2DW0A

Crystal structure of vap2 from crotalus atrox venom (form 2-1 crystal)
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
414
structure length
414
Chain Sequence
PFRFVELVLVVDKAMVTKNNGDLDKIKTRMYEIVNTVNEIYRYMYIHVALVGLEIWSNEDKITVKPEAGYTLNAFGEWRKTDLLTRKKHDNAQLLTAIDLDRVIGLAYVGSMCHPKRSTGIIQDYSEINLVVAVIMAHEMGHNLGINHDSGYCSCGDYACIMRPEISPEPSTFFSNCSYFECWDFIMNHNPECILNEPLGTDIISPPVCGNELLEVGEECDCGTPENCQNECCDAATCKLKSGSQCGHGDCCEQCKFSKSGTECRASMSECDPAEHCTGQSSECPADVFHKNGQPCLDNYGYCYNGNCPIMYHQCYDLFGADVYEAEDSCFERNQKGNYYGYCRKENGNKIPCAPEDVKCGRLYCKDNSPGQNNPCKMFYSNEDEHKGMVLPGTKCADGKVCSNGHCVDVATAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catrocollastatin
publication title Crystal structures of catrocollastatin/VAP2B reveal a dynamic, modular architecture of ADAM/adamalysin/reprolysin family proteins
pubmed doi rcsb
molecule tags Apoptosis, toxin
total genus 126
structure length 414
sequence length 414
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00200 Disintegrin Disintegrin
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
A PF08516 ADAM_CR ADAM cysteine-rich
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2dw0A01
4GF1A 3HY7A 1BIWA 1B8YA 3P1VA 1MMRA 4WKIA 1JIWP 1XFVA 1A85A 2CLTA 1I73A 3TSKA 3L0VA 1C7KA 4GR0A 1ATLA 1MNCA 3U1RA 4HX3A 1UEAA 3AIGA 1ZS0A 1MMQA 1R1JA 3DL1A 1UMSA 2MZIA 4Q1LA 1HTDA 3UVCA 4DD8A 1K7IA 2I47A 4H82A 1IAEA 3EHYA 1BM6A 1CGLA 4H2EA 1JIZA 5LABA 3LMCA 2W0DA 3RTSA 1IABA 4G9LA 1HFCA 1R1IA 2V4BA 4JQGA 2W15A 1PWPA 3CKIA 3P24A 4JP4A 1C3IA 2WOAA 1GKDA 4GWNA 3G42A 1R1HA 1YP1A 3EDIA 2XS3A 1ZVXA 1OM6A 3EDHA 4IUWA 4J4MA 3I7IA 5D2BA 1QJIA 1QUAA 3L0TA 1UMTA 1J7NA 3EDGA 1CGFA 3DWBA 4H49A 4PKWA 3F17A 1JAQA 4JIJA 2D1NA 2OVXA 5BPAA 1UTTA 2WO9A 2KRJA 1HV5A 1PWQA 2YB9A 3EDZA 3LJGA 1D5JA 4ZR5A 3RTTA 5I2ZA 3LUMA 3OHLA 2AYKA 1XFUA 4A3WA 4PKRA 3F15A 2QPJA 3O2XA 2OXUA 1BUDA 1EAKA 1ASTA 3LILA 4H84A 1BSWA 2D1OA 1KUIA 2OXWA 4AXQA 1SU3A 3KECA 2N8RA 4DF9A 1JK3A 1QIBA 4JPAA 2JT5A 1SLNA 3SHIA 4JA1A 5B5OA 1G9KA 1JJ9A 4WK7A 1H71P 1CGEA 1UTZA 1MMPA 2ERQA 4DV8A 3KEKA 1S4BP 1Q3AA 3Q2HA 4H3XA 4HMAA 1R55A 1BQQM 2JSDA 1GE5A 2K9CA 3ZUKA 3AYKA 1SRPA 4I03A 3KHIA 5CZMA 4AYKA 2EROA 4H30A 4GR8A 1Y93A 456CA 5BOTA 3LUNA 3LIRA 3O64A 2OI0A 3N2VA 1BKCA 5L7FA 1YCMA 3LEAA 4FXQA 1XFXA 2HU6A 4FVLA 4WKEA 966CA 1RM8A 3N2UA 2E2DA 1QJJA 3VTGA 1OO9A 3G5CA 2X7MA 3K7LA 1I76A 1PWWA 5L79A 1QIAA 1A86A 5D1TA 2SRTA 1JH1A 2RJPA 1L6JA 1MMBA 5D1SA 1XURA 3DNGA 2DDFA 1B3DA 2TCLA 4I35A 5CXAA 3LQBA 1ZXCA 2J83A 3ZVSA 1BQOA 3KMEA 2J0TA 1JANA 2Y6DA 1OM7A 1D8FA 1HOVA 1AYKA 3KRYA 1HFSA 1HY7A 1YOUA 4GUYA 5I12A 1K7GA 3BA0A 4PKTA 4CTHA 4XBHA 3B8ZA 3GBOA 1JKYA 1ZXVA 4IJOA 1BZSA 1D7XA 4DPEA 3LE9A 3AYUA 3B2ZA 2K2GA 3V96B 2MLSA 3NX7A 3WV3A 4FU4A 1BKCE 1Y0VA 2JNPA 3F16A 3LGPA 2JT6A 1KUGA 2W14A 2X3BA 4XM8A 3HY9A 3ZXHA 1KUHA 1FM1A 1KUKA 5I43A 