2DW6A

Crystal structure of the mutant k184a of d-tartrate dehydratase from bradyrhizobium japonicum complexed with mg++ and d-tartrate
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
388
structure length
388
Chain Sequence
SVRIVDVREITKPISSPIRNAYIDFTKMTTSLVAVVTDVVREGKRVVGYGFNSNGRYGQGGLIRERFASRILEADPKKLLNEAGDNLDPDKVWAAMMINEKPGGHGERSVAVGTIDMAVWDAVAKIAGKPLFRLLAERHGVKANPRVFVYAAGGYYYPGKGLSMLRGEMRGYLDRGYNVVKMAIGGAPIEEDRMRIEAVLEEIGKDAQLAVDANGRFNLETGIAYAKMLRDYPLFWYEEVGDPLDYALQAALAEFYPGPMATGENLFSHQDARNLLRYGGMRPDRDWLQFDCALSYGLCEYQRTLEVLKTHGWSPSRCIPHGGHQMSLNIAAGLGLGGNESYPDLFQPYGGFPDGVRVENGHITMPDLPGIGFEGKSDLYKEMKALAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of Enzymatic Activities in the Enolase Superfamily: d-Tartrate Dehydratase from Bradyrhizobium japonicum
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Lyase
molecule keywords Bll6730 protein
total genus 137
structure length 388
sequence length 388
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.81: D(-)-tartrate dehydratase.
pdb deposition date 2006-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2dw6A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2dw6A01
2OKTA 3SQSA 2P3ZA 2AKZA 4ROPA 2OO6A 4DN1A 3N6JA 2ZC8A 1P43A 3ZVIA 3FYYA 4MMWA 3UXLA 4KWSA 4A35A 5FJPA 3RR1A 2OZ3A 4KT2A 3SBFA 3T4WA 2GDQA 2PU1A 3PK7A 4YWSA 2HXTA 2QQ6A 2GGJA 2PA6A 2AL2B 4EWJA 3THUA 4F4RA 4IHCA 3D46A 3DIPA 2XGZA 2OZTA 3ES8A 3TWAA 4JN7A 2OPJA 5BOEA 2XH7A 3OTRA 4JN8A 2HZGA 2XSXA 4IT1A 3TW9A 3Q4DA 3ENLA 1MRAA 2GL5A 1EBGA 3DGBA 4HCLA 3SN0A 3ZVHA 2PSNA 3IJIA 3VA8A 3MUCA 1ONEA 3IJLA 3OZYA 3PFRA 3T9PA 3BSMA 3R11A 1R0MA 1JCTA 4IL2A 2OFJA 3UCDA 3H8AA 1TZZA 3FJ4A 3N4EA 3EEZA 3CAWA 2GGIA 2GGGA 3P3BA 1EC9A 3STPA 4E5TA 3V5FA 1TE6A 3TCSA 4HYRA 2QJJA 4G7FA 1ECQA 3S47A 4DWDA 3QPEA 4G8TA 3ZLFA 5J04A 4GISA 3GD6A 1P48A 3TOYA 4GIRA 3CB3A 1PDYA 4GGHA 2FYMA 4JHMA 3TWBA 2O56A 4MGGA 6ENLA 3T8QA 1KKRA 3DG7A 3TJIA 1OEPA 2QJNA 3V5CA 1ELSA 3DDMA 2PS2A 1XS2A 3IK4A 1WUEA 3I6TA 3H7VA 2POZA 2ZADA 2OZ8A 5FJRA 3Q45A 4Z1YA 4J1OA 3QLDA 2OG9A 1EC8A 1KKOA 2GGHA 3R0KA 2PMQA 4K8GA 4GGBA 1XPYA 3DFHA 3ZVHB 5FJOA 4GYPC 3R10A 3VFCA 3CK5A 3GY1A 3VC6A 3JVAA 1W6TA 3VC5A 1YEYA 4DYEA 3DG3A 3CXOA 3S5SA 3TTEA 3DFYA 4GYPA 3K1GA 3SSZA 1L8PA 3P93A 2PTZA 1EBHA 3RO6A 2PGEA 2AL2A 3MZNA 5IDZA 2AKMA 1SJAA 3QKEA 1BQGA 4E8GA 4X2PA 3QN3A 3I4KA 4HPNA 2ONEA 2XH4A 4H2HA 1F9CA 4ZA0A 2XH2A 3V3WA 3FV9A 1TKKA 2HXUA 4E6MA 4IP5A 4H1ZA 3SN4A 2OLAA 1JPDX 3VDGA 3TQPA 3RRAA 4ENLA 3OW1A 3RGTA 3JW7A 2FKPA 4HNLA 3VCCA 3TJ4A 3UGVA 2PP1A 3MKCA 2OX4A 2QGYA 2QDEA 1WUFA 2OQYA 3MQTA 3PWGA 3I6EA 4H83A 3VCNA 3R0UA 3NXLA 4H19A 3UJEA 3SJNA 1NU5A 1IYXA 4J3ZA 2I5QA 4HCDA 2P8CA 3B97A 5FJTA 3DG6A 3H70A 4GFIA 2PP3A 2MNRA 3KUMA 3V4BA 3SN1A 4KEMA 2PP0A 3UXKA 5EU9A 1JDFA 4Z17A 2PPGA 2DW7A 4DHGA 3ZLHA 1BKHA 3UJRA 3OP2A 3ES7A 4K1WA 2GGEA 3GC2A 1SJDA 1SJCA 3MY9A 1MNSA 2PCEA 4DX3A 2NQLA 7ENLA 4IL0A 3R1ZA 2MUCA 1MDRA 3RITA 3CT2A 2QJMA 4E4FA 1SJBA 2PU0A 4DXKA 2QDDA 3P0WA 4IP4A 3UJSA 4KPLA 2CHRA 1RVKA 2P88A 4M6UA 4FI4A 3MWCA 3H12A 3OPSA 3NZGA 2PODA 3OZMA 1PDZA 2GSHA 1FHUA 1E9IA 3U4FA 3N6HA 2HNEA 2RDXA 3U9IA 5FJUA 4HN8A 3FCPA 2QVHA 1FHVA 3DERA 4FP1A 4IZGA 2PGWA 4A6GA 3CYJA 3BJSA 3HPFA 1KCZA 3N4FA 3NFUA 2P8BA 1JPMA 2P0IA 1DTNA 3FVDA 4HNCA 4A3RA 2XH0A 3T6CA 2AL1A 5BOFA 1KD0A 3DESA 4ZCWA 4E4UA 3DEQA 1EC7A 2DW6A 1NELA 3UCCA 4GMEA 3UJFA 3MSYA 4K2SA 3JZUA 3D47A 3QTPA 3IJQA 4M0XA 2PTXA 3GO2A 5ENLA 1MUCA 3FXGA 1MDLA 2PTYA 3NO1A 1R6WA 3UJ2A 3EKGA 2PTWA 2OVLA 3ZLGA 3BOXA 4MKSA 2OQHA 3RCYA 3PWIA 3R25A 4HCHA
chains in the Genus database with same CATH superfamily
1O12A 1XLDA 2P3ZA 4NY2A 3CZLA 1HZYA 1TPVA 3TTYA 4KFOA 3BO9A 2GUYA 1A3HA 2YYUA 3NQVA 3VIJA 3G3MA 4KWSA 3DI0A 3BQ5A 4JTKA 4ECLA 2DFAA 4UTUA 2ZYFA 2VC6A 1DWGM 3EDEA 5FJIA 1H1ZA 4PFMA 2WWCA 3AQUA 2WQDA 3KRZA 3R07C 1XIDA 7XIMA 1DWJM 3OGSA 5C0QA 1QT1A 1TPUA 2XGBA 4E2BA 5DMNA 4RDWA 1OFDA 3TYUA 3MP3A 3KHJA 3VK5A 4B5NA 2QUUA 3ZYZA 2WLYA 3IJLA 1E4MM 4N6FA 3SFWA 3W7DA 4F0MA 5EKYA 1ITCA 1YQZA 2ZZ4A 2DZBA 4HZMA 1QVBA 3SQMA 4BFAA 1XYMA 4WCJA 3GVGA 2WP5A 4CQ8A 4EOUA 1TYGA 5M5DA 1E6SM 4J5NA 5G4EA 3G22A 2FJUB 1HG3A 2WZIA 4LJ3A 1E9LA 4JEQA 4C6LA 3S9YA 4O17A 4JTTA 1K4HA 4DQWA 4CQCA 4B2DA 4QTGA 1E1EA 1DPMA 1XLAA 4PBFA 3URQA 1JZ2A 3KLKA 5HJYA 1P48A 1T3QC 1H60A 1JUEA 1F4HA 3A47A 1RQEA 4C6FA 2E6FA 2Q8LA 4F40A 1QMLA 2F8QA 2NV2A 2QS8A 3F4WA 3V75A 4MPKA 2J7FA 1WUEA 3TTSA 4HA1A 3QQ1A 5CH9A 4JOMA 5FEPA 3CPRA 4E8CA 4MJ2A 2C8NA 5AZ0A 7REQB 2BZNA 5IHRA 1QRQA 1GVSA 3GXPA 2PWGA 3R0KA 4WSJA 1K9TA 3AISA 3AUJA 1K8CA 3OODA 1QATA 2ZWZA 1GVIA 4QIUA 4FIRA 2ZXDA 3NRZB 1EYWA 3MUZ1 2ZRWA 4NEVA 1GVYA 4B5VA 4MY1A 1UWRA 5JUVA 4GRTA 1X96A 2WHKA 3VGBA 2PWFA 2VFFA 4ZO6A 3M6YA 2ODOA 1L8PA 1QPKA 3KDNA 3FW6A 4NZ1A 4QM1A 2PGEA 4GQ0A 1X38A 2RKXA 1R38A 1EJTC 3GU9A 2FB3A 4PMRA 2NUXA 2HEJA 3VU2A 4JIQA 2Q3RA 1V6TA 4E2OA 1UHVA 4IGMA 4HTYA 1PUDA 4IPNB 4S2CA 2PWVA 3GNPA 1BSIA 1RD6A 3UG3A 3ARUA 3JW7A 3YPIA 4BA0A 4C6MA 2HVOA 3T44A 2D0HA 4LQ1A 1D7FA 4GO9A 4M29A 2QDEA 4BURA 1KM5A 4Q8NA 3GIYA 1CEOA 1H7OA 4Z1AA 3OVGA 5HR6A 2OXNA 3KCLA 3BGGA 3P2VA 4RK8A 2GRTA 3S5YA 2DORA 