 4BISA 5FY7A 4RHV1 4OHXA 2JDUA 3ZKUA 5KC5A 3VL9A 4K1ZA 2D3RA 2XLAA 3OBTA 4XFHA 1YIFA 1ND2A 2PFWA 2XJUA 4RS5B 4N43B 2OZ6A 1UL9A 4NUBA 4OHWA 3THTA 1YRZA 3SH5A 1BBT1 3K75B 3MO4A 2G9FA 3AYEA 5A3LA 3WP3A 1ND3B 1W8TA 3TYJA 1AXYA 4LBQB 3WHTA 3LPFA 1CD3G 4NPMA 4BMBA 3B01A 5L9VA 3D82A 1YYNA 3WW2A 3AZZA 1JTZX 3Q8BA 4XYXA 5CFDA 5A1LA 3AK0A 3OBAA 3I59B 1WD4A 2Q8CA 4QB6A 1UOBA 1JYXA 2HWF3 1RUJ1 4XF3A 1MS4A 5FK8A 1PO23 1RGSA 1ZBA3 4IEVA 3I2KA 1IPJA 3KVAA 5F7UA 3I7DA 3AVRA 1B09A 1XSRA 3BI3A 3CJIB 1W6PB 4CP9B 4Q4W3 4Z2AA 1UWWA 2C9AA 2YBSA 2RS11 3GBWA 1OQEA 5FMDA 1VRH3 3POYA 2VZVA 3P1IA 3U4XA 2C9KA 1F4AA 1D4M3 1LOBA 5LWBA 4XFIA 2QQIA 1ULDA 1CAVB 2GSYA 1V6KA 3IT8A 3K4ZA 3O14A 4RQPC 1FOD1 2QQVA 2ZAHA 1JBCA 3LQCA 4HG6B 4GWNA 1UU4A
chains in the Genus database with same CATH topology
5I0UA 1COV3 2D93A 4P9WA 1H8TA 2WS91 3VHNA 3USSA 2XJTA 5BNNA 2GMEA 4YZ4A 1QJY1 2B39A 5KHKA 3DPRA 3JBG3 2GNDA 2HWE1 1IS3A 3PHMA 3FFQA 4ISRA 3NAPC 1DGWX 1EYBA 3ES1A 1AL0G 4XXAA 4YSFA 1MS9A 1YI9A 4OI0A 1X8MA 1NA1C 1KDMA 3KT4A 3W59A 1G7YA 4GH4C 2DCJA 3AXDA 3ZYPA 1DQ5A 1W39A 3DKWA 4R9DA 5FPZA 4LR4A 1GZCA 2WL1A 1ZA4A 4HSJA 1XNKA 1UKRA 2HWF2 3VBSC 1C3HA 1TME2 1ZBA2 1V9U3 2Z2SB 3MZHA 4PQ9A 1HRI1 2PHUA 2V09A 2ZACA 4Q4W2 1FMD1 4XIOA 3ES4A 1VRH2 3FC0A 4FOYA 4RFT0 5F6KA 4CDQB 1VBA1 1D4M2 2V73A 2PHXA 4LHKA 1C1LA 2YROA 2A70A 1GV9A 1VBC1 1ASJ2 4LE4A 1U5YA 2VH9A 3VDDA 3RI8A 2GZWA 4XBQA 1COV2 3B94A 1AR81 4FXKB 1LGBA 1RUE3 2B42B 2HWB3 3L9JT 2XLGA 2DFCA 2P37A 5J3UA 3ZFFC 4B7KA 5BNPB 1LKNA 2D97A 2XG3A 1RUI3 3AJYA 3JBG2 3OJBA 3N7KA 4IEQA 5HI0A 1PZ7A 4QU2A 1W2UA 3ZN5A 1HRV3 5DZEA 5J09A 2YC0A 3ZFGB 2E7QA 4Q4Y1 1AR91 4IV1B 5IK5A 1QJX3 1O5UA 3H9AA 4CDWC 1QMJA 3FJSA 