2DW2A

Crystal structure of vap2 from crotalus atrox venom (form 2-5 crystal)
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
415
structure length
415
Chain Sequence
b'NPFRFVELVLVVDKAMVTKNNGDLDKIKTRMYEIVNTVNEIYRYMYIHVALVGLEIWSNEDKITVKPEAGYTLNAFGEWRKTDLLTRKKHDNAQLLTAIDLDRVIGLAYVGSMCHPKRSTGIIQDYSEINLVVAVIMAHEMGHNLGINHDSGYCSCGDYACIMRPEISPEPSTFFSNCSYFECWDFIMNHNPECILNEPLGTDIISPPVCGNELLEVGEECDCGTPENCQNECCDAATCKLKSGSQCGHGDCCEQCKFSKSGTECRASMSECDPAEHCTGQSSECPADVFHKNGQPCLDNYGYCYNGNCPIMYHQCYDLFGADVYEAEDSCFERNQKGNYYGYCRKENGNKIPCAPEDVKCGRLYCKDNSPGQNNPCKMFYSNEDEHKGMVLPGTKCADGKVCSNGHCVDVATAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catrocollastatin
publication title Crystal structures of catrocollastatin/VAP2B reveal a dynamic, modular architecture of ADAM/adamalysin/reprolysin family proteins
pubmed doi rcsb
molecule tags Apoptosis, toxin
total genus 117
structure length 415
sequence length 415
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00200 Disintegrin Disintegrin
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
A PF08516 ADAM_CR ADAM cysteine-rich
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2dw2A01
1MMQA 2XS3A 2FV5A 4H2EA 2E2DA 3G42A 4H49A 1K7GA 4IN9A 5D1UA 4XM7A 4ON1A 1USNA 2W12A 3SHIA 3HBUP 1C3IA 1A86A 5CZMA 1CIZA 3DL1A 3G5CA 5D1TA 1BIWA 3KRYA 3F17A 2DDFA 4L63A 2MLSA 2OW2A 1UMTA 2JNPA 5D1SA 1R1IA 1CXVA 3OHOA 2DW2A 1WNIA 1EB6A 2OXUA 3N2VA 2WO9A 1G05A 5I12A 5B5PA 1CAQA 2W0DA 1YP1A 3LGPA 4ZR5A 1XFVA 1JAQA 3F16A 2OY4A 4AXQA 5CXAA 3O2XA 2OZRA 1D8MA 1MMRA 3U1RA 3LEAA 3LIKA 3F15A 3EHYA 1GXDA 1EAKA 3CKIA 4A7BA 3B92A 2X7MA 1GE6A 3KMEA 2L0RA 1XUCA 1GE7A 1XFXA 1ZS0A 2DDYA 2OI0A 2OW0A 1CGEA 3EHXA 1OO9A 2MZEA 3LUNA 4H84A 1ZTQA 2J0TA 1YOUA 3WV2A 2W14A 3LQ0A 3EWJA 1BQQM 2XS4A 5JMYA 4GR0A 4H82A 3TT4A 2EROA 2J83A 2X3BA 1S4BP 2FV9A 1CGFA 1BM6A 4GQLA 1IAGA 5I2ZA 2E3XA 1DTHA 1KUGA 1PWPA 1CGLA 1XUDA 3MA2A 1H71P 4GF1A 1JAPA 1MMBA 1QJIA 1PWWA 2ERPA 4AUOA 2DW1A 4ILWD 1UEAA 4JIJA 1Q3AA 4PKWA 1JANA 2JSDA 3Q2HA 5LABA 3HY9A 1OS9A 1OM7A 3EDGA 5D7WA 1KUHA 2OVXA 1XURA 2W13A 1I73A 4JQGA 4GR8A 1SMPA 1ATLA 1R1JA 3I7GA 3L0VA 1PWUA 1YCMA 3TVCA 3LJZA 1AKLA 2JT5A 1D7XA 1OM8A 1O0QA 1R54A 3F18A 2AYKA 4FVLA 2MZHA 1ASTA 1SU3A 1D8FA 4PKUA 1HOVA 3K7NA 3VI1A 3O64A 2K9CA 1HTDA 4XCTA 3ZXHA 5I0LA 1IABA 2Y6CA 3LUMA 2YB9A 2QPJA 1BKCI 1ZP5A 4H30A 5BOTA 1JK3A 1GE5A 4DV8A 1BQOA 3LILA 966CA 2OW1A 1AF0A 1CK7A 2MLRA 3N2UA 1XFWA 1BSWA 2WO8A 1CQRA 2JIHA 3NX7A 4PKTA 4A3WA 1HFCA 1QICA 1K7IA 1GO8P 1B8YA 4FXQA 4WKEA 5L7FA 1BKCE 3LKAA 1HY7A 1G12A 1JAOA 2K2GA 4L19A 4EFSA 2O36A 1FLSA 4FU4A 1UTTA 1QIBA 5L79A 4R3VA 1O0TA 4WZVA 4L6TA 1L6JA 1EUBA 1MMPA 1OM6A 4H76A 2V4BA 3WV1A 3KEJA 1IACA 4HX3A 3Q2GA 3KWVC 3KEKA 2HU6A 2DW0A 2W15A 2YIGA 1KUKA 1K7QA 4XM8A 1GKDA 4JP4A 1KUFA 3DSLA 1SLMA 4J4MA 2CLTA 2N8RA 2X3CA 3RTSA 1HV5A 3K7LA 