2DW0A

Crystal structure of vap2 from crotalus atrox venom (form 2-1 crystal)
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
414
structure length
414
Chain Sequence
b'PFRFVELVLVVDKAMVTKNNGDLDKIKTRMYEIVNTVNEIYRYMYIHVALVGLEIWSNEDKITVKPEAGYTLNAFGEWRKTDLLTRKKHDNAQLLTAIDLDRVIGLAYVGSMCHPKRSTGIIQDYSEINLVVAVIMAHEMGHNLGINHDSGYCSCGDYACIMRPEISPEPSTFFSNCSYFECWDFIMNHNPECILNEPLGTDIISPPVCGNELLEVGEECDCGTPENCQNECCDAATCKLKSGSQCGHGDCCEQCKFSKSGTECRASMSECDPAEHCTGQSSECPADVFHKNGQPCLDNYGYCYNGNCPIMYHQCYDLFGADVYEAEDSCFERNQKGNYYGYCRKENGNKIPCAPEDVKCGRLYCKDNSPGQNNPCKMFYSNEDEHKGMVLPGTKCADGKVCSNGHCVDVATAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catrocollastatin
publication title Crystal structures of catrocollastatin/VAP2B reveal a dynamic, modular architecture of ADAM/adamalysin/reprolysin family proteins
pubmed doi rcsb
molecule tags Apoptosis, toxin
total genus 126
structure length 414
sequence length 414
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00200 Disintegrin Disintegrin
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
A PF08516 ADAM_CR ADAM cysteine-rich
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2dw0A01
1FLSA 1A86A 2OY2A 2XS4A 3V96B 4GF1A 4PKQA 4WKIA 1G12A 1CK7A 1QJJA 1R54A 1HTDA 4IUWA 2XS3A 2D1NA 2W0DA 3HY7A 3EDZA 3HBUP 3AIGA 3ELMA 2J83A 5H8XA 1CIZA 1GO8P 2DDYA 2POJA 3KWVC 1PWWA 2JNPA 2DW0A 5LABA 1QJIA 2HU6A 3F16A 5B5PA 1IABA 5L79A 3N2UA 3TT4A 3DWBA 3KMEA 2MLRA 4PKSA 1G9KA 3K7NA 4ILWD 4XM6A 1OM8A 1JIZA 4JPAA 1D8MA 1GKDA 1PWVA 2E3XA 4AYKA 5CZMA 2EROA 3LJTA 4PKRA 1ND1A 1BQQM 3U1RA 3BA0A 1O0QA 2W14A 1B3DA 1Q3AA 4QKZA 3O64A 1G49A 4WF6A 4XM8A 4DV8A 2DDFA 1XFUA 1CGEA 1HY7A 1UMSA 3TVCA 1ZTQA 1BKCI 4GQLA 1KUFA 1R55A 4H30A 3LJZA 1OO9A 1DMTA 1BQOA 2FV5A 1MMQA 1QIAA 1D8FA 1OM7A 2W15A 4FVLA 4PKTA 5D2BA 3LJGA 1J7NA 3E8RA 1XFVA 2X3BA 3G5CA 1C7KA 3DPFA 3HDAP 1MMBA 4GWNA 1OM6A 1D5JA 1MMRA 1ZXVA 1SMPA 5B5OA 1ATLA 2D1OA 4H1QA 3F19A 1BKCA 5CXAA 1JH1A 1Z3JA 3HY9A 5I2ZA 3I7GA 2WO9A 2RJQA 1RM8A 3EDHA 2Y6DA 3LUMA 3KMCA 3WV2A 1BUDA 5I3MA 2KRJA 1G05A 3HBVP 3KHIA 1PWUA 4GR3A 2A8HA 1KAPP 3LILA 3EHXA 3LGPA 3P24A 4FU4A 1YP1A 3DNGA 2OVZA 966CA 1GE7A 4I03A 1GE6A 2JT5A 4IJOA 1FM1A 1HFCA 2JSDA 3B2ZA 1UMTA 3I7IA 3F18A 5I4OA 1XURA 2MLSA 1ASTA 5D3CA 3Q2GA 1R1HA 1KBCA 1R1JA 2WO8A 3HB2P 1PWQA 2V4BA 1HV5A 4GUYA 5BPAA 2TCLA 2ERQA 4WZVA 4PKWA 1OMJA 1YOUA 2OW0A 4AUOA 2W13A 2X7MA 4IN9A 2OXWA 3CKIA 4I35A 3RTSA 1JAPA 1JAOA 2MZIA 3F15A 3MA2A 1EB6A 1IACA 4Q1LA 3KEKA 2YIGA 4R3VA 1SATA 1L6JA 5I0LA 1S4BP 3TSKA 1KUKA 4WK7A 2OXUA 3WV1A 3O2XA 4G9LA 3LQBA 1JIWP 4CTHA 1XFWA 1ZVXA 1IAEA 4WKEA 3OHLA 1FBLA 5D1SA 4H49A 3HYGA 5D7WA 4ON1A 3RTTA 2X3AA 2E2DA 3K7LA 1YCMA 4XCTA 1Y0VA 2AIGP 2USNA 2OY4A 3LKAA 1KUHA 3EDIA 4AXQA 2YB9A 4FXYP 1JK3A 1MNCA 5BOYA 1A85A 1BUVM 1DTHA 3LUNA 3G42A 2DW1A 2AYKA 1EAKA 2OXZA 4EFSA 1O0TA 2OVXA 