2DWDC

Crystal structure of kcsa-fab-tba complex in tl+
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB HEAVY CHAIN
publication title Crystallographic Study of the Tetrabutylammonium Block to the KcsA K(+) Channel
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 42
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2dwdC00
1QLEC 3K03A 2ATKC 2HFEC 2ITCC 4MVUA 4BW5A 3F7YC 2DWDC 3RVYA 3TCUA 2Y69C 3UKMA 1M56C 3STZC 2WLKA 4DXWA 2K1EA 4P9OA 5IY5C 5KUKA 1G4YB 4JTAB 3E8FA 4RAIA 1J95A 1ORQC 3E8GA 2EIJC 2WLIA 3AG3C 4HZ3A 4ZBMA 3T1CA 3ABLC 3SYOA 4JTCB 2BOCC 2ITDC 4MTGA 3K04A 4GX1A 2WLNA 3JYCA 4R8CA 5CBFA 2EINC 3LUTB 2EILC 3LDDA 3OR6C 4LP8A 4MVSA 5E1AC 2YEVA 3SPIA 4GX2A 4WFGA 3SJQC 3WG7C 4X8AA 2Q68A 3T4DA 1R3IC 4WFHA 1P7BA 3FB5C 5KUMA 1LNQA 3ASOC 5EBMC 3AG1C 4PA6A 2P7TC 3SYCA 2AHZA 1OCCC 2Q67A 3RVZA 4MVRA 4LCUC 4MSWC 2Q6AA 4PDMA 4QE9A 5B1BC 4I9WA 3T4ZA 2AHYA 3SPCA 1ZWIC 1OCZC 2WLLB 4MW3A 3E83A 2HVJC 4RUEA 2WLIB 2WLHA 3OGCC 4XDKA 4MTOA 3SYPA 2ZD9A 4H37A 3PJSK 1K4CC 4H33A 4PA4A 3IFXA 4PDVA 4R6ZA 4UUJC 3RW0A 2HJFC 1R3LC 3EFFK 2A9HA 3LDCA 4EKWA 3HPLC 4WFEA 4WFFA 4TWKA 2QTOA 5EBWC 3FB6C 3LNMB 4MVZA 3SPGA 4G27B 3OUFA 3AG2C 2DWEC 4J9ZB 1OCOC 2X6BA 4QE7A 5B1AC 4R50A 3FB8C 1OCRC 2WLJA 2X6CA 5EC2C 3FB7C 1R3JC 3STLC 3E89A 4GX5A 5EK0A 4CBCA 1K4DC 3SYAA 4HYOA 2W0FC 3SYQA 3TETA 2Q69A 4P9PA 3SPJA 2NLJC 1V55C 3ZRSA 2IH3C 3R65A 3BEHA 4PA7A 4P30A 4XDJA 3K0GA 3OUSA 2BOBC 4MTFA 4GX0A 5J9PC 4G28B 2H8PC 3F7VC 3K06A 3SPHA 3K08A 2IH1C 4MVOA 4PA9A 3ZJZA 3RBZA 2DYRC 2DYSC 2HG5C 2HVKC 3ASNC 4RO2A 2EIMC 4X89A 4F4LA 5B3SC 4LBEC 4PDLA 4XDLA 3UM7A 4KFMA 1XL4A 2OCCC 2WLLA 2A79B 3IGAC 1KKDA 2A0LA 4MS2A 3F5WC 3E8BA 2EIKC 4RUFA 5EBLC 4MW8A 2QKSA 4X88A 1V54C 3ABMC 3KG2A 3OR7C 5BZBA 2R9RB 3VOUA 5CBHA 4PDRA 4MVQA 3AG4C 1XL6A 1M57C 1BL8A 2KB1A 2WLMA 3LDEA 4OXSA 3T2MA 4QNHB 2ZXWC 1JVMA 4JTDB 4J9YB 3GB7C 3K0DA 1S5HC 2X6AA 1R3KC 4MVMA 3E86A 4PA3A 5CBGA 3E8HA 3ABKC 3X2QC 4P2ZA 4R7CA 5EC1C 2JK5C