4FXYP 3HDBA 3EDZA 4DD8A 3B2ZA 1B3DA 3F1AA 2OY2A 1A85A 4WK7A 5I3MA 1Y8JA 4JA1A 1Y93A 1R55A 2D1OA 2OW9A 1BUVM 3KECA 1Y0VA 1JIZA 1FM1A 5D2BA 1QUAA 1HFSA 1UMSA 2I47A 1RM8A 2X3AA 2D1NA 3ZUKA 5B5OA 1IAAA 3LK8A 3EDHA 1ZVXA 1SLNA 5I4OA 1XFUA 5CUHA 4WF6A 3AYKA 2RJPA 4I03A 1D5JA 1JH1A 5D3CA 1JJ9A 830CA 1BZSA 4I35A 2A8HA 3USNA 2Y6DA 3LE9A 2USNA 3ELMA 1ND1A 1KAPP 1ROSA 3DPFA 4QKZA 2OXWA 1XFZA 1I76A 1G49A 3HB2P 1Z3JA 3OHLA 3DNGA 5BOYA 1PWVA 1JKYA 4AYKA 1GO7P 1MNCA 3WV3A 1J7NA 4DF9A 3AYUA 1R1HA 2JT6A 4HMAA 4DPEA 3AIGA 1FBLA 2RJQA 2OXZA 2WOAA 1IAEA 3LIRA 1IADA 3HYGA 2CKIA 1KUIA 3V96B 2AIGP 4H1QA 2ERQA 4Q1LA 5BPAA 3TS4A 4AIGA 4PKQA 3EDIA 1QIAA 3RTTA 1C8TA 4GUYA 1OS2A 1I1IP 1GKCA 4PKSA 3LJGA 3HDAP 3DWBA 456CA 4G0DA 3BA0A 4WKIA 3LMCA 1AYKA 2KRJA 1OMJA 1G4KA 3DPEA 1JIWP 3P24A 1C7KA 1DMTA 2OVZA 3KHIA 4PKRA 4CTHA 4PKVA 3GBOA 4IUWA 5H8XA 2PJTA 1RMZA 3E8RA 2SRTA 3B8ZA 1BUDA 3F19A 4H3XA 1UTZA 3VTGA 4GWNA 1QJJA 1YQYA 3UVCA 1KBCA 3KMCA 2MZIA 2O3EA 1BKCA 3LJTA 3L0TA 3P1VA 4GWMA 4JPAA 1ZXCA 1G9KA 1XFYA 3I7IA 3TSKA 2TCLA 1SRPA 3ZVSA 1ZXVA 5I43A 1PWQA 4XBHA 4XM6A 2Z2DA 4IJOA 4G9LA 3LQBA 4GR3A 1SATA 2POJA 3HY7A 3HBVP
chains in the Genus database with same CATH superfamily
1MMQA 2XS3A 2FV5A 4H2EA 2E2DA 3G42A 4H49A 1K7GA 4IN9A 5D1UA 4XM7A 4ON1A 1USNA 2W12A 3SHIA 3HBUP 1C3IA 1A86A 5CZMA 1CIZA 3DL1A 3G5CA 5D1TA 1BIWA 3KRYA 3F17A 2DDFA 4L63A 2MLSA 2OW2A 1UMTA 1TVIA 2JNPA 5D1SA 1R1IA 1CXVA 3OHOA 2DW2A 1WNIA 1EB6A 2OXUA 3N2VA 2WO9A 1G05A 5I12A 5B5PA 1CAQA 2W0DA 1YP1A 3LGPA 4ZR5A 2YUFA 1XFVA 1JAQA 3F16A 2OY4A 4AXQA 5CXAA 3O2XA 2OZRA 1D8MA 1MMRA 3U1RA 3LEAA 3LIKA 3F15A 3EHYA 1GXDA 1EAKA 1OZ9A 3CKIA 4A7BA 3B92A 2X7MA 1GE6A 3KMEA 2L0RA 1XUCA 1GE7A 1XFXA 1ZS0A 2DDYA 2OI0A 2OW0A 1CGEA 3EHXA 1OO9A 2MZEA 3LUNA 4H84A 1ZTQA 2J0TA 1YOUA 3WV2A 2W14A 3LQ0A 3EWJA 1BQQM 2XS4A 5JMYA 4GR0A 4H82A 3TT4A 2EROA 2J83A 2X3BA 1S4BP 2FV9A 1CGFA 1BM6A 4GQLA 1IAGA 5I2ZA 2E3XA 1DTHA 1KUGA 1PWPA 1CGLA 1XUDA 3MA2A 1H71P 4GF1A 1JAPA 1MMBA 1QJIA 1PWWA 2ERPA 4AUOA 2DW1A 4ILWD 1UEAA 4JIJA 4L7AA 1Q3AA 4PKWA 1JANA 2JSDA 3Q2HA 5LABA 3HY9A 1OS9A 3DTKA 1OM7A 3EDGA 5D7WA 1KUHA 2OVXA 1XURA 2W13A 1I73A 4JQGA 4GR8A 1SMPA 1ATLA 1R1JA 3I7GA 3L0VA 1PWUA 1YCMA 3TVCA 3LJZA 1AKLA 2JT5A 1D7XA 1OM8A 1O0QA 1XAXA 1R54A 3F18A 2AYKA 4FVLA 2MZHA 1ASTA 1SU3A 1D8FA 4PKUA 1HOVA 3K7NA 3VI1A 3O64A 2K9CA 1HTDA 4XCTA 3ZXHA 5I0LA 1IABA 2Y6CA 3LUMA 2YB9A 2QPJA 1BKCI 1ZP5A 4H30A 5BOTA 1JK3A 1GE5A 4DV8A 1BQOA 3LILA 966CA 2OW1A 1AF0A 1CK7A 2MLRA 3N2UA 1XFWA 1BSWA 2WO8A 1CQRA 2JIHA 3NX7A 4PKTA 4A3WA 1HFCA 1QICA 1K7IA 1GO8P 1B8YA 4FXQA 4WKEA 5L7FA 1XM5A 1BKCE 3LKAA 1HY7A 1G12A 1JAOA 2K2GA 4L19A 4EFSA 2O36A 1FLSA 4FU4A 1UTTA 1QIBA 5L79A 4R3VA 1O0TA 4WZVA 4L6TA 1L6JA 1EUBA 1MMPA 1OM6A 4H76A 2V4BA 3WV1A 3KEJA 1IACA 4HX3A 3Q2GA 3KWVC 3KEKA 2HU6A 2DW0A 2W15A 3DTIA 2YIGA 1KUKA 1K7QA 4XM8A 1GKDA 4JP4A 