1ZS0A 1ROSA 1SU3A 1KUIA 1QICA 1JAQA 3F17A 2OZRA 1K7GA 4G0DA 3GBOA 1GKCA 1XUCA 3VI1A 2O36A 1CGFA 1IAAA 5I12A 1CQRA 4HX3A 4H82A 3ZVSA 2QPJA 5D1UA 1UTZA 1QIBA 3P1VA 3DSLA 3KEJA 4JP4A 1JJ9A 1OS2A 4FXQA 1EUBA 1AYKA 1K7IA 3LE9A 2WOAA 3EHYA 1GXDA 2Z2DA 4L63A 3LMCA 1BIWA 4JIJA 1XFXA 3DPEA 4GR0A 5BOTA 2JIHA 2I47A 3ZUKA 2SRTA 1BZSA 1ZP5A 2OW2A 2J0TA 3F1AA 2X3CA 4J4MA 1PWPA 1HFSA 3NX7A 1GE5A 456CA 1Y93A 3VTGA 2K2GA 3ZXHA 1OS9A 2K9CA 3Q2HA 1YQYA 1JANA 4GWMA 1WNIA 1BSWA 830CA 3OHOA 5JMYA 2OW9A 4DPEA 2W12A 4JQGA 1XUDA 1K7QA 1C8TA 3EDGA 3TS4A 1USNA 3LIRA 2CLTA 1IADA 3AYKA 2MZHA 2N8RA 3LIKA 3N2VA 2O3EA 1H71P 1GO7P 4H84A 3LQ0A 4PKUA 3UVCA 4H3XA 3SHIA 1SLNA 1CGLA 3EWJA 1I76A 4A3WA 4A7BA 2L0RA 1XFZA 3LK8A 4PKVA 2ERPA 4L19A 4XM7A 3B8ZA 2Y6CA 1XFYA 3KECA 1AKLA 4DF9A 5I43A 3USNA 1KUGA 4DD8A 1CXVA 2MZEA 3KRYA 2OI0A 3DL1A 4JA1A 1HOVA 3LEAA 4H2EA 1I1IP 2JT6A 4AIGA 5CUHA 1SLMA 1B8YA 4HMAA 2DW2A 2PJTA 1MMPA 1BKCE 1IAGA 1UEAA 1SRPA 3L0TA 1D7XA 2FV9A 1ZXCA 2OW1A 1CAQA 4L6TA 1RMZA 3AYUA 1R1IA 4H76A 1Y8JA 5L7FA 5D1TA 2RJPA 3HDBA 1JKYA 1UTTA 2CKIA 3B92A 4ZR5A 1BM6A 3L0VA 4GR8A 3WV3A 1I73A 1QUAA 1G4KA 4XBHA 1C3IA 1AF0A
chains in the Genus database with same CATH superfamily
1FLSA 1A86A 2OY2A 2XS4A 3V96B 4GF1A 4PKQA 4WKIA 1G12A 1CK7A 1QJJA 1R54A 1HTDA 4IUWA 2XS3A 2D1NA 2W0DA 3HY7A 3EDZA 3HBUP 3AIGA 3ELMA 2J83A 5H8XA 1CIZA 1GO8P 2DDYA 2POJA 3KWVC 1PWWA 2JNPA 2DW0A 5LABA 1QJIA 2HU6A 3F16A 5B5PA 1IABA 5L79A 3N2UA 3TT4A 3DWBA 3KMEA 2MLRA 4PKSA 1G9KA 3K7NA 4ILWD 1XAXA 4XM6A 1OM8A 1JIZA 4JPAA 1D8MA 1GKDA 1PWVA 2E3XA 4AYKA 5CZMA 2EROA 3LJTA 4PKRA 1ND1A 1BQQM 3U1RA 3BA0A 1O0QA 2W14A 1B3DA 1Q3AA 4QKZA 3O64A 1G49A 4WF6A 4XM8A 4DV8A 2DDFA 1XFUA 1CGEA 1HY7A 1UMSA 3TVCA 1ZTQA 1BKCI 4GQLA 1KUFA 1R55A 4H30A 3LJZA 1OO9A 1DMTA 1BQOA 2FV5A 1MMQA 1QIAA 1D8FA 1OM7A 2W15A 4FVLA 4PKTA 5D2BA 3LJGA 1J7NA 3E8RA 1XFVA 2X3BA 3G5CA 1C7KA 3DPFA 3HDAP 1MMBA 4GWNA 1OM6A 1D5JA 1MMRA 1ZXVA 1SMPA 5B5OA 1ATLA 2D1OA 4H1QA 3F19A 1BKCA 5CXAA 1JH1A 1Z3JA 3HY9A 5I2ZA 3I7GA 2WO9A 2RJQA 1RM8A 3EDHA 2Y6DA 3LUMA 3KMCA 3WV2A 1BUDA 5I3MA 2KRJA 1G05A 3HBVP 3KHIA 1PWUA 4GR3A 2A8HA 1KAPP 3LILA 3EHXA 3LGPA 3P24A 4FU4A 1YP1A 3DNGA 2OVZA 966CA 1GE7A 4I03A 1GE6A 2JT5A 4IJOA 1FM1A 1HFCA 2JSDA 3B2ZA 1UMTA 3I7IA 3F18A 5I4OA 1XURA 2MLSA 1ASTA 5D3CA 3Q2GA 1R1HA 1KBCA 1R1JA 2WO8A 3HB2P 1PWQA 2V4BA 1HV5A 4GUYA 5BPAA 2TCLA 2ERQA 4WZVA 4PKWA 1OMJA 1YOUA 2OW0A 4AUOA 2W13A 2X7MA 4IN9A 2OXWA 3CKIA 4I35A 3RTSA 1JAPA 1JAOA 2MZIA 3F15A 3MA2A 1EB6A 1IACA 4Q1LA 3KEKA 2YIGA 4R3VA 1SATA 1L6JA 5I0LA 3DTEA 1S4BP 3TSKA 1KUKA 4WK7A 2OXUA 3WV1A 3O2XA 4G9LA 3LQBA 1JIWP 4CTHA 1XFWA 1ZVXA 1IAEA 4WKEA 3OHLA 1FBLA 5D1SA 4H49A 3HYGA 5D7WA 4ON1A 3RTTA 2X3AA 2E2DA 3K7LA 1YCMA 4XCTA 1Y0VA 2AIGP 2USNA 2OY4A 3LKAA 1KUHA 3EDIA 4AXQA 2YB9A 4FXYP 1JK3A 1MNCA 5BOYA 1A85A 1BUVM 1DTHA 3LUNA 3G42A 2DW1A 2AYKA 1EAKA 