chains in the Genus database with same CATH superfamily
5KMGA 5IJ0A 1YTFD 4X1YA 5GTHZ 2QKCA 1I0HA 3JATA 5KA6A 2W0XA 1FFTB 3ML0A 3AG4B 3E8GA 2Q7GA 3CRQA 1AJNA 1PNLA 1EZVH 1X4TA 4ZKIA 1QR9A 1SQQH 4GX2A 1Q82W 4IT5A 3SGIA 4JI5O 1BGYH 1S5JA 1SQFA 2BTOA 5BMVA 3FB5C 3N2KA 4JPRA 3SPCA 3CCQV 3E22A 4DR7O 1IXMA 4GT1A 2Q8VA 3QF7A 3RYFB 4EKWA 2YI9A 4CC5A 5KHIA 2JEXA 1HNZB 2C2AA 5LP6B 3CYOA 3CCEV 5K1XA 4D7TA 4X65B 3OTOB 2XAHA 4JI2O 3E89A 3A0BZ 2ZM6O 4GCZA 3OAAG 1YF2A 3W7TA 3M8AA 4OGQB 5F2VO 5J2TB 2LW1A 1YJ9V 3DXRA 2F23A 2DYRB 3ASNB 4YJ3A 1NVPB 2OCCB 3LSQA 1S76D 3RBZA 2NR5A 3UM7A 2PI4A 1V54B 4BIOA 5LGUA 5IT9N 1VQ4V 2QWOB 5B1NA 1QBZA 3L71H 4JI5B 4LF9O 1Z2GA 4PDRA 4B3TO 1BL8A 3T2MA 4OXSA 2Q7HA 2YS8A 4LF4O 4JI7O 5CBGA 4DR6O 4DR7B 4I4TA 1AR1B 1QLEC 1K5QA 3FYIB 4UVBA 4J41A 5JJEB 3ABMB 1Q90D 1JA8A 3CSXA 3L75H 2E5LO 1YSCA 3JCUZ 4LNUA 4JAVA 3CC4V 2FKXA 1R6KA 5CBFA 4JYBA 2YEVA 2DQ3A 4JI2B 5LA6B 3OM3B 4CH3A 4YJ2B 5KUMA 3ASOC 3ZCCA 2ZM6B 1YZBA 2P7TC 3SYCA 4QPKA 1RPRA 3P32A 3JD2A 4EEQA 2M6YA 2ADPA 2WWWA 3FX7A 2F43G 2HVJC 1Q6IA 2HHHO 4U7NA 2JGUA 3CRCA 2FTKA 2Y0IA 1B6QA 4JASA 1E1RG 1FXHA 2B9ZA 1B06A 3HPLC 4HBNA 5EBWC 4ICGA 2KG7A 4RQEA 2UUBO 4LF9B 1NR7A 5IJ0B 4B3TB 4DW1A 4LF4B 4JI7B 3UO2A 2BE3A 4DR6B 1SRYA 4ZOLB 1SS3A 4FJCC 3F5TA 3CEIA 1OCRB 3ZJZA 2E5LB 4O4HA 1RSOA 4B08A 1VQNV 3KZIZ 3N2KB 5B3SC 2JJ1G 2OCHA 4RO2A 4LF6O 1WPXA 4KL1A 1U97A 3A2FA 1MA1A 1NTMH 1XL6A 5IWAO 2KB1A 3H1JH 3BABA 3HKEA 1SETA 4J11A 1I7FA 4JI3O 2IW5A 2HHHB 4J42A 2YIAA 4X1IA 2DWDC 2P4VA 2QM8A 5IY5C 2WLKA 4P9OA 4N21A 2JEUA 1LUWA 2QSAA 1EBOA 5CA3A 4HAMA 3ZMUA 2UUBB 2CK3G 3CMAV 2HP8A 1O9GA 3ZRWA 2Q68A 3LNNA 4IL6Z 