1KUFA 3DSLA 1SLMA 4J4MA 2CLTA 2N8RA 2X3CA 3RTSA 1HV5A 3K7LA 4FXYP 3HDBA 3EDZA 4DD8A 3B2ZA 1B3DA 3F1AA 2OY2A 1A85A 4WK7A 5I3MA 1Y8JA 4JA1A 1Y93A 1R55A 2D1OA 2OW9A 1BUVM 3KECA 1Y0VA 1JIZA 1FM1A 5D2BA 1QUAA 1HFSA 1UMSA 2I47A 1RM8A 2X3AA 2D1NA 3ZUKA 5B5OA 1IAAA 3LK8A 3EDHA 1ZVXA 1SLNA 5I4OA 1XFUA 5CUHA 4WF6A 3AYKA 2RJPA 4I03A 1D5JA 1JH1A 5D3CA 1JJ9A 830CA 1BZSA 4I35A 2A8HA 3USNA 3LE9A 2Y6DA 2USNA 3ELMA 1ND1A 1KAPP 1ROSA 3DPFA 4QKZA 2OXWA 1XFZA 1I76A 1G49A 3HB2P 1Z3JA 3OHLA 3DNGA 5BOYA 1PWVA 1JKYA 4AYKA 1GO7P 1MNCA 3DTEA 3WV3A 1J7NA 4DF9A 3AYUA 1R1HA 2JT6A 4HMAA 4DPEA 3AIGA 1FBLA 2RJQA 2OXZA 2WOAA 1IAEA 3LIRA 1IADA 3HYGA 2CKIA 1KUIA 3V96B 2AIGP 4H1QA 2ERQA 4Q1LA 5BPAA 3TS4A 4AIGA 4PKQA 3EDIA 1QIAA 3RTTA 1C8TA 4GUYA 1OS2A 1I1IP 1GKCA 4PKSA 3LJGA 3HDAP 3DWBA 456CA 4G0DA 3BA0A 4WKIA 3LMCA 1AYKA 2KRJA 1OMJA 1G4KA 3DPEA 1JIWP 3P24A 1C7KA 1DMTA 2OVZA 3KHIA 4PKRA 4CTHA 4PKVA 3GBOA 4IUWA 5H8XA 2PJTA 1RMZA 3E8RA 2SRTA 3B8ZA 1BUDA 3F19A 4H3XA 1UTZA 3VTGA 4GWNA 1QJJA 1YQYA 3UVCA 1KBCA 3KMCA 2MZIA 2O3EA 1BKCA 3LJTA 3L0TA 3P1VA 4GWMA 4JPAA 1ZXCA 1G9KA 1XFYA 3I7IA 3TSKA 2TCLA 1SRPA 3ZVSA 1ZXVA 5I43A 1PWQA 4XBHA 4XM6A 2Z2DA 4IJOA 4G9LA 3LQBA 4GR3A 1SATA 2POJA 3HY7A 3HBVP
chains in the Genus database with same CATH topology
1MMQA 2XS3A 2FV5A 4H2EA 2E2DA 3G42A 4H49A 1K7GA 4IN9A 5D1UA 4XM7A 4ON1A 1USNA 2W12A 3SHIA 3HBUP 1C3IA 1A86A 5CZMA 1CIZA 3DL1A 3G5CA 5D1TA 1BIWA 3KRYA 3F17A 2DDFA 4L63A 2MLSA 2OW2A 1UMTA 2JNPA 5D1SA 1R1IA 1CXVA 3OHOA 2DW2A 1WNIA 1EB6A 2OXUA 3N2VA 2WO9A 1G05A 5I12A 5B5PA 1CAQA 2W0DA 1YP1A 3LGPA 4ZR5A 2YUFA 1XFVA 1JAQA 3F16A 2OY4A 4AXQA 5CXAA 3O2XA 2OZRA 1D8MA 1MMRA 3U1RA 3LEAA 3LIKA 3F15A 3EHYA 1GXDA 1EAKA 3CKIA 4A7BA 3B92A 2X7MA 1GE6A 3KMEA 2L0RA 1XUCA 1GE7A 1XFXA 1ZS0A 2DDYA 2OI0A 2OW0A 1CGEA 3EHXA 1OO9A 2MZEA 3LUNA 4H84A 1ZTQA 2J0TA 1YOUA 3WV2A 2W14A 3LQ0A 3EWJA 1BQQM 2XS4A 5JMYA 4GR0A 4H82A 3TT4A 2EROA 2J83A 2X3BA 1S4BP 2FV9A 1CGFA 1BM6A 4GQLA 1IAGA 5I2ZA 2E3XA 1DTHA 1KUGA 1PWPA 1CGLA 1XUDA 3MA2A 1H71P 4GF1A 1JAPA 1MMBA 1QJIA 1PWWA 2ERPA 4AUOA 2DW1A 4ILWD 1UEAA 4JIJA 4L7AA 1Q3AA 4PKWA 1JANA 2JSDA 3Q2HA 5LABA 3HY9A 1OS9A 3DTKA 1OM7A 3EDGA 5D7WA 1KUHA 2OVXA 1XURA 2W13A 1I73A 4JQGA 4GR8A 1SMPA 1ATLA 1R1JA 3I7GA 3L0VA 1PWUA 1YCMA 3TVCA 3LJZA 1AKLA 2JT5A 1D7XA 1OM8A 1O0QA 1R54A 3F18A 2AYKA 4FVLA 2MZHA 1ASTA 1SU3A 1D8FA 4PKUA 1HOVA 3K7NA 3VI1A 3O64A 2K9CA 1HTDA 4XCTA 3ZXHA 5I0LA 1IABA 2Y6CA 3LUMA 2YB9A 2QPJA 1BKCI 1ZP5A 4H30A 5BOTA 1JK3A 1GE5A 4DV8A 1BQOA 3LILA 966CA 2OW1A 1AF0A 1CK7A 2MLRA 3N2UA 1XFWA 1BSWA 2WO8A 1CQRA 2JIHA 3NX7A 4PKTA 4A3WA 1HFCA 1QICA 1K7IA 1GO8P 1B8YA 4FXQA 4WKEA 5L7FA 1BKCE 3LKAA 1HY7A 1G12A 1JAOA 2K2GA 4L19A 4EFSA 2O36A 1FLSA 4FU4A 1UTTA 1QIBA 5L79A 4R3VA 1O0TA 4WZVA 4L6TA 1L6JA 1EUBA 1MMPA 1OM6A 4H76A 2V4BA 3WV1A 3KEJA 1IACA 4HX3A 3Q2GA 3KWVC 3KEKA 2HU6A 2DW0A 2W15A 