2OXZA 4EFSA 1O0TA 2OVXA 1ZS0A 1ROSA 1SU3A 1KUIA 1QICA 1JAQA 3F17A 2OZRA 1K7GA 4G0DA 3GBOA 1GKCA 1XUCA 3VI1A 2O36A 1CGFA 1IAAA 5I12A 1CQRA 4HX3A 4H82A 3ZVSA 2QPJA 5D1UA 1UTZA 4L7AA 1QIBA 3P1VA 3DSLA 3KEJA 4JP4A 1JJ9A 1OS2A 4FXQA 1EUBA 1AYKA 1K7IA 3LE9A 2WOAA 3EHYA 1GXDA 2Z2DA 3DTKA 4L63A 3LMCA 1BIWA 4JIJA 1XFXA 3DPEA 4GR0A 5BOTA 2JIHA 2I47A 3ZUKA 2SRTA 1BZSA 1ZP5A 2OW2A 2J0TA 3F1AA 2X3CA 4J4MA 1PWPA 1HFSA 3NX7A 1GE5A 456CA 1Y93A 3VTGA 2K2GA 3ZXHA 1OS9A 2K9CA 3Q2HA 1YQYA 1JANA 4GWMA 1WNIA 1TVIA 1BSWA 830CA 3OHOA 5JMYA 2OW9A 4DPEA 2W12A 4JQGA 1XUDA 1K7QA 1C8TA 3EDGA 3TS4A 1USNA 3LIRA 2CLTA 1IADA 3AYKA 2MZHA 2N8RA 3LIKA 3N2VA 2O3EA 1H71P 1GO7P 4H84A 3LQ0A 4PKUA 3UVCA 4H3XA 3SHIA 1SLNA 1CGLA 3EWJA 1I76A 4A3WA 4A7BA 2L0RA 1XFZA 3LK8A 4PKVA 2ERPA 4L19A 4XM7A 3B8ZA 1XM5A 2Y6CA 1XFYA 3KECA 1AKLA 4DF9A 5I43A 3USNA 1KUGA 1OZ9A 4DD8A 1CXVA 2YUFA 2MZEA 3KRYA 2OI0A 3DL1A 4JA1A 1HOVA 3DTIA 3LEAA 4H2EA 1I1IP 2JT6A 4AIGA 5CUHA 1SLMA 1B8YA 4HMAA 2DW2A 2PJTA 1MMPA 1BKCE 1IAGA 1UEAA 1SRPA 3L0TA 1D7XA 2FV9A 1ZXCA 2OW1A 1CAQA 4L6TA 1RMZA 3AYUA 1R1IA 4H76A 1Y8JA 5L7FA 5D1TA 2RJPA 3HDBA 1JKYA 1UTTA 2CKIA 3B92A 4ZR5A 1BM6A 3L0VA 4GR8A 3WV3A 1I73A 1QUAA 1G4KA 4XBHA 1C3IA 1AF0A
chains in the Genus database with same CATH topology
1FLSA 1A86A 2OY2A 2XS4A 3V96B 4GF1A 4PKQA 4WKIA 1G12A 1CK7A 1QJJA 1R54A 1HTDA 4IUWA 2XS3A 2D1NA 2W0DA 3HY7A 3EDZA 3HBUP 3AIGA 3ELMA 2J83A 5H8XA 1CIZA 1GO8P 2DDYA 2POJA 3KWVC 1PWWA 2JNPA 2DW0A 5LABA 1QJIA 2HU6A 3F16A 5B5PA 1IABA 5L79A 3N2UA 3TT4A 3DWBA 3KMEA 2MLRA 4PKSA 1G9KA 3K7NA 4ILWD 4XM6A 1OM8A 1JIZA 4JPAA 1D8MA 1GKDA 1PWVA 2E3XA 4AYKA 5CZMA 2EROA 3LJTA 4PKRA 1ND1A 1BQQM 3U1RA 3BA0A 1O0QA 2W14A 1B3DA 1Q3AA 4QKZA 3O64A 1G49A 4WF6A 4XM8A 4DV8A 2DDFA 1XFUA 1CGEA 1HY7A 1UMSA 3TVCA 1ZTQA 1BKCI 4GQLA 1KUFA 1R55A 4H30A 3LJZA 1OO9A 1DMTA 1BQOA 2FV5A 1MMQA 1QIAA 1D8FA 1OM7A 2W15A 4FVLA 4PKTA 5D2BA 3LJGA 1J7NA 3E8RA 1XFVA 2X3BA 3G5CA 1C7KA 3DPFA 3HDAP 1MMBA 4GWNA 1OM6A 1D5JA 1MMRA 1ZXVA 1SMPA 5B5OA 1ATLA 2D1OA 4H1QA 3F19A 1BKCA 5CXAA 1JH1A 1Z3JA 3HY9A 5I2ZA 3I7GA 2WO9A 2RJQA 1RM8A 3EDHA 2Y6DA 3LUMA 3KMCA 3WV2A 1BUDA 5I3MA 2KRJA 1G05A 3HBVP 3KHIA 1PWUA 4GR3A 2A8HA 1KAPP 3LILA 3EHXA 3LGPA 3P24A 4FU4A 1YP1A 3DNGA 2OVZA 966CA 1GE7A 4I03A 1GE6A 2JT5A 4IJOA 1FM1A 1HFCA 2JSDA 3B2ZA 1UMTA 3I7IA 3F18A 5I4OA 1XURA 2MLSA 1ASTA 5D3CA 3Q2GA 1R1HA 1KBCA 1R1JA 2WO8A 3HB2P 1PWQA 2V4BA 1HV5A 4GUYA 5BPAA 2TCLA 2ERQA 4WZVA 4PKWA 1OMJA 1YOUA 2OW0A 4AUOA 2W13A 2X7MA 4IN9A 2OXWA 3CKIA 4I35A 3RTSA 1JAPA 1JAOA 2MZIA 3F15A 3MA2A 1EB6A 1IACA 4Q1LA 3KEKA 2YIGA 4R3VA 1SATA 1L6JA 5I0LA 3DTEA 1S4BP 3TSKA 1KUKA 4WK7A 2OXUA 3WV1A 3O2XA 4G9LA 3LQBA 1JIWP 4CTHA 1XFWA 1ZVXA 1IAEA 4WKEA 3OHLA 1FBLA 5D1SA 4H49A 3HYGA 5D7WA 4ON1A 3RTTA 2X3AA 2E2DA 3K7LA 1YCMA 4XCTA 1Y0VA 2AIGP 2USNA 2OY4A 3LKAA 1KUHA 3EDIA 4AXQA 2YB9A 4FXYP 