4WFHA 1P84F 4KXRA 5D5PA 4WF9V 4A5UB 1KYOF 2AHYA 3RFRA 3AK2A 2IJIA 5IYDO 5BR8O 4K3AA 1VQMV 2JDIG 3FAVB 2WLIB 4O4LA 3K5OA 2HJFC 4C7UA 1R3LC 4LF6B 1WA8B 3W7UA 1K5SA 2LFSA 1NU1H 4I5SA 5JJJB 3BVOA 1OCZB 2O57A 3EHBB 5LOVA 2XAQA 1PL0A 5IWAB 2H3OA 2JVDA 1D5NA 1S3JA 2VWJA 1YTFB 4JI3B 5K1PA 1V55C 5KAIZ 2IH3C 1YHQV 1PP9H 1ZSPA 4CS4A 4B3MO 3OUSA 3CHXA 3UQ8A 2EIMB 1BE3H 4I55A 2QM7A 1H2SB 5IJ9B 3OFNG 1FKAO 2DYSC 2HVKC 1SZXA 1UFIA 4PDLA 1K34A 2ZCEA 3TXQA 1X59A 1GRJA 3HKCB 2CE4A 3KG2A 3S3XA 1NTKH 5BZBA 2R9RB 4F6RA 5CBHA 3W7SA 3AG4C 1ZLZA 4DK0A 2AZ0A 3OEEG 1S5HC 1MSWD 3E86A 2F4VO 5BR8B 2CTWA 1EN5A 4P2ZA 4R50A 2JK5C 2UUAO 3ZMZA 3HKDB 5KUKA 5L3DA 2K1EA 4K8ZA 1G4YB 1Z5VA 2EZPA 3WB0A 4JV5O 1SC5B 3LUTB 3OR6C 4LP8A 5DEDA 1ZX3A 3ZHTA 3L72H 3BCCH 1R3IC 4FFKA 5JH7A 1LNQA 1S0VA 4UV9A 4RWUA 4O4HB 5IDJA 4MSWC 2AXTZ 4JYAO 4UXNA 2YXLA 2QR4A 5EYPB 4B3MB 4RUEA 3JASA 3P3PA 5L3CA 1PNKA 2LP7A 1JR9A 4WFFA 2GTAA 3L9DA 4ZI7A 4IYHA 1WP7A 1HDJA 2X6BA 4L87A 2ZKOA 5JWPA 1Z5WA 2ZNIA 4X62O 2HR3A 5B5EZ 2F4VB 1BSMA 4I50A 1ZTEA 4JYCA 2UUAB 1Q6UA 3G6EV 4XDJA 3AG2B 1IDSA 2JGDA 3QVNA 3UT5B 3ZRWB 1L0LH 4X89A 5HFLA 4XDLA 2LGQA 3QO7A 5LMNO 4JV5B 1XDCA 1F4MA 4RUFA 3K5MA 3ABMC 4JI6O 4WBNA 2WLMA 3K5LA 3DGEA 1NKDA 4O2AA 3N27A 4JYAB 3OMIB 3ZMVA 4W4KA 2QE7G 2IU0A 2ITCC 3OMNB 3K9SA 4DR5O 5LOVB 1BMFG 4HZ3A 3JAWB 3IJ4A 2P6JA 1TVKB 3CP1A 1URFA 3JYCA 4U3FH 4MVSA 3VQXA 1LR1A 4DYLA 1XOUA 4LWSB 3SJBC 2IM9A 2YC0A 4KUMA 3RYHB 5LP6A 4X62B 5IE9A 3JD3A 1OCCC 1QNMA 1XUQA 2JIZG 4J7JA 4D7SA 4DV2O 4UCUA 4UCTA 5J2TA 4H37A 3PJSK 1AP5A 3RW0A 2CGNA 4DV3O 5LMNB 4FLXA 3FB6C 1US6A 1K8AW 5B1BB 4QE7A 4HNAB 5D5QA 4JI6B 1OCRC 3QG5A 2GV9A 4LR3A 3SYQA 3ABTA 5B1OA 4FMTA 2VQEO 1BT8A 3JSLA 4I7ZB 2YIBD 5JVDB 4DR5B 4MTFA 5B1AB 4Q6GA 1GTOA 3DC5A 4PA9A 1PNMA 5JH7B 4F4LA 4X1KB 2OWOA 2Y0PA 1KKDA 2QWNB 4JI0O 2QKSA 4JZ2A 4W4LA 2QDOA 1FPOA 5LGTA 1YIJV 2F66C 4JTDB 5LA6A 1JFFA 4DUYO 2B5UA 3CJHA 4DV2B 1B3QA 5LL6Y 3M99B 1Y76B 4ZI7B 5LYJB 2Y69B 2UXBO 5BXZA 4FK5C 2X0LA 1VF6A 3E8FA 5LGNA 1ORQC 4DV3B 3CX5F 1FJGO 4JI8O 4X64O 4JYYA 3RN4A 1HP8A 4I50B 1RM1C 4MTGA 1VARA 1VQOV 2KQXA 2XAFA 3LDDA 1GN3A 4TQDA 3X2QB 3K9AA 3P30A 1H2GA 3O65A 2ARHA 1XEQA 2YXYA 4UVAA 1Y74B 1RP3B 2VQEB 2N04A 3KCYA 3T4ZA 1N34O 4D6TH 4ZHQB 1OCZC 1XHXA 3GWOA 4FLZA 5KAFZ 5IYZB 2Y4TA 4DV7O 4ZOLA 4NB5A 4WBNB 2ZINA 4UVCA 1M93A 2GBOA 1N8RW 4O2AB 3CB2A 4JI0B 5IYBO 4QIWF 1KMIZ 4TUYB 3N2GB 1F51A 4FVMA 2CAZC 4Z2WA 4LFCO 2FMLA 4MT8A 2QA4V 4DUYB 4B7KA 1JMKC 3JAKB 1YJNV 1YJWV 2NLJC 2YICA 2FYUH 2PGGA 2UXBB 2EZOA 3MDSA 2KKWA 2YIBA 2H8PC 3IC9A 5FNVB 2QM4A 1FJGB 2L35A 4JI8B 4X64B 2QWPB 1F4NA 2LFRA 3ZBHA 1Y4MA 3I5DA 4KFMA 1VF7A 1M57B 5KHKA 5CMUA 1SQPH 4AILC 1AI6A 3WU2Z 4JI4O 2XTAA 1YCIA 3JD0A 4B3RO 3GB7C 5LHIA 1N34B 2X6AA 1WJZA 1NT2B 1SESA 3CXCU 4NXNO 5EC1C 2DJVA 3U0ZA 1U96A 4DV7B 4H13B 1Q5OA 3BA9A 3FYEB 1NQTA 1T5EA 1FYJA 1GMGA 4MTXA 3ZN1A 1AROP 3FAVA 4DUZO 2WLIA 2EX3A 4PELA 4PI0A 3SPIA 1WA8A 3AG1B 2DN9A 2QGNA 4LFCB 1XMOO 4GLXA 1M56B 2L6LA 3ZX6A 2X7RB 2Q6AA 2BTQB 1Q3EA 2Y4UA 1K73W 5LBQA 2E76B 3SYPA 1KBHA 4FZ0A 1D5AA 4TQFA 4PDVA 1G8MA 1OCOB 1B04A 3CCJV 1JFFB 3H1LH 3CJHB 5IJ9A 2VRZA 3AG2C 4Z1VA 1IX9A 1QU7A 5B66Z 3I56V 4JI4B 4B3RB 3HKCA 4QGPA 4DV6O 4NXNB 3ZMSA 4GX0A 3PN1A 4DR3O 3CRAA 3K06A 4DUZB 3AG7A 5TISZ 4G2KA 4GKKO 1BHBA 3HKDA 3BAAA 3IGAC 1I5YA 1E1QG 2LGWA 2MK3A 5FPRA 4CH4A 1XMOB 2ODMA 5KHGA 1YITV 2ZIOA 3RWRD 1Y6XA 3ETEA 2M7WA 2ZT9B 1KU9A 1EZJA 2CTPA 2E74B 1PKXA 5E79Z 4UCSA 3QTCA 4PI2A 1Q8IA 1TA8A 4UFZA 5EYPA 4JF3A 2F95B 3T1CA 1J95A 1VQ6V 3FFQA 1H8EG 2Q0AA 1E79G 2EINC 3HR0A 2B1GA 4WFGA 4CZZA 3D3QA 1W0KG 4DV6B 3AG3B 4QE9A 1M4UA 5B1BC 5KHJA 2RNBA 4PV1B 1PPJH 