4LVBA 3DKLA 1BEUA 4ADWA 5G2IA 7TIMA 3QR3A 4U4MA 1TV2A 2Z1SA 5AHLA 1OX5A 3VUSA 1VPXA 3SN1A 2BLEA 2Y5SA 5D8ZA 1CBGA 2JIWA 3KVJA 1M7JA 3E1F1 1B3ZA 4EXBA 3NPUA 5E09A 3RNDA 3M4HA 1NQ6A 3CWHA 4FX9A 2QCNA 1V02A 5D2YA 3UZXA 1I0BA 2QUTA 4WQ6A 4ZGYA 1M7PA 3W81A 3MTWA 4RJEA 4WXZA 2XN1A 2VWTA 4PB4A 1KLYA 1XIIA 1BYDA 3NQGA 4DAIA 2QF8A 3IJ9A 3WK0A 2PCEA 2PI6A 1JI2A 2YLLA 3SCUA 1US0A 5G5GB 3O0HA 2IMRA 2J3NA 1KC7A 4PE8A 4DRSA 3OB8A 1YLVA 1K8XA 2YQUA 3LN3A 1VBUA 1J4EA 4GOAA 4B9YA 2W3ZA 3OLGA 4S23A 5BMXA 8TIMA 5A94A 1JNDA 4A3HA 1LYXA 3FKKA 5FAGA 5H6HA 4KIEA 2JKEA 4YXGA 4HHMA 1QI4A 3U2CA 3CMJA 1EP1A 2GSHA 5I00A 1WAUA 1ONWA 3C0JA 3VO0A 1WXYA 3AHYA 1D7KA 2CERA 1F3EA 1EB3A 3HA1A 4GK8A 4NZCA 3L8KA 4IFRA 3VM5A 4WY0A 1E15A 3JU2A 3QC3A 3FCPA 1Q6QA 1XC6A 5ECVA 4WRHA 1TELA 4KCVA 4FAMA 3WJWA 3KBWA 2WVTA 2PLKA 3IRSA 3B9DA 1BF2A 2PDQA 2ISWA 4C6JA 1ZJBA 7CGTA 1K4QA 3VNYA 4NJGA 2BY0A 3DHUA 2VQUA 2QVNA 3TVAA 1QK0A 5D2TA 1QW8A 3DFQA 2CLFA 4RPQA 2ZRYA 3RU8X 1OQFA 2NWSA 4ZCWA 3VTRA 1TPC1 5IXEA 5D05A 2EPMX 8RUCA 5CPMA 3VOFA 5FL0A 1ZFJA 4PCTA 3CUHA 2FJKA 1MUCA 1UD8A 1M6JA 2WQPA 3HGSA 1R2SA 2PTYA 3QGVA 2CFYA 3VKAA 1R8LA 3CGDA 1P0EA 4J3UA 5AYIA 1ADSA 3FDGA 4L7ZA 3BTNA 3ZLGA 1ZQ5A 4F0LA 4GIAA 2V67A 4RE4A 1HL2A 4MWAC 2XFFA 5FACA 1CNVA 2OWXA 5LKYA 1XLLA 1Y5WA 1EL3A 1MUWA 3UCQA 1DXFA 3SADA 3OVPA 3NO5A 3N6JA 1WOBA 2ISFA 2JKAA 5HK4A 2D3NA 1QHPA 4XQ6A 3L5LA 1XWYA 4I90A 3S2LA 3U5YA 3RR1A 4K8EA 3SBFA 2YDAA 4EWND 1LLOA 1RA5A 2R9RA 3K5XA 4WIWA 1HP5A 1E0XA 2L5HA 1KLZA 2PA6A 2CDUA 3GG7A 2WJZA 3H55A 4U2ZA 1ITQA 2Y5EA 4MY9A 1MI3A 5HXMA 2QUMA 4RUBA 5BXSA 3SR6B 1B5TA 5AHEA 1P7TB 4F2TA 1QUMA 1VZWA 2OB3A 2QJHA 5KMYA 2NX3A 4S3KA 1FO4A 4N9DA 3GW3A 5XIAA 4GC4A 1VFHA 3TFCA 4V28A 1LLZA 5LIUX 1FEAA 3KOXA 3EDFA 5SWUA 4JBRA 2RAGA 4N42A 5KVIA 1KRCC 2XN0A 2BASA 3EOLA 4O8RA 3W84A 2VR2A 1CXKA 3VXGA 3VZXA 4H7CA 3SSJA 3UNDA 1GQNA 1E1CB 2ADAA 6A3HA 4KF1A 3GH7A 3PVFA 3CAWA 1DEDA 1ME7A 2ZFAA 3VFLA 1JXJA 4DO4A 3SY8A 4PCNA 1L6GA 3IGHX 3V5FA 5AECA 3S46A 4CU8A 2G3MA 3TAKA 4C7GA 3WD3A 1LL4A 1IF2A 3NVDA 3ZJ7A 3W1PA 5LA1A 5J04A 5HATA 4GIRA 3K8MA 4MWAB 1R7AA 4Y6GA 4UZSA 1B3WA 2GQ9A 4EF9A 3F2BA 3VDHA 3E0WA 2DT0A 1A5MC 1FWWA 5TAOA 3VD3A 4AWSA 2E5DA 3WIJA 4JHZA 4BF9A 3P67A 4F9DA 3QLDA 3GXTA 4L4LA 1X7FA 5CBIA 1Q63A 1GYNA 2GK1A 4OUIA 5F7UA 3T78A 2YZRA 3BLLA 2OMAA 2DIEA 1XPYA 2PGRA 2QULA 3PBVA 4S2BA 4G2DA 2YB4A 2WMIA 3BV7A 1QTWA 3CK5A 3KRSA 1K7FA 3DBNA 4YTRA 2TRSA 1PYFA 3VPLA 2VGFA 1E70M 3PPGA 4US5D 4H9ZA 4D1JA 5DY2A 4FF5A 3M0MA 2OKOA 1BHGA 3S5SA 5DCBA 4DBWA 1EX5A 4S1FA 5LYRA 2GUUA 5AVNA 5DO8A 2VL4A 1RV8A 1NM9A 1DJXA 2W54A 5F4WA 4U33A 4X2PA 4XIAA 2VCCA 3I4KA 3GXNA 3PJTA 3VIMA 2ZIDA 2E67A 3GDMA 3T4CA 1VLIA 2ASHA 2ZRUA 4G1NA 2XISA 1J9YA 1DNCA 1EZWA 3KLJA 5C70A 5A2BA 3TQPA 4GA8A 4DYJA 3UWUA 3PSVA 2JALA 3UZZA 4GWEA 5I07A 4FB7A 3RR4A 1WOAA 3B8TA 3KOYA 4LCQA 1WUFA 3P84A 5I3HA 3TC6A 1WDQA 1S3HA 1VENA 1D2KA 3VZZA 4JTLA 3S83A 3VABA 1OJXA 4F66A 1ML1A 3W88A 1Z44A 2YGYA 3OYZA 4UWMA 1UASA 4GNVA 2PBGA 3CUGA 4XZBA 4Q8QA 3AXKA 3WD4A 2ZE0A 4QSFA 4HJWA 3M0ZA 1LTDA 2EPKX 1RALA 1QWKA 5EU9A 2ABBA 3KRBA 5E9XA 5T9BG 4P7LA 4Q4KA 4DI9A 2PWEA 3G1FA 1V79A 2DT1A 3O0KA 3WLKX 3SURA 2NT1A 3TYZA 2E5CA 3DHPA 3RK8A 2BWGA 4KESA 1W5MA 5AN7A 4XAPA 4HNUA 1VPYA 3THAA 5A6BA 3OP2A 1GONA 3GC2A 3BLEA 4O11A 4RZBA 3WQFA 1CECA 2Q8XA 3QR0A 4MB1A 2X2GA 1T41A 3ITXA 1X39A 4TTUA 4QQ3A 3GG0A 1F4AA 3NXFA 5ABGA 1CLVA 3WJSA 1SJBA 3LXBA 3OZPA 4GZIA 4KPLA 4A8LA 2VDHA 1R2RA 1TPFA 4ZFMA 3EZ4A 4YYFA 4M6VA 1GORA 1JI1A 2BFGA 4RE2A 3H12A 5AC6A 3V1HA 3A22A 3AU6A 1S7MA 3LCWA 4O50A 4KETA 3U4FA 3ZOAA 1TZ9A 3PN8A 4US5A 2VZSA 1EH9A 2WSYA 5E6YA 4DWSC 3CAQA 4U31A 4DF1A 2WJFA 5GQBA 3XISA 5M17A 3MWAA 4GJJA 1R5YA 3N25A 2OJPA 3OO2A 2ZZ2A 1QXLA 3W7GA 1C90A 4XZHA 1F6PA 3R8GA 1XX1A 5HULA 2IPJA 3G1SA 2P0IA 3GNDA 4F0KA 1FKXA 4A3RA 2XVPA 1XCWA 3P80A 1TWIA 4YHEA 1CIUA 2AQVA 1YBQB 1JZ7A 4XZ9A 1EC7A 2DW6A 3ZJKA 4TV6A 1QI5A 2DVUA 4NILA 1XLJA 3LPFA 1H09A 3BV4A 4FX8A 1I2QA 2WAGA 1ENUA 3UU0A 3C2FA 1U22A 4NNBA 1Z41A 1ADDA 4X61A 2W63A 3APYA 4D6HA 3PWIA 1L6WA 4JKMA 4DIAA 2ZX9A 3IAPA 4CNOA 4U3AA 5CLTA 3PC0A 4XZMX 4Z08A 2J9ZA 3TEVA 4ROPA 2R6OA 1H5YA 1SFJA 5CSRA 1KCLA 3URHA 4CN1A 3LMZA 1UKPA 1BG9A 1PO9A 4QITA 3W38A 3FKRA 1OC5A 2GSEA 3HGOA 3NVWB 1XLGA 3P60A 4UC5A 2BBFA 2VX6A 1YPXA 1B90A 1JVNA 3OZOA 5BU6A 4L61A 1UCWA 3GRSA 1L2UA 1JXKA 5BOEA 4OOUA 1RCQA 3CIXA 3EOUA 1R85A 1IEIA 4GKTA 4BF5A 1HVQA 2XSXA 1RVGA 3Q58A 3WY1A 3ZQ9A 1I4NA 3Q4DA 5A8GA 1CXIA 2BDQA 4GPNA 3SIZA 5F1VA 2PSNA 1Q6OA 4HN4A 4Q22A 1J01A 1Q7MA 4J3TA 3LBOA 3EXSA 3N12A 2ZX8A 1VDVA 1GRAA 4HK5A 3L5MA 1R3WA 3L4YA 2V3FA 3T40A 5PTDA 4OE7A 1ME9A 2QCCA 4H9MA 1MZRA 3EMCA 2WOIA 1S5WA 5KITA 4NNAA 2QUNA 1JDAA 3LD5A 4YU1A 1ZPTA 1R3VA 3GXMA 4F48A 4FXFA 1MFUA 3M16A 4W93A 5LXEA 3KM8A 4N4PA 5T9CE 3VCRA 1TE6A 3W26A 3I7QA 3W1RA 1B4EA 3IJDA 4FMVA 1W1A1 1QDSA 3KBMA 4JPGA 5D09A 2G5WA 4LSBA 1B54A 4AD0A 3VD4A 1HP4A 3GE7A 3NIYA 4H4PA 5CC5A 1I75A 5LZLA 2HISA 5I3KA 2XN2A 3TUUA 2FFCA 1ZS2A 2ZZ0A 4NKCA 1E40A 1KKRA 3ORWA 2PS2A 5JIPA 1ZBCA 3EEGA 8CGTA 4M1BA 4ZODA 3GBEA 2POZA 8XIAA 2D2JA 3MW7A 4H4TA 3N2MA 1XGZA 3W7PA 4J3XA 3CHFA 1NDVA 3GU2A 1H51A 3B8WA 