3DTIA 2YIGA 1KUKA 1K7QA 4XM8A 1GKDA 4JP4A 1KUFA 3DSLA 1SLMA 4J4MA 2CLTA 2N8RA 2X3CA 3RTSA 1HV5A 3K7LA 4FXYP 3HDBA 3EDZA 4DD8A 3B2ZA 1B3DA 3F1AA 2OY2A 1A85A 4WK7A 5I3MA 1Y8JA 4JA1A 1Y93A 1R55A 2D1OA 2OW9A 1BUVM 3KECA 1Y0VA 1JIZA 1FM1A 5D2BA 1QUAA 1HFSA 1UMSA 2I47A 1RM8A 2X3AA 2D1NA 3ZUKA 5B5OA 1IAAA 3LK8A 3EDHA 1ZVXA 1SLNA 5I4OA 1XFUA 5CUHA 4WF6A 3AYKA 2RJPA 4I03A 1D5JA 1JH1A 5D3CA 1JJ9A 830CA 1BZSA 4I35A 2A8HA 3USNA 2Y6DA 3LE9A 2USNA 3ELMA 1ND1A 1KAPP 1ROSA 3DPFA 4QKZA 2OXWA 1XFZA 1I76A 1G49A 3HB2P 1Z3JA 3OHLA 3DNGA 5BOYA 1PWVA 1JKYA 4AYKA 1GO7P 1MNCA 3DTEA 3WV3A 1J7NA 4DF9A 3AYUA 1R1HA 2JT6A 4HMAA 4DPEA 3AIGA 1FBLA 2RJQA 2OXZA 2WOAA 1IAEA 3LIRA 1IADA 3HYGA 2CKIA 1KUIA 3V96B 2AIGP 4H1QA 2ERQA 4Q1LA 5BPAA 3TS4A 4AIGA 4PKQA 3EDIA 1QIAA 3RTTA 1C8TA 4GUYA 1OS2A 1I1IP 1GKCA 4PKSA 3LJGA 3HDAP 3DWBA 456CA 4G0DA 3BA0A 4WKIA 3LMCA 1AYKA 2KRJA 1OMJA 1G4KA 3DPEA 1JIWP 3P24A 1C7KA 1DMTA 2OVZA 3KHIA 4PKRA 4CTHA 4PKVA 3GBOA 4IUWA 5H8XA 2PJTA 1RMZA 3E8RA 2SRTA 3B8ZA 1BUDA 3F19A 4H3XA 1UTZA 3VTGA 4GWNA 1QJJA 1YQYA 3UVCA 1KBCA 3KMCA 2MZIA 2O3EA 1BKCA 3LJTA 3L0TA 3P1VA 4GWMA 4JPAA 1ZXCA 1G9KA 1XFYA 3I7IA 3TSKA 2TCLA 1SRPA 3ZVSA 1ZXVA 5I43A 1PWQA 4XBHA 4XM6A 2Z2DA 4IJOA 4G9LA 3LQBA 4GR3A 1SATA 2POJA 3HY7A 3HBVP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MMQ A;  2XS3 A;  2FV5 A;  4H2E A;  2E2D A;  3G42 A;  4H49 A;  1K7G A;  4IN9 A;  5D1U A;  4XM7 A;  4ON1 A;  1USN A;  2W12 A;  3SHI A;  3HBU P;  1C3I A;  1A86 A;  5CZM A;  1CIZ A;  3DL1 A;  3G5C A;  5D1T A;  1BIW A;  3KRY A;  3F17 A;  2DDF A;  4L63 A;  2MLS A;  2OW2 A;  1UMT A;  2JNP A;  5D1S A;  1R1I A;  1CXV A;  3OHO A;  2DW2 A;  1WNI A;  1EB6 A;  2OXU A;  3N2V A;  2WO9 A;  1G05 A;  5I12 A;  5B5P A;  1CAQ A;  2W0D A;  1YP1 A;  3LGP A;  4ZR5 A;  1XFV A;  1JAQ A;  3F16 A;  2OY4 A;  4AXQ A;  5CXA A;  3O2X A;  2OZR A;  1D8M A;  1MMR A;  3U1R A;  3LEA A;  3LIK A;  3F15 A;  3EHY A;  1GXD A;  1EAK A;  3CKI A;  4A7B A;  3B92 A;  2X7M A;  1GE6 A;  3KME A;  2L0R A;  1XUC A;  1GE7 A;  1XFX A;  1ZS0 A;  2DDY A;  2OI0 A;  2OW0 A;  1CGE A;  3EHX A;  1OO9 A;  2MZE A;  3LUN A;  4H84 A;  1ZTQ A;  2J0T A;  1YOU A;  3WV2 A;  2W14 A;  3LQ0 A;  3EWJ A;  1BQQ M;  2XS4 A;  5JMY A;  4GR0 A;  4H82 A;  3TT4 A;  2ERO A;  2J83 A;  2X3B A;  1S4B P;  2FV9 A;  1CGF A;  1BM6 A;  4GQL A;  1IAG A;  5I2Z A;  2E3X A;  1DTH A;  1KUG A;  1PWP A;  1CGL A;  1XUD A;  3MA2 A;  1H71 P;  4GF1 A;  1JAP A;  1MMB A;  1QJI A;  1PWW A;  2ERP A;  4AUO A;  2DW1 A;  4ILW D;  1UEA A;  4JIJ A;  1Q3A A;  4PKW A;  1JAN A;  2JSD A;  3Q2H A;  5LAB A;  3HY9 A;  1OS9 A;  1OM7 A;  3EDG A;  5D7W A;  1KUH A;  2OVX A;  1XUR A;  2W13 A;  1I73 A;  4JQG A;  4GR8 A;  1SMP A;  1ATL A;  1R1J A;  3I7G A;  3L0V A;  1PWU A;  1YCM A;  3TVC A;  3LJZ A;  1AKL A;  2JT5 A;  1D7X A;  1OM8 A;  1O0Q A;  1R54 A;  3F18 A;  2AYK