1JK3A 1MNCA 5BOYA 1A85A 1BUVM 1DTHA 3LUNA 3G42A 2DW1A 2AYKA 1EAKA 2OXZA 4EFSA 1O0TA 2OVXA 1ZS0A 1ROSA 1SU3A 1KUIA 1QICA 1JAQA 3F17A 2OZRA 1K7GA 4G0DA 3GBOA 1GKCA 1XUCA 3VI1A 2O36A 1CGFA 1IAAA 5I12A 1CQRA 4HX3A 4H82A 3ZVSA 2QPJA 5D1UA 1UTZA 4L7AA 1QIBA 3P1VA 3DSLA 3KEJA 4JP4A 1JJ9A 1OS2A 4FXQA 1EUBA 1AYKA 1K7IA 3LE9A 2WOAA 3EHYA 1GXDA 2Z2DA 3DTKA 4L63A 3LMCA 1BIWA 4JIJA 1XFXA 3DPEA 4GR0A 5BOTA 2JIHA 2I47A 3ZUKA 2SRTA 1BZSA 1ZP5A 2OW2A 2J0TA 3F1AA 2X3CA 4J4MA 1PWPA 1HFSA 3NX7A 1GE5A 456CA 1Y93A 3VTGA 2K2GA 3ZXHA 1OS9A 2K9CA 3Q2HA 1YQYA 1JANA 4GWMA 1WNIA 1BSWA 830CA 3OHOA 5JMYA 2OW9A 4DPEA 2W12A 4JQGA 1XUDA 1K7QA 1C8TA 3EDGA 3TS4A 1USNA 3LIRA 2CLTA 1IADA 3AYKA 2MZHA 2N8RA 3LIKA 3N2VA 2O3EA 1H71P 1GO7P 4H84A 3LQ0A 4PKUA 3UVCA 4H3XA 3SHIA 1SLNA 1CGLA 3EWJA 1I76A 4A3WA 4A7BA 2L0RA 1XFZA 3LK8A 4PKVA 2ERPA 4L19A 4XM7A 3B8ZA 2Y6CA 1XFYA 3KECA 1AKLA 4DF9A 5I43A 3USNA 1KUGA 4DD8A 1CXVA 2YUFA 2MZEA 3KRYA 2OI0A 3DL1A 4JA1A 1HOVA 3DTIA 3LEAA 4H2EA 1I1IP 2JT6A 4AIGA 5CUHA 1SLMA 1B8YA 4HMAA 2DW2A 2PJTA 1MMPA 1BKCE 1IAGA 1UEAA 1SRPA 3L0TA 1D7XA 2FV9A 1ZXCA 2OW1A 1CAQA 4L6TA 1RMZA 3AYUA 1R1IA 4H76A 1Y8JA 5L7FA 5D1TA 2RJPA 3HDBA 1JKYA 1UTTA 2CKIA 3B92A 4ZR5A 1BM6A 3L0VA 4GR8A 3WV3A 1I73A 1QUAA 1G4KA 4XBHA 1C3IA 1AF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FLS A;  1A86 A;  2OY2 A;  2XS4 A;  3V96 B;  4GF1 A;  4PKQ A;  4WKI A;  1G12 A;  1CK7 A;  1QJJ A;  1R54 A;  1HTD A;  4IUW A;  2XS3 A;  2D1N A;  2W0D A;  3HY7 A;  3EDZ A;  3HBU P;  3AIG A;  3ELM A;  2J83 A;  5H8X A;  1CIZ A;  1GO8 P;  2DDY A;  2POJ A;  3KWV C;  1PWW A;  2JNP A;  2DW0 A;  5LAB A;  1QJI A;  2HU6 A;  3F16 A;  5B5P A;  1IAB A;  5L79 A;  3N2U A;  3TT4 A;  3DWB A;  3KME A;  2MLR A;  4PKS A;  1G9K A;  3K7N A;  4ILW D;  4XM6 A;  1OM8 A;  1JIZ A;  4JPA A;  1D8M A;  1GKD A;  1PWV A;  2E3X A;  4AYK A;  5CZM A;  2ERO A;  3LJT A;  4PKR A;  1ND1 A;  1BQQ M;  3U1R A;  3BA0 A;  1O0Q A;  2W14 A;  1B3D A;  1Q3A A;  4QKZ A;  3O64 A;  1G49 A;  4WF6 A;  4XM8 A;  4DV8 A;  2DDF A;  1XFU A;  1CGE A;  1HY7 A;  1UMS A;  3TVC A;  1ZTQ A;  1BKC I;  4GQL A;  1KUF A;  1R55 A;  4H30 A;  3LJZ A;  1OO9 A;  1DMT A;  1BQO A;  2FV5 A;  1MMQ A;  1QIA A;  1D8F A;  1OM7 A;  2W15 A;  4FVL A;  4PKT A;  5D2B A;  3LJG A;  1J7N A;  3E8R A;  1XFV A;  2X3B A;  3G5C A;  1C7K A;  3DPF A;  3HDA P;  1MMB A;  4GWN A;  1OM6 A;  1D5J A;  1MMR A;  1ZXV A;  1SMP A;  5B5O A;  1ATL A;  2D1O A;  4H1Q A;  3F19 A;  1BKC A;  5CXA A;  1JH1 A;  1Z3J A;  3HY9 A;  5I2Z A;  3I7G A;  2WO9 A;  2RJQ A;  1RM8 A;  3EDH A;  2Y6D A;  3LUM A;  3KMC A;  3WV2 A;  1BUD A;  5I3M A;  2KRJ A;  1G05 A;  3HBV P;  3KHI A;  1PWU A;  4GR3 A;  2A8H A;  1KAP P;  3LIL A;  3EHX A;  3LGP A;  3P24 A;  4FU4 A;  1YP1 A;  3DNG A;  2OVZ A;  966C A;  1GE7 A;  4I03 A;  1GE6 A;  2JT5 A;  4IJO A;  1FM1 A;  1HFC A;  2JSD A;  3B2Z