2DW1A

Crystal structure of vap2 from crotalus atrox venom (form 2-2 crystal)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
415
structure length
415
Chain Sequence
b'NPFRFVELVLVVDKAMVTKNNGDLDKIKTRMYEIVNTVNEIYRYMYIHVALVGLEIWSNEDKITVKPEAGYTLNAFGEWRKTDLLTRKKHDNAQLLTAIDLDRVIGLAYVGSMCHPKRSTGIIQDYSEINLVVAVIMAHEMGHNLGINHDSGYCSCGDYACIMRPEISPEPSTFFSNCSYFECWDFIMNHNPECILNEPLGTDIISPPVCGNELLEVGEECDCGTPENCQNECCDAATCKLKSGSQCGHGDCCEQCKFSKSGTECRASMSECDPAEHCTGQSSECPADVFHKNGQPCLDNYGYCYNGNCPIMYHQCYDLFGADVYEAEDSCFERNQKGNYYGYCRKENGNKIPCAPEDVKCGRLYCKDNSPGQNNPCKMFYSNEDEHKGMVLPGTKCADGKVCSNGHCVDVATAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catrocollastatin
publication title Crystal structures of catrocollastatin/VAP2B reveal a dynamic, modular architecture of ADAM/adamalysin/reprolysin family proteins
pubmed doi rcsb
molecule tags Apoptosis, toxin
total genus 118
structure length 415
sequence length 415
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00200 Disintegrin Disintegrin
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
A PF08516 ADAM_CR ADAM cysteine-rich
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2dw1A01
3KECA 830CA 1R55A 1KUKA 3LJTA 4JIJA 5CXAA 3F17A 3F15A 4H82A 3AIGA 2J0TA 3DPFA 4PKVA 1ATLA 3G5CA 4ZR5A 1QIBA 4DPEA 4HMAA 1PWUA 3LKAA 2MZHA 5D1TA 1ND1A 5JMYA 1USNA 3EWJA 4PKSA 4GR3A 5B5OA 1GE6A 1UMTA 3F16A 2ERPA 2JIHA 3LK8A 1IACA 2X3CA 2W0DA 1BKCI 3ZUKA 1ZXCA 1RMZA 3N2VA 3ZXHA 3VI1A 4HX3A 2Y6CA 1JK3A 2OXUA 1IAGA 4H3XA 1XFUA 3TSKA 1HOVA 3WV3A 3N2UA 4EFSA 1O0QA 3KMEA 5LABA 1JANA 3ELMA 4I03A 1K7IA 2WO9A 1D5JA 4DD8A 1EB6A 1XURA 4AUOA 4PKRA 1JH1A 3I7IA 1K7QA 2WOAA 3Q2GA 2OW2A 4H30A 4PKUA 2JNPA 1XFZA 4PKWA 5I3MA 3EDZA 1KUHA 4H84A 1UEAA 1ZS0A 2JSDA 2OY4A 4XBHA 5L7FA 1G49A 1QIAA 2A8HA 3U1RA 1BKCE 1G12A 2YIGA 1ROSA 1I73A 1A85A 1SRPA 1C3IA 1CIZA 1Z3JA 5I0LA 1D7XA 4JP4A 3LJGA 3B8ZA 1IADA 3WV1A 2K9CA 4JQGA 1O0TA 2D1OA 3F19A 2AIGP 4WKIA 3LJZA 1ASTA 1HFCA 3HY9A 966CA 2OZRA 4AXQA 1G9KA 1GXDA 1KAPP 3VTGA 4XM7A 2K2GA 2DDFA 5D7WA 4GWNA 5BOYA 3EDGA 2USNA 456CA 3LQBA 1QJJA 1KUGA 2FV5A 1GKCA 4GWMA 1RM8A 2OW9A 1EUBA 3RTTA 3KEKA 1YOUA 2OXZA 4FVLA 1CK7A 2W14A 2X3AA 1BQOA 3HDAP 1C8TA 1SATA 2KRJA 4FU4A 3WV2A 1OS9A 3LEAA 3UVCA 3HB2P 2RJQA 5D1SA 1MMBA 1K7GA 4GR0A 5I4OA 1B8YA 1Y93A 3L0TA 3TT4A 1OM8A 3LIRA 1JJ9A 4H2EA 2MZIA 1XUDA 1CGFA 1S4BP 1CXVA 1ZP5A 4L19A 3TS4A 1UMSA 1FM1A 3ZVSA 2E2DA 1HY7A 1MMRA 1XFYA 4QKZA 1CAQA 1KUFA 2DW1A 1D8FA 1BUDA 3AYKA 2YB9A 2CKIA 1DTHA 1SU3A 1I1IP 1GO7P 1G4KA 4JA1A 4AYKA 1JAQA 1BQQM 1BKCA 3LIKA 4WF6A 1CGEA 4XCTA 1QJIA 4L6TA 1XFWA 3LUNA 1PWPA 3O64A 1OS2A 1JIWP 1H71P 4GUYA 3L0VA 2N8RA 2AYKA 1C7KA 5I12A 2PJTA 1DMTA 4XM8A 1AF0A 5I2ZA 2OVZA 2O3EA 1ZXVA 1FBLA 2OW0A 1Y8JA 1L6JA 3EDIA 1B3DA 2JT5A 4FXYP 2XS3A 1R1HA 2HU6A 4G9LA 2DDYA 1GE5A 1HV5A 1QICA 1AKLA 3LE9A 3V96B 2WO8A 