4IG2A 2VDGA 4M3PA 2PRMA 3D6NA 3SGUA 9XIMA 1XP3A 5CAKA 2OZ0A 5I78A 2DSZA 4L9YA 4H4UA 4F79A 1IEVA 5BU9A 1CTNA 5DBUA 4FNRA 1W6TA 1DWFM 5HANA 2X8HA 3M7SA 3L0NA 1VHNA 1RD5A 4JTQA 1EA9C 2OU4A 1FIQB 4CD6A 4I6VA 4US6A 4J7RA 1VCVA 3W85A 2O55A 3A9BA 5D4YA 4UTHA 3GKFA 3QKEA 5CJ5A 4D6CA 3PS7A 3QN3A 5DANA 5FSDC 1T8QA 1AOGA 3OG2A 3V3WA 4A3YA 5FIPA 4AYSA 1KXQA 3UPWA 4RNJA 2V5DA 3G18A 1O1ZA 1S2VA 1CB2A 1SM9A 3FK4A 4IMDA 1ZJIA 5CAHA 2RUSA 4XZIA 3OW1A 3NDYA 1R3YA 4HMCA 2OODA 3VM7A 2VO5A 3RO8A 4MWAA 4S3GA 1VCFA 4JDBA 3W1TA 1B0IA 3H26A 3TFXA 1UIOA 3P8JA 4HA0A 2YDQA 1UR3M 2J47A 1C91A 1Q6GA 2Z1WA 4H83A 3L2MA 4NIRA 2DEPA 3E2SA 4BF7A 4K38A 2XUCA 3NXLA 1NU5A 5IM51 5A3HA 1EO7A 2CITA 4UOJA 1DVJA 1WE5A 2VC7A 1SZGA 4HOZA 3EF6A 5I3JA 1F3PA 6REQB 3E2QA 3FHAA 1EFZA 1KGXA 2YBVA 4RCXA 1CXLA 4E3TA 4HHHA 4EVZA 1FWEC 2TODA 1XBYA 4U28A 3G0SA 2D20A 1XSKA 2ZE3A 2VT0A 1DOSA 4D6FA 4CD7A 5XIMA 2YFOA 3QY8A 1UWSA 3PZNA 4IGSA 2CBUA 1YYAA 3UWEA 1FFUC 1VEOA 4J57A 3WQGA 4O53A 1AL7A 3NQ2A 2P1FA 3HQ1A 3UD6A 1OC7A 2QJMA 3WLQA 4E4FA 1IEXA 1OF6A 3P0WA 1RP8A 2BB0A 4Q4SA 4E3VA 5FL1A 3CUXA 5LIXX 3VOCA 1MUMA 2DSWA 3V0UA 1OCQA 4Z2IA 3R94A 4JEJA 3KW3A 3MCMA 1LRQA 2ISSA 4PTWA 4OBSA 4LB4A 2PDLA 2OQLA 1B4KA 3L67A 4G56A 3FDKA 3B4YA 3GNOA 4GG9A 1OC6A 1GOKA 4N7QA 3UG8A 9RUBA 5JCNA 3PAOA 4XK2A 3ZT5A 1EX1A 4IZGA 4WDXA 1JOAA 3T1GA 2YCIX 4H6EA 2GYIA 3W2MA 2Q8ZA 4ZTYA 2A3AA 3M44A 4H9VA 3NEHA 3OBAA 3NPVA 3P5ZA 3QHOA 4U5IA 4AZ6A 4BQ4A 3ANYA 4MJ4A 3KHDA 2ZVRA 3EWXA 3MO4A 2PDXA 4HK7A 2XG9A 1TQXA 1NEYA 4GMEA 3ZWTA 4D6EA 1KM6A 1GKPA 1QOXA 2A2IA 3PBMA 4NASA 1V6YA 4LBSA 5HJLA 1UROA 4MYAA 2QYGA 5I06A 2RFGA 2PC4A 3INPA 1UW9A 3LYEA 1YTDA 1SUXA 5K3VA 1SYTA 2H9AB 1EP3A 4YTUA 2X1RA 1ESWA 3CEPA 2R94A 5I7GA 5I3IA 4UFMA 2W3RA 3KTSA 1UR0A 2IQTA 4F8XA 1DJHA 4S3FA 4PB3A 3W1AA 1B31A 2GJNA 1W1B1 4ONVA 3CQKA 4FR6A 4YN5A 4TXEA 4YCPA 1N5XA 2HBVA 2OZ3A 2A79A 1JZ3A 2IPFA 2QQ6A 1KM4A 3L5AA 1VGAA 3AYVA 5FOOA 2ZX5A 3QOMA 1E9YB 5FF2A 3G1VA 1TV3A 3ITOA 3LY0A 3M0HA 1ZLPA 4CU7A 5CLWA 3W71A 1ISXA 4XKYA 2VEPA 1JGIA 3ITTA 3LHUA 2XIMA 3MSGA 2NVCA 3S5ZA 2CZ5A 1FBAA 4C90A 4HOWA 4PN2A 1V5XA 3V35A 4WOQA 1G0CA 4UCFA 1YE6A 3LNPA 1B3YA 4NQ1A 4QDMA 1BD0A 2D24A 4I5XA 4JAWA 3WQWA 3UXIA 3PPHA 2BOEX 2Y61A 4H4WA 1CT5A 4EAMA 3DGRA 6CGTA 4H6KA 4I9TA 3B40A 2Y62A 3SGGA 3BC9A 4BQ3A 4UTFA 3L68A 3VNIA 2AGTA 5AZ1A 4GY1A 3FJ4A 1OD8A 1KN0A 5AHNA 2ZZ5A 3N4EA 2ACRA 6ALDA 4TVWA 4RZ4A 1E3ZA 2NVKX 3B9NA 4GYFA 5KZ6A 3R8HA 2R1PA 3TLLA 3TSDA 2WV8A 3N6QA 3MUXA 1R3SA 3TCSA 1Q2RA 3HG4A 1F7BA 2QJJA 2VGBA 4G7FA 1JDCA 3A4AA 3S47A 1RQHA 4PSRA 1Q1RA 1EWEA 1IE7C 2XIBA 4HHLA 4I7WA 5EBUA 2CZFA 3GD6A 4HZ6A 4AC7C 2PDJA 3KZPA 3A5VA 1CXFA 1AA1B 1T96A 1XS2A 5IOBA 1PX3A 3IK4A 5E5CA 1VIZA 3VINA 1PL9A 2J88A 4D1IA 2ZUMA 4LRSA 1B9BA 2WKGA 4DBEA 1SMAA 4R9OA 4QISA 2ZTJA 3CL8A 3DFSA 3TXZA 2C7FA 3Q2DA 3QW3A 1OF8A 4AZIA 1X1OA 4WHBA 3FJNA 4IMFA 3O6AA 2Y5JA 1F61A 1VS1A 3GFZA 4NRRA 3VMPA 1A5LC 2X8RA 3VGFA 3W0KA 3TQVA 3VFCA 3W76A 1JD7A 3WF3A 4AX6A 5CGMA 4TU1A 3KVKA 1KWGA 2WOWA 3A13A 1U33A 2QPUA 1XBXA 3VX1A 4A2SA 4D6JA 2QT3A 3UNTA 1IQ8A 4DUOA 4GYJA 5C9ZA 2Y2WA 3BLDA 3R2GA 3GFXA 2WCAA 4DVOA 1OG6A 1YIXA 1RHCA 1Z89A 3C6CA 4LF2A 4AHPA 3BH4A 3TONA 4LU0A 3KVMA 4PMYA 3F2CA 6PTDA 2CWXA 1IEWA 1HTIA 1UR1A 4HPNA 5KZEA 3FEMA 4ZA0A 3A4WA 1W9BM 4RDYA 3M46A 4TVUA 4WEVX 2WB5A 4NI3A 1W1VA 1J93A 1GRBA 4LYRA 1UMLA 4IP5A 4WR3A 5TQLA 1QNQA 4IH3A 1SZEA 1XBVA 1AFSA 4TMCA 4RXFA 3SN4A 4L65A 2XVKA 3WQ5A 3CH0A 1EJWC 3V7PA 2OT0A 3W2UA 3CUJA 1SU5A 4HNLA 5DMLA 1A50A 5AYXA 3BCFA 2X1TA 3NVTA 1WO2A 4UQDA 1WBJA 1V6VA 1GVRA 1FECA 2F38A 3S2NA 2J9XA 4FNQA 3VUPA 4H4SA 3I6EA 4QLKA 1UJPA 2EPOA 2BXZA 2R1KA 2ATMA 5JCMA 4GY7A 1XSIA 1SMDA 1A0DA 1V93A 3O6CA 3PTDA 1RBLA 5FJTA 1OIFA 2MNRA 1KFEA 3LCXA 1EOMA 3UXKA 1F6YA 1EHNA 4CD4A 3AS3A 5CZKA 4AZCB 4NAEA 3B8SA 2PPGA 4JTDA 2DW7A 1BWCA 4PRRA 1Z32X 3V18A 3KBNA 2WBAA 4HNNA 4JX6A 1B3VA 5EFDA 5AOUA 3UJRA 3PHAA 4AEFA 4DJFC 1XINA 3WK2A 3LTPA 1Q8JA 4IIHA 2C91A 4WZHA 2NQLA 3GTFA 4HB7A 2DGAA 3OVQA 1CGUA 3HV8A 1DQUA 2DZXA 1NY1A 1PKMA 3AHVA 3MMTA 3TC3A 4PCPA 4XVDA 3UJSA 3NQFA 3E9AA 5C5YA 2YL6A 3SIMA 5E0CA 3JR2A 4TVCA 5HBFA 3MWCA 1XYFA 4DZIA 2WW5A 1HXJA 1S5VA 4Z0SA 3GD3A 3PZQA 3AUOA 3QRHA 3A23A 1DORA 3H23A 1A3XA 2VFGA 3VE7A 4X63A 3VMOA 1E0UA 1P0DA 4JIRA 1SZNA 3UZWA 4LTSA 1EJVC 4C6CA 3H24A 5BMWA 2NVDA 4IIDA 4FZIA 5LNWA 3MJYA 4ATWA 4BI6A 4AMCA 3GUGA 1Z9AA 3FLUA 3CYVA 3LCFA 4G7EB 1LVLA 4DAFA 4UQCA 4U3CA 1FCUA 3EWWA 1A0CA 2DQWA 3C86A 5BXRA 3N2BA 2NUYA 1UBPC 1EUNA 3K4DA 4WY0F 2VUYA 3BGAA 1UPMB 2F84A 3VOIA 1KD0A 4P8XA 4QE5A 5HWNA 5G2WA 3DFOA 4FLOA 3MSDA 2BSLA 3PB0A 4AAJA 4O4VA 2J7CA 3GO2A 5ENLA 3CQIA 4NEWA 4UTWC 1GV4A 1QBAA 2WZTA 1CLXA 3FN9A 1YADA 4QJ5B 1KQYA 1R6WA 2QV4A 4O16A 3CV7A 3DENA 1L0PA 3Q67A 1HF6A 4Q8MA 4RW5A 4I3GA 2FPTA 4IIGA 1YNQA 4O54A 3GUWA 1YPFA 4HCHA 1FX6A 1W17A 1YX1A 3DXIA 1B3OA 1LZOA 4TVDA 3SZ8A 2CC0A 4DJDC 2ISVA 2V5CA 2PU1A 1M7XA 3N2XA 4EPKA 3AMDA 4D71A 3R58A 4K8DA 2HXTA 3DC0A 3W72A 1VJSA 3W37A 1WAWA 5IHSA 3N3MA 4TTGA 2BVTA 1BPLB 2QLYA 1HNYA 1UYQA 2WBGA 5CPQA 2G4FA 1XH1A 3SEPA 2HZGA 4W85A 2B0MA 1E6PA 1JGMA 3CMFA 4JS3A 3W86A 4Q7NA 3FX4A 3ERPA 1BYAA 3VKCA 4GRSA 1W0MA 