A;  4FVL A;  2MZH A;  1AST A;  1SU3 A;  1D8F A;  4PKU A;  1HOV A;  3K7N A;  3VI1 A;  3O64 A;  2K9C A;  1HTD A;  4XCT A;  3ZXH A;  5I0L A;  1IAB A;  2Y6C A;  3LUM A;  2YB9 A;  2QPJ A;  1BKC I;  1ZP5 A;  4H30 A;  5BOT A;  1JK3 A;  1GE5 A;  4DV8 A;  1BQO A;  3LIL A;  966C A;  2OW1 A;  1AF0 A;  1CK7 A;  2MLR A;  3N2U A;  1XFW A;  1BSW A;  2WO8 A;  1CQR A;  2JIH A;  3NX7 A;  4PKT A;  4A3W A;  1HFC A;  1QIC A;  1K7I A;  1GO8 P;  1B8Y A;  4FXQ A;  4WKE A;  5L7F A;  1BKC E;  3LKA A;  1HY7 A;  1G12 A;  1JAO A;  2K2G A;  4L19 A;  4EFS A;  2O36 A;  1FLS A;  4FU4 A;  1UTT A;  1QIB A;  5L79 A;  4R3V A;  1O0T A;  4WZV A;  4L6T A;  1L6J A;  1EUB A;  1MMP A;  1OM6 A;  4H76 A;  2V4B A;  3WV1 A;  3KEJ A;  1IAC A;  4HX3 A;  3Q2G A;  3KWV C;  3KEK A;  2HU6 A;  2DW0 A;  2W15 A;  2YIG A;  1KUK A;  1K7Q A;  4XM8 A;  1GKD A;  4JP4 A;  1KUF A;  3DSL A;  1SLM A;  4J4M A;  2CLT A;  2N8R A;  2X3C A;  3RTS A;  1HV5 A;  3K7L A;  4FXY P;  3HDB A;  3EDZ A;  4DD8 A;  3B2Z A;  1B3D A;  3F1A A;  2OY2 A;  1A85 A;  4WK7 A;  5I3M A;  1Y8J A;  4JA1 A;  1Y93 A;  1R55 A;  2D1O A;  2OW9 A;  1BUV M;  3KEC A;  1Y0V A;  1JIZ A;  1FM1 A;  5D2B A;  1QUA A;  1HFS A;  1UMS A;  2I47 A;  1RM8 A;  2X3A A;  2D1N A;  3ZUK A;  5B5O A;  1IAA A;  3LK8 A;  3EDH A;  1ZVX A;  1SLN A;  5I4O A;  1XFU A;  5CUH A;  4WF6 A;  3AYK A;  2RJP A;  4I03 A;  1D5J A;  1JH1 A;  5D3C A;  1JJ9 A;  830C A;  1BZS A;  4I35 A;  2A8H A;  3USN A;  2Y6D A;  3LE9 A;  2USN A;  3ELM A;  1ND1 A;  1KAP P;  1ROS A;  3DPF A;  4QKZ A;  2OXW A;  1XFZ A;  1I76 A;  1G49 A;  3HB2 P;  1Z3J A;  3OHL A;  3DNG A;  5BOY A;  1PWV A;  1JKY A;  4AYK A;  1GO7 P;  1MNC A;  3WV3 A;  1J7N A;  4DF9 A;  3AYU A;  1R1H A;  2JT6 A;  4HMA A;  4DPE A;  3AIG A;  1FBL A;  2RJQ A;  2OXZ A;  2WOA A;  1IAE A;  3LIR A;  1IAD A;  3HYG A;  2CKI A;  1KUI A;  3V96 B;  2AIG P;  4H1Q A;  2ERQ A;  4Q1L A;  5BPA A;  3TS4 A;  4AIG A;  4PKQ A;  3EDI A;  1QIA A;  3RTT A;  1C8T A;  4GUY A;  1OS2 A;  1I1I P;  1GKC A;  4PKS A;  3LJG A;  3HDA P;  3DWB A;  456C A;  4G0D A;  3BA0 A;  4WKI A;  3LMC A;  1AYK A;  2KRJ A;  1OMJ A;  1G4K A;  3DPE A;  1JIW P;  3P24 A;  1C7K A;  1DMT A;  2OVZ A;  3KHI A;  4PKR A;  4CTH A;  4PKV A;  3GBO A;  4IUW A;  5H8X A;  2PJT A;  1RMZ A;  3E8R A;  2SRT A;  3B8Z A;  1BUD A;  3F19 A;  4H3X A;  1UTZ A;  3VTG A;  4GWN A;  1QJJ A;  1YQY A;  3UVC A;  1KBC A;  3KMC A;  2MZI A;  2O3E A;  1BKC A;  3LJT A;  3L0T A;  3P1V A;  4GWM A;  4JPA A;  1ZXC A;  1G9K A;  1XFY A;  3I7I A;  3TSK A;  2TCL A;  1SRP A;  3ZVS A;  1ZXV A;  5I43 A;  1PWQ A;  4XBH A;  4XM6 A;  2Z2D A;  4IJO A;  4G9L A;  3LQB A;  4GR3 A;  1SAT A;  2POJ A;  3HY7 A;  3HBV P; 
#chains in the Genus database with same CATH topology