3DSLA 1O0TA 2USNA 1GE6A 1OS9A 2CKIA 2OXZA 2OVZA 1ROSA 1BUVM 1GKCA 2FV5A 4L19A 1Y8JA 5CUHA 3DPEA 3ELMA 2W12A 3LQ0A 2DW0A 2Y6CA 2O3EA 1CK7A 3TT4A 1GO8P 1WNIA 1G05A 2JIHA 1EB6A 1FBLA 1Z3JA 2MZHA 2POJA 1ND1A 3F19A 3EHXA 1PWUA 1DMTA 1C8TA 1CXVA 3LIKA 5JMYA 3HB2P 1JAPA 4PKSA 2OY2A 2OZRA 2E3XA 4R3VA 1ZP5A 1USNA 4L6TA 4IN9A 4PKQA 3OHOA 1KAPP 3K7NA 5H8XA 3LJTA 4XCTA 3B92A 4XM6A 5D7WA 1G12A 4PKUA 4H1QA 2XS4A 1EUBA 1FLSA 2W13A 2OW2A 4L63A 1YQYA 1G49A 3Q2GA 4AIGA 3HBUP 1SMPA 1XFYA 1O0QA 3MA2A 1GO7P 5I3MA 3LK8A 4QKZA 3HBVP 2O36A 3F1AA 1SLMA 1D8MA 1CAQA 3F18A 3LJZA 1IAGA 2OW1A 1IADA 1RMZA 4ILWD 2MZEA 2PJTA 4WZVA 1OM8A 3HDAP 4GQLA 1ZTQA 830CA 2ERPA 2A8HA 5B5PA 1I1IP 2YIGA 4PKVA 3EWJA 2OW9A 4GWMA 5I4OA 2RJQA 2OW0A 4EFSA 2L0RA 2Z2DA 3USNA 2OY4A 3TS4A 2DW2A 1OMJA 1SATA 2MLRA 2X3AA 3HDBA 3WV2A 3WV1A 4ON1A 1KBCA 1OS2A 4H76A 1PWVA 4GR3A 1BKCI 1IAAA 4FXYP 1DTHA 5D3CA 2WO8A 5I0LA 1XUCA 3KEJA 1AKLA 1CIZA 1G4KA 3DPFA 1IACA 5BOYA 3E8RA 4WF6A 3I7GA 1K7QA 3HYGA 1AF0A 4AUOA 2X3CA 3VI1A 1JAOA 1CQRA 2FV9A 1GXDA 2DW1A 2AIGP 5D1UA 4A7BA 3TVCA 1XFZA 1R54A 4XM7A 3KWVC 1KUFA 3KMCA 3LKAA 1GE7A 2DDYA 1XFWA 1QICA 1XUDA 4G0DA
chains in the Genus database with same CATH superfamily
4GF1A 3HY7A 1BIWA 1B8YA 3P1VA 1MMRA 4WKIA 1JIWP 1XFVA 1A85A 2CLTA 1I73A 3TSKA 3L0VA 1C7KA 4GR0A 1ATLA 1MNCA 3U1RA 4HX3A 1UEAA 3AIGA 1ZS0A 1MMQA 1R1JA 3DL1A 1UMSA 2MZIA 4Q1LA 1HTDA 3UVCA 4DD8A 1K7IA 2I47A 4H82A 1IAEA 3EHYA 1BM6A 1CGLA 4H2EA 4L7AA 1JIZA 5LABA 3LMCA 2W0DA 1TVIA 3RTSA 1IABA 4G9LA 1HFCA 1R1IA 2V4BA 4JQGA 2W15A 1PWPA 3CKIA 3P24A 4JP4A 1C3IA 2WOAA 1GKDA 4GWNA 3G42A 1R1HA 1YP1A 3EDIA 2XS3A 1ZVXA 1OM6A 3EDHA 4IUWA 4J4MA 3I7IA 5D2BA 1QJIA 1QUAA 3L0TA 1UMTA 1J7NA 3EDGA 1CGFA 3DWBA 4H49A 4PKWA 3F17A 1JAQA 4JIJA 2D1NA 2OVXA 5BPAA 1UTTA 2WO9A 2KRJA 1HV5A 1PWQA 2YB9A 3EDZA 3LJGA 1D5JA 4ZR5A 3RTTA 5I2ZA 3LUMA 3OHLA 2AYKA 1XFUA 4A3WA 4PKRA 3F15A 2QPJA 3O2XA 2OXUA 1BUDA 1EAKA 1ASTA 3LILA 4H84A 1BSWA 2D1OA 1KUIA 2OXWA 4AXQA 1SU3A 3KECA 2N8RA 4DF9A 1JK3A 1QIBA 4JPAA 2JT5A 1SLNA 3SHIA 4JA1A 5B5OA 1G9KA 1JJ9A 4WK7A 1H71P 1CGEA 1UTZA 2YUFA 1MMPA 2ERQA 4DV8A 3KEKA 1S4BP 1Q3AA 3Q2HA 4H3XA 4HMAA 1R55A 1BQQM 2JSDA 1GE5A 2K9CA 3ZUKA 3AYKA 1SRPA 4I03A 3KHIA 1OZ9A 5CZMA 4AYKA 2EROA 4H30A 4GR8A 1Y93A 456CA 5BOTA 3LUNA 3LIRA 3O64A 2OI0A 3N2VA 1BKCA 5L7FA 1YCMA 3LEAA 4FXQA 1XFXA 2HU6A 4FVLA 4WKEA 966CA 1RM8A 3N2UA 2E2DA 1QJJA 3VTGA 1OO9A 3G5CA 2X7MA 3K7LA 1I76A 1PWWA 5L79A 1QIAA 1A86A 3DTIA 5D1TA 2SRTA 1JH1A 2RJPA 1L6JA 1MMBA 5D1SA 1XURA 3DNGA 2DDFA 1B3DA 2TCLA 4I35A 5CXAA 3LQBA 1ZXCA 2J83A 3ZVSA 1BQOA 3KMEA 2J0TA 1JANA 2Y6DA 1OM7A 1D8FA 1HOVA 1AYKA 3KRYA 1HFSA 1HY7A 1YOUA 4GUYA 5I12A 1K7GA 3BA0A 4PKTA 4CTHA 4XBHA 3B8ZA 3GBOA 1JKYA 1ZXVA 4IJOA 1BZSA 1D7XA 4DPEA 3LE9A 3AYUA 3B2ZA 2K2GA 3V96B 2MLSA 3NX7A 3WV3A 4FU4A 1BKCE 1Y0VA 2JNPA 3F16A 3LGPA 2JT6A 1KUGA 2W14A 2X3BA 