3DWBA 2D1NA 2L0RA 2XS4A 2FV9A 4WK7A 3F18A 1XFVA 2O36A 3G42A 1PWWA 3K7NA 5CUHA 3I7GA 4H49A 3EHYA 1OM6A 2X7MA 4H76A 2I47A 3HY7A 3CKIA 5B5PA 3KWVC 1BIWA 1JAPA 3P24A 1PWVA 2JT6A 5BOTA 1HFSA 3B92A 4PKTA 1GE7A 4GQLA 3USNA 1AYKA 1YQYA 1OMJA 3OHOA 1SMPA 3MA2A 4IJOA 3F1AA 3B2ZA 3SHIA 3DL1A 1YP1A 4A3WA 1D8MA 1JKYA 3BA0A 1KBCA 4WZVA 1UTZA 1XFXA 5D2BA 3DPEA 5CZMA 3GBOA 1R1IA 1I76A 4H1QA 5I43A 2OY2A 4GF1A 1BSWA 3OHLA 2MZEA 3EHXA 2QPJA 3LILA 3E8RA 4J4MA 4PKQA 3HYGA 5H8XA 2ERQA 2W12A 1Y0VA 1BM6A 1PWQA 1XUCA 4I35A 1JIZA 5D1UA 2OVXA 2Y6DA 3RTSA 1ZVXA 2V4BA 3HDBA 5BPAA 1MNCA 2W15A 2Z2DA 2OI0A 1SLMA 3KEJA 3O2XA 1Q3AA 1GO8P 2OXWA 3K7LA 2EROA 1GKDA 3DSLA 2TCLA 4ON1A 3HBVP 4DV8A 1G05A 3HBUP 1QUAA 3KHIA 2POJA 2RJPA 4FXQA 4CTHA 1CQRA 4IUWA 3KMCA 1BUVM 1A86A 2J83A 3NX7A 2W13A 1MMQA 1CGLA 1IABA 4IN9A 1IAEA 2DW0A 1OM7A 5L79A 1IAAA 1SLNA 3KRYA 4WKEA 1UTTA 1YCMA 1ZTQA 4XM6A 4G0DA 2DW2A 3DNGA 3AYUA 4A7BA 3LUMA 4R3VA 1HTDA 1R54A 2CLTA 2SRTA 1R1JA 2X3BA 4JPAA 2OW1A 1JAOA 2MLRA 1BZSA 3EDHA 1J7NA 2MLSA 3LMCA 3P1VA 3Q2HA 4GR8A 1EAKA 1OO9A 1MMPA 1KUIA 4ILWD 4AIGA 1FLSA 4DF9A 3LQ0A 4Q1LA 2E3XA 5D3CA 3TVCA 4L63A 3LGPA 1WNIA
chains in the Genus database with same CATH superfamily
3KECA 830CA 1R55A 1KUKA 3LJTA 4JIJA 5CXAA 3F17A 3F15A 4H82A 3AIGA 2J0TA 3DPFA 4PKVA 1ATLA 3G5CA 4ZR5A 1QIBA 4DPEA 4HMAA 1PWUA 3LKAA 2MZHA 5D1TA 1ND1A 5JMYA 1USNA 3DTEA 3EWJA 4PKSA 4GR3A 5B5OA 1GE6A 1UMTA 3F16A 2ERPA 2JIHA 3LK8A 1IACA 2X3CA 2W0DA 1BKCI 3ZUKA 1ZXCA 1RMZA 3N2VA 3ZXHA 3VI1A 4HX3A 2Y6CA 1JK3A 2OXUA 1IAGA 4H3XA 1XFUA 3TSKA 1HOVA 3WV3A 3N2UA 4EFSA 1O0QA 1XAXA 3KMEA 5LABA 1JANA 3ELMA 4I03A 1K7IA 2WO9A 1D5JA 4DD8A 2YUFA 1EB6A 1XURA 4AUOA 4PKRA 1JH1A 3I7IA 1K7QA 2WOAA 3Q2GA 2OW2A 4H30A 4PKUA 2JNPA 1XFZA 4PKWA 5I3MA 3EDZA 1KUHA 4H84A 1UEAA 1ZS0A 2JSDA 2OY4A 4XBHA 5L7FA 1G49A 1QIAA 2A8HA 3U1RA 1BKCE 1G12A 2YIGA 1ROSA 1I73A 1A85A 1SRPA 1C3IA 1OZ9A 1CIZA 1Z3JA 5I0LA 1D7XA 4JP4A 3LJGA 3B8ZA 1IADA 3WV1A 2K9CA 4JQGA 1O0TA 2D1OA 3F19A 2AIGP 4WKIA 3LJZA 1ASTA 1HFCA 3HY9A 966CA 2OZRA 4AXQA 1G9KA 1GXDA 1KAPP 3VTGA 4XM7A 2K2GA 2DDFA 5D7WA 4GWNA 5BOYA 3EDGA 2USNA 456CA 3LQBA 1QJJA 1KUGA 2FV5A 1GKCA 4GWMA 1RM8A 2OW9A 1EUBA 3RTTA 3KEKA 1YOUA 2OXZA 4FVLA 1CK7A 2W14A 2X3AA 1BQOA 3HDAP 1C8TA 1SATA 2KRJA 4FU4A 3WV2A 1OS9A 3LEAA 3UVCA 3HB2P 2RJQA 5D1SA 1MMBA 1K7GA 4GR0A 5I4OA 1B8YA 1Y93A 3L0TA 3TT4A 1OM8A 3LIRA 1JJ9A 4H2EA 2MZIA 1XUDA 1CGFA 1S4BP 1CXVA 1ZP5A 4L19A 3TS4A 1UMSA 1FM1A 3ZVSA 2E2DA 1HY7A 1MMRA 1XFYA 4QKZA 1CAQA 1KUFA 2DW1A 1D8FA 1BUDA 3AYKA 2YB9A 2CKIA 1DTHA 1SU3A 1I1IP 1GO7P 1G4KA 4JA1A 4L7AA 4AYKA 1JAQA 1BQQM 1BKCA 3LIKA 4WF6A 1CGEA 4XCTA 1QJIA 4L6TA 1XFWA 3LUNA 1PWPA 3O64A 1OS2A 1JIWP 1H71P 4GUYA 3L0VA 2N8RA 2AYKA 1C7KA 5I12A 2PJTA 1DMTA 4XM8A 1AF0A 5I2ZA 2OVZA 2O3EA 1ZXVA 1FBLA 2OW0A 1Y8JA 1L6JA 3EDIA 1B3DA 2JT5A 4FXYP 2XS3A 1R1HA 2HU6A 4G9LA 2DDYA 