 1MMQ A;  2XS3 A;  2FV5 A;  4H2E A;  2E2D A;  3G42 A;  4H49 A;  1K7G A;  4IN9 A;  5D1U A;  4XM7 A;  4ON1 A;  1USN A;  2W12 A;  3SHI A;  3HBU P;  1C3I A;  1A86 A;  5CZM A;  1CIZ A;  3DL1 A;  3G5C A;  5D1T A;  1BIW A;  3KRY A;  3F17 A;  2DDF A;  4L63 A;  2MLS A;  2OW2 A;  1UMT A;  1TVI A;  2JNP A;  5D1S A;  1R1I A;  1CXV A;  3OHO A;  2DW2 A;  1WNI A;  1EB6 A;  2OXU A;  3N2V A;  2WO9 A;  1G05 A;  5I12 A;  5B5P A;  1CAQ A;  2W0D A;  1YP1 A;  3LGP A;  4ZR5 A;  2YUF A;  1XFV A;  1JAQ A;  3F16 A;  2OY4 A;  4AXQ A;  5CXA A;  3O2X A;  2OZR A;  1D8M A;  1MMR A;  3U1R A;  3LEA A;  3LIK A;  3F15 A;  3EHY A;  1GXD A;  1EAK A;  1OZ9 A;  3CKI A;  4A7B A;  3B92 A;  2X7M A;  1GE6 A;  3KME A;  2L0R A;  1XUC A;  1GE7 A;  1XFX A;  1ZS0 A;  2DDY A;  2OI0 A;  2OW0 A;  1CGE A;  3EHX A;  1OO9 A;  2MZE A;  3LUN A;  4H84 A;  1ZTQ A;  2J0T A;  1YOU A;  3WV2 A;  2W14 A;  3LQ0 A;  3EWJ A;  1BQQ M;  2XS4 A;  5JMY A;  4GR0 A;  4H82 A;  3TT4 A;  2ERO A;  2J83 A;  2X3B A;  1S4B P;  2FV9 A;  1CGF A;  1BM6 A;  4GQL A;  1IAG A;  5I2Z A;  2E3X A;  1DTH A;  1KUG A;  1PWP A;  1CGL A;  1XUD A;  3MA2 A;  1H71 P;  4GF1 A;  1JAP A;  1MMB A;  1QJI A;  1PWW A;  2ERP A;  4AUO A;  2DW1 A;  4ILW D;  1UEA A;  4JIJ A;  4L7A A;  1Q3A A;  4PKW A;  1JAN A;  2JSD A;  3Q2H A;  5LAB A;  3HY9 A;  1OS9 A;  3DTK A;  1OM7 A;  3EDG A;  5D7W A;  1KUH A;  2OVX A;  1XUR A;  2W13 A;  1I73 A;  4JQG A;  4GR8 A;  1SMP A;  1ATL A;  1R1J A;  3I7G A;  3L0V A;  1PWU A;  1YCM A;  3TVC A;  3LJZ A;  1AKL A;  2JT5 A;  1D7X A;  1OM8 A;  1O0Q A;  1XAX A;  1R54 A;  3F18 A;  2AYK A;  4FVL A;  2MZH A;  1AST A;  1SU3 A;  1D8F A;  4PKU A;  1HOV A;  3K7N A;  3VI1 A;  3O64 A;  2K9C A;  1HTD A;  4XCT A;  3ZXH A;  5I0L A;  1IAB A;  2Y6C A;  3LUM A;  2YB9 A;  2QPJ A;  1BKC I;  1ZP5 A;  4H30 A;  5BOT A;  1JK3 A;  1GE5 A;  4DV8 A;  1BQO A;  3LIL A;  966C A;  2OW1 A;  1AF0 A;  1CK7 A;  2MLR A;  3N2U A;  1XFW A;  1BSW A;  2WO8 A;  1CQR A;  2JIH A;  3NX7 A;  4PKT A;  4A3W A;  1HFC A;  1QIC A;  1K7I A;  1GO8 P;  1B8Y A;  4FXQ A;  4WKE A;  5L7F A;  1XM5 A;  1BKC E;  3LKA A;  1HY7 A;  1G12 A;  1JAO A;  2K2G A;  4L19 A;  4EFS A;  2O36 A;  1FLS A;  4FU4 A;  1UTT A;  1QIB A;  5L79 A;  4R3V A;  1O0T A;  4WZV A;  4L6T A;  1L6J A;  1EUB A;  1MMP A;  1OM6 A;  4H76 A;  2V4B A;  3WV1 A;  3KEJ A;  1IAC A;  4HX3 A;  3Q2G A;  3KWV C;  3KEK A;  2HU6 A;  2DW0 A;  2W15 A;  3DTI A;  2YIG A;  1KUK A;  1K7Q A;  4XM8 A;  1GKD A;  4JP4 A;  1KUF A;  3DSL A;  1SLM A;  4J4M A;  2CLT A;  2N8R A;  2X3C A;  3RTS A;  1HV5 A;  3K7L A;  4FXY P;  3HDB A;  3EDZ A;  4DD8 A;  3B2Z A;  1B3D A;  3F1A A;  2OY2 A;  1A85 A;  4WK7 A;  5I3M A;  1Y8J A;  4JA1 A;  1Y93 A;  1R55 A;  2D1O A;  2OW9 A;  1BUV M;  3KEC A;  1Y0V A;  1JIZ A;  1FM1 A;  5D2B A;  1QUA A;  1HFS A;  1UMS A;  2I47 A;  1RM8 A;  2X3A A;  2D1N A;  3ZUK A;  5B5O A;  1IAA A;  3LK8 A;  3EDH A;  1ZVX A;  1SLN A;  5I4O A;  1XFU A;  5CUH A;  4WF6 A;  3AYK A;  2RJP A;  