4XM8A 3HY9A 3ZXHA 1KUHA 1FM1A 1KUKA 5I43A 3DSLA 1O0TA 2USNA 1GE6A 1OS9A 2CKIA 2OXZA 2OVZA 1ROSA 1BUVM 1GKCA 2FV5A 4L19A 1Y8JA 5CUHA 3DPEA 3ELMA 2W12A 3LQ0A 2DW0A 2Y6CA 2O3EA 1CK7A 3TT4A 1GO8P 1WNIA 1G05A 2JIHA 1EB6A 1FBLA 1Z3JA 2MZHA 2POJA 1ND1A 3F19A 3EHXA 1PWUA 1DMTA 1C8TA 1CXVA 3LIKA 5JMYA 1XAXA 3HB2P 1JAPA 4PKSA 2OY2A 2OZRA 2E3XA 4R3VA 1ZP5A 1USNA 4L6TA 4IN9A 4PKQA 3DTEA 3OHOA 1KAPP 3K7NA 5H8XA 3LJTA 4XCTA 3B92A 4XM6A 5D7WA 1G12A 4PKUA 4H1QA 2XS4A 1EUBA 1FLSA 2W13A 2OW2A 4L63A 1YQYA 1G49A 3Q2GA 4AIGA 3HBUP 1SMPA 1XFYA 1O0QA 3MA2A 1GO7P 5I3MA 3LK8A 4QKZA 3HBVP 2O36A 3F1AA 1SLMA 1D8MA 1CAQA 3F18A 3LJZA 1IAGA 2OW1A 1IADA 1RMZA 4ILWD 2MZEA 2PJTA 4WZVA 1OM8A 3HDAP 4GQLA 1ZTQA 830CA 2ERPA 2A8HA 5B5PA 1I1IP 2YIGA 4PKVA 3EWJA 2OW9A 4GWMA 5I4OA 2RJQA 2OW0A 4EFSA 2L0RA 2Z2DA 3USNA 2OY4A 3TS4A 2DW2A 1OMJA 1SATA 3DTKA 2MLRA 2X3AA 3HDBA 3WV2A 3WV1A 4ON1A 1KBCA 1OS2A 4H76A 1PWVA 1XM5A 4GR3A 1BKCI 1IAAA 4FXYP 1DTHA 5D3CA 2WO8A 5I0LA 1XUCA 3KEJA 1AKLA 1CIZA 1G4KA 3DPFA 1IACA 5BOYA 3E8RA 4WF6A 3I7GA 1K7QA 3HYGA 1AF0A 4AUOA 2X3CA 3VI1A 1JAOA 1CQRA 2FV9A 1GXDA 2DW1A 2AIGP 5D1UA 4A7BA 3TVCA 1XFZA 1R54A 4XM7A 3KWVC 1KUFA 3KMCA 3LKAA 1GE7A 2DDYA 1XFWA 1QICA 1XUDA 4G0DA
chains in the Genus database with same CATH topology
4GF1A 3HY7A 1BIWA 1B8YA 3P1VA 1MMRA 4WKIA 1JIWP 1XFVA 1A85A 2CLTA 1I73A 3TSKA 3L0VA 1C7KA 4GR0A 1ATLA 1MNCA 3U1RA 4HX3A 1UEAA 3AIGA 1ZS0A 1MMQA 1R1JA 3DL1A 1UMSA 2MZIA 4Q1LA 1HTDA 3UVCA 4DD8A 1K7IA 2I47A 4H82A 1IAEA 3EHYA 1BM6A 1CGLA 4H2EA 4L7AA 1JIZA 5LABA 3LMCA 2W0DA 3RTSA 1IABA 4G9LA 1HFCA 1R1IA 2V4BA 4JQGA 2W15A 1PWPA 3CKIA 3P24A 4JP4A 1C3IA 2WOAA 1GKDA 4GWNA 3G42A 1R1HA 1YP1A 3EDIA 2XS3A 1ZVXA 1OM6A 3EDHA 4IUWA 4J4MA 3I7IA 5D2BA 1QJIA 1QUAA 3L0TA 1UMTA 1J7NA 3EDGA 1CGFA 3DWBA 4H49A 4PKWA 3F17A 1JAQA 4JIJA 2D1NA 2OVXA 5BPAA 1UTTA 2WO9A 2KRJA 1HV5A 1PWQA 2YB9A 3EDZA 3LJGA 1D5JA 4ZR5A 3RTTA 5I2ZA 3LUMA 3OHLA 2AYKA 1XFUA 4A3WA 4PKRA 3F15A 2QPJA 3O2XA 2OXUA 1BUDA 1EAKA 1ASTA 3LILA 4H84A 1BSWA 2D1OA 1KUIA 2OXWA 4AXQA 1SU3A 3KECA 2N8RA 4DF9A 1JK3A 1QIBA 4JPAA 2JT5A 1SLNA 3SHIA 4JA1A 5B5OA 1G9KA 1JJ9A 4WK7A 1H71P 1CGEA 1UTZA 2YUFA 1MMPA 2ERQA 4DV8A 3KEKA 1S4BP 1Q3AA 3Q2HA 4H3XA 4HMAA 1R55A 1BQQM 2JSDA 1GE5A 2K9CA 3ZUKA 3AYKA 1SRPA 4I03A 3KHIA 5CZMA 4AYKA 2EROA 4H30A 4GR8A 1Y93A 456CA 5BOTA 3LUNA 3LIRA 3O64A 2OI0A 3N2VA 1BKCA 5L7FA 1YCMA 3LEAA 4FXQA 1XFXA 2HU6A 4FVLA 4WKEA 966CA 1RM8A 3N2UA 2E2DA 1QJJA 3VTGA 1OO9A 3G5CA 2X7MA 3K7LA 1I76A 1PWWA 5L79A 1QIAA 1A86A 3DTIA 5D1TA 2SRTA 1JH1A 2RJPA 1L6JA 1MMBA 5D1SA 1XURA 3DNGA 2DDFA 1B3DA 2TCLA 4I35A 5CXAA 3LQBA 1ZXCA 2J83A 3ZVSA 1BQOA 3KMEA 2J0TA 1JANA 2Y6DA 1OM7A 1D8FA 1HOVA 1AYKA 3KRYA 1HFSA 1HY7A 1YOUA 4GUYA 5I12A 1K7GA 3BA0A 4PKTA 4CTHA 4XBHA 3B8ZA 3GBOA 1JKYA 1ZXVA 4IJOA 1BZSA 1D7XA 4DPEA 3LE9A 3AYUA 3B2ZA 2K2GA 3V96B 2MLSA 3NX7A 3WV3A 4FU4A 