1GE5A 1HV5A 1QICA 1AKLA 3LE9A 3V96B 2WO8A 3DWBA 2D1NA 2L0RA 2XS4A 2FV9A 4WK7A 3F18A 1XFVA 2O36A 3G42A 1PWWA 3K7NA 5CUHA 3I7GA 4H49A 3EHYA 1OM6A 2X7MA 4H76A 2I47A 3HY7A 3CKIA 5B5PA 3KWVC 1BIWA 1JAPA 3P24A 1PWVA 2JT6A 5BOTA 1HFSA 3B92A 4PKTA 1GE7A 4GQLA 3USNA 1AYKA 1YQYA 1OMJA 3OHOA 1SMPA 3MA2A 4IJOA 3F1AA 3B2ZA 3SHIA 3DL1A 1YP1A 4A3WA 1D8MA 1JKYA 3BA0A 1KBCA 4WZVA 1UTZA 1XFXA 5D2BA 3DPEA 5CZMA 3GBOA 1R1IA 1I76A 4H1QA 5I43A 2OY2A 4GF1A 1BSWA 3OHLA 2MZEA 3EHXA 2QPJA 3LILA 3E8RA 4J4MA 4PKQA 3HYGA 5H8XA 3DTIA 1XM5A 2ERQA 2W12A 1Y0VA 1BM6A 1PWQA 1XUCA 4I35A 1JIZA 5D1UA 2OVXA 2Y6DA 3RTSA 1ZVXA 2V4BA 3HDBA 5BPAA 1MNCA 2W15A 2Z2DA 2OI0A 1SLMA 3KEJA 3O2XA 1Q3AA 1GO8P 2OXWA 3K7LA 2EROA 1GKDA 3DSLA 2TCLA 4ON1A 3HBVP 4DV8A 1G05A 3HBUP 1QUAA 3KHIA 2POJA 2RJPA 4FXQA 4CTHA 1CQRA 4IUWA 3KMCA 1BUVM 1A86A 2J83A 3NX7A 2W13A 1MMQA 1CGLA 1IABA 4IN9A 1IAEA 2DW0A 1OM7A 5L79A 1IAAA 1SLNA 3KRYA 4WKEA 1UTTA 1YCMA 1ZTQA 4XM6A 1TVIA 4G0DA 2DW2A 3DNGA 3AYUA 4A7BA 3LUMA 4R3VA 1HTDA 1R54A 2CLTA 2SRTA 1R1JA 2X3BA 4JPAA 2OW1A 1JAOA 2MLRA 1BZSA 3EDHA 1J7NA 2MLSA 3LMCA 3P1VA 3Q2HA 4GR8A 1EAKA 1OO9A 1MMPA 1KUIA 4ILWD 4AIGA 1FLSA 4DF9A 3LQ0A 4Q1LA 2E3XA 5D3CA 3DTKA 3TVCA 4L63A 3LGPA 1WNIA
chains in the Genus database with same CATH topology
3KECA 830CA 1R55A 1KUKA 3LJTA 4JIJA 5CXAA 3F17A 3F15A 4H82A 3AIGA 2J0TA 3DPFA 4PKVA 1ATLA 3G5CA 4ZR5A 1QIBA 4DPEA 4HMAA 1PWUA 3LKAA 2MZHA 5D1TA 1ND1A 5JMYA 1USNA 3DTEA 3EWJA 4PKSA 4GR3A 5B5OA 1GE6A 1UMTA 3F16A 2ERPA 2JIHA 3LK8A 1IACA 2X3CA 2W0DA 1BKCI 3ZUKA 1ZXCA 1RMZA 3N2VA 3ZXHA 3VI1A 4HX3A 2Y6CA 1JK3A 2OXUA 1IAGA 4H3XA 1XFUA 3TSKA 1HOVA 3WV3A 3N2UA 4EFSA 1O0QA 3KMEA 5LABA 1JANA 3ELMA 4I03A 1K7IA 2WO9A 1D5JA 4DD8A 2YUFA 1EB6A 1XURA 4AUOA 4PKRA 1JH1A 3I7IA 1K7QA 2WOAA 3Q2GA 2OW2A 4H30A 4PKUA 2JNPA 1XFZA 4PKWA 5I3MA 3EDZA 1KUHA 4H84A 1UEAA 1ZS0A 2JSDA 2OY4A 4XBHA 5L7FA 1G49A 1QIAA 2A8HA 3U1RA 1BKCE 1G12A 2YIGA 1ROSA 1I73A 1A85A 1SRPA 1C3IA 1CIZA 1Z3JA 5I0LA 1D7XA 4JP4A 3LJGA 3B8ZA 1IADA 3WV1A 2K9CA 4JQGA 1O0TA 2D1OA 3F19A 2AIGP 4WKIA 3LJZA 1ASTA 1HFCA 3HY9A 966CA 2OZRA 4AXQA 1G9KA 1GXDA 1KAPP 3VTGA 4XM7A 2K2GA 2DDFA 5D7WA 4GWNA 5BOYA 3EDGA 2USNA 456CA 3LQBA 1QJJA 1KUGA 2FV5A 1GKCA 4GWMA 1RM8A 2OW9A 1EUBA 3RTTA 3KEKA 1YOUA 2OXZA 4FVLA 1CK7A 2W14A 2X3AA 1BQOA 3HDAP 1C8TA 1SATA 2KRJA 4FU4A 3WV2A 1OS9A 3LEAA 3UVCA 3HB2P 2RJQA 5D1SA 1MMBA 1K7GA 4GR0A 5I4OA 1B8YA 1Y93A 3L0TA 3TT4A 1OM8A 3LIRA 1JJ9A 4H2EA 2MZIA 1XUDA 1CGFA 1S4BP 1CXVA 1ZP5A 4L19A 3TS4A 1UMSA 1FM1A 3ZVSA 2E2DA 1HY7A 1MMRA 1XFYA 4QKZA 1CAQA 1KUFA 2DW1A 1D8FA 1BUDA 3AYKA 2YB9A 2CKIA 1DTHA 1SU3A 1I1IP 1GO7P 1G4KA 4JA1A 4L7AA 4AYKA 1JAQA 1BQQM 1BKCA 3LIKA 4WF6A 1CGEA 4XCTA 1QJIA 4L6TA 1XFWA 3LUNA 1PWPA 3O64A 1OS2A 1JIWP 1H71P 4GUYA 3L0VA 2N8RA 2AYKA 1C7KA 5I12A 2PJTA 1DMTA 4XM8A 1AF0A 5I2ZA 2OVZA 2O3EA 1ZXVA 1FBLA 2OW0A 1Y8JA 