A;  1UMT A;  3I7I A;  3F18 A;  5I4O A;  1XUR A;  2MLS A;  1AST A;  5D3C A;  3Q2G A;  1R1H A;  1KBC A;  1R1J A;  2WO8 A;  3HB2 P;  1PWQ A;  2V4B A;  1HV5 A;  4GUY A;  5BPA A;  2TCL A;  2ERQ A;  4WZV A;  4PKW A;  1OMJ A;  1YOU A;  2OW0 A;  4AUO A;  2W13 A;  2X7M A;  4IN9 A;  2OXW A;  3CKI A;  4I35 A;  3RTS A;  1JAP A;  1JAO A;  2MZI A;  3F15 A;  3MA2 A;  1EB6 A;  1IAC A;  4Q1L A;  3KEK A;  2YIG A;  4R3V A;  1SAT A;  1L6J A;  5I0L A;  1S4B P;  3TSK A;  1KUK A;  4WK7 A;  2OXU A;  3WV1 A;  3O2X A;  4G9L A;  3LQB A;  1JIW P;  4CTH A;  1XFW A;  1ZVX A;  1IAE A;  4WKE A;  3OHL A;  1FBL A;  5D1S A;  4H49 A;  3HYG A;  5D7W A;  4ON1 A;  3RTT A;  2X3A A;  2E2D A;  3K7L A;  1YCM A;  4XCT A;  1Y0V A;  2AIG P;  2USN A;  2OY4 A;  3LKA A;  1KUH A;  3EDI A;  4AXQ A;  2YB9 A;  4FXY P;  1JK3 A;  1MNC A;  5BOY A;  1A85 A;  1BUV M;  1DTH A;  3LUN A;  3G42 A;  2DW1 A;  2AYK A;  1EAK A;  2OXZ A;  4EFS A;  1O0T A;  2OVX A;  1ZS0 A;  1ROS A;  1SU3 A;  1KUI A;  1QIC A;  1JAQ A;  3F17 A;  2OZR A;  1K7G A;  4G0D A;  3GBO A;  1GKC A;  1XUC A;  3VI1 A;  2O36 A;  1CGF A;  1IAA A;  5I12 A;  1CQR A;  4HX3 A;  4H82 A;  3ZVS A;  2QPJ A;  5D1U A;  1UTZ A;  1QIB A;  3P1V A;  3DSL A;  3KEJ A;  4JP4 A;  1JJ9 A;  1OS2 A;  4FXQ A;  1EUB A;  1AYK A;  1K7I A;  3LE9 A;  2WOA A;  3EHY A;  1GXD A;  2Z2D A;  4L63 A;  3LMC A;  1BIW A;  4JIJ A;  1XFX A;  3DPE A;  4GR0 A;  5BOT A;  2JIH A;  2I47 A;  3ZUK A;  2SRT A;  1BZS A;  1ZP5 A;  2OW2 A;  2J0T A;  3F1A A;  2X3C A;  4J4M A;  1PWP A;  1HFS A;  3NX7 A;  1GE5 A;  456C A;  1Y93 A;  3VTG A;  2K2G A;  3ZXH A;  1OS9 A;  2K9C A;  3Q2H A;  1YQY A;  1JAN A;  4GWM A;  1WNI A;  1BSW A;  830C A;  3OHO A;  5JMY A;  2OW9 A;  4DPE A;  2W12 A;  4JQG A;  1XUD A;  1K7Q A;  1C8T A;  3EDG A;  3TS4 A;  1USN A;  3LIR A;  2CLT A;  1IAD A;  3AYK A;  2MZH A;  2N8R A;  3LIK A;  3N2V A;  2O3E A;  1H71 P;  1GO7 P;  4H84 A;  3LQ0 A;  4PKU A;  3UVC A;  4H3X A;  3SHI A;  1SLN A;  1CGL A;  3EWJ A;  1I76 A;  4A3W A;  4A7B A;  2L0R A;  1XFZ A;  3LK8 A;  4PKV A;  2ERP A;  4L19 A;  4XM7 A;  3B8Z A;  2Y6C A;  1XFY A;  3KEC A;  1AKL A;  4DF9 A;  5I43 A;  3USN A;  1KUG A;  4DD8 A;  1CXV A;  2MZE A;  3KRY A;  2OI0 A;  3DL1 A;  4JA1 A;  1HOV A;  3LEA A;  4H2E A;  1I1I P;  2JT6 A;  4AIG A;  5CUH A;  1SLM A;  1B8Y A;  4HMA A;  2DW2 A;  2PJT A;  1MMP A;  1BKC E;  1IAG A;  1UEA A;  1SRP A;  3L0T A;  1D7X A;  2FV9 A;  1ZXC A;  2OW1 A;  1CAQ A;  4L6T A;  1RMZ A;  3AYU A;  1R1I A;  4H76 A;  1Y8J A;  5L7F A;  5D1T A;  2RJP A;  3HDB A;  1JKY A;  1UTT A;  2CKI A;  3B92 A;  4ZR5 A;  1BM6 A;  3L0V A;  4GR8 A;  3WV3 A;  1I73 A;  1QUA A;  1G4K A;  4XBH A;  1C3I A;  1AF0 A; 
#chains in the Genus database with same CATH topology