1BKCE 1Y0VA 2JNPA 3F16A 3LGPA 2JT6A 1KUGA 2W14A 2X3BA 4XM8A 3HY9A 3ZXHA 1KUHA 1FM1A 1KUKA 5I43A 3DSLA 1O0TA 2USNA 1GE6A 1OS9A 2CKIA 2OXZA 2OVZA 1ROSA 1BUVM 1GKCA 2FV5A 4L19A 1Y8JA 5CUHA 3DPEA 3ELMA 2W12A 3LQ0A 2DW0A 2Y6CA 2O3EA 1CK7A 3TT4A 1GO8P 1WNIA 1G05A 2JIHA 1EB6A 1FBLA 1Z3JA 2MZHA 2POJA 1ND1A 3F19A 3EHXA 1PWUA 1DMTA 1C8TA 1CXVA 3LIKA 5JMYA 3HB2P 1JAPA 4PKSA 2OY2A 2OZRA 2E3XA 4R3VA 1ZP5A 1USNA 4L6TA 4IN9A 4PKQA 3DTEA 3OHOA 1KAPP 3K7NA 5H8XA 3LJTA 4XCTA 3B92A 4XM6A 5D7WA 1G12A 4PKUA 4H1QA 2XS4A 1EUBA 1FLSA 2W13A 2OW2A 4L63A 1YQYA 1G49A 3Q2GA 4AIGA 3HBUP 1SMPA 1XFYA 1O0QA 3MA2A 1GO7P 5I3MA 3LK8A 4QKZA 3HBVP 2O36A 3F1AA 1SLMA 1D8MA 1CAQA 3F18A 3LJZA 1IAGA 2OW1A 1IADA 1RMZA 4ILWD 2MZEA 2PJTA 4WZVA 1OM8A 3HDAP 4GQLA 1ZTQA 830CA 2ERPA 2A8HA 5B5PA 1I1IP 2YIGA 4PKVA 3EWJA 2OW9A 4GWMA 5I4OA 2RJQA 2OW0A 4EFSA 2L0RA 2Z2DA 3USNA 2OY4A 3TS4A 2DW2A 1OMJA 1SATA 3DTKA 2MLRA 2X3AA 3HDBA 3WV2A 3WV1A 4ON1A 1KBCA 1OS2A 4H76A 1PWVA 4GR3A 1BKCI 1IAAA 4FXYP 1DTHA 5D3CA 2WO8A 5I0LA 1XUCA 3KEJA 1AKLA 1CIZA 1G4KA 3DPFA 1IACA 5BOYA 3E8RA 4WF6A 3I7GA 1K7QA 3HYGA 1AF0A 4AUOA 2X3CA 3VI1A 1JAOA 1CQRA 2FV9A 1GXDA 2DW1A 2AIGP 5D1UA 4A7BA 3TVCA 1XFZA 1R54A 4XM7A 3KWVC 1KUFA 3KMCA 3LKAA 1GE7A 2DDYA 1XFWA 1QICA 1XUDA 4G0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GF1 A;  3HY7 A;  1BIW A;  1B8Y A;  3P1V A;  1MMR A;  4WKI A;  1JIW P;  1XFV A;  1A85 A;  2CLT A;  1I73 A;  3TSK A;  3L0V A;  1C7K A;  4GR0 A;  1ATL A;  1MNC A;  3U1R A;  4HX3 A;  1UEA A;  3AIG A;  1ZS0 A;  1MMQ A;  1R1J A;  3DL1 A;  1UMS A;  2MZI A;  4Q1L A;  1HTD A;  3UVC A;  4DD8 A;  1K7I A;  2I47 A;  4H82 A;  1IAE A;  3EHY A;  1BM6 A;  1CGL A;  4H2E A;  1JIZ A;  5LAB A;  3LMC A;  2W0D A;  3RTS A;  1IAB A;  4G9L A;  1HFC A;  1R1I A;  2V4B A;  4JQG A;  2W15 A;  1PWP A;  3CKI A;  3P24 A;  4JP4 A;  1C3I A;  2WOA A;  1GKD A;  4GWN A;  3G42 A;  1R1H A;  1YP1 A;  3EDI A;  2XS3 A;  1ZVX A;  1OM6 A;  3EDH A;  4IUW A;  4J4M A;  3I7I A;  5D2B A;  1QJI A;  1QUA A;  3L0T A;  1UMT A;  1J7N A;  3EDG A;  1CGF A;  3DWB A;  4H49 A;  4PKW A;  3F17 A;  1JAQ A;  4JIJ A;  2D1N A;  2OVX A;  5BPA A;  1UTT A;  2WO9 A;  2KRJ A;  1HV5 A;  1PWQ A;  2YB9 A;  3EDZ A;  3LJG A;  1D5J A;  4ZR5 A;  3RTT A;  5I2Z A;  3LUM A;  3OHL A;  2AYK A;  1XFU A;  4A3W A;  4PKR A;  3F15 A;  2QPJ A;  3O2X A;  2OXU A;  1BUD A;  1EAK A;  1AST A;  3LIL A;  4H84 A;  1BSW A;  2D1O A;  1KUI A;  2OXW A;  4AXQ A;  1SU3 A;  3KEC A;  2N8R A;  4DF9 A;  1JK3 A;  1QIB A;  4JPA A;  2JT5 A;  1SLN A;  3SHI A;  4JA1 A;  5B5O A;  1G9K A;  1JJ9 A;  4WK7 A;  1H71 P;  1CGE A;  1UTZ A;  1MMP A;  2ERQ A;  4DV8 A;  3KEK A;  1S4B P;  1Q3A A;  3Q2H A;  4H3X A;  4HMA A;  1R55 A;  1BQQ M;  2JSD A;  1GE5 A;  2K9C A;  3ZUK A;  3AYK A;  1SRP A;  4I03 A;  3KHI A;  5CZM A;  4AYK A;  2ERO A;  4H30 A;  4GR8 A;  1Y93 A;  456C