1L6JA 3EDIA 1B3DA 2JT5A 4FXYP 2XS3A 1R1HA 2HU6A 4G9LA 2DDYA 1GE5A 1HV5A 1QICA 1AKLA 3LE9A 3V96B 2WO8A 3DWBA 2D1NA 2L0RA 2XS4A 2FV9A 4WK7A 3F18A 1XFVA 2O36A 3G42A 1PWWA 3K7NA 5CUHA 3I7GA 4H49A 3EHYA 1OM6A 2X7MA 4H76A 2I47A 3HY7A 3CKIA 5B5PA 3KWVC 1BIWA 1JAPA 3P24A 1PWVA 2JT6A 5BOTA 1HFSA 3B92A 4PKTA 1GE7A 4GQLA 3USNA 1AYKA 1YQYA 1OMJA 3OHOA 1SMPA 3MA2A 4IJOA 3F1AA 3B2ZA 3SHIA 3DL1A 1YP1A 4A3WA 1D8MA 1JKYA 3BA0A 1KBCA 4WZVA 1UTZA 1XFXA 5D2BA 3DPEA 5CZMA 3GBOA 1R1IA 1I76A 4H1QA 5I43A 2OY2A 4GF1A 1BSWA 3OHLA 2MZEA 3EHXA 2QPJA 3LILA 3E8RA 4J4MA 4PKQA 3HYGA 5H8XA 3DTIA 2ERQA 2W12A 1Y0VA 1BM6A 1PWQA 1XUCA 4I35A 1JIZA 5D1UA 2OVXA 2Y6DA 3RTSA 1ZVXA 2V4BA 3HDBA 5BPAA 1MNCA 2W15A 2Z2DA 2OI0A 1SLMA 3KEJA 3O2XA 1Q3AA 1GO8P 2OXWA 3K7LA 2EROA 1GKDA 3DSLA 2TCLA 4ON1A 3HBVP 4DV8A 1G05A 3HBUP 1QUAA 3KHIA 2POJA 2RJPA 4FXQA 4CTHA 1CQRA 4IUWA 3KMCA 1BUVM 1A86A 2J83A 3NX7A 2W13A 1MMQA 1CGLA 1IABA 4IN9A 1IAEA 2DW0A 1OM7A 5L79A 1IAAA 1SLNA 3KRYA 4WKEA 1UTTA 1YCMA 1ZTQA 4XM6A 4G0DA 2DW2A 3DNGA 3AYUA 4A7BA 3LUMA 4R3VA 1HTDA 1R54A 2CLTA 2SRTA 1R1JA 2X3BA 4JPAA 2OW1A 1JAOA 2MLRA 1BZSA 3EDHA 1J7NA 2MLSA 3LMCA 3P1VA 3Q2HA 4GR8A 1EAKA 1OO9A 1MMPA 1KUIA 4ILWD 4AIGA 1FLSA 4DF9A 3LQ0A 4Q1LA 2E3XA 5D3CA 3DTKA 3TVCA 4L63A 3LGPA 1WNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KEC A;  830C A;  1R55 A;  1KUK A;  3LJT A;  4JIJ A;  5CXA A;  3F17 A;  3F15 A;  4H82 A;  3AIG A;  2J0T A;  3DPF A;  4PKV A;  1ATL A;  3G5C A;  4ZR5 A;  1QIB A;  4DPE A;  4HMA A;  1PWU A;  3LKA A;  2MZH A;  5D1T A;  1ND1 A;  5JMY A;  1USN A;  3EWJ A;  4PKS A;  4GR3 A;  5B5O A;  1GE6 A;  1UMT A;  3F16 A;  2ERP A;  2JIH A;  3LK8 A;  1IAC A;  2X3C A;  2W0D A;  1BKC I;  3ZUK A;  1ZXC A;  1RMZ A;  3N2V A;  3ZXH A;  3VI1 A;  4HX3 A;  2Y6C A;  1JK3 A;  2OXU A;  1IAG A;  4H3X A;  1XFU A;  3TSK A;  1HOV A;  3WV3 A;  3N2U A;  4EFS A;  1O0Q A;  3KME A;  5LAB A;  1JAN A;  3ELM A;  4I03 A;  1K7I A;  2WO9 A;  1D5J A;  4DD8 A;  1EB6 A;  1XUR A;  4AUO A;  4PKR A;  1JH1 A;  3I7I A;  1K7Q A;  2WOA A;  3Q2G A;  2OW2 A;  4H30 A;  4PKU A;  2JNP A;  1XFZ A;  4PKW A;  5I3M A;  3EDZ A;  1KUH A;  4H84 A;  1UEA A;  1ZS0 A;  2JSD A;  2OY4 A;  4XBH A;  5L7F A;  1G49 A;  1QIA A;  2A8H A;  3U1R A;  1BKC E;  1G12 A;  2YIG A;  1ROS A;  1I73 A;  1A85 A;  1SRP A;  1C3I A;  1CIZ A;  1Z3J A;  5I0L A;  1D7X A;  4JP4 A;  3LJG A;  3B8Z A;  1IAD A;  3WV1 A;  2K9C A;  4JQG A;  1O0T A;  2D1O A;  3F19 A;  2AIG P;  4WKI A;  3LJZ A;  1AST A;  1HFC A;  3HY9 A;  966C A;  2OZR A;  4AXQ A;  1G9K A;  1GXD A;  1KAP P;  3VTG A;  4XM7 A;  2K2G A;  2DDF A;  5D7W A;  4GWN A;  5BOY A;  3EDG A;  2USN A;  456C A;  3LQB A;  1QJJ A;  1KUG A;  2FV5 A;  1GKC A;  4GWM A;  1RM8 A;  2OW9 A;  1EUB A;  3RTT A;  3KEK A;  1YOU A;  2OXZ A;  4FVL A;  1CK7 A;  2W14 A;  2X3A A;  1BQO A;  3HDA P;  1C8T A;  1SAT A;  2KRJ A;  4FU4 A;  3WV2 A;  1OS9 A;  3LEA A;  3UVC A;  3HB2 P;  2RJQ A;  5D1S A;  1MMB A;  1K7G A;  4GR0 A;  5I4O A;  1B8Y A;  1Y93 A;  3L0T A;  3TT4 A;  1OM8 A;  3LIR A;  1JJ9 A;  4H2E A;  2MZI A;  1XUD A;  1CGF A;  1S4B P;  1CXV A;  1ZP5 A;  4L19 A;  3TS4 A;  1UMS A;  1FM1 A;  3ZVS A;  2E2D A;  1HY7 A;  1MMR A;  1XFY A;  4QKZ A;  1CAQ A;  1KUF A;  2DW1 A;  1D8F A;  1BUD A;  3AYK A;  2YB9 A;  2CKI A;  1DTH A;  1SU3 A;  1I1I P;  1GO7 P;  1G4K A;  4JA1 A;  4AYK A;  1JAQ A;  1BQQ M;  1BKC A;  3LIK A;  4WF6 A;  1CGE A;  4XCT A;  1QJI A;  4L6T A;  1XFW A;  3LUN A;  1PWP A;  3O64 A;  1OS2 A;  1JIW P;  1H71 P;  4GUY A;  3L0V A;  2N8R A;  2AYK A;  1C7K A;  5I12 A;  2PJT A;  1DMT A;  4XM8 A;  1AF0 A;  5I2Z A;  2OVZ A;  2O3E A;  1ZXV A;  1FBL A;  2OW0 A;  1Y8J A;  1L6J A;  3EDI A;  1B3D A;  2JT5 A;  4FXY P;  2XS3 A;  1R1H A;  2HU6 A;  4G9L A;  2DDY A;  1GE5 A;  1HV5 A;  1QIC A;  1AKL A;  3LE9 A;  3V96 B;  2WO8 A;  3DWB A;  2D1N A;  2L0R A;  2XS4 A;  2FV9 A;  4WK7 A;  3F18 A;  1XFV A;  2O36 A;  3G42 A;  1PWW A;  3K7N A;  5CUH A;  3I7G A;  4H49 A;  3EHY A;  1OM6 A;  2X7M A;  4H76 A;  2I47 A;  3HY7 A;  3CKI A;  5B5P A;  3KWV C;  1BIW A;  1JAP A;  3P24 A;  1PWV A;  2JT6 A;  5BOT A;  1HFS A;  3B92 A;  4PKT A;  1GE7 A;  4GQL A;  3USN A;  1AYK A;  1YQY A;  1OMJ A;  3OHO A;  1SMP A;  3MA2 A;  4IJO A;  3F1A A;  3B2Z A;  3SHI A;  3DL1 A;  1YP1 A;  4A3W A;  1D8M A;  1JKY A;  3BA0 A;  1KBC A;  4WZV A;  1UTZ A;  1XFX A;  5D2B A;  3DPE A;  5CZM A;  3GBO A;  1R1I A;  1I76 A;  4H1Q A;  5I43 A;  2OY2 A;  4GF1 A;  1BSW A;  3OHL A;  2MZE A;  3EHX A;  2QPJ A;  3LIL A;  3E8R A;  4J4M A;  4PKQ A;  3HYG A;  5H8X A;  2ERQ A;  2W12 A;  1Y0V A;  1BM6 A;  1PWQ A;  1XUC A;  4I35 A;  1JIZ A;  5D1U A;  2OVX A;  2Y6D A;  3RTS A;  1ZVX A;  2V4B A;  3HDB A;  5BPA A;  1MNC A;  2W15 A;  2Z2D A;  2OI0 A;  1SLM A;  3KEJ A;  3O2X A;  1Q3A A;  1GO8 P;  2OXW A;  3K7L A;  2ERO A;  1GKD A;  3DSL A;  2TCL A;  4ON1 A;  3HBV P;  4DV8 A;  1G05 A;  3HBU P;  1QUA A;  3KHI A;  2POJ A;  2RJP A;  4FXQ A;  4CTH A;  1CQR A;  4IUW A;  3KMC A;  1BUV M;  1A86 A;  2J83 A;  3NX7 A;  2W13 A;  1MMQ A;  1CGL A;  1IAB A;  4IN9 A;  1IAE A;  2DW0 A;  1OM7 A;  5L79 A;  1IAA A;  1SLN A;  3KRY A;  4WKE A;  1UTT A;  1YCM A;  1ZTQ A;  4XM6 A;  4G0D A;  2DW2 A;  3DNG A;  3AYU A;  4A7B A;  3LUM A;  4R3V A;  1HTD A;  1R54 A;  2CLT A;  2SRT A;  1R1J A;  2X3B A;  4JPA A;  2OW1 A;  1JAO A;  2MLR A;  1BZS A;  3EDH A;  1J7N A;  2MLS A;  3LMC A;  3P1V A;  3Q2H A;  4GR8 A;  1EAK A;  1OO9 A;  1MMP A;  1KUI A;  4ILW D;  4AIG A;  1FLS A;  4DF9 A;  3LQ0 A;  4Q1L A;  2E3X A;  5D3C A;  3TVC A;  4L63 A;  3LGP A;  1WNI A; 
#chains in the Genus database with same CATH topology