2Q7EA 4DR3B 2EILB 3I55V 1JJ2U 1MG1A 2ZE6A 3ZMTA 3IFXA 4GKKB 3UT5A 3LNMB 4DR4O 1WB8A 4U3JB 1Q43A 2FL4A 2VS0A 5LMUO 4LFAO 5B1AC 1I5XA 3FKSG 1RFYA 2WLJA 3JAMN 1VMGA 1NJIW 3WFVA 5ITZB 2W0FC 1FXKB 3JCZA 4BW9A 3ZRSA 2GUZB 1HNWO 2P06A 1SQBH 3U11A 1BCCH 4YIOA 1SQGA 1XMQO 4JZGA 1UJWB 2FB5A 3D3IA 4DO2A 5KLVH 1VQ9V 4O2BB 1QHTA 3JAWA 1TVKA 3VOUA 5HFMA 2QKAA 4MVQA 2D2CB 3M7MX 1NS1A 4QNHB 5DM6V 4DV4O 4LWSA 5L3GA 3RYHA 3X2QC 4BIZA 5CA0B 3ETQA 1MZEA 3K03A 2KSDA 4BW5A 2D3OW 3TCUA 1FFXB 4UV8A 1HR0O 4UB8Z 3ZHRA 4DR4B 5FLXN 3ZHUA 2P67A 3HB3B 5LMUB 4LFAB 2CUGA 3GVMA 5FL7G 4LF8O 3BHPA 2IBZH 1I94O 4HNAA 1D2DA 2Y48A 2EIJB 1GH6A 2ZR3A 3G4SV 2UUCO 1HNWB 3RYIB 1VQ5V 3OGCC 2V4DA 1XMQB 5CA1B 4LFBO 3ZEDA 3WG7B 3TXSA 5JVDA 1XILA 2LO1A 1DF4A 1GK9A 2DWEC 1GN2A 4X1KA 3QO5A 1N32O 5LP6C 3B40A 3SYAA 3ZN0A 3ETGA 4CS2A 4DV4B 2CDYA 3CCRV 1HWYA 1KUQA 1K7DA 3H01A 3H9VA 1AR4A 1V9PA 1JX9A 5EZYB 4YHHO 2A3QA 3U10A 4FFBB 1M1KW 1Y76A 3F7VC 5LYJA 2W6JG 1HR0B 4AHCA 3K08A 2DYRC 3ASNC 3G71V 2ZDIC 2OCCC 3UO3A 4AI8A 1BHAA 3F5WC 4LF8B 1V54C 1IURA 1I94B 1N33O 2WPDG 1S72V 1KP3A 2YXHA 2PTMA 1QLEB 4I9QA 2UUCB 2OTJV 1Y74A 1ROPA 3CCSV 4LBEC 2LW7A 3SR2C 3W7XA 2Q73A 4MVUA 4LFBB 4FM0A 5H9CA 1TAEA 3UKMA 4ZHQA 1M56C 1YXBA 2R9IA 2BOCC 2N05A 5IYZA 3AEIA 4GX1A 1AVMA 2ZIMA 1GM7A 2YIDA 4NKGB 1CXZB 5EIBD 1N32B 4GUNA 1GN4A 5CB4B 3CS5A 2HJDA 3AK3A 4TUYA 3CE2A 3N2GA 4PDMA 3ABLB 4DV1O 1EN6A 3OEHG 4YHHB 3BY6A 3E83A 1FAFA 1NZ6A 1WPBA 1K92A 3JAKA 1W0JG 3D36C 3JSNA 1VF6C 4J7KA 4H33A 2ZNJA 3LDCA 1KECA 1XREA 1QQCA 2QTOA 3K59A 1QVGU 1XNRO 3GWKC 1S77D 5FNVA 1SQXH 3EVKA 3MAQA 3Q4HB 2IJKA 1N33B 1K97A 3FB8C 1J5EO 4YXWG 4FLUA 3J80N 3IAYA 3VBBA 5EK0A 3ICXA 4E2LA 4Z1MG 1MSDA 3H1KH 4GYCB 2Q5ZA 3A8TA 3TK1A 4X20B 4UCOA 1AP6A 4OX9O 2JJ2G 1PL4A 2BOBC 1IVSA 1WN7A 3ZIAG 2ZDIA 1UPGA 2IH1C 2DW4A 1JJOA 