4PH6A 1JRCA 3RNMA 1SW3A 2VVSA 5G1TA 3C4UA 3G2GA 3OZYA 2E68A 3S1GA 4XTDA 1F6KA 1GOOA 1H11A 1IEQA 1F74A 5TD4A 6XIMA 1XG3A 4OECA 1LORA 1GVOA 4GI4A 3NL6A 4WY0B 1RBOB 1H50A 1TUFA 1LBMA 1LQ2A 3TYCA 3N9RA 1JUKA 3PUGA 4XAFA 1S2CA 4FA3A 1O5QA 4E2DA 2GJRA 1Q6RA 4DZ5A 5LA0A 3CWOX 4HHPA 1W5PA 3W2LA 2DT2A 1ICPA 4AWEA 2HWGA 2V30A 5CPTA 5F2GA 2WM1A 2DUXA 1G7UA 2PDIA 4URIA 1XIBA 4NG3A 2X0HA 4O13A 1R46A 2FGZA 4KMQA 3G1YA 2W4XA 3EPMA 1ISYA 4CN6A 4D6IA 4CD5A 1XC4A 5E0KA 3DDMA 2PWDA 1XYBA 2OR2A 4JTHA 4R88A 1TA3A 4GQQA 4I5UA 1BVNP 3Q45A 4XZLX 1UH2A 2EBNA 1CXEA 3W7IA 1OINA 2AMGA 3A24A 1OHLA 3RLUA 3N73A 4O52A 3TSBA 2PDHA 5D2WA 2OO0A 3DFHA 1SGJA 4JD4A 1UWQA 1OADA 5MHBA 3F4VA 3E02A 4LUTA 4YIWA 5IFPA 1KR0A 3CGTA 2W62A 1DJYA 2Q01A 3DG3A 3CXOA 1OGGA 4W7WA 3MDWA 4QAIA 1KTNA 1MYRA 3MVTA 2F2KA 3WQOA 1KBKA 3LQLA 2Z1BA 4V27A 2WANA 4ERGA 2JKPA 5RUBA 3AIQA 3FA3A 5D9OA 4LV9A 1SFSA 1W1PA 5LGXA 5HMSA 1OYAA 1CB7B 2G95A 4D6DA 3VD5A 1JAKA 4HZ7A 4HNTA 1HO1A 1PX8A 3AAMA 3L4TA 2FZDA 3D3FA 3QTGA 3VGHA 4EM4A 5HAOA 1X98A 1KFJA 3AICA 5XINA 3BDKA 1AZ2A 2P5NA 4KPRA 5E1QA 3O1NA 3TH6A 3OQ8A 1FH8A 3P6LA 2C1HA 1V59A 1E3XA 3MQTA 4KS0A 4AZHA 1C3FA 3I65A 4KWVA 3N2OA 3OA5A 1Q7ZA 3W28A 3WKZA 3RCMA 2FH8A 2BOFX 3IJ6A 4MADA 4XVEA 4GH1A 3PTMA 4UOZA 4HCDA 1E4LA 2P8CA 4XKMA 4ICNA 1ONRA 1REQB 4PL2A 1AQHA 1GOXA 1U1UA 5C9UA 3SQLA 4GZEA 3HG5A 1GTHA 3WJZA 2NX9A 1CI1A 3UF9A 2C14A 1R9YA 4IIFA 2ZBTA 2A3HA 1R30A 3B9AA 1TJRA 1ZUAX 2DV0A 3TX9A 4KBXA 4K39A 1LBFA 1HQTA 3IUHA 1KV8A 2QDGA 1BKHA 4H9TA 4ACZB 2JGQA 2YXGA 4YVXA 4FLQA 3ES7A 3GW0A 4L1XA 3HGJA 1JL8A 3BANA 1I0DA 1GGOA 4HBKA 2UV8G 3QHNA 3T7VA 4HPJA 4AZCA 1ZJAA 1P6BA 3P81A 3GD4A 3HTWA 2Q6ZA 3W3OA 1NDWA 2PTDA 1OT2A 3SB0A 1NOUA 4C1NA 4U5KA 3MKVA 5HMEA 3HJEA 2YA0A 1GVFA 3DU0A 2CHRA 2VFDA 4KEUA 3K4WA 1OD0A 3VZYA 3AYRA 3BLFA 1THFD 1RJRA 2QV5A 3W25A 4QSHA 3DX5A 1IIHA 3SW6A 4A3QA 3T42A 2Y7EA 1XGDA 3QPZA 1KM1A 1L6YA 1DE5A 2C0HA 3G24A 4A2RA 4JIHA 3URNA 3RAOA 1EO5A 2PLCA 1F3XA 1JCJA 1YMYA 4MM1A 2WVSA 4PCFA 3OIHA 1CCWB 1TPDA 3D9XA 3HPXA 1OFQA 2PD5A 1GREA 2H3DA 2FQIA 3B0VC 5K4XA 4CNPA 2XVNA 2E77A 1EQCA 1G9HA 3F5LA 1XRTA 3EB4A 4LXFA 2G97A 2W91A 1NAL1 2C0AA 4FX7A 3U2OA 2I56A 2Z6JA 3Q94A 4AF0B 3T0DA 3T0TA 1VYRA 1XIFA 3D0CA 2A3LA 2R1LA 3F2DA 2E4TA 3JZUA 4R85A 2WSQA 4RNFA 2X7WA 1XKYA 1I2NA 2GFTA 1V7YA 1IXNA 3W6LA 1JULA 4PBGA 1MDLA 2A7NA 2HSAA 3PBWA 2WMKA 1ZALA 2CCRA 1GHRA 4GR1A 4AXKA 2YCLB 3CHDA 2F6KA 2IPGA 3NURA 4W88A 4Z2GA 1YXDA 4UTTA 2WMGA 3UWYA 3RXZA 1GKQA 2Y6ZA 1RK6A 2ZX7A 2OYLA 4YVPA 2CKRA 1A4MA 4BQ2A 4PMQA 1LRNA 3TE9A 3GDTA 3UWZA 3AN1A 5K9DA 2CLOA 2DZTA 3LZ3A 5E9AA 3BAJA 4HJFA 1LBLA 1XL9A 3EOOA 4YWSA 1M7OA 3WFZA 5LIWX 1BF6A 4EWJA 3APTA 3NR0A 4B5WA 3AIEA 1XD0A 3ANVA 2VD9A 2CETA 4CVWA 3AALA 1UUQA 3DIPA 1AODA 1K9DA 3TJXA 1N5WC 4ZSUA 4CU6A 5LNSA 3MP4A 4AZ5A 3M5ZA 4C1NB 3P62A 4DB7A 1CW2A 5J5RA 2ESCA 3PM6A 4UR7A 1C9DA 4CQAA 1XIHA 3EPOA 1TIMA 2VP8A 3CGCA 2A1YA 4HCLA 3SN0A 3ZVHA 1ALDA 4HD5A 3PPCA 4R7JA 1HKIA 2ZUSA 2F6UA 4LNYA 1HFBA 3S6OA 2OOFA 3QY7A 1XRSA 1DJZA 1TRDA 1D3CA 3E0FA 4QRNA 4Q3MA 3W83A 4ZQRA 1AD4A 2I57A 1KB3A 2RGMA 2NQJA 3ZXWA 2CBVA 4ORMA 1EDGA 4S3CA 5ER0A 3DK9A 1BKSA 1VQTA 1A49A 3II4A 1M03A 3EWYA 1I1WA 2F61A 3STPA 3WQ4A 1ZY9A 1EOKA 4LC6A 4E5TA 4EACA 4H41A 1E9ZB 3VD7A 1DV7A 2BC1A 1I9CB 4H4VA 4C6DA 1KCKA 3WBWA 4DNAA 1ECQA 1HJXA 3CLWA 4DWSB 2NQ9A 4H4RA 2CZDA 2WPBA 4K36A 1KRBC 3NSNA 4Q7BA 5D8WA 1GVEA 3G3DA 3RILA 5EPDA 4DM2A 5F2MA 1S2UA 1AH0A 4GGHA 3T2QA 1PPIA 3ZJ6A 1XDIA 1TO3A 1YTKA 4PMUA 1EP2A 3QY6A 3VILA 4DLMA 4INFA 4MAZA 3G77A 2VX7A 4ASTA 3LHTA 4MB3A 2X7VA 3M0IA 3WDJA 4NP7A 4BZYA 1O95A 3LB8A 3W70A 4NZJA 2OZ8A 4FF7A 3RJXA 4NSBA 2WXDM 3QV6A 1RP9A 2OYMA 3IGSA 1GQLA 2OG9A 5ABTA 4PMXA 3C2YA 1M01A 2H9AA 2A7RA 4WD0A 3PJUA 2OGJA 1ONFA 3W00A 2JK2A 4QJ3B 3TXVA 1GNXA 3NDZA 3K13A 2W0HA 4AF0A 2V68A 1NHSA 4ZTXA 1XD1A 3DFYA 1HUVA 1E55A 4AQLA 1ZBWA 3KVLA 3EA2A 3HG3A 3E38A 3GNXA 4GJ1A 4LAMA 4CQ9A 4ERIA 2YVFA 3QEZA 4LBRA 3DFPA 1EIXA 4AD1A 2AKMA 1KGWA 2GDUA 4HU0A 2QCHA 5AYZA 2XH2A 3M0XA 2HXUA 2ZUVA 3L5OA 2FPVA 1H0IA 2G41A 4B3KA 3HM7A 1CGVA 4IX2A 2PWUA 1H7RA 2OLAA 3W4RA 4LUSB 2XSBA 5DT5A 3BPWA 4DF2A 3N3TA 4PUJA 4PTDA 2WC7A 2BY1A 4O28A 1O5XA 3BARA 4IISA 1AQFA 5FS9A 3P14A 4OV4A 3CBWA 3H7UA 3HQPA 4HTBA 4IMGA 3QYQA 3OLIA 4UQBA 1MQQA 2VZTA 4PGLA 4OOZA 1HJVA 1IYXA 4P7RA 2E9BA 1KFKA 1BQCA 3A21A 4S39A 4B5XA 2NSOA 3M0LA 1UD2A 3AHZA 4J3SA 4MHBA 4P5UA 3EA1A 3SCNA 2YOCA 2C1GA 3NO3A 3S5OA 2PURA 1EJRC 4U10A 3W7QA 4CGTA 1E51A 4QCEA 2J7EA 4NJKA 1RQBA 1UKQA 1XV8A 4MJMA 4YTSA 1XF0A 2DZUA 4B4HA 3I7SA 3ME3A 1A3WA 1C92A 1UP3A 1HX0A 2QCFA 2GVGA 3ABQA 5MF5A 3A7UA 4KGLA 2GUBA 2Z7GA 3LCHA 3WQCA 2P88A 2X0YA 3T0BA 3G0UA 2DPEA 2DZPA 4N0RA 1BYBA 3NZGA 1GHSA 1LT8A 2X16A 3OHMB 3GYCA 1ISZA 4REQB 3ARRA 4JFSA 4L9XA 1BLIA 3IAQA 4JICA 1CWYA 5GJMA 2ZZ1A 4HSNA 3NG3A 1O1HA 3U9IA 3WNKA 4UFLA 3BZJA 4OHQA 3CTTA 1TJ2A 3LXAA 3RU6A 3PZ9A 3NQMA 1NWRA 1VFFA 3SECA 2QVHA 5C71A 1GETA 2WJDA 4H8HA 7A3HA 3DERA 3L65A 2JEQA 2GJPA 1VFMA 3GR8A 2W79A 4HT3A 2Z24A 3HPFA 1I2RA 1EGVA 4DI8A 5DQPA 1DJNA 2UY3A 1VBRA 5B80A 1DTNA 1UMYA 3W2KA 1XPGA 2V63A 4UR9A 3AMLA 2X05A 2B7OA 2AL1A 4IMAA 2BS9A 4C6QA 1SO3A 1I2OA 