 3KEC A;  830C A;  1R55 A;  1KUK A;  3LJT A;  4JIJ A;  5CXA A;  3F17 A;  3F15 A;  4H82 A;  3AIG A;  2J0T A;  3DPF A;  4PKV A;  1ATL A;  3G5C A;  4ZR5 A;  1QIB A;  4DPE A;  4HMA A;  1PWU A;  3LKA A;  2MZH A;  5D1T A;  1ND1 A;  5JMY A;  1USN A;  3DTE A;  3EWJ A;  4PKS A;  4GR3 A;  5B5O A;  1GE6 A;  1UMT A;  3F16 A;  2ERP A;  2JIH A;  3LK8 A;  1IAC A;  2X3C A;  2W0D A;  1BKC I;  3ZUK A;  1ZXC A;  1RMZ A;  3N2V A;  3ZXH A;  3VI1 A;  4HX3 A;  2Y6C A;  1JK3 A;  2OXU A;  1IAG A;  4H3X A;  1XFU A;  3TSK A;  1HOV A;  3WV3 A;  3N2U A;  4EFS A;  1O0Q A;  1XAX A;  3KME A;  5LAB A;  1JAN A;  3ELM A;  4I03 A;  1K7I A;  2WO9 A;  1D5J A;  4DD8 A;  2YUF A;  1EB6 A;  1XUR A;  4AUO A;  4PKR A;  1JH1 A;  3I7I A;  1K7Q A;  2WOA A;  3Q2G A;  2OW2 A;  4H30 A;  4PKU A;  2JNP A;  1XFZ A;  4PKW A;  5I3M A;  3EDZ A;  1KUH A;  4H84 A;  1UEA A;  1ZS0 A;  2JSD A;  2OY4 A;  4XBH A;  5L7F A;  1G49 A;  1QIA A;  2A8H A;  3U1R A;  1BKC E;  1G12 A;  2YIG A;  1ROS A;  1I73 A;  1A85 A;  1SRP A;  1C3I A;  1OZ9 A;  1CIZ A;  1Z3J A;  5I0L A;  1D7X A;  4JP4 A;  3LJG A;  3B8Z A;  1IAD A;  3WV1 A;  2K9C A;  4JQG A;  1O0T A;  2D1O A;  3F19 A;  2AIG P;  4WKI A;  3LJZ A;  1AST A;  1HFC A;  3HY9 A;  966C A;  2OZR A;  4AXQ A;  1G9K A;  1GXD A;  1KAP P;  3VTG A;  4XM7 A;  2K2G A;  2DDF A;  5D7W A;  4GWN A;  5BOY A;  3EDG A;  2USN A;  456C A;  3LQB A;  1QJJ A;  1KUG A;  2FV5 A;  1GKC A;  4GWM A;  1RM8 A;  2OW9 A;  1EUB A;  3RTT A;  3KEK A;  1YOU A;  2OXZ A;  4FVL A;  1CK7 A;  2W14 A;  2X3A A;  1BQO A;  3HDA P;  1C8T A;  1SAT A;  2KRJ A;  4FU4 A;  3WV2 A;  1OS9 A;  3LEA A;  3UVC A;  3HB2 P;  2RJQ A;  5D1S A;  1MMB A;  1K7G A;  4GR0 A;  5I4O A;  1B8Y A;  1Y93 A;  3L0T A;  3TT4 A;  1OM8 A;  3LIR A;  1JJ9 A;  4H2E A;  2MZI A;  1XUD A;  1CGF A;  1S4B P;  1CXV A;  1ZP5 A;  4L19 A;  3TS4 A;  1UMS A;  1FM1 A;  3ZVS A;  2E2D A;  1HY7 A;  1MMR A;  1XFY A;  4QKZ A;  1CAQ A;  1KUF A;  2DW1 A;  1D8F A;  1BUD A;  3AYK A;  2YB9 A;  2CKI A;  1DTH A;  1SU3 A;  1I1I P;  1GO7 P;  1G4K A;  4JA1 A;  4L7A A;  4AYK A;  1JAQ A;  1BQQ M;  1BKC A;  3LIK A;  4WF6 A;  1CGE A;  4XCT A;  1QJI A;  4L6T A;  1XFW A;  3LUN A;  1PWP A;  3O64 A;  1OS2 A;  1JIW P;  1H71 P;  4GUY A;  3L0V A;  2N8R A;  2AYK A;  1C7K A;  5I12 A;  2PJT A;  1DMT A;  4XM8 A;  1AF0 A;  5I2Z A;  2OVZ A;  2O3E A;  1ZXV A;  1FBL A;  2OW0 A;  1Y8J A;  1L6J A;  3EDI A;  1B3D A;  2JT5 A;  4FXY P;  2XS3 A;  1R1H A;  2HU6 A;  4G9L A;  2DDY A;  1GE5 A;  1HV5 A;  1QIC A;  1AKL A;  3LE9 A;  3V96 B;  2WO8 A;  3DWB A;  2D1N A;  2L0R A;  2XS4 A;  2FV9 A;  4WK7 A;  3F18 A;  1XFV A;  2O36 A;  3G42 A;  1PWW A;  3K7N A;  5CUH A;  3I7G A;  4H49 A;  3EHY A;  1OM6 A;  2X7M A;  4H76 A;  2I47 A;  3HY7 A;  3CKI A;  5B5P A;  3KWV C;  1BIW A;  1JAP A;  3P24 A;  1PWV A;  2JT6 A;  5BOT A;  1HFS A;  3B92 A;  4PKT A;  1GE7 A;  4GQL A;  3USN A;  1AYK A;  1YQY A;  1OMJ A;  3OHO A;  1SMP A;  3MA2 A;  4IJO A;  3F1A A;  3B2Z A;  3SHI A;  