4I03 A;  1D5J A;  1JH1 A;  5D3C A;  1JJ9 A;  830C A;  1BZS A;  4I35 A;  2A8H A;  3USN A;  3LE9 A;  2Y6D A;  2USN A;  3ELM A;  1ND1 A;  1KAP P;  1ROS A;  3DPF A;  4QKZ A;  2OXW A;  1XFZ A;  1I76 A;  1G49 A;  3HB2 P;  1Z3J A;  3OHL A;  3DNG A;  5BOY A;  1PWV A;  1JKY A;  4AYK A;  1GO7 P;  1MNC A;  3DTE A;  3WV3 A;  1J7N A;  4DF9 A;  3AYU A;  1R1H A;  2JT6 A;  4HMA A;  4DPE A;  3AIG A;  1FBL A;  2RJQ A;  2OXZ A;  2WOA A;  1IAE A;  3LIR A;  1IAD A;  3HYG A;  2CKI A;  1KUI A;  3V96 B;  2AIG P;  4H1Q A;  2ERQ A;  4Q1L A;  5BPA A;  3TS4 A;  4AIG A;  4PKQ A;  3EDI A;  1QIA A;  3RTT A;  1C8T A;  4GUY A;  1OS2 A;  1I1I P;  1GKC A;  4PKS A;  3LJG A;  3HDA P;  3DWB A;  456C A;  4G0D A;  3BA0 A;  4WKI A;  3LMC A;  1AYK A;  2KRJ A;  1OMJ A;  1G4K A;  3DPE A;  1JIW P;  3P24 A;  1C7K A;  1DMT A;  2OVZ A;  3KHI A;  4PKR A;  4CTH A;  4PKV A;  3GBO A;  4IUW A;  5H8X A;  2PJT A;  1RMZ A;  3E8R A;  2SRT A;  3B8Z A;  1BUD A;  3F19 A;  4H3X A;  1UTZ A;  3VTG A;  4GWN A;  1QJJ A;  1YQY A;  3UVC A;  1KBC A;  3KMC A;  2MZI A;  2O3E A;  1BKC A;  3LJT A;  3L0T A;  3P1V A;  4GWM A;  4JPA A;  1ZXC A;  1G9K A;  1XFY A;  3I7I A;  3TSK A;  2TCL A;  1SRP A;  3ZVS A;  1ZXV A;  5I43 A;  1PWQ A;  4XBH A;  4XM6 A;  2Z2D A;  4IJO A;  4G9L A;  3LQB A;  4GR3 A;  1SAT A;  2POJ A;  3HY7 A;  3HBV P; 
#chains in the Genus database with same CATH homology
 1MMQ A;  2XS3 A;  2FV5 A;  4H2E A;  2E2D A;  3G42 A;  4H49 A;  1K7G A;  4IN9 A;  5D1U A;  4XM7 A;  4ON1 A;  1USN A;  2W12 A;  3SHI A;  3HBU P;  1C3I A;  1A86 A;  5CZM A;  1CIZ A;  3DL1 A;  3G5C A;  5D1T A;  1BIW A;  3KRY A;  3F17 A;  2DDF A;  4L63 A;  2MLS A;  2OW2 A;  1UMT A;  2JNP A;  5D1S A;  1R1I A;  1CXV A;  3OHO A;  2DW2 A;  1WNI A;  1EB6 A;  2OXU A;  3N2V A;  2WO9 A;  1G05 A;  5I12 A;  5B5P A;  1CAQ A;  2W0D A;  1YP1 A;  3LGP A;  4ZR5 A;  2YUF A;  1XFV A;  1JAQ A;  3F16 A;  2OY4 A;  4AXQ A;  5CXA A;  3O2X A;  2OZR A;  1D8M A;  1MMR A;  3U1R A;  3LEA A;  3LIK A;  3F15 A;  3EHY A;  1GXD A;  1EAK A;  3CKI A;  4A7B A;  3B92 A;  2X7M A;  1GE6 A;  3KME A;  2L0R A;  1XUC A;  1GE7 A;  1XFX A;  1ZS0 A;  2DDY A;  2OI0 A;  2OW0 A;  1CGE A;  3EHX A;  1OO9 A;  2MZE A;  3LUN A;  4H84 A;  1ZTQ A;  2J0T A;  1YOU A;  3WV2 A;  2W14 A;  3LQ0 A;  3EWJ A;  1BQQ M;  2XS4 A;  5JMY A;  4GR0 A;  4H82 A;  3TT4 A;  2ERO A;  2J83 A;  2X3B A;  1S4B P;  2FV9 A;  1CGF A;  1BM6 A;  4GQL A;  1IAG A;  5I2Z A;  2E3X A;  1DTH A;  1KUG A;  1PWP A;  1CGL A;  1XUD A;  3MA2 A;  1H71 P;  4GF1 A;  1JAP A;  1MMB A;  1QJI A;  1PWW A;  2ERP A;  4AUO A;  2DW1 A;  4ILW D;  1UEA A;  4JIJ A;  4L7A A;  1Q3A A;  4PKW A;  1JAN A;  2JSD A;  3Q2H A;  5LAB A;  3HY9 A;  1OS9 A;  3DTK A;  1OM7 A;  3EDG A;  5D7W A;  1KUH A;  2OVX A;  1XUR A;  2W13 A;  1I73 A;  4JQG A;  4GR8 A;  1SMP A;  1ATL A;  1R1J A;  3I7G A;  3L0V A;  1PWU A;  