1AR63 2VOXA 5ACA1 4QPIB 1RMU3 1V9U2 1G9FA 1CAUA 5C4WB 4G4FA 3PVNA 1PK6A 3RSJA 4GKXA 1JYIA 2EF6A 1RVF3 4OVEA 5KXDA 1VALA 4QPGB 1WLDA 1Y9QA 3GBFA 1FPN3 3NVCA 4R9BA 4Q0VA 5FMOS 3AP6A 5A32B 2IFRA 4HPKB 3ZIXA 4XJ9A 4FPFA 3ZSMA 2QZ2A 1J58A 2DUQA 5B2GB 5K8SA 2D6OX 5ABJA 3LWCA 2WT0A 3AYAA 4HBNA 1WD3A 3LCPA 4QGLA 1WW7A 1HXS2 3TNPB 3PJQA 1QJU3 1RUI2 5IK4A 4LO7A 5GM0A 3FX3A 4FXGB 4I30A 1DQ2A 2I07B 4QM9A 1HRV2 3ELNA 2AREA 1Q8SA 1ZRCA 1S55A 4YW4A 4FTEA 4KU7A 4YM1A 3OPZA 3J26N 2HWD1 3RRDA 4JGYC 4WVWA 1H2MA 2GH8A 1AR62 1PIV3 1EAH3 1J59A 3KMHA 2ZX1A 2RS53 3AM2A 1RMU2 1GNZA 4FCAA 1KJLA 1UPSA 4XETA 5JOZA 2DVGA 3IPVA 1OD5A 4Y22B 1QF3A 3IIAA 1AR73 1J3QA 2BWAA 3TN91 3SCHA 2RR11 1MQTB 3KSCA 4NO4A 2WNVC 4UW4A 2F4PA 1SLBA 4Q1RA 1CIWA 4HT1T 3NSTA 2KM2A 1YIPA 2VXRA 5K9YA 4XJ8A 2Q5TA 1H1IA 1Z7S1 3FUQA 2R30A 2D3PA 2MEV3 2GAUA 2DCKA 1H1AA 1HQWA 4AFCA 1VBB1 4JGZA 1QJU2 1S0GA 3ZYGA 3B93A 1BEV3 1C8M3 4QX5A 3EJKA 5E16A 3S7IA 1MVQA 4JVAA 3LAGA 4IV3A 4F3JA 2AZ5A 1IS5A 1H8VA 4FPJA 4K8FA 5I0RA 3V0BB 1FNYA 4EJRA 4IETA 4KGQA 4TYSA 2IXKA 4LNVA 5CA6A 3VHOA 3OF1A 4DPNA 4IEPA 1R1A1 3CU7A 1LB2A 5L19A 4OI4A 1PIV2 4KL1A 1EAH2 4N9HA 3R05A 3VKOA 3E6BA 2XWJB 3VBOA 1UAIA 2RS52 3WW3A 1Y7BA 2FQPA 2W39A 1C28A 4E27A 3ZSLA 1QXRA 2JG8A 4PIZA 3AMPA 1OSGA 4TLFA 5CAZA 1RUOA 2Y38A 5C6CA 1S0JA 4LHNA 1XU2A 5LK5A 4BCUA 4OI2A 2R043 1GSLA 2A5ZA 3VL8A 1O5LA 4GB33 4QPYA 4AW7A 1LU1A 3OYWA 4L8QA 3ZXLA 4Q2FA 4ATEA 5BY5A 1W6NB 2ARBA 1KJRA 2B8MA 2ERFA 2VQAA 3UV9A 3WG4A 4PIYA 2WFF1 4OHYA 3AYCA 2MEV2 1B35B 1PGSA 4QD2A 2X53S 2R073 4FP2A 2XHKA 2ZKNA 2NQYA 2QKDA 4IL7A 4UW6A 3WT3A 1BEV2 1C8M2 3VV1A 3ZO0B 1BMV1 3FLPA 4KWJA 1GR3A 5EYXA 4P9LA 4B29A 2JG9B 2ATFA 2ZZQA 2ZCWA 