3DL1 A;  1YP1 A;  4A3W A;  1D8M A;  1JKY A;  3BA0 A;  1KBC A;  4WZV A;  1UTZ A;  1XFX A;  5D2B A;  3DPE A;  5CZM A;  3GBO A;  1R1I A;  1I76 A;  4H1Q A;  5I43 A;  2OY2 A;  4GF1 A;  1BSW A;  3OHL A;  2MZE A;  3EHX A;  2QPJ A;  3LIL A;  3E8R A;  4J4M A;  4PKQ A;  3HYG A;  5H8X A;  3DTI A;  1XM5 A;  2ERQ A;  2W12 A;  1Y0V A;  1BM6 A;  1PWQ A;  1XUC A;  4I35 A;  1JIZ A;  5D1U A;  2OVX A;  2Y6D A;  3RTS A;  1ZVX A;  2V4B A;  3HDB A;  5BPA A;  1MNC A;  2W15 A;  2Z2D A;  2OI0 A;  1SLM A;  3KEJ A;  3O2X A;  1Q3A A;  1GO8 P;  2OXW A;  3K7L A;  2ERO A;  1GKD A;  3DSL A;  2TCL A;  4ON1 A;  3HBV P;  4DV8 A;  1G05 A;  3HBU P;  1QUA A;  3KHI A;  2POJ A;  2RJP A;  4FXQ A;  4CTH A;  1CQR A;  4IUW A;  3KMC A;  1BUV M;  1A86 A;  2J83 A;  3NX7 A;  2W13 A;  1MMQ A;  1CGL A;  1IAB A;  4IN9 A;  1IAE A;  2DW0 A;  1OM7 A;  5L79 A;  1IAA A;  1SLN A;  3KRY A;  4WKE A;  1UTT A;  1YCM A;  1ZTQ A;  4XM6 A;  1TVI A;  4G0D A;  2DW2 A;  3DNG A;  3AYU A;  4A7B A;  3LUM A;  4R3V A;  1HTD A;  1R54 A;  2CLT A;  2SRT A;  1R1J A;  2X3B A;  4JPA A;  2OW1 A;  1JAO A;  2MLR A;  1BZS A;  3EDH A;  1J7N A;  2MLS A;  3LMC A;  3P1V A;  3Q2H A;  4GR8 A;  1EAK A;  1OO9 A;  1MMP A;  1KUI A;  4ILW D;  4AIG A;  1FLS A;  4DF9 A;  3LQ0 A;  4Q1L A;  2E3X A;  5D3C A;  3DTK A;  3TVC A;  4L63 A;  3LGP A;  1WNI A; 
#chains in the Genus database with same CATH homology
 3KEC A;  830C A;  1R55 A;  1KUK A;  3LJT A;  4JIJ A;  5CXA A;  3F17 A;  3F15 A;  4H82 A;  3AIG A;  2J0T A;  3DPF A;  4PKV A;  1ATL A;  3G5C A;  4ZR5 A;  1QIB A;  4DPE A;  4HMA A;  1PWU A;  3LKA A;  2MZH A;  5D1T A;  1ND1 A;  5JMY A;  1USN A;  3DTE A;  3EWJ A;  4PKS A;  4GR3 A;  5B5O A;  1GE6 A;  1UMT A;  3F16 A;  2ERP A;  2JIH A;  3LK8 A;  1IAC A;  2X3C A;  2W0D A;  1BKC I;  3ZUK A;  1ZXC A;  1RMZ A;  3N2V A;  3ZXH A;  3VI1 A;  4HX3 A;  2Y6C A;  1JK3 A;  2OXU A;  1IAG A;  4H3X A;  1XFU A;  3TSK A;  1HOV A;  3WV3 A;  3N2U A;  4EFS A;  1O0Q A;  3KME A;  5LAB A;  1JAN A;  3ELM A;  4I03 A;  1K7I A;  2WO9 A;  1D5J A;  4DD8 A;  2YUF A;  1EB6 A;  1XUR A;  4AUO A;  4PKR A;  1JH1 A;  3I7I A;  1K7Q A;  2WOA A;  3Q2G A;  2OW2 A;  4H30 A;  4PKU A;  2JNP A;  1XFZ A;  4PKW A;  5I3M A;  3EDZ A;  1KUH A;  4H84 A;  1UEA A;  1ZS0 A;  2JSD A;  2OY4 A;  4XBH A;  5L7F A;  1G49 A;  1QIA A;  2A8H A;  3U1R A;  1BKC E;  1G12 A;  2YIG A;  1ROS A;  1I73 A;  1A85 A;  1SRP A;  1C3I A;  1CIZ A;  1Z3J A;  5I0L A;  1D7X A;  4JP4 A;  3LJG A;  3B8Z A;  1IAD A;  3WV1 A;  2K9C A;  4JQG A;  1O0T A;  2D1O A;  3F19 A;  2AIG P;  4WKI A;  3LJZ A;  1AST A;  1HFC A;  3HY9 A;  966C A;  2OZR A;  4AXQ A;  1G9K A;  1GXD A;  1KAP P;  3VTG A;  4XM7 A;  2K2G A;  2DDF A;  5D7W A;  4GWN A;  5BOY A;  3EDG A;  2USN A;  456C A;  3LQB A;  1QJJ A;  1KUG A;  2FV5 A;  1GKC A;  4GWM A;  1RM8 A;  2OW9 A;  1EUB A;  3RTT A;  3KEK A;  1YOU