A;  5BOT A;  3LUN A;  3LIR A;  3O64 A;  2OI0 A;  3N2V A;  1BKC A;  5L7F A;  1YCM A;  3LEA A;  4FXQ A;  1XFX A;  2HU6 A;  4FVL A;  4WKE A;  966C A;  1RM8 A;  3N2U A;  2E2D A;  1QJJ A;  3VTG A;  1OO9 A;  3G5C A;  2X7M A;  3K7L A;  1I76 A;  1PWW A;  5L79 A;  1QIA A;  1A86 A;  5D1T A;  2SRT A;  1JH1 A;  2RJP A;  1L6J A;  1MMB A;  5D1S A;  1XUR A;  3DNG A;  2DDF A;  1B3D A;  2TCL A;  4I35 A;  5CXA A;  3LQB A;  1ZXC A;  2J83 A;  3ZVS A;  1BQO A;  3KME A;  2J0T A;  1JAN A;  2Y6D A;  1OM7 A;  1D8F A;  1HOV A;  1AYK A;  3KRY A;  1HFS A;  1HY7 A;  1YOU A;  4GUY A;  5I12 A;  1K7G A;  3BA0 A;  4PKT A;  4CTH A;  4XBH A;  3B8Z A;  3GBO A;  1JKY A;  1ZXV A;  4IJO A;  1BZS A;  1D7X A;  4DPE A;  3LE9 A;  3AYU A;  3B2Z A;  2K2G A;  3V96 B;  2MLS A;  3NX7 A;  3WV3 A;  4FU4 A;  1BKC E;  1Y0V A;  2JNP A;  3F16 A;  3LGP A;  2JT6 A;  1KUG A;  2W14 A;  2X3B A;  4XM8 A;  3HY9 A;  3ZXH A;  1KUH A;  1FM1 A;  1KUK A;  5I43 A;  3DSL A;  1O0T A;  2USN A;  1GE6 A;  1OS9 A;  2CKI A;  2OXZ A;  2OVZ A;  1ROS A;  1BUV M;  1GKC A;  2FV5 A;  4L19 A;  1Y8J A;  5CUH A;  3DPE A;  3ELM A;  2W12 A;  3LQ0 A;  2DW0 A;  2Y6C A;  2O3E A;  1CK7 A;  3TT4 A;  1GO8 P;  1WNI A;  1G05 A;  2JIH A;  1EB6 A;  1FBL A;  1Z3J A;  2MZH A;  2POJ A;  1ND1 A;  3F19 A;  3EHX A;  1PWU A;  1DMT A;  1C8T A;  1CXV A;  3LIK A;  5JMY A;  3HB2 P;  1JAP A;  4PKS A;  2OY2 A;  2OZR A;  2E3X A;  4R3V A;  1ZP5 A;  1USN A;  4L6T A;  4IN9 A;  4PKQ A;  3OHO A;  1KAP P;  3K7N A;  5H8X A;  3LJT A;  4XCT A;  3B92 A;  4XM6 A;  5D7W A;  1G12 A;  4PKU A;  4H1Q A;  2XS4 A;  1EUB A;  1FLS A;  2W13 A;  2OW2 A;  4L63 A;  1YQY A;  1G49 A;  3Q2G A;  4AIG A;  3HBU P;  1SMP A;  1XFY A;  1O0Q A;  3MA2 A;  1GO7 P;  5I3M A;  3LK8 A;  4QKZ A;  3HBV P;  2O36 A;  3F1A A;  1SLM A;  1D8M A;  1CAQ A;  3F18 A;  3LJZ A;  1IAG A;  2OW1 A;  1IAD A;  1RMZ A;  4ILW D;  2MZE A;  2PJT A;  4WZV A;  1OM8 A;  3HDA P;  4GQL A;  1ZTQ A;  830C A;  2ERP A;  2A8H A;  5B5P A;  1I1I P;  2YIG A;  4PKV A;  3EWJ A;  2OW9 A;  4GWM A;  5I4O A;  2RJQ A;  2OW0 A;  4EFS A;  2L0R A;  2Z2D A;  3USN A;  2OY4 A;  3TS4 A;  2DW2 A;  1OMJ A;  1SAT A;  2MLR A;  2X3A A;  3HDB A;  3WV2 A;  3WV1 A;  4ON1 A;  1KBC A;  1OS2 A;  4H76 A;  1PWV A;  4GR3 A;  1BKC I;  1IAA A;  4FXY P;  1DTH A;  5D3C A;  2WO8 A;  5I0L A;  1XUC A;  3KEJ A;  1AKL A;  1CIZ A;  1G4K A;  3DPF A;  1IAC A;  5BOY A;  3E8R A;  4WF6 A;  3I7G A;  1K7Q A;  3HYG A;  1AF0 A;  4AUO A;  2X3C A;  3VI1 A;  1JAO A;  1CQR A;  2FV9 A;  1GXD A;  2DW1 A;  2AIG P;  5D1U A;  4A7B A;  3TVC A;  1XFZ A;  1R54 A;  4XM7 A;  3KWV C;  1KUF A;  3KMC A;  3LKA A;  1GE7 A;  2DDY A;  1XFW A;  1QIC A;  1XUD A;  4G0D A; 
#chains in the Genus database with same CATH topology