1SW7A 1UG6A 5ECUA 4OIFA 4UBPC 4EQSA 3M6DA 1YKWA 4IXXA 5A6KA 1LPFA 3F1QA 1RJPA 1K9FA 1X6LA 4NF7A 3SRKA 1LUCB 4H7ZA 3V1PA 4HNVA 1EJSC 2B4GA 4ZOAA 3S6DA 5AB3A 3DGHA 2GOKA 4ES4A 3G1XA 3M0VA 1ZNNA 4M52A 3NL5A 1TCDA 4LA1A 3B8VA 3W7CA 1US3A 2FIQA 4P2VA 1IZKA 3P61A 1ZJHA 1OK4A 4LVDA 1VYPX 1XANA 2H90A 2VVNA 3B9EA 4LALA 4I5RA 3SUSA 5BXPA 2W61A 2X1IA 1DBTA 1WZMA 3MC5A 3TYDA 1J0IA 1K77A 2JEPA 4RNHA 4FPSA 2HPIA 2XTKA 1TJPA 2GGJA 1N8FA 2V6AA 2R1MA 3TR9A 2J66A 2BTMA 2R24A 4ATDA 1HJQA 2DSKA 1J6OA 4N4QA 3EOSA 5K2ZA 1CGWA 1FKWA 3QM3A 1O66A 3E12A 1RA0A 4Q8VA 1GCYA 3CB8A 1BZLA 3TYBA 3ZMRA 2YJQA 3STCA 1QCWA 4UTLA 3HZ3A 4Y7EA 4UUIA 1PIIA 2XVLA 1PCKA 4RV3A 1ONEA 3M7WA 1QNOA 1QFEA 1AMKA 1FUYA 3ITLA 1FTXA 2YW4A 3A4XA 3OLEA 3WLTA 4B2DD 3OU8A 3N4AA 3AXMA 3WF0A 3GRIA 1GKRA 4OVXA 3BW2A 2BV9A 5D02A 3TP4A 2CU0A 3W02A 4KWOA 3L4XA 1ODUA 4MNJA 4DXXA 2DUAA 5FAJA 2FLIA 1I1XA 4JN6A 3B06A 5B7ZA 5BRPA 3FGCA 4HYRA 1DE6A 1DJGA 4UFKA 3N13A 4W84A 1A5BA 3C0QA 4K68A 2HK0A 5REQB 1H61A 1KXTA 4UNKA 3QV7A 4NL1A 3AMGA 2FZBA 4Y9OA 1NDYA 5G4WA 2PDGA 2FYMA 3C5QA 2QJIA 1D8CA 2RJHA 3TWBA 4GI8A 2Y0FA 4BEQA 3MBDA 4JQ1A 4I6KA 2FTYA 3IIVA 3CHEA 4BI5A 1TR9A 1F07A 4D6GA 3EX3A 3PJWA 3F5KA 4UTMA 1NHQA 1OSEA 1AZ1A 3DH9A 3BW4A 2V3EA 4MOZA 2GGHA 2UY2A 3IVUA 1E56A 1QW9A 4JIIX 2PMQA 2F2HA 5U1OA 3ZVHB 1S39A 5G4HC 2A0NA 4S3DA 1FCBA 5DCEA 3O2LA 4WKAA 1G69A 2R8WA 3B4UA 1EJ7L 5CZSA 1LG2A 3KXQA 4C6IA 4DYEA 4M5PA 4HIBA 4H01A 1TQJA 3SGZA 3K1GA 1K02A 1XYZA 3HV9A 1Q5MA 3WLPA 3NSMA 4D8LA 4WVXA 1W3NA 3M5YA 3MZNA 3ZFHA 4CCEA 1J0ZA 3WMBA 3GDRA 4JYFA 3B0YA 3HQNA 1UA7A 2FMOA 4DUXA 3DECA 2ZZ7A 3WLMA 3GHSA 4GI6A 2F5ZA 4PTNA 4WOZA 1PHWA 2V5KA 4DNHA 2VD8A 2JF6A 3PNUA 4JL2A 1TTIA 2QEZA 3T07A 2CLHA 2HDJA 1HL9A 2HMCA 2ZDSA 1LL7A 3GVQA 2Z2AA 4LB3A 3OQEA 5BWFA 2PP1A 2Z1VA 5CBBA 2C18A 4GQRA 4F9JA 3N29A 5D9NA 2GDVA 1RM6B 3GZAA 3BMWA 4IMCA 2FTPA 1ME8A 2BVDA 2VQTA 1CGXA 4H4QA 3WD0A 1AMYA 4Y90A 1O6IA 3BXWA 1YDYA 4I9JA 1JCNA 4LCRA 3UVIA 2PP3A 5C8BB 3H2NA 1FVPA 1W3TA 3H4XA 3B0PA 3PSWA 2YA1A 4WXYA 5MKGA 4ML4A 2XFRA 3FAXA 3LSBA 3LM7A 1SR0A 3WELA 3CMGA 4H04A 4IJCA 1H2JA 3W9ZA 2DSUA 4P7NA 2OSWA 4RL3A 4H50A 1G4SA 4J40A 2YSWA 1E6QM 1OFEA 4B9ZA 3CWNA 3RFAA 1V3IA 1SJDA 3BW3A 1QPQA 2Y8UA 5C55A 1PKYA 4LC8A 3C2EA 1H0GA 3CAKA 1MNSA 2A85A 3WMLA 4Q8OA 4W8AA 2JGYA 4MSSA 4X9SA 1WDPA 2YKKA 4XTIA 4GC3A 2YVGA 3RX3A 3M5XA 4MZ1A 3I3EA 2PB1A 5A6MA 2IKIA 1J12A 3PZTA 5AC7A 1SO4A 4EAYA 4FI4A 2NXGA 3R13A 4C6KA 3ZO9A 1C8VA 2Y85A 3LGGA 1XHCA 3GDLA 3PBUA 2O9RA 5E0FA 3GXDA 2WMFA 1LP6A 1GERA 4WKFA 3U6WA 3VVGA 2BGSA 2WCSA 2YCJA 3N19B 4H3DA 1WNOA 3EPNA 4UQAA 3DBPA 1FHVA 3R4IA 1FRBA 4B5SA 2ZKMX 1XRFA 3CYJA 1JCYA 3K4AA 4CKQA 2WM0A 1GYLA 1XDMA 3G8RA 4D9PA 1TV7A 3FVDA 1XJBA 3NM1A 1G94A 3NVZB 3TQKA 2E6YA 4BS0A 3H21A 5FEXA 2J6XA 3CO4A 3QTPA 3WQEA 1GEHA 4I7UA 4DM1A 3WENA 3O05A 4AY1A 2X8CA 3A3WA 5G2HA 4ZB5A 4M7SA 3KBVA 1W3JA 1MXGA 2WPGA 3OIXA 4R27A 4RR4A 2AQWA 4TO8A 4O1AA 1FCQA 1X6NA 2YDRA 3TZNA 3SQSA 1P0BA 3U7VA 1GEUA 4CEXC 3EDDA 5TBOA 1I60A 1FWBC 1VRXA 3BURA 4KT2A 3LBCA 3AYTA 5LSMA 4K7YA 1WYIA 2V5BA 3PK7A 4Q4RA 3NZ1A 1RPKA 1XDLA 3T55A 3TYAA 5L6UA 1J2BA 3LEPA 4L80A 3W82A 2DVXA 1PCWA 2EKGA 1PZ1A 3LUTA 2INFA 2OSXA 2XH7A 1E71M 1KM2A 2E6DA 1SO5A 3PR2A 1JQXA 3PZOA 1C29A 3SR7A 4ZMGA 3LM3A 3LCGA 3SM0A 4L1WA 2GR1A 1MRAA 2GL5A 3O7UA 3MHFA 3WH9A 4DUWA 1ZAHA 4QQUA 1HIZA 2XU2A 4OJYA 2A3CA 5JMUA 1H6VA 1YNYA 2OOGA 3W7KA 4QHRA 2XYLA 2PDWA 1UKTA 4MIMA 4M24A 5D30A 3BUVA 4ZZ9A 3CXBA 3NQ8A 5I3DA 5JCLA 3EXRA 1KQZA 2V8ZA 3LENA 5TF0A 2WC4A 3B9JB 4C5ZA 1L6SA 3QSRA 1JRBA 4R5EA 1ISWA 4PUWA 2PUZA 1MW0A 3JS3A 2Z4GA 1K70A 2A5HA 3H7RA 2WC3A 3UA4A 1XXXA 4PL1A 4E38A 1LRTA 4J27A 4TX9A 2EQ8A 1HN1A 1EJXC 1GEQA 1YTEA 5BOOA 2WSPA 1FHLA 3PTKA 4NXKA 1P0NA 5CJNA 4KFNA 3E49A 2JF7A 2ZXQA 2FFIA 3IACA 1ICSA 4YVVA 3LTYA 3PG6A 3N18A 1MOKA 3QV8A 3AIBA 4YL2A 1Q4NX 1E4IA 2ZXAA 3CL7A 3ZSTA 3WO8A 1T0OA 3W07A 4RE0A 1F5ZA 1P6CA 3SCOA 3R10A 3QH2A 4JTFA 4GUGA 1ZL1A 3CIVA 4AW7A 3L0GA 4QG8A 5FS6A 1QAPA 3W7JA 3VKBA 3S42A 1V7AA 3NDOA 4JL1A 2CKSA 3ZJ8A 1QU4A 4CEUC 5I24A 2XSAA 1TCMA 2HE8A 3S2JA 4JX4A 4XZNX 4RZ5A 3MV11 2AAMA 2EXOA 1QHOA 4DO7A 3P93A 3QKZA 3MCNA 3KCOA 1AG1O 4JTUA 3QFBA 3Q65A 5JVLA 1CDGA 4MY8A 1GXFA 1NWSA 2G3IA 2EQDA 2NT0A 4IM4A 3MV01 1QOQA 4WKHA 2WVUA 4ZQPA 3FV9A 3N14A 2ZDRA 1GOIA 1NIUA 1OFBA 3DHDA 3LHVA 3T08A 3ARSA 4XUGA 4ACYA 3ZT6A 1UP0A 4KEZA 2UWFA 5HNRA 1XLMA 1W9UA 4IFOA 3VCCA 4EMIA 4FXRA 4JTEA 3TJ4A 4REQA 1ZP4A 4DUVA 2JFEX 3GNRA 4A8IA 3DJJA 2D2OA 1SFTA 3ZR4A 2QMJA 3AIWA 4C7DA 5I0DA 2GQAA 3UPBA 1KRMA 2QHAA 3U8GA 3EAOA 1VHCA 4K6AA 2OSYA 2XINA 1XH0A 5DRIA 4LANA 1EGZA 1XQKA 4J3ZA 3L2LA 3AO0A 4OU1A 3A9IA 4O0QA 4N9CA 1KM3A 3HB9A 1XLFA 2Z27A 2X40A 3PBYA 1KCXA 3C3NA 2QUVA 5FF3A 4AVNA 4QBXA 1KFBA 2O9PA 2J27A 4MNLA 3IUIA 1H1YA 3RCNA 4O10A 4A21A 2YX0A 3W24A 1SSDA 4NAEB 3ITCA 3PZVA 4MWAD 5BRQA 6REQA 1UWAA 3HMCA 1TREA 3QV9A 4NVTA 3DHFA 3CT2A 5H1WA 3IC9A 4O1EA 2PU0A 1DL3A 4Z42C 2ZXBA 3BOFA 2D0FA 1EA0A 4XD6A 3WEMA 5I09A 3CQJA 1TSIA 1JEHA 2DZAA 2DP3A 2OTDA 2X0SA 4JQ2A 4RDVA 3W7MA 3QGKC 3QQ0A 5FCZA 4Y9PA 3TN6A 1YRRA 4ZO9A 4XBJA 1FHUA 2V3GA 2Y70A 1U5VA 2AGKA 4HOXA 2VHLA 4UFIA 3WJXA 3GAKA 