 1FLS A;  1A86 A;  2OY2 A;  2XS4 A;  3V96 B;  4GF1 A;  4PKQ A;  4WKI A;  1G12 A;  1CK7 A;  1QJJ A;  1R54 A;  1HTD A;  4IUW A;  2XS3 A;  2D1N A;  2W0D A;  3HY7 A;  3EDZ A;  3HBU P;  3AIG A;  3ELM A;  2J83 A;  5H8X A;  1CIZ A;  1GO8 P;  2DDY A;  2POJ A;  3KWV C;  1PWW A;  2JNP A;  2DW0 A;  5LAB A;  1QJI A;  2HU6 A;  3F16 A;  5B5P A;  1IAB A;  5L79 A;  3N2U A;  3TT4 A;  3DWB A;  3KME A;  2MLR A;  4PKS A;  1G9K A;  3K7N A;  4ILW D;  1XAX A;  4XM6 A;  1OM8 A;  1JIZ A;  4JPA A;  1D8M A;  1GKD A;  1PWV A;  2E3X A;  4AYK A;  5CZM A;  2ERO A;  3LJT A;  4PKR A;  1ND1 A;  1BQQ M;  3U1R A;  3BA0 A;  1O0Q A;  2W14 A;  1B3D A;  1Q3A A;  4QKZ A;  3O64 A;  1G49 A;  4WF6 A;  4XM8 A;  4DV8 A;  2DDF A;  1XFU A;  1CGE A;  1HY7 A;  1UMS A;  3TVC A;  1ZTQ A;  1BKC I;  4GQL A;  1KUF A;  1R55 A;  4H30 A;  3LJZ A;  1OO9 A;  1DMT A;  1BQO A;  2FV5 A;  1MMQ A;  1QIA A;  1D8F A;  1OM7 A;  2W15 A;  4FVL A;  4PKT A;  5D2B A;  3LJG A;  1J7N A;  3E8R A;  1XFV A;  2X3B A;  3G5C A;  1C7K A;  3DPF A;  3HDA P;  1MMB A;  4GWN A;  1OM6 A;  1D5J A;  1MMR A;  1ZXV A;  1SMP A;  5B5O A;  1ATL A;  2D1O A;  4H1Q A;  3F19 A;  1BKC A;  5CXA A;  1JH1 A;  1Z3J A;  3HY9 A;  5I2Z A;  3I7G A;  2WO9 A;  2RJQ A;  1RM8 A;  3EDH A;  2Y6D A;  3LUM A;  3KMC A;  3WV2 A;  1BUD A;  5I3M A;  2KRJ A;  1G05 A;  3HBV P;  3KHI A;  1PWU A;  4GR3 A;  2A8H A;  1KAP P;  3LIL A;  3EHX A;  3LGP A;  3P24 A;  4FU4 A;  1YP1 A;  3DNG A;  2OVZ A;  966C A;  1GE7 A;  4I03 A;  1GE6 A;  2JT5 A;  4IJO A;  1FM1 A;  1HFC A;  2JSD A;  3B2Z A;  1UMT A;  3I7I A;  3F18 A;  5I4O A;  1XUR A;  2MLS A;  1AST A;  5D3C A;  3Q2G A;  1R1H A;  1KBC A;  1R1J A;  2WO8 A;  3HB2 P;  1PWQ A;  2V4B A;  1HV5 A;  4GUY A;  5BPA A;  2TCL A;  2ERQ A;  4WZV A;  4PKW A;  1OMJ A;  1YOU A;  2OW0 A;  4AUO A;  2W13 A;  2X7M A;  4IN9 A;  2OXW A;  3CKI A;  4I35 A;  3RTS A;  1JAP A;  1JAO A;  2MZI A;  3F15 A;  3MA2 A;  1EB6 A;  1IAC A;  4Q1L A;  3KEK A;  2YIG A;  4R3V A;  1SAT A;  1L6J A;  5I0L A;  3DTE A;  1S4B P;  3TSK A;  1KUK A;  4WK7 A;  2OXU A;  3WV1 A;  3O2X A;  4G9L A;  3LQB A;  1JIW P;  4CTH A;  1XFW A;  1ZVX A;  1IAE A;  4WKE A;  3OHL A;  1FBL A;  5D1S A;  4H49 A;  3HYG A;  5D7W A;  4ON1 A;  3RTT A;  2X3A A;  2E2D A;  3K7L A;  1YCM A;  4XCT A;  1Y0V A;  2AIG P;  2USN A;  2OY4 A;  3LKA A;  1KUH A;  3EDI A;  4AXQ A;  2YB9 A;  4FXY P;  1JK3 A;  1MNC A;  5BOY A;  1A85 A;  1BUV M;  1DTH A;  3LUN A;  3G42 A;  2DW1 A;  2AYK A;  1EAK A;  2OXZ A;  4EFS A;  1O0T A;  2OVX A;  1ZS0 A;  1ROS A;  1SU3 A;  1KUI A;  1QIC A;  1JAQ A;  3F17 A;  2OZR A;  1K7G A;  4G0D A;  3GBO A;  1GKC A;  1XUC A;  3VI1 A;  2O36 A;  1CGF A;  1IAA A;  5I12 A;  1CQR A;  4HX3 A;  4H82 A;  3ZVS A;  2QPJ A;  5D1U A;  1UTZ A;  4L7A A;  1QIB A;  3P1V A;  3DSL A;  3KEJ A;  4JP4 A;  1JJ9 A;  1OS2 A;  4FXQ A;  1EUB A;  1AYK A;  1K7I A;  3LE9 A;  2WOA A;  3EHY A;  1GXD A;  2Z2D A;  3DTK A;  4L63 A;  3LMC A;  1BIW A;  4JIJ A;  1XFX A;  3DPE A;  