1YCM A;  3TVC A;  3LJZ A;  1AKL A;  2JT5 A;  1D7X A;  1OM8 A;  1O0Q A;  1R54 A;  3F18 A;  2AYK A;  4FVL A;  2MZH A;  1AST A;  1SU3 A;  1D8F A;  4PKU A;  1HOV A;  3K7N A;  3VI1 A;  3O64 A;  2K9C A;  1HTD A;  4XCT A;  3ZXH A;  5I0L A;  1IAB A;  2Y6C A;  3LUM A;  2YB9 A;  2QPJ A;  1BKC I;  1ZP5 A;  4H30 A;  5BOT A;  1JK3 A;  1GE5 A;  4DV8 A;  1BQO A;  3LIL A;  966C A;  2OW1 A;  1AF0 A;  1CK7 A;  2MLR A;  3N2U A;  1XFW A;  1BSW A;  2WO8 A;  1CQR A;  2JIH A;  3NX7 A;  4PKT A;  4A3W A;  1HFC A;  1QIC A;  1K7I A;  1GO8 P;  1B8Y A;  4FXQ A;  4WKE A;  5L7F A;  1BKC E;  3LKA A;  1HY7 A;  1G12 A;  1JAO A;  2K2G A;  4L19 A;  4EFS A;  2O36 A;  1FLS A;  4FU4 A;  1UTT A;  1QIB A;  5L79 A;  4R3V A;  1O0T A;  4WZV A;  4L6T A;  1L6J A;  1EUB A;  1MMP A;  1OM6 A;  4H76 A;  2V4B A;  3WV1 A;  3KEJ A;  1IAC A;  4HX3 A;  3Q2G A;  3KWV C;  3KEK A;  2HU6 A;  2DW0 A;  2W15 A;  3DTI A;  2YIG A;  1KUK A;  1K7Q A;  4XM8 A;  1GKD A;  4JP4 A;  1KUF A;  3DSL A;  1SLM A;  4J4M A;  2CLT A;  2N8R A;  2X3C A;  3RTS A;  1HV5 A;  3K7L A;  4FXY P;  3HDB A;  3EDZ A;  4DD8 A;  3B2Z A;  1B3D A;  3F1A A;  2OY2 A;  1A85 A;  4WK7 A;  5I3M A;  1Y8J A;  4JA1 A;  1Y93 A;  1R55 A;  2D1O A;  2OW9 A;  1BUV M;  3KEC A;  1Y0V A;  1JIZ A;  1FM1 A;  5D2B A;  1QUA A;  1HFS A;  1UMS A;  2I47 A;  1RM8 A;  2X3A A;  2D1N A;  3ZUK A;  5B5O A;  1IAA A;  3LK8 A;  3EDH A;  1ZVX A;  1SLN A;  5I4O A;  1XFU A;  5CUH A;  4WF6 A;  3AYK A;  2RJP A;  4I03 A;  1D5J A;  1JH1 A;  5D3C A;  1JJ9 A;  830C A;  1BZS A;  4I35 A;  2A8H A;  3USN A;  2Y6D A;  3LE9 A;  2USN A;  3ELM A;  1ND1 A;  1KAP P;  1ROS A;  3DPF A;  4QKZ A;  2OXW A;  1XFZ A;  1I76 A;  1G49 A;  3HB2 P;  1Z3J A;  3OHL A;  3DNG A;  5BOY A;  1PWV A;  1JKY A;  4AYK A;  1GO7 P;  1MNC A;  3DTE A;  3WV3 A;  1J7N A;  4DF9 A;  3AYU A;  1R1H A;  2JT6 A;  4HMA A;  4DPE A;  3AIG A;  1FBL A;  2RJQ A;  2OXZ A;  2WOA A;  1IAE A;  3LIR A;  1IAD A;  3HYG A;  2CKI A;  1KUI A;  3V96 B;  2AIG P;  4H1Q A;  2ERQ A;  4Q1L A;  5BPA A;  3TS4 A;  4AIG A;  4PKQ A;  3EDI A;  1QIA A;  3RTT A;  1C8T A;  4GUY A;  1OS2 A;  1I1I P;  1GKC A;  4PKS A;  3LJG A;  3HDA P;  3DWB A;  456C A;  4G0D A;  3BA0 A;  4WKI A;  3LMC A;  1AYK A;  2KRJ A;  1OMJ A;  1G4K A;  3DPE A;  1JIW P;  3P24 A;  1C7K A;  1DMT A;  2OVZ A;  3KHI A;  4PKR A;  4CTH A;  4PKV A;  3GBO A;  4IUW A;  5H8X A;  2PJT A;  1RMZ A;  3E8R A;  2SRT A;  3B8Z A;  1BUD A;  3F19 A;  4H3X A;  1UTZ A;  3VTG A;  4GWN A;  1QJJ A;  1YQY A;  3UVC A;  1KBC A;  3KMC A;  2MZI A;  2O3E A;  1BKC A;  3LJT A;  3L0T A;  3P1V A;  4GWM A;  4JPA A;  1ZXC A;  1G9K A;  1XFY A;  3I7I A;  3TSK A;  2TCL A;  1SRP A;  3ZVS A;  1ZXV A;  5I43 A;  1PWQ A;  4XBH A;  4XM6 A;  2Z2D A;  4IJO A;  4G9L A;  3LQB A;  4GR3 A;  1SAT A;  2POJ A;  3HY7 A;  3HBV P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...