 4GF1 A;  3HY7 A;  1BIW A;  1B8Y A;  3P1V A;  1MMR A;  4WKI A;  1JIW P;  1XFV A;  1A85 A;  2CLT A;  1I73 A;  3TSK A;  3L0V A;  1C7K A;  4GR0 A;  1ATL A;  1MNC A;  3U1R A;  4HX3 A;  1UEA A;  3AIG A;  1ZS0 A;  1MMQ A;  1R1J A;  3DL1 A;  1UMS A;  2MZI A;  4Q1L A;  1HTD A;  3UVC A;  4DD8 A;  1K7I A;  2I47 A;  4H82 A;  1IAE A;  3EHY A;  1BM6 A;  1CGL A;  4H2E A;  4L7A A;  1JIZ A;  5LAB A;  3LMC A;  2W0D A;  1TVI A;  3RTS A;  1IAB A;  4G9L A;  1HFC A;  1R1I A;  2V4B A;  4JQG A;  2W15 A;  1PWP A;  3CKI A;  3P24 A;  4JP4 A;  1C3I A;  2WOA A;  1GKD A;  4GWN A;  3G42 A;  1R1H A;  1YP1 A;  3EDI A;  2XS3 A;  1ZVX A;  1OM6 A;  3EDH A;  4IUW A;  4J4M A;  3I7I A;  5D2B A;  1QJI A;  1QUA A;  3L0T A;  1UMT A;  1J7N A;  3EDG A;  1CGF A;  3DWB A;  4H49 A;  4PKW A;  3F17 A;  1JAQ A;  4JIJ A;  2D1N A;  2OVX A;  5BPA A;  1UTT A;  2WO9 A;  2KRJ A;  1HV5 A;  1PWQ A;  2YB9 A;  3EDZ A;  3LJG A;  1D5J A;  4ZR5 A;  3RTT A;  5I2Z A;  3LUM A;  3OHL A;  2AYK A;  1XFU A;  4A3W A;  4PKR A;  3F15 A;  2QPJ A;  3O2X A;  2OXU A;  1BUD A;  1EAK A;  1AST A;  3LIL A;  4H84 A;  1BSW A;  2D1O A;  1KUI A;  2OXW A;  4AXQ A;  1SU3 A;  3KEC A;  2N8R A;  4DF9 A;  1JK3 A;  1QIB A;  4JPA A;  2JT5 A;  1SLN A;  3SHI A;  4JA1 A;  5B5O A;  1G9K A;  1JJ9 A;  4WK7 A;  1H71 P;  1CGE A;  1UTZ A;  2YUF A;  1MMP A;  2ERQ A;  4DV8 A;  3KEK A;  1S4B P;  1Q3A A;  3Q2H A;  4H3X A;  4HMA A;  1R55 A;  1BQQ M;  2JSD A;  1GE5 A;  2K9C A;  3ZUK A;  3AYK A;  1SRP A;  4I03 A;  3KHI A;  1OZ9 A;  5CZM A;  4AYK A;  2ERO A;  4H30 A;  4GR8 A;  1Y93 A;  456C A;  5BOT A;  3LUN A;  3LIR A;  3O64 A;  2OI0 A;  3N2V A;  1BKC A;  5L7F A;  1YCM A;  3LEA A;  4FXQ A;  1XFX A;  2HU6 A;  4FVL A;  4WKE A;  966C A;  1RM8 A;  3N2U A;  2E2D A;  1QJJ A;  3VTG A;  1OO9 A;  3G5C A;  2X7M A;  3K7L A;  1I76 A;  1PWW A;  5L79 A;  1QIA A;  1A86 A;  3DTI A;  5D1T A;  2SRT A;  1JH1 A;  2RJP A;  1L6J A;  1MMB A;  5D1S A;  1XUR A;  3DNG A;  2DDF A;  1B3D A;  2TCL A;  4I35 A;  5CXA A;  3LQB A;  1ZXC A;  2J83 A;  3ZVS A;  1BQO A;  3KME A;  2J0T A;  1JAN A;  2Y6D A;  1OM7 A;  1D8F A;  1HOV A;  1AYK A;  3KRY A;  1HFS A;  1HY7 A;  1YOU A;  4GUY A;  5I12 A;  1K7G A;  3BA0 A;  4PKT A;  4CTH A;  4XBH A;  3B8Z A;  3GBO A;  1JKY A;  1ZXV A;  4IJO A;  1BZS A;  1D7X A;  4DPE A;  3LE9 A;  3AYU A;  3B2Z A;  2K2G A;  3V96 B;  2MLS A;  3NX7 A;  3WV3 A;  4FU4 A;  1BKC E;  1Y0V A;  2JNP A;  3F16 A;  3LGP A;  2JT6 A;  1KUG A;  2W14 A;  2X3B A;  4XM8 A;  3HY9 A;  3ZXH A;  1KUH A;  1FM1 A;  1KUK A;  5I43 A;  3DSL A;  1O0T A;  2USN A;  1GE6 A;  1OS9 A;  2CKI A;  2OXZ A;  2OVZ A;  1ROS A;  1BUV M;  1GKC A;  2FV5 A;  4L19 A;  1Y8J A;  5CUH A;  3DPE A;  3ELM A;  2W12 A;  3LQ0 A;  2DW0 A;  2Y6C A;  2O3E A;  1CK7 A;  3TT4 A;  1GO8 P;  1WNI A;  1G05 A;  2JIH A;  1EB6 A;  1FBL A;  1Z3J A;  2MZH A;  2POJ A;  1ND1 A;  3F19 A;  3EHX A;  1PWU A;  1DMT A;  1C8T A;  1CXV A;  3LIK A;  5JMY A;  1XAX A;  3HB2 P;  1JAP A;  4PKS A;  