5KTLA 1U1HA 2WJEA 2A3EA 2RDXA 3PB2A 3WD2A 2XM2A 1S46A 1W9VA 4BY3A 1GRHA 3PZUA 4IGNA 1NF7A 3UR7A 3W01A 4XD5A 2ZQ0A 3WN6A 3KDOA 3M0YA 4L5ZA 5DFAA 1PKLA 4DJEA 3VIOA 4DF0A 1XG4A 1JEZA 3CO8A 3WQVA 4GABA 4LW7A 2ZC1A 1LJYA 2CHNA 4DJEC 3TA6A 3SY1A 3UJFA 1EGMA 1VRDA 3VAVA 3AMZA 3Q37A 1TVLA 2PBOA 3NZRA 4FK9A 1N63C 2VOMA 5CSUA 1RPXA 4G9PA 3QOKA 3APGA 1QR7A 1XUZA 7REQA 2QW5A 4LV4A 4D8ZA 3E5PA 3R25A 3MKKA 4DJFA 3RM4A 3D3AA 4MKVA 2PWHA 1RSCA 1W9XA 3NOEA 2GVEA 2OO6A 2VEIA 3CPUA 3SCWA 3FYYA 3MMUA 4ZFCA 1A47A 2WVVA 1SZRA 4W5UA 2X09A 2QCDA 3PP7A 1TJ1A 2BGNE 2QCGA 3T2OA 3W1LA 1RXOB 3TAOA 3EYPA 4F4RA 3THQA 3TA9A 3W23A 5I3FA 3TWAA 3AJXA 3XIMA 4JN8A 1OFOA 4JIPA 1EUAA 4PODA 3TW9A 3LCLA 4O0KA 2QCLA 1UZDA 3QZEA 1YE4A 3SCTA 4C7FA 1ZP3A 1JPIA 4NZFA 4QJ4B 4I9MA 1VQZA 2A6NA 2ZUUA 3DI1A 1V6XA 3HBLA 4NXSA 1UWTA 4L56A 2BGQA 4JTJA 2RGLA 3M64A 1JAEA 1PSCA 1VFOA 3K46A 1WKEA 3R11A 3B03A 3NYDA 4IPIA 4PMJA 3C0SA 4QXIA 3TIMA 1HKMA 1S2WA 3GHUA 2HBXA 3AXIA 3DKJA 1XCFA 3WLNA 3W7NA 1FDJA 4DO6A 5JBFA 2Z25A 1JYNA 3U2EA 1MZHA 2EPLX 1HKKA 3U4AA 3UERA 2J13A 3K30A 2QAPA 3VDCA 5FMHA 5F4SA 3H2CA 1VH7A 4IFKA 3NL3A 4NJHA 3LRKA 3CUIA 2BX7A 3PJXA 3NQBA 2X41A 1WBHA 1QK2A 1LDCA 2E6AA 3FEQA 1FWIC 3NQ7A 4NAFA 4BWLA 2JE8A 4Z1BA 4JHOA 2Z6IA 4MGGA 1NSJA 4L1GA 2EJAA 4ICMA 1YNPA 1NH6A 1ELSA 3KWXA 2QDHA 5BROA 4APNA 2I17A 5U4NA 4PA8A 1WB0A 4DBSA 5I03A 2PAJA 1W5OA 1PTGA 1AJ0A 4GXWA 4X0VA 1LG1A 2WO5A 5LNUA 2UBPC 5AHIA 3UXDA 4GGBA 3G1DA 3KS5A 5DY3A 3UXAA 1K7EA 3FYPA 4M8UA 3JZEA 2RDWA 3MANA 3CV1A 1TPB1 1PYMA 3GY1A 1NVMA 1I6NA 4M82A 4XKYB 3QFWA 4NYYA 4YPJA 2GWGA 3ITGA 1K9EA 1YBQA 5HWMA 4Z2LA 2WHJA 2BXYA 3T81A 2HROA 3NJ3A 4PUEA 1BQGA 2Y7GA 3TN4A 2V2DA 4HU4A 4H8UA 2ONEA 3LADA 2VFEA 1F9CA 2BNJA 3UWQA 3LRMA 1Q6DA 4GVFA 3RDKA 3CS2A 4NU7A 1F2JA 4F0SA 1O68A 2FVMA 4Y9AA 2WVVB 2D1ZA 3IVSA 1ZGDA 4LAZA 4ZL1A 1OCJA 3DGZA 5C54A 2GQ8A 3RGTA 5BYWA 1VB9A 1FWRA 2VKZG 1MQPA 3V16A 1V0MA 1WCGA 5DX7A 4KEVA 3W27A 4GH3A 4PTXA 1E73M 3UYCA 4CNNA 4JTRA 1WZKA 5C7VA 3T09A 5BXTA 4RV8A 1Q6EA 4MAVA 4AWTA 1OJTA 3WQPA 3ICJA 3LERA 3IEBA 4DWSD 5T26A 4Q6JA 4OFCA 3TTOA 3DAQA 4X22A 2J75A 3V4BA 3R43A 2Q71A 1VKFA 3WFAA 1GOWA 3RG6A 3C2RA 1OBAA 1XFCA 3S9IA 5HR7A 1QPRA 1GZJA 1POJA 4DHGA 2IXUA 2OT1A 2EKCA 3NOYA 5AYBA 4ZXOA 3LXCA 4DELA 3WG6A 5AKQA 4ACZA 1TWDA 3GRTA 3IVTA 6TIMA 1EF2A 1F3WA 2EG6A 4GXPA 3HPAA 4RZ6A 3GG8A 2QMKA 3LA4A 1PIFA 2E09A 4ZB2A 5DCDA 3UP8A 2OGYA 5JH2A 3WCZA 2PF0A 1GJPA 4FS9A 4QE4A 2GPTA 3F5JA 4LOCA 3SUUA 3EKZA 3LSCA 2V3DA 3S8HA 2HQAA 4YTTA 4QJ1A 4K7ZA 1XLKA 4PUDA 4PYSA 4FNUA 5J5DA 1NDZA 3AROA 4H2CA 4LY4A 3HW2A 1ZHAA 1R7OA 2VCAA 1IT0A 2D23A 4UFHA 2NXIA 2O9OA 1V6WA 3GAYA 4B92A 2O4QA 3UZJA 1N62C 1IZCA 4H00A 2A3BA 3MPGA 2YPIA 1ZMDA 1XYLA 3W22A 4MWAE 2HNEA 1L2QA 2EG8A 3FA4A 1X8FA 4R33A 1ZBKA 4TMBA 4EPDC 1AJ2A 4O18A 1BTCA 1V0LA 3WX7A 3FFSA 2CHOA 5CPSA 2HRWA 3VX0A 5M03A 3DOPA 4E0CA 1UBSA 5TNVA 2EHHA 1V03A 3WL1A 4Y9NA 3WDHA 2EEXA 1NF0A 4MKNA 1B57A 2XH0A 4LVAA 5EMUA 3L23A 3LZ5A 4TIMA 4AFYA 2PGFA 4F0HA 4Y9MA 1DQWA 4W8LA 3WDIA 1W37A 3KOZA 4FEZA 5HNTA 2NV1A 1TX0A 2IKHA 4K2SA 3EWUA 3IJQA 5TIMA 1AJZA 1W9PA 7PTDA 4AIBA 1X1NA 4TR9A 1S2TA 3VOJA 2Z2UA 4O4WA 1BXBA 3CZJA 2J7DA 2GR2A 2E9MA 3EX6A 4ROQA 3QMSA 2OVLA 3BOXA 1QPNA 1QI3A 1ZAJA 3ONCA 3TJLA 4YNGA 3BG9A 1P4CA 4L6OA 1GJUA 2I14A 2G8ZA 1O5RA 2X8GA 3BMXA 1KRAC 1J6PA 2NX1A 3P0XA 3UY8A 1W8GA 3GVWA 1JZ8A 1UJQA 1DHKA 2REQB 3EX2A 2GJXA 5H8MA 5LHEA 1DJQA 2R91A 2ZVIA 5G5IA 3GDBA 1TTJA 5D32A 3S1XA 1FWDC 5KETA 3LV6A 4QS6A 4F0RA 4Z2HA 3LCIA 1NWTA 3GH5A 3GBDA 3MHGA 2QIWA 3K8KA 4GYKA 2YBUA 1XLIA 3QMTA 3AZTA 2HE5A 4IJRA 4JDYA 4GZ7A 1G4EA 5AY7A 4KQNA 5FKYA 3VNJA 4IMEA 1O60A 2BC0A 1R3TA 1DIOA 4PB5A 1V0KA 3UETA 4G7EA 2ISDA 1N8IA 1T40A 4UR8A 3S2CA 1S1RA 2P53A 1OT1A 1JCTA 1P6WA 1E6ZA 4W5ZA 5CJMA 2VOTA 5JCKA 4XV0A 2Y8VA 4LCSA 1C9WA 4OBTA 2VZUA 1E0TA 2WKLA 3H2EA 2EJ1A 1P7TA 4MNMA 3WLIA 3A12A 4N9BA 3TN3A 5HQMA 3M9YA 4DO5A 3ZZ1A 1UOZA 1TTQA 1I8JA 4DWDA 3TYEA 4G8TA 3ALFA 3BAWA 4HKPA 3ARYA 3UT0A 3MI2A 3O6YX 1OK6A 3NQEA 4JR5A 3T8LA 4DLFA 3T8QA 3NUKA 2QJNA 3V5CA 4GX8A 4EQXA 3B8IA 3AXXA 2AOSA 2VGGA 4WGXA 1UR4A 2Y89A 4MNKA 4X9YA 1TPWA 3LQGA 3H7VA 4RW3A 3AI0A 3VGDA 1VFLA 2FMNA 3BG3A 4EANA 3FHQA 1ZENA 3WK3A 3IPWA 1EC8A 4H9YA 4LF1A 2NV9A 5D03A 5M3WA 2QF7A 4Q4MA 4A29A 4PC8A 2O7QA 1QPOA 2A8XA 3H2MA 5FJOA 5M1TA 3VOGA 1W1TA 4ZOHB 3NSXA 5CQ1A 4GUHA 4PMOA 1EQPA 1GOMA 3R12A 2E28A 1MVYA 4PRWA 4J28A 4FALA 2Q09A 3FOKA 4Q8PA 3PAJA 3AXHA 2VC5A 3C8NA 2EGZA 4QR6A 1N55A 1US2A 4LGXA 1V08A 1B2YA 2VI0A 1WKDA 3W75A 4E8GA 1GRGA 3M1ZA 4C5YA 1GWJA 1MW2A 4QNWA 2XH4A 4H2HA 3OEXA 4FLRA 2CFFA 1GVQA 4NX5A 1STZA 3MCOA 4ADUA 1K6AA 1WXZA 3C61A 3SJ3A 3A3HA 3EMZA 4DPPA 4KCWA 4AIOA 5I02A 3A4JA 5F1UA 3SDOA 2J7BA 1JPDX 4PTMA 5C6MA 2JIEA 3CZ8A 3KTCA 3CC1A 2ZA3A 4NAFB 1U1JA 2CLKA 3GR4A 4Q6XA 1O4UA 1G7VA 2PLJA 3MYPA 3FSTA 3EMQA 1EHAA 1HW6A 3R0UA 4LIIA 3UEQA 3SJNA 4EIVA 5LIYX 3ARZA 2I5QA 3W74A 1UD4A 1C7TA 4AG0A 4IIBA 1ICQA 1FP9A 4LNCA 3BMVA 4MFDA 4ZBCA 8A3HA 1GZ1A 1XKJA 3CQHA 1JFXA 3GR7A 4W9TA 3L2IA 1UH4A 1WYGA 3W6MA 3CIWA 2FHCA 2VC9A 1E0WA 2B7PA 4FR1A 4GLEA 2X50A 4AXNA 1MEWA 3O3RA 4DBUA 1E6XM 1UC4A 1ZMCA 4MDOA 1OCNA 4PMVA 1KGUA 