4GR0 A;  5BOT A;  2JIH A;  2I47 A;  3ZUK A;  2SRT A;  1BZS A;  1ZP5 A;  2OW2 A;  2J0T A;  3F1A A;  2X3C A;  4J4M A;  1PWP A;  1HFS A;  3NX7 A;  1GE5 A;  456C A;  1Y93 A;  3VTG A;  2K2G A;  3ZXH A;  1OS9 A;  2K9C A;  3Q2H A;  1YQY A;  1JAN A;  4GWM A;  1WNI A;  1TVI A;  1BSW A;  830C A;  3OHO A;  5JMY A;  2OW9 A;  4DPE A;  2W12 A;  4JQG A;  1XUD A;  1K7Q A;  1C8T A;  3EDG A;  3TS4 A;  1USN A;  3LIR A;  2CLT A;  1IAD A;  3AYK A;  2MZH A;  2N8R A;  3LIK A;  3N2V A;  2O3E A;  1H71 P;  1GO7 P;  4H84 A;  3LQ0 A;  4PKU A;  3UVC A;  4H3X A;  3SHI A;  1SLN A;  1CGL A;  3EWJ A;  1I76 A;  4A3W A;  4A7B A;  2L0R A;  1XFZ A;  3LK8 A;  4PKV A;  2ERP A;  4L19 A;  4XM7 A;  3B8Z A;  1XM5 A;  2Y6C A;  1XFY A;  3KEC A;  1AKL A;  4DF9 A;  5I43 A;  3USN A;  1KUG A;  1OZ9 A;  4DD8 A;  1CXV A;  2YUF A;  2MZE A;  3KRY A;  2OI0 A;  3DL1 A;  4JA1 A;  1HOV A;  3DTI A;  3LEA A;  4H2E A;  1I1I P;  2JT6 A;  4AIG A;  5CUH A;  1SLM A;  1B8Y A;  4HMA A;  2DW2 A;  2PJT A;  1MMP A;  1BKC E;  1IAG A;  1UEA A;  1SRP A;  3L0T A;  1D7X A;  2FV9 A;  1ZXC A;  2OW1 A;  1CAQ A;  4L6T A;  1RMZ A;  3AYU A;  1R1I A;  4H76 A;  1Y8J A;  5L7F A;  5D1T A;  2RJP A;  3HDB A;  1JKY A;  1UTT A;  2CKI A;  3B92 A;  4ZR5 A;  1BM6 A;  3L0V A;  4GR8 A;  3WV3 A;  1I73 A;  1QUA A;  1G4K A;  4XBH A;  1C3I A;  1AF0 A; 
#chains in the Genus database with same CATH homology
 1FLS A;  1A86 A;  2OY2 A;  2XS4 A;  3V96 B;  4GF1 A;  4PKQ A;  4WKI A;  1G12 A;  1CK7 A;  1QJJ A;  1R54 A;  1HTD A;  4IUW A;  2XS3 A;  2D1N A;  2W0D A;  3HY7 A;  3EDZ A;  3HBU P;  3AIG A;  3ELM A;  2J83 A;  5H8X A;  1CIZ A;  1GO8 P;  2DDY A;  2POJ A;  3KWV C;  1PWW A;  2JNP A;  2DW0 A;  5LAB A;  1QJI A;  2HU6 A;  3F16 A;  5B5P A;  1IAB A;  5L79 A;  3N2U A;  3TT4 A;  3DWB A;  3KME A;  2MLR A;  4PKS A;  1G9K A;  3K7N A;  4ILW D;  4XM6 A;  1OM8 A;  1JIZ A;  4JPA A;  1D8M A;  1GKD A;  1PWV A;  2E3X A;  4AYK A;  5CZM A;  2ERO A;  3LJT A;  4PKR A;  1ND1 A;  1BQQ M;  3U1R A;  3BA0 A;  1O0Q A;  2W14 A;  1B3D A;  1Q3A A;  4QKZ A;  3O64 A;  1G49 A;  4WF6 A;  4XM8 A;  4DV8 A;  2DDF A;  1XFU A;  1CGE A;  1HY7 A;  1UMS A;  3TVC A;  1ZTQ A;  1BKC I;  4GQL A;  1KUF A;  1R55 A;  4H30 A;  3LJZ A;  1OO9 A;  1DMT A;  1BQO A;  2FV5 A;  1MMQ A;  1QIA A;  1D8F A;  1OM7 A;  2W15 A;  4FVL A;  4PKT A;  5D2B A;  3LJG A;  1J7N A;  3E8R A;  1XFV A;  2X3B A;  3G5C A;  1C7K A;  3DPF A;  3HDA P;  1MMB A;  4GWN A;  1OM6 A;  1D5J A;  1MMR A;  1ZXV A;  1SMP A;  5B5O A;  1ATL A;  2D1O A;  4H1Q A;  3F19 A;  1BKC A;  5CXA A;  1JH1 A;  1Z3J A;  3HY9 A;  5I2Z A;  3I7G A;  2WO9 A;  2RJQ A;  1RM8 A;  3EDH A;  2Y6D A;  3LUM A;  3KMC A;  3WV2 A;  1BUD A;  5I3M A;  2KRJ A;  1G05 A;  3HBV P;  3KHI A;  1PWU A;  4GR3 A;  2A8H A;  1KAP P;  3LIL A;  3EHX A;  3LGP A;  3P24 A;  4FU4 A;  1YP1 A;  3DNG A;  2OVZ A;  966C A;  1GE7 