4XF0A 5H9SA 5IT6A 1RUC1 4XJZA 1AYN3 1VBE3 4P14A 1WBFA 3IDCB 3VLBB 1IS4A 1BVVA 3BU7A 3MW2A 4LHLA 1EPWA 3RZZA 2VNRA 4Q26A 4GMP3 2D6NA 3WG3A 1AX0A 4O9EA 3M3EA 5AC92 4BA6A 4TZDA 4FPOB 2R042 4GXLA 4AYUA 4GB32 2VQ0A 4M01A 2AENA 4DMIA 5LEJA 3JQXA 3THPA 3RYRA 2OZJA 5J36A 4AVTA 5CFCA 4HFSA 1A8MA 1D2SA 2G9GA 1JUHA 1PVC3 3SISA 3M3QA 2ZJCA 1K5MC 2NMOA 4PBPA 1ZM1A 5JR7B 4I01A 2CWMA 1RUG1 1KFUL 1HQNA 3A4UA 4OI1A 1ND2B 1IQAA 2CV6A 1AYN2 5DZGA 4ZU5A 4UW5A 5JI7A 1ENXA 2BPA2 3JD73 5BNOA 3X29B 4AI8A 1O91A 5IK7A 4AK3A 3POSA 4AQSA 2EVXA 3ECQA 3H50A 4LT5A 3JUUA 3PMSA 4JDNA 5J96B 3J9SA 5L7OC 1PMIA 4JAAA 4E2SA 1DGLA 4COVA 1JHNA 1PO21 2SLIA 4ITCA 1PGL2 1PO13 4LO5B 4C91A 2A7AA 1GYKA 3RNSA 2ZGQA 2ZAAA 1OHFA 3CLPA 4Q4W1 5HCFA 4S2FA 1VAMA 5DUXA 4P9XA 2BWCA 1LECA 3VBUB 1JXNA 3M70A 4YGBA 3ZYJB 4E2GA 1PVC2 3CO2A 1IZ3A 4PF5A 3AZXA 3NO8A 5AVPA 1OKQA 4RR3C 5F6LB 1U5XA 5FQ0A 2WINB 2BFUL 5I8SA 5DUWA 4MV2A 1QXPA 2A6YA 2EAKA 1LHNA 4IERA 1MS3A 4RS5C 4Q8LA 2PTMA 4YGCA 4N43C 1H8TB 2Q4SA 2ZGLA 2PLV1 3MF9A 5BNNB 4DINB 3JD72 1SBDA 3IKWA 2E53A 1AX1A 3DPRB 5HCAA 3G6JB 1DBNA 5FCCA 1ND3C 4XF9A 4Q8KA 1MEC1 5FPXA 1NQDA 3MLJA 1CPNA 2OVUA 3DGTA 1UZYA 1GQGA 4MH0E 1TMF3 2RE9A 5FFOC 2P3KA 1ZRFA 1A6CA 3KT1A 5KBFA 1PO12 3GHMA 3URFA 1UW8A 3M7AA 2MHFA 4WM7A 3WNXA 2X29A 3ZIWA 1WCSA 5GLVA 3CJIC 2ENRA 3AZVA 4WVMB 4S2GA 3QBQA 1UU5A 4BHPA 3N36A 3QLQA 4CEWA 1XNCA 5EZWA 1POV3 2P3IA 1IS6A 1W6OA 1R082 3DN7A 4NWWA 2DFBA 4XFBA 3J4UH 1S0IA 4K21A 3O0VA 4NHMA 1KD7A 2WZR3 2QZ3A 1RUE1 2HWB1 5EV7A 4M3CA 3FMGA 1GBGA 5D8AA 3GALA 4MUVA 4GMP0 4QHBA 1G9CA 5CB7A 4XE9A 2GNMA 2H0VA 2GNTA 3TBDA 3R4DB 2ZX4A 4HMZA 4DQAA 1HRV1 2XJSA 4IEYA 5GZEA 5I0SA 3MIHA 4QT6A 1QJX1 3CF6E 1YI7A 4CP1A 