4WUIA 3GKAA 3NNTA 1K8YA 1QHZA 2YBTA 3DYPA 3UY7A 2CPUA 3MYOA 1E6RA 2YCEA 4UZUA 3UR5A 1IR2A 4F2UA 2I1OA 4OTKA 4IWWA 1MRQA 1JCLA 1H7XA 4EXAA 2B7NA 1HL8A 1J96A 5JCIA 2C13A 2CLEA 3OOQA 3IGUA 1DKWA 2CLMA 3AM9A 3THDA 3FGCB 1UKSA 3GC4A 4AEEA 2V0TA 3AZSA 3DZ1A 1GG1A 4O0ZA 3IIXA 2VCBA 1UIPA 1TYTA 3EA3A 3KOWA 3ARQA 1BWLA 3CV6A 3GU1A 2C3DA 3GZ3A 4W7VA 5AVHA 4AY8A 3QC0A 4QEEA 4GI9A 2V69A 2YW3A 5K7JA 4QNEA 3AS0A 1DHPA 1JPMA 1VLWA 3E0LA 3OHIA 4HMNA 4JTAA 4QS5A 3B8DA 5MKGB 2YB1A 1DIEA 3FY1A 3C56A 1ZDLA 5HQLA 1Q66A 1IWBA 4BHYA 2DUZA 3MSYA 1PE1A 1V6UA 1T7LA 1HVXA 2P10A 1X1ZA 3HF3A 3M0JA 4YWIA 4P7QA 1Z3NA 5HMFA 1H63A 3NTYA 4BQ5A 2Y88A 3SRDA 3UJ2A 1HKJA 3EKGA 4GXMA 1M3UA 2PTWA 4JXCA 2OQHA 2BODX 4GBUA 1TMLA 2OEKA 3STGA 3ELFA 4Z1CA 1M04A 1TG7A 4RPPA 5B7YA 3MUAA 2AKZA 1NP2A 2GJLA 1P43A 2HVMA 4MZYA 3R5EA 5BWAA 4IICA 1FWNA 5H91A 1GQJA 1YHTA 3T4WA 2ZZ6A 3N9SA 4KWUA 2ICSA 4EF8A 3C2OA 2XGZA 2OZTA 1FOBA 3ES8A 2FHFA 3VIHA 4Q8WA 4JN7A 3DK4A 2VX4A 2E5BA 2UY4A 3RX4A 3ARXA 3CL6A 2IXVA 3BVJA 3VIFA 3KAOA 1FWJC 3KBJA 1TIWA 1B1YA 1B9ZA 4B90A 4LS2A 4BR1A 5CZ0A 4LFYA 5I23A 4GBDA 3GLCA 2CZVA 3CAVA 1C7SA 1IGWA 2WK2A 2FZNA 4JGDA 1E0VA 3LXDA 4GVHA 1W3HA 3NYZA 1UUMA 3F4DA 1JRPA 3H2OA 3W87A 1UD6A 2VDIA 4IL2A 1YPIA 1K4GA 1MQRA 1OFRA 2BMBA 4O8AA 1XIGA 3BAXA 4HPXA 2V6OA 3HMJG 2CESA 1XYCA 3TZFA 4PUKA 3OA3A 3RPDA 4S3EA 3LNMA 1QNRA 4IX0A 1UWUA 4Q8UA 1OVDA 1ZB5A 4M80A 2FZ8A 4TV5A 3RX2A 1IXOA 3V0TA 2YIHA 3DJGX 4JQAA 1C8XA 4GIYA 3SY5A 3QPEA 4O1FA 1VCGA 2DH3A 2REQA 3I6RA 3BCDA 1FWAC 1EXBA 2J8FA 2F6XA 2O56A 1F73A 5A6LA 3OBKA 1W31A 1U2YA 3NQDA 4G5DA 5EYWA 5HJXA 3E3HA 3U7BA 3BICA 4IPLA 3GVRA 5AFDA 1IHIA 5CGTA 1HGWA 1OX6A 4ZOCA 4TQTA 4DZHA 5G1YA 4NX0A 3VDBA 5HNUA 1PVNA 1XYAA 4K7VA 5D2XA 2V5JA 3ZIZA 5F2IA 3EX1A 3BJTA 1KFLA 3FVMA 2QCEA 1LOQA 1OY0A 3ARVA 3RJYA 5E70A 1S2AA 1IT8A 2XDFA 3GFYA 4DJDD 1LQ0A 4UNIA 1O94A 3LTSA 2W66A 4HMEA 4LYKA 3C2VA 3TTEA 4PRTA 4TVYA 3LS9A 3CU2A 1VP5A 5HA7A 4B91A 3LU2A 1A5OC 3N11A 1TWZA 1C8QA 2DJLA 1N82A 3RRXA 1EDQA 3WLOA 3M43A 3MB9A 5CC3A 1TV8A 1Z8AA 5KVHA 4EMJA 1EIBA 2YL5A 2PF8A 4E6MA 1DWAM 3PPFA 4H1ZA 2AMXA 1L8NA 3RRAA 4PFHA 1J11A 4MG4A 5BZAA 5A8MA 1AL8A 1JNEA 3CM4A 1ZXIC 1O5KA 2G3NA 1AH4A 2DT3A 1TFVA 1H3GA 1WPCA 5K9CA 5I3GA 3W1UA 5LIKX 2DH2A 4L4OA 4QLJA 2VX5A 4A4AA 3N2CA 2YCKX 1GT8A 3F4CA 2H3BA 3QQWA 3O15A 3UJEA 4Z0JA 1ZAIA 3AZRA 4CNUA 4O57A 3GYEA 4V33A 1S5NA 2P76A 1ONXA 4NZ5A 4UTKA 3GIQA 3VYLA 4KEMA 3WH7A 4N9EA 1A4LA 1Z48A 1H2IA 4N02A 3ARPA 4OGZA 5ABHA 1Z42A 2OELA 3BZGA 5GRTA 3A3XA 7TAAA 3VDAA 2DZSA 2VMFA 1NQKA 1R2TA 3BL3A 1PX4A 1CZ1A 1Q13A 1IGSA 4KRZA 1XLCA 3TDFA 4ZR8A 3PG8A 4OV9A 3LPGA 4B3LA 1WDWA 4N6EA 4DPQA 1G5AA 1GW1A 3S0CA 3N1AA 4LUIA 4GNJA 1PBGA 3NQ6A 3LPOA 4IL0A 1UR2A 4QLLA 1M9HA 3ZR5A 1YXYA 3R8RA 3RPTA 1D3HA 1DJIA 1G4TA 3HFTA 3O0FA 1EPXA 5L9FA 5IDIA 4B15A 4EQRA 4ZOEA 1NP0A 4H4ZA 2EAWA 2HPMA 3WZ0E 1QJWA 4I8YA 4MZ8A 2ZA1A 1ZRQA 1U5JA 4AZGA 3P5YA 2E5AA 3HJZA 2VYOA 2IPWA 1VFSA 4FLSA 5U25A 2FZMA 3ARTA 4LH8A 3XINA 1NFPA 1AQ0A 1V3KA 3BJFA 4CVUA 4JYDA 5LA2A 3VOHA 2A6LA 4M19A 1SSGA 1J79A 1XQLA 3PZGA 4F2BA 4FP1A 3LV5A 2PGWA 4A6GA 3JRKA 2KX9A 2Z7KA 2GR0A 2Y7DA 3N4FA 1KBJA 4ZEPA 2F9RA 1FWSA 1VPQA 4C6NA 2P8BA 3GM8A 1RH9A 3ISIX 4ADSA 4H9XA 4HNCA 5EB8A 2E1DA 3ABSA 3QZ6A 4KIRA 1M53A 1J10A 4C91A 1VBGA 5CPNA 3HN3A 2PE4A 2OWWA 2GVJA 1NJJA 3TCEA 3QLLA 4ZE5A 4I8DA 4AVOA 3D47A 1RUSA 1JPKA 5AYYA 3GSMA 3W2JA 2ACSA 1OG0A 4Q4QA 1TWWA 3NVYB 3UW6A 2GLKA 3F7JA 3OJGA 3QFEA 3E74A 2VFHA 5I79A 1KFCA 3AOFA 1V77A 3QZAA 3GTNA 5GPRA 1W54A 1ITXA 1DP0A 1V3LA 2QCDB 2ANUA 3EOEA 1KWKA 4B5TA 1H7WA 1WXJA 4MVAA 4XD3A 4WDTA 3NEVA 4CQDA 4LS0A 4AIUA 2HS6A 4M56A 5DXYA 1EDTA 1RY0A 5HPCA 5HDRA 1JYWA 3CHCA 4R34A 4MFEA 1XICA 3ETRB 4NHVA 1GSNA 4WK9A 2CLLA 3BGJA 2HQMA 3WH5A 1JZ4A 4XX6A 1NOWA 3G5EA 3VI2A 5DMYA 3U2ZA 1RCOB 3D46A 1SR9A 2Z26A 1X8CA 2D22A 4IFKB 3SUTA 2JQXA 3WEOA 1GQKA 3I68A 1K1DA 1W9DM 4IT1A 3VGGA 4F3HA 4XSLA 2Q02A 2VXNA 1K8ZA 3U48A 4WGHA 2W27A 3WYZA 3W7EA 4H4XA 3SCRA 3IJIA 1LM1A 1W2VA 5LNRA 5EMLA 1MO0A 2EPHA 3QYSA 5C2GA 1JDEA 1YW1A 3S9ZA 1R86A 4JZ5A 4IF2A 2WOVA 1FFRA 1VC4A 1XDJA 4RDZA 1SW0A 4RKAA 3JUGA 1JZ6A 1FFVC 2JBMA 3EEZA 1MO9A 1DXEA 1JF6A 1JG9A 3W1NA 1ZCOA 3MO7A 1EC9A 3USBA 2GOUA 4UMBA 3MI3A 4MB4A 3KWSA 4GCAA 4ATLA 1I45A 5A2AA 1VEPA 1IXPA 3W1QA 3I3BA 4QGCA 1R9XA 1QO5A 4FIQA 4JNZA 1PWLA 5A69A 1A80A 1QNVA 4H6QA 1NPXA 2G37A 2D2HA 1AUSL 5CG0A 1EYEA 2GQWA 5DELA 1EEPA 2EO7A 3TNOA 3OGVA 2VRKA 2O0TA 4AD2A 4BKNA 3MDUA 1WA3A 3DG7A 4LBUA 1NDAA 4UTJA 1FXPA 3RLGA 1MEHA 2H6RA 4L9ZA 2NW0A 5FJRA 4DJDA 2J62A 3BSGA 3WMCA 4Z1YA 4HA3A 1GQIA 1IWAA 2C19A 2PDMA 1I2PA 1OWQA 3AWNA 5D33A 3MT1A 2QAEA 1PWMA 2R14A 4K8GA 3FAWA 3RLVA 1QI2A 2GR3A 3UESA 3R89A 1IXQA 3QJAA 3WK1A 5DMMA 1U5HA 1NARA 2FDSA 3CGBA 3VC6A 3NZPA 2E40A 3AFBA 3VC5A 2RH9A 1GRTA 3EANA 9CGTA 3I10A 1X97A 1ZCCA 3WNPA 1S3TC 2P3EA 3LDVA 5DRCA 1EKOA 2J77A 2WSKA 5A1AA 1YDVA 1TUXA 2E7FA 1GW9A 4KKXA 3FJ6A 4OBRA 2I7GA 3UQNA 2WKJA 5CXPA 3I4EA 3TSMA 2ACUA 3P7YA 2FGBA 4FO4A 2EQ6A 2C79A 4PMNA 2HCVA 3AWOA 4IPJA 2Z28A 3BG5A 4DNMA 4DEFA 4YS1A 4DBDA 3GTHA 1V3MA 1M1BA 3R0DA 1XFBA 4B5UA 3UGVA 2C3CA 4Z1DA 3H54A 2OX4A 3G1HA 2QGYA 4EM3A 1A5SA 