2OY2 A;  2OZR A;  2E3X A;  4R3V A;  1ZP5 A;  1USN A;  4L6T A;  4IN9 A;  4PKQ A;  3DTE A;  3OHO A;  1KAP P;  3K7N A;  5H8X A;  3LJT A;  4XCT A;  3B92 A;  4XM6 A;  5D7W A;  1G12 A;  4PKU A;  4H1Q A;  2XS4 A;  1EUB A;  1FLS A;  2W13 A;  2OW2 A;  4L63 A;  1YQY A;  1G49 A;  3Q2G A;  4AIG A;  3HBU P;  1SMP A;  1XFY A;  1O0Q A;  3MA2 A;  1GO7 P;  5I3M A;  3LK8 A;  4QKZ A;  3HBV P;  2O36 A;  3F1A A;  1SLM A;  1D8M A;  1CAQ A;  3F18 A;  3LJZ A;  1IAG A;  2OW1 A;  1IAD A;  1RMZ A;  4ILW D;  2MZE A;  2PJT A;  4WZV A;  1OM8 A;  3HDA P;  4GQL A;  1ZTQ A;  830C A;  2ERP A;  2A8H A;  5B5P A;  1I1I P;  2YIG A;  4PKV A;  3EWJ A;  2OW9 A;  4GWM A;  5I4O A;  2RJQ A;  2OW0 A;  4EFS A;  2L0R A;  2Z2D A;  3USN A;  2OY4 A;  3TS4 A;  2DW2 A;  1OMJ A;  1SAT A;  3DTK A;  2MLR A;  2X3A A;  3HDB A;  3WV2 A;  3WV1 A;  4ON1 A;  1KBC A;  1OS2 A;  4H76 A;  1PWV A;  1XM5 A;  4GR3 A;  1BKC I;  1IAA A;  4FXY P;  1DTH A;  5D3C A;  2WO8 A;  5I0L A;  1XUC A;  3KEJ A;  1AKL A;  1CIZ A;  1G4K A;  3DPF A;  1IAC A;  5BOY A;  3E8R A;  4WF6 A;  3I7G A;  1K7Q A;  3HYG A;  1AF0 A;  4AUO A;  2X3C A;  3VI1 A;  1JAO A;  1CQR A;  2FV9 A;  1GXD A;  2DW1 A;  2AIG P;  5D1U A;  4A7B A;  3TVC A;  1XFZ A;  1R54 A;  4XM7 A;  3KWV C;  1KUF A;  3KMC A;  3LKA A;  1GE7 A;  2DDY A;  1XFW A;  1QIC A;  1XUD A;  4G0D A; 
#chains in the Genus database with same CATH homology
 4GF1 A;  3HY7 A;  1BIW A;  1B8Y A;  3P1V A;  1MMR A;  4WKI A;  1JIW P;  1XFV A;  1A85 A;  2CLT A;  1I73 A;  3TSK A;  3L0V A;  1C7K A;  4GR0 A;  1ATL A;  1MNC A;  3U1R A;  4HX3 A;  1UEA A;  3AIG A;  1ZS0 A;  1MMQ A;  1R1J A;  3DL1 A;  1UMS A;  2MZI A;  4Q1L A;  1HTD A;  3UVC A;  4DD8 A;  1K7I A;  2I47 A;  4H82 A;  1IAE A;  3EHY A;  1BM6 A;  1CGL A;  4H2E A;  4L7A A;  1JIZ A;  5LAB A;  3LMC A;  2W0D A;  3RTS A;  1IAB A;  4G9L A;  1HFC A;  1R1I A;  2V4B A;  4JQG A;  2W15 A;  1PWP A;  3CKI A;  3P24 A;  4JP4 A;  1C3I A;  2WOA A;  1GKD A;  4GWN A;  3G42 A;  1R1H A;  1YP1 A;  3EDI A;  2XS3 A;  1ZVX A;  1OM6 A;  3EDH A;  4IUW A;  4J4M A;  3I7I A;  5D2B A;  1QJI A;  1QUA A;  3L0T A;  1UMT A;  1J7N A;  3EDG A;  1CGF A;  3DWB A;  4H49 A;  4PKW A;  3F17 A;  1JAQ A;  4JIJ A;  2D1N A;  2OVX A;  5BPA A;  1UTT A;  2WO9 A;  2KRJ A;  1HV5 A;  1PWQ A;  2YB9 A;  3EDZ A;  3LJG A;  1D5J A;  4ZR5 A;  3RTT A;  5I2Z A;  3LUM A;  3OHL A;  2AYK A;  1XFU A;  4A3W A;  4PKR A;  3F15 A;  2QPJ A;  3O2X A;  2OXU A;  1BUD A;  1EAK A;  1AST A;  3LIL A;  4H84 A;  1BSW A;  2D1O A;  1KUI A;  2OXW A;  4AXQ A;  1SU3 A;  3KEC A;  2N8R A;  4DF9 A;  1JK3 A;  1QIB A;  4JPA A;  2JT5 A;  1SLN A;  3SHI A;  4JA1 A;  5B5O A;  1G9K A;  1JJ9 A;  4WK7 A;  1H71 P;  1CGE A;  1UTZ A;  2YUF A;  1MMP A;  2ERQ A;  4DV8 A;  3KEK A;  1S4B P;  1Q3A A;  3Q2H A;  4H3X A;  4HMA A;  1R55 A;  1BQQ M;  2JSD A;  1GE5 A;  2K9C A;  3ZUK A;  3AYK