4X6QB 1T6GC 1Q43A 3AFKA 1GNHA 1TMF2 1OMIA 3SMHA 2QDNA 2DVBA 2MNGA 2VW2A 2YPJA 2OPKA 2VU9A 3QH7A 3WW4A 3MW4A 2Z69A 1FNZA 2WLPA 1V70A 2BUKA 3LA7A 1RVF1 2ZGNA 3D8CA 1CAUB 2YZ4A 1PK6B 5FO9B 1FPN1 1SBFA 1OQ1A 3USUA 2IXHA 4KG8A 3SH3A 4QQ2A 4CDQC 2A73B 5AVAA 1SFNA 3LGRA 1SDWA 3VKLA 4Z82A 4FBFA 2LTNA 3ZVXA 1NCQA 3H1WA 2WZR2 3MW3A 2IXIA 4AG4A 2JXAA 4IQPA 4X6RB 2R062 3O0XA 2SBAA 5AFEA 1HIXA 2DYCA 1QGLA 3CNAA 3VHPA 2JKBA 2ETEA 3E97A 4UBGA 1ZREA 5T55A 1J1LA 5BNPC 1NLSA 2JENA 4XFAA 2D98A 2XPJA 1XRUA 3ZMNA 2ZMNA 4OHZA 3B7MA 4H7MA 4EN6B 4YFZA 4IEOA 1H2LA 4R9CA 4Y1VA 4OLLA 1URXA 4Q27A 2D44A 3ZFGC 4Y24A 4ZKTB 4IV1C 2PYTA 1CONA 3WG1A 4BQ1A 4AEMA 5DDJ1 2VW0A 2GDFA 4QPIC 4YGEA 1AR71 4LBQD 1XYPA 5C4WC 4FOWA 3AXEA 5KXCA 1UKGA 3BOPA 5J37A 4QPGC 5C8CA 1LHOA 2BGCA 5JLVA 1C1FA 2XL7A 4AFAA 4HLTA 2HEVF 1RUH3 4LBLA 3ACLA 2VVDA 3AP5A 1KQRA 4GWMA 2RMU1 1LOCA 3ASIA 2CNAA 1BEV1 3VBRA 4Z8BA 1QQP2 4RSUA 3P3PA 5BUVA 4XQDA 2GC3A 4LA2A 2H6CA 2OIIA 1BXHA 1KDKA 2HWC1 3LB9A 4OZXA 5CU1A 1LULA 4CEYB 1Q3EA 1QY4A 4IV3B 4SBVA 3MI8A 1U5IA 4X8PA 2QE3A 5I93A 1QNWA 3C2UA 1M06G 1QKQA 3UKVA 2XJVA 2ZGMA 4MYEA 2GN7A 1CAXA 1OA3A 1UZZA 1POV0 2CWSA 3AMHA 4AVCA 1XQNA 2Z5WA 4AFBA 4K20A 1WW4A 2DCTA 3VBOB 2I74A 2D6PA 2WIIB 1FAYA 1ZRRA 3ILNA 2JG8B 1H9PA 3NW4A 2EA7A 4XHXA 5JMCA 1MQTC 2PAEA 3NJZA 2WNUA 3MIBA 4AHYA 5FTTC 1RUH2 3VZNA 4CYDA 3OYWB 3JB8A 1TME3 2R071 4JDMA 5JSOA 4XQWA 1AJKA 4H14A 3TOJA 1LHVA 1PNGA 4DRVA 1QXJA 2XKOA 4V1PA 3ZN4A 3N7MA 2BQPA 2E63A 4XJUA 5GLTA 1RJ8A 1V6OA 2ET1A 3ZXFA 3IWZA 4RL7A 3H1YA 4AVSA 1ASJ3 4JGYA 4CDXA 1XXNA 3PVEA 4FAGA 4D7TA 4XEZA 1AL21 1SFYA 1VBE1 2ZS6B 4QQLA 4LBMA 3ZSEA 3HT1A 4MGYE 2YMZA 1FV3A 4XOGA 4K9SA 2Q0AA 3AFGA 4Q4V1 3PVOA 