4TUFA 4OWGA 4EKJA 2DZWA 3VIKA 4JCMA 1MXDA 1E4NA 2PDYA 1L6FA 3K2GA 5EBAA 1UQZA 1Z7AA 3WUFA 4GHRA 3LX9A 4H19A 1OM0A 3V0SA 1KXHA 4WDUA 3PUOA 5CC7A 1W56A 1RLDA 4HK6A 4NT0A 1A5UA 3BAIA 2FH6A 3B97A 3EX4A 1Q6LA 3IK2A 3QSTA 1UZ1A 5HUPA 4GUJA 3NGFA 3REQB 4QE1A 4LT9A 3CTLA 5A5WA 1VIWA 2BCPA 1RR2A 2GK1B 2YDSA 3DCPA 2GVYA 3NA8A 1ISVA 1W5NA 3M5VA 3DH7A 3F03K 5AC8A 1RAKA 3R6IA 1WKYA 4JNMA 3GNNA 2KAUC 3WEZA 5KSWA 3TU9A 3RIKA 4AX7A 1BGGA 4GUIA 1LCOA 3OBEA 1RK5A 3S6TA 1LL6A 1JQVA 1PV8A 3RITA 5A6BD 3O07A 1C93A 1WDDA 2OCZA 4IP4A 3VKDA 1AQMA 4HZ8A 3U57A 1RCXB 2PRLA 3FA5A 1WDSA 1OGBA 2WSRA 1K7XA 4AEOA 1J0YA 2PODA 5KINA 4Z2KA 5CKSA 4JTIA 2V3AA 2FGLA 3SUWA 1FWHC 2E9LA 4WLCA 2I5IA 3KFTA 1XLHA 1NHPA 2PZNA 1RLCL 1ITUA 2E3TA 4S38A 3ZWSA 3WF4A 2WP6A 3GB6A 4HN8A 2IKGA 2C1IA 3U5UA 1W1IE 4QROA 5FESA 1R47A 5IFTA 3J7HA 1V3HA 3G6MA 3KP0A 1JYXA 2PC8A 3VNKA 3B8UA 4P7OA 1LT7A 4HYVA 2WMJA 1LWJA 1XLBA 4OQVA 1CPUA 4HA4A 1G4PA 2XJ7A 2POTA 5JIWA 4B16A 5FA5A 2WBKA 5H2ZA 3DESA 3QW4B 5A8PA 1ZK7A 5KEZA 1XM3A 4GX9A 4CNSA 3PTQA 3P74A 4A05A 4R53A 2B7QA 4LUTB 1XRVA 4M0XA 2NZLA 1X2HA 3VNMA 1D3GA 4PUMA 2R1NA 3WF1A 2QKFA 5FF4A 3NO1A 1POKA 2FPYA 1LROA 2NLIA 3TMLA 1HJSA 4P8UA 4O19A 1VF8A 2AAQA 1T8XA 1NHRA 2VWSA 4CUCA 1Q65A 5CPLA 3WDQA 4O14A 1VJIA 4MMWA 1A53A 4AIEA 2O4MA 1W5QA 4QP0A 4A35A 2NPXA 1Q85A 3KCJA 2GDQA 1E6NA 2FVKA 4GO8A 5LHFA 1OX4A 5HMDA 2INEA 3R7MA 1Y65A 4HYWA 5A6AA 1UUOA 4AVFA 5I6SA 4JX5A 5LGZA 4XAZA 3T0AA 1FEBA 4JIEA 4GFSA 1W8SA 2JK6A 4EXQA 5D9PA 3P8IA 4ICCX 5ABEA 1KM0A 1PZ0A 2XIOA 3WNLA 1W1ZA 4LEQA 4Q7IA 1NWUA 1KA9F 4XBSA 1EBGA 1VJZA 1E1CA 3WDPP 1QASA 3URAA 3VA8A 2ALDA 4JKKA 4M1RA 4TX8A 1J0HA 3KL0A 1OB0A 2G96A 1MWOA 1F8IA 2VELA 2PLMA 3HRDC 2QZRA 3WLSA 1B3XA 3SI9A 4DJFD 1IR1A 2TAAA 3VIIA 1LWIA 2DIKA 1Q6FA 3WBEA 5CG7A 2NSXA 3H8AA 3OYXA 3KE0A 4N2YA 1H1NA 2UZ9A 3W1MA 4EE9A 3DUGA 1W2PA 3WBXA 2BY3A 2WHMA 3IV3A 1PB0A 2W3SA 4ERAA 3SQPA 1ZU8A 3MVIA 3U0HA 2QXWA 3GHRA 1DYSA 4C60A 3WLHA 4KRTA 3G1RA 1F8WA 5T8GA 5DXXA 4C6PA 1G1YA 4GZJA 4BK9A 1EPVA 2V82A 5FF7A 3MU7A 4R7OA 2HTMA 3IWPA 5ABFB 4JHMA 1PJ9A 3MMDA 4H4IA 1C8YA 4UTTC 2XFYA 2NLYA 6ENLA 1OEPA 4ZB0A 3LBMA 4QAWA 3A5FA 4AHQA 2PEVA 1JD9A 2ZX6A 5I2UA 3DC8A 4PCSA 3EXTA 5FSEC 1JJKA 5K9XA 1OYBA 1ZTVA 3AHTA 3B9OA 1QOPA 4GCXA 3MHUA 4V15A 2ZUNA 3CLMA 5HPOA 3SCVA 1TRIA 2CWNA 3VIGA 3JVAA 3VD9A 5G1MA 1TE1A 3WH8A 1YEYA 3L4VA 1M65A 3URBA 2DIJA 2XZ9A 1NTHA 5H8UA 3IUDA 2OYKA 1TJ0A 2PTZA 2HK1A 3QPYA 1XUUA 4ALDA 4V1XA 3WQDA 3L4ZA 4EQWA 1FA2A 4M51A 3OLDA 4DJED 3IV8A 2ZUWA 1TKKA 4IQEA 4PEKA 8XIMA 3CUZA 4V2XA 3TC7A 1MEIA 4PZVA 2VRQA 3LHYA 3DYOA 4YJ5A 4O12A 1P0KA 4TX6A 3EDKA 4YWOA 4NUWA 4W4QA 3LPPA 4G1KA 3PFMA 3GDKA 2OQYA 5JRBA 3L21A 4CN4A 2A21A 5C9WA 1DWIM 2V81A 4O1CA 4Y96A 4JDRA 1SVDA 2VEKA 3TR2A 4JFVA 3CV2A 3DG6A 3H70A 1RZMA 3KUMA 4KFPA 2PP0A 4PBEA 3M07A 1GPFA 3ONBA 1TV5A 3NQAA 5M2FX 4HP5A 4W8BA 4HMDA 2O92A 3WJYA 5CZTA 1N61C 2WNQA 1DIKA 3FYOA 1UR8A 2WNZA 2Z1XA 3GG1A 2WLZA 4H7VA 1FQ0A 2AAAA 5FS7A 1J0KA 1DJWA 1JCMP 1WQ5A 3MY9A 3SFKA 1SQ7A 3UBPC 2E3ZA 3MZ2A 4JFTA 1CGYA 3CT7A 1AVAA 4KGJA 1GOQA 2MUCA 4NYUA 4EP8C 3ZSSA 5A8QA 2VEMA 1UR9A 2CLPA 3PZMA 3H4KA 2NQ5A 3CZKA 2QR6A 5E93A 3CNYA 3SCSA 2QAFA 3BAKA 5DN1A 1BXCA 4ZSTA 2RHGA 4IQJA 3PNZA 3C52A 1YDNA 4O1BA 2WMHA 5I5RA 1UA3A 2XIIA 1FY6A 3MA8A 3SRFA 4ZQNA 3AHXA 1D7YA 1LQAA 3UPMA 4I9AA 2PD9A 5BW6A 3GHTA 2Y63A 1M68A 3E0VA 3LRLA 4AYGA 1XSJA 3RHGA 3BCJA 2V9DA 2YR1A 1PZ2A 3BJSA 1KCZA 4YLWA 3N34A 1PHQA 3B3DA 1XISA 4PSPA 3WUBA 3EBVA 1NFGA 3KS6A 1SFLA 4IQDA 1XI3A 4UOQA 4QFUA 4XO6A 1BVWA 3AMKA 3WUGA 1WP6A 1X7IA 3USZA 1X2GA 3COTA 4ML9A 2R9ZA 4IUOA 4AISA 3A64A 4AH7A 1T5AA 4E4PA 2Y1HA 3C3UA 4UFJA 4HPGA 1LLWA 4UTWA 3VGEA 3B04A 2BHYA 4Y8EA 1HGYA 4W7UA 4J35A 5BCAA 2ZRVA 3F4NA 1FP8A 4ZQCA 1X6UA 2V2CA 2TMDA 4MKSA 3PG9A 1S5TA 3S5NA 4MLRA 1EZ2A 1PTDA 4YHGA 1TV4A 5C7HA 4G6CA 1F3TA 2OKTA 3CQ0A 2B81A 4J2MA 5C9RA 1CXHA 1AW5A 3ZVIA 2F7FA 5EL1A 4IGHA 4KCUA 4MB5A 3W29A 5AHMA 1XIMA 3H4GA 4KERA 3H4WA 7ODCA 2QPXA 2QPSA 1QWGA 2Z0IA 2XVGA 1JFHA 2DY3A 1LUCA 1Z6KA 1ZZMA 3RLHA 3MMWA 1RBAA 4WJEA 3OTRA 4KH2A 5F2LA 1PS9A 4MF4A 4PMZA 2FDMA 1WZLA 1OZQA 1DXLA 2FVLA 4LPCA 2VR5A 1LWHA 1KNWA 1FHDA 2FZ9A 4AUBA 1MW3A 4WJ8A 4DZAA 2X2YA 3ZR6A 1JPHA 2ZOXA 4JKLA 3I7RA 2W0UA 5E6ZA 5DLCA 4O15A 1KO0A 2EQ9A 1A5NC 2VEFA 3UWVA 3IGXA 1U30A 4IXHA 1R0MA 2D73A 4WX2A 3H2AA 3LOTA 2C15A 3UCDA 5K4ZA 4BJHA 4NJIA 2I16A 1ADOA 3P3BA 1GESA 3GC5A 2INZA 1IZJA 2VZVA 4FNSA 2OLSA 1W3KA 5GJPA 4MTVA 1Q2SA 1R87A 4CD8A 3ITVA 4PR4A 4RXGA 4FNTA 4GD0A 2J9YA 2V3BA 2RDTA 4HSOA 5HOSA 2IW0A 3FSUA 3V5OA 2H8ZA 2VJXA 5HNNA 2PDKA 3E5BA 1UD3A 1GYMA 3N2TA 2NWRA 4B3ZA 5FD0A 2G0WA 3GWQA 1H41A 2WPEA 1XR2A 1EF3A 2GZXA 4XD4A 2ZUTA 3EWBX 1KBLA 1AK5A 3MBFA 3BLOA 3IIOA 1BWVA 1MSSA 2XZ7A 4JY8A 3M0KA 2YCLA 4W87A 3KLLA 4ADTA 4NI8A 5GNXA 2IQ0A 4BV6A 1T6MA 3S2MA 2P0OA 1VAHA 5J8LA 2HJPA 1JZ5A 3A6OA 1XIJA 5EMYA 2C16A 4M81A 1J5TA 4D2JA 4LUJA 3HU7A 3N9KA 4AC1X 1ECEA 5IBXA 2QJGA 5IBXC 3QF0A 4ORIA 2W55A 1N60C 2ALRA 3BLKA 3SSZA 1IT7A 1TVNA 5D37A 2IKJA 3WD1A 2G3FA 3LLDA 1EBHA 1A5CA 3KX6A 3RO6A 3EDJA 3UFYA 1S38A 2AL2A 3C8FA 2ZICA 4GE8A 1M5WA 1TX2A 1S5MA 4HNOA 1DIDA 4J56A 4JFWA 5C2CA 4QG6A