A;  1SRP A;  4I03 A;  3KHI A;  5CZM A;  4AYK A;  2ERO A;  4H30 A;  4GR8 A;  1Y93 A;  456C A;  5BOT A;  3LUN A;  3LIR A;  3O64 A;  2OI0 A;  3N2V A;  1BKC A;  5L7F A;  1YCM A;  3LEA A;  4FXQ A;  1XFX A;  2HU6 A;  4FVL A;  4WKE A;  966C A;  1RM8 A;  3N2U A;  2E2D A;  1QJJ A;  3VTG A;  1OO9 A;  3G5C A;  2X7M A;  3K7L A;  1I76 A;  1PWW A;  5L79 A;  1QIA A;  1A86 A;  3DTI A;  5D1T A;  2SRT A;  1JH1 A;  2RJP A;  1L6J A;  1MMB A;  5D1S A;  1XUR A;  3DNG A;  2DDF A;  1B3D A;  2TCL A;  4I35 A;  5CXA A;  3LQB A;  1ZXC A;  2J83 A;  3ZVS A;  1BQO A;  3KME A;  2J0T A;  1JAN A;  2Y6D A;  1OM7 A;  1D8F A;  1HOV A;  1AYK A;  3KRY A;  1HFS A;  1HY7 A;  1YOU A;  4GUY A;  5I12 A;  1K7G A;  3BA0 A;  4PKT A;  4CTH A;  4XBH A;  3B8Z A;  3GBO A;  1JKY A;  1ZXV A;  4IJO A;  1BZS A;  1D7X A;  4DPE A;  3LE9 A;  3AYU A;  3B2Z A;  2K2G A;  3V96 B;  2MLS A;  3NX7 A;  3WV3 A;  4FU4 A;  1BKC E;  1Y0V A;  2JNP A;  3F16 A;  3LGP A;  2JT6 A;  1KUG A;  2W14 A;  2X3B A;  4XM8 A;  3HY9 A;  3ZXH A;  1KUH A;  1FM1 A;  1KUK A;  5I43 A;  3DSL A;  1O0T A;  2USN A;  1GE6 A;  1OS9 A;  2CKI A;  2OXZ A;  2OVZ A;  1ROS A;  1BUV M;  1GKC A;  2FV5 A;  4L19 A;  1Y8J A;  5CUH A;  3DPE A;  3ELM A;  2W12 A;  3LQ0 A;  2DW0 A;  2Y6C A;  2O3E A;  1CK7 A;  3TT4 A;  1GO8 P;  1WNI A;  1G05 A;  2JIH A;  1EB6 A;  1FBL A;  1Z3J A;  2MZH A;  2POJ A;  1ND1 A;  3F19 A;  3EHX A;  1PWU A;  1DMT A;  1C8T A;  1CXV A;  3LIK A;  5JMY A;  3HB2 P;  1JAP A;  4PKS A;  2OY2 A;  2OZR A;  2E3X A;  4R3V A;  1ZP5 A;  1USN A;  4L6T A;  4IN9 A;  4PKQ A;  3DTE A;  3OHO A;  1KAP P;  3K7N A;  5H8X A;  3LJT A;  4XCT A;  3B92 A;  4XM6 A;  5D7W A;  1G12 A;  4PKU A;  4H1Q A;  2XS4 A;  1EUB A;  1FLS A;  2W13 A;  2OW2 A;  4L63 A;  1YQY A;  1G49 A;  3Q2G A;  4AIG A;  3HBU P;  1SMP A;  1XFY A;  1O0Q A;  3MA2 A;  1GO7 P;  5I3M A;  3LK8 A;  4QKZ A;  3HBV P;  2O36 A;  3F1A A;  1SLM A;  1D8M A;  1CAQ A;  3F18 A;  3LJZ A;  1IAG A;  2OW1 A;  1IAD A;  1RMZ A;  4ILW D;  2MZE A;  2PJT A;  4WZV A;  1OM8 A;  3HDA P;  4GQL A;  1ZTQ A;  830C A;  2ERP A;  2A8H A;  5B5P A;  1I1I P;  2YIG A;  4PKV A;  3EWJ A;  2OW9 A;  4GWM A;  5I4O A;  2RJQ A;  2OW0 A;  4EFS A;  2L0R A;  2Z2D A;  3USN A;  2OY4 A;  3TS4 A;  2DW2 A;  1OMJ A;  1SAT A;  3DTK A;  2MLR A;  2X3A A;  3HDB A;  3WV2 A;  3WV1 A;  4ON1 A;  1KBC A;  1OS2 A;  4H76 A;  1PWV A;  4GR3 A;  1BKC I;  1IAA A;  4FXY P;  1DTH A;  5D3C A;  2WO8 A;  5I0L A;  1XUC A;  3KEJ A;  1AKL A;  1CIZ A;  1G4K A;  3DPF A;  1IAC A;  5BOY A;  3E8R A;  4WF6 A;  3I7G A;  1K7Q A;  3HYG A;  1AF0 A;  4AUO A;  2X3C A;  3VI1 A;  1JAO A;  1CQR A;  2FV9 A;  1GXD A;  2DW1 A;  2AIG P;  5D1U A;  4A7B A;  3TVC A;  1XFZ A;  1R54 A;  4XM7 A;  3KWV C;  1KUF A;  3KMC A;  3LKA A;  1GE7 A;  2DDY A;  1XFW A;  1QIC A;  1XUD A;  4G0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...