A;  4I03 A;  1GE6 A;  2JT5 A;  4IJO A;  1FM1 A;  1HFC A;  2JSD A;  3B2Z A;  1UMT A;  3I7I A;  3F18 A;  5I4O A;  1XUR A;  2MLS A;  1AST A;  5D3C A;  3Q2G A;  1R1H A;  1KBC A;  1R1J A;  2WO8 A;  3HB2 P;  1PWQ A;  2V4B A;  1HV5 A;  4GUY A;  5BPA A;  2TCL A;  2ERQ A;  4WZV A;  4PKW A;  1OMJ A;  1YOU A;  2OW0 A;  4AUO A;  2W13 A;  2X7M A;  4IN9 A;  2OXW A;  3CKI A;  4I35 A;  3RTS A;  1JAP A;  1JAO A;  2MZI A;  3F15 A;  3MA2 A;  1EB6 A;  1IAC A;  4Q1L A;  3KEK A;  2YIG A;  4R3V A;  1SAT A;  1L6J A;  5I0L A;  3DTE A;  1S4B P;  3TSK A;  1KUK A;  4WK7 A;  2OXU A;  3WV1 A;  3O2X A;  4G9L A;  3LQB A;  1JIW P;  4CTH A;  1XFW A;  1ZVX A;  1IAE A;  4WKE A;  3OHL A;  1FBL A;  5D1S A;  4H49 A;  3HYG A;  5D7W A;  4ON1 A;  3RTT A;  2X3A A;  2E2D A;  3K7L A;  1YCM A;  4XCT A;  1Y0V A;  2AIG P;  2USN A;  2OY4 A;  3LKA A;  1KUH A;  3EDI A;  4AXQ A;  2YB9 A;  4FXY P;  1JK3 A;  1MNC A;  5BOY A;  1A85 A;  1BUV M;  1DTH A;  3LUN A;  3G42 A;  2DW1 A;  2AYK A;  1EAK A;  2OXZ A;  4EFS A;  1O0T A;  2OVX A;  1ZS0 A;  1ROS A;  1SU3 A;  1KUI A;  1QIC A;  1JAQ A;  3F17 A;  2OZR A;  1K7G A;  4G0D A;  3GBO A;  1GKC A;  1XUC A;  3VI1 A;  2O36 A;  1CGF A;  1IAA A;  5I12 A;  1CQR A;  4HX3 A;  4H82 A;  3ZVS A;  2QPJ A;  5D1U A;  1UTZ A;  4L7A A;  1QIB A;  3P1V A;  3DSL A;  3KEJ A;  4JP4 A;  1JJ9 A;  1OS2 A;  4FXQ A;  1EUB A;  1AYK A;  1K7I A;  3LE9 A;  2WOA A;  3EHY A;  1GXD A;  2Z2D A;  3DTK A;  4L63 A;  3LMC A;  1BIW A;  4JIJ A;  1XFX A;  3DPE A;  4GR0 A;  5BOT A;  2JIH A;  2I47 A;  3ZUK A;  2SRT A;  1BZS A;  1ZP5 A;  2OW2 A;  2J0T A;  3F1A A;  2X3C A;  4J4M A;  1PWP A;  1HFS A;  3NX7 A;  1GE5 A;  456C A;  1Y93 A;  3VTG A;  2K2G A;  3ZXH A;  1OS9 A;  2K9C A;  3Q2H A;  1YQY A;  1JAN A;  4GWM A;  1WNI A;  1BSW A;  830C A;  3OHO A;  5JMY A;  2OW9 A;  4DPE A;  2W12 A;  4JQG A;  1XUD A;  1K7Q A;  1C8T A;  3EDG A;  3TS4 A;  1USN A;  3LIR A;  2CLT A;  1IAD A;  3AYK A;  2MZH A;  2N8R A;  3LIK A;  3N2V A;  2O3E A;  1H71 P;  1GO7 P;  4H84 A;  3LQ0 A;  4PKU A;  3UVC A;  4H3X A;  3SHI A;  1SLN A;  1CGL A;  3EWJ A;  1I76 A;  4A3W A;  4A7B A;  2L0R A;  1XFZ A;  3LK8 A;  4PKV A;  2ERP A;  4L19 A;  4XM7 A;  3B8Z A;  2Y6C A;  1XFY A;  3KEC A;  1AKL A;  4DF9 A;  5I43 A;  3USN A;  1KUG A;  4DD8 A;  1CXV A;  2YUF A;  2MZE A;  3KRY A;  2OI0 A;  3DL1 A;  4JA1 A;  1HOV A;  3DTI A;  3LEA A;  4H2E A;  1I1I P;  2JT6 A;  4AIG A;  5CUH A;  1SLM A;  1B8Y A;  4HMA A;  2DW2 A;  2PJT A;  1MMP A;  1BKC E;  1IAG A;  1UEA A;  1SRP A;  3L0T A;  1D7X A;  2FV9 A;  1ZXC A;  2OW1 A;  1CAQ A;  4L6T A;  1RMZ A;  3AYU A;  1R1I A;  4H76 A;  1Y8J A;  5L7F A;  5D1T A;  2RJP A;  3HDB A;  1JKY A;  1UTT A;  2CKI A;  3B92 A;  4ZR5 A;  1BM6 A;  3L0V A;  4GR8 A;  3WV3 A;  1I73 A;  1QUA A;  1G4K A;  4XBH A;  1C3I A;  1AF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...