3FHIB 1OA2A 3A0NA 3TWIA 1PGW2 3AKTA 4NHLA 3TAYA 3M3IA 1VAKA 3H7YA 2D40A 2WNVA 3IDBB 4HETA 2BNNA 2PAKA 4AFMA 1X36A 3ZXJA 1N3OA 5I91A 1WMDA 4RGAA 2H0BA 2YGLA 5JOYA 1ZZCA 5KHGA 3GZTB 1TE1B 1OI6A 1WCKA 1VR3A 1QOSA 2WT1A 4QQHA 1H1MA 5EFUA 1JYCA 4PLOA 1AYM1 2EIGA 3ATGA 3J8F3 5LEKA 1B35C 1SQ4A 2Q30A 3KGZA 2GC2A 4AQTA 1TEIA 3WUDA 1RHI2 4U2AA 4MXVA 5DUUA 5K7PA 2EAAA 2ZHKA 1GZWA 2JG9C 2UU8A 1H4HA 3AMNA 5E1RA 2BW8A 4BM8A 4WV8A 1MS1A 2GU9A 3PTYA 3VBFA 1CN1A 4L11A 3I2DA 5I8YA 4IEUA 3WV6A 3M1HA 2Y0OA 2FBEA 2NMNA 3WDVA 1HXS3 1O3QA 1LRHA 5BNOB 3VBHC 2UWCA 4D69A 4N7UA 1YJLA 4YM3A 1C57A 1OQDA 3D5OA 3UK9A 3A0KA 1Q56A 4H55A 1REEA 4NOTA 4AXOA 2X5IA 3VUOA 1NY72 1G86A 1UIKA 4BLJA 1DQ0A 2E51A 4XMIA 1H0BA 1PZ8A 4LTAA 1GZ9A 2UY8A 2UYAA 3B69A 4YW3A 2XVKA 4YVWA 2K2SA 2DTYA 3FE5A 4NR1A 4Q0SA 2A71A 4MSVA 1O3TA 2RM23 2Q1ZB 4K7JA 3J8F2 3AX4A 3NV3A 1UD1A 1ULGA 4XFGA 4BOWA 1YXWA 1DFQA 1LESA 1V6JA 4DXZA 3GNEA 4AEDB 4WM8B 4ATFA 1F9KA 2A3WA 5FQ0B 3E6CC 2W08A 1IPKA 3W58A 1ND2C 4HK9A 2PHLA 1ZBE3 5FLHA 3M3CA 1SBEA 2JDZA 1R093 4Z92B 4N7IA 1LHUA 1Z0HA 2CGNA 5L73A 3HBZA 4Y1XA 2ZGUA 5BV6A 2E6VA 1ZZBA 2OYZA 1Q8PA 4J1XA 5FOJB 3GBGA 1LTEA 3ETQA 3ZSKA 4Q4X1 1APNA 5EWSA 4OHVA 5C33A 5TSWA 5CBLA 2WA4A 4KH9A 1IKPA 5K0UA 1OFSA 1U12A 5DG1A 4WM7B 3WCSA 3V65A 2XBO3 1LEDA 2RM22 5F9TA 1GANA 5JDBA 1WW6A 1H2NA 1W0PA 3VBUC 1QH6A 1EV11 3JU9A 3AYDA 2ZHLA 1W6OB 1F5JA 1D4VB 2BVBA 4XTPA 3HWJA 5LRRA 3ILFA 4AEJA 1UIJA 2WQ4A 3VZOA 2CGPA 1YHFA 4XF1A 3I54A 1WW5A 1F8VA 2NLRA 5JSPA 1BYHA 5D8AB 1GLHA 1H8TC 1AHSA 1RUD1 4D7YA 1ZBE2 1QNYA 5IK8A 3RDIA 2BFUS 5BNNC 1R092 2VULA 1DZRA 2B45X 2XVGA 5FO7B 3DPRC 4LBNA 1DGWA 5L7OA 1DGRA 1UN1A 3WQ1A 2FMYA 4FPLA 4PCRA 3KLSA 2YYOA <