A;  2OXZ A;  4FVL A;  1CK7 A;  2W14 A;  2X3A A;  1BQO A;  3HDA P;  1C8T A;  1SAT A;  2KRJ A;  4FU4 A;  3WV2 A;  1OS9 A;  3LEA A;  3UVC A;  3HB2 P;  2RJQ A;  5D1S A;  1MMB A;  1K7G A;  4GR0 A;  5I4O A;  1B8Y A;  1Y93 A;  3L0T A;  3TT4 A;  1OM8 A;  3LIR A;  1JJ9 A;  4H2E A;  2MZI A;  1XUD A;  1CGF A;  1S4B P;  1CXV A;  1ZP5 A;  4L19 A;  3TS4 A;  1UMS A;  1FM1 A;  3ZVS A;  2E2D A;  1HY7 A;  1MMR A;  1XFY A;  4QKZ A;  1CAQ A;  1KUF A;  2DW1 A;  1D8F A;  1BUD A;  3AYK A;  2YB9 A;  2CKI A;  1DTH A;  1SU3 A;  1I1I P;  1GO7 P;  1G4K A;  4JA1 A;  4L7A A;  4AYK A;  1JAQ A;  1BQQ M;  1BKC A;  3LIK A;  4WF6 A;  1CGE A;  4XCT A;  1QJI A;  4L6T A;  1XFW A;  3LUN A;  1PWP A;  3O64 A;  1OS2 A;  1JIW P;  1H71 P;  4GUY A;  3L0V A;  2N8R A;  2AYK A;  1C7K A;  5I12 A;  2PJT A;  1DMT A;  4XM8 A;  1AF0 A;  5I2Z A;  2OVZ A;  2O3E A;  1ZXV A;  1FBL A;  2OW0 A;  1Y8J A;  1L6J A;  3EDI A;  1B3D A;  2JT5 A;  4FXY P;  2XS3 A;  1R1H A;  2HU6 A;  4G9L A;  2DDY A;  1GE5 A;  1HV5 A;  1QIC A;  1AKL A;  3LE9 A;  3V96 B;  2WO8 A;  3DWB A;  2D1N A;  2L0R A;  2XS4 A;  2FV9 A;  4WK7 A;  3F18 A;  1XFV A;  2O36 A;  3G42 A;  1PWW A;  3K7N A;  5CUH A;  3I7G A;  4H49 A;  3EHY A;  1OM6 A;  2X7M A;  4H76 A;  2I47 A;  3HY7 A;  3CKI A;  5B5P A;  3KWV C;  1BIW A;  1JAP A;  3P24 A;  1PWV A;  2JT6 A;  5BOT A;  1HFS A;  3B92 A;  4PKT A;  1GE7 A;  4GQL A;  3USN A;  1AYK A;  1YQY A;  1OMJ A;  3OHO A;  1SMP A;  3MA2 A;  4IJO A;  3F1A A;  3B2Z A;  3SHI A;  3DL1 A;  1YP1 A;  4A3W A;  1D8M A;  1JKY A;  3BA0 A;  1KBC A;  4WZV A;  1UTZ A;  1XFX A;  5D2B A;  3DPE A;  5CZM A;  3GBO A;  1R1I A;  1I76 A;  4H1Q A;  5I43 A;  2OY2 A;  4GF1 A;  1BSW A;  3OHL A;  2MZE A;  3EHX A;  2QPJ A;  3LIL A;  3E8R A;  4J4M A;  4PKQ A;  3HYG A;  5H8X A;  3DTI A;  2ERQ A;  2W12 A;  1Y0V A;  1BM6 A;  1PWQ A;  1XUC A;  4I35 A;  1JIZ A;  5D1U A;  2OVX A;  2Y6D A;  3RTS A;  1ZVX A;  2V4B A;  3HDB A;  5BPA A;  1MNC A;  2W15 A;  2Z2D A;  2OI0 A;  1SLM A;  3KEJ A;  3O2X A;  1Q3A A;  1GO8 P;  2OXW A;  3K7L A;  2ERO A;  1GKD A;  3DSL A;  2TCL A;  4ON1 A;  3HBV P;  4DV8 A;  1G05 A;  3HBU P;  1QUA A;  3KHI A;  2POJ A;  2RJP A;  4FXQ A;  4CTH A;  1CQR A;  4IUW A;  3KMC A;  1BUV M;  1A86 A;  2J83 A;  3NX7 A;  2W13 A;  1MMQ A;  1CGL A;  1IAB A;  4IN9 A;  1IAE A;  2DW0 A;  1OM7 A;  5L79 A;  1IAA A;  1SLN A;  3KRY A;  4WKE A;  1UTT A;  1YCM A;  1ZTQ A;  4XM6 A;  4G0D A;  2DW2 A;  3DNG A;  3AYU A;  4A7B A;  3LUM A;  4R3V A;  1HTD A;  1R54 A;  2CLT A;  2SRT A;  1R1J A;  2X3B A;  4JPA A;  2OW1 A;  1JAO A;  2MLR A;  1BZS A;  3EDH A;  1J7N A;  2MLS A;  3LMC A;  3P1V A;  3Q2H A;  4GR8 A;  1EAK A;  1OO9 A;  1MMP A;  1KUI A;  4ILW D;  4AIG A;  1FLS A;  4DF9 A;  3LQ0 A;  4Q1L A;  2E3X A;  5D3C A;  3DTK A;  3TVC A;  4L63 A;  3LGP A;  1WNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...