5JJNB 2K9PA 2Z5UA 1FD9A 2W6IG 2P4KA 1IBLO 3ZHVA 2ZQMA 4DV1B 1W2BU 3UCSC 1AI7A 4NYKA 1XI1A 2ATKC 2CTRA 4FM2A 2EIKB 3F7YC 2BTQA 3WB1A 1KQSU 2DOSA 1R73A 3P3NA 4JTAB 4LH6A 3AG3C 1XNRB 1DF5A 4UB6Z 2ZXWB 2GTSA 1VF5B 4BR6A 1ZL8B 2H94A 4J7ZA 2PZSA 2EILC 1J5EB 5H6QA 3CRMA 3JD4A 4X8AA 2ZR2A 5A9GA 3T4DA 1VP7A 1SA0B 2Q67A 2OIGA 4MVRA 2OIEA 1COWG 4TOIA 4ZIBA 3DTUB 4I9WA 1H2MA 1DLBA 3W7WA 3D36A 4OX9B 3K57A 3T1HO 4H0LB 2ZD9A 2CGOA 4DRXB 2BCCH 1FXKC 5J2UB 3SDLA 1NR1A 3B77A 1SERA 4IGGA 3ZS8C 4CH5A 1R1BA 1TUEB 2AZ2A 1IBLB 1L8DA 3HKBB 2XHBA 1Q6HA 1K4DC 4LF7O 2Q69A 4DW0A 3JALB 2XUMA 3APQA 3RYCB 2DE0X 3CD6V 4P30A 5J9PC 1NTZH 5LHHA 1GAXA 1TUBB 4Q20A 4PHZA 4EFBA 4OPHA 4AQYO 1SKVA 2EIMC 1Q7YW 1VQKV 2WLLA 2YUAA 1MNGA 3OR7C 2ZE5A 3T1YO 3D8CA 1VQ7V 5GONB 1GN6A 4K0KO 4JGSA 3VQWA 4R7CA 1PV0A 3T1HB 2AGAA 1L0NH 2ZE8A 3OD4A 4WCEV 2G38A 1EFRG 4RAIA 2EIJC 1YI2V 1ZAUA 3G80A 4TV9B 3CCVV 5LXTB 2LJ2A 1W59A 2OT5A 2RQ6A 2WLNA 1JPXA 3OE7G 2RDCA 3ABKB 5DN6G 1TGOA 1H8HG 1YVWA 3WG7C 4NTYA 3L70H 4U3JA 4FIPC 4LF7B 1H2KA 2Z0AA 2CH7B 4LCUC 5GW7A 1WP8A 1AI4A 5ITZA 1FXKA 1AJQA 1F23A 4K8XA 4RQFA 2PYJA 4PA4A 1DTOA 4AQYB 5DECA 2GUZA 2VWKA 1QR8A 2E3CA 2B1IA 3OGIB 2E75B 4G27B 1KKCA 3OUFA 3CC2V 3T1YB 1H2LA 1JCHA 3OTFA 4GX5A 1N4CA 4HYOA 4O2BA 2IU3A 2NNUA 4K0KB 4TT3G 2QJ1A 2WA4A 3R65A 2AW9A 4FLWA 1JOYA 3NXSA 4EB6B 4G28B 5AG2A 4CH6A 1BQ0A 5CA0A 4B3SO 4MVOA 3B8NA 3K79A 1KB9F 1WB7A 2ADQB 4GZRB 2EULA 4GKJO 1Y66A 2A79B 2RMKB 4BIUA 2A0LA 2RJZA 4QJFB 5C8YB 1FFXA 2XAJA 5EBLC 3TGUH 4X88A 4DV0O 4LH7A 4FZ1A 3OW2U 3JARB 1IXBA 3K0DA 1Q86W 4XBFA 1FXVA 1BS3A 4O4JB 3RVYA 1H2NA 3RYIA 2N74A 1GO3F 2R9AA 3MHSC 1SQVH 3ABLC 5CA1A 4X66O 1AB3A 1MZFA 3K04A 4JI1O 4U7OA 4I0XB 5KA5A 3ABUA 1OCCB 4IIJB 3L74H 5JQGA 5KX5B 4O4IB 3ZRVA 5KMGB 3RVZA 1AR5A 4X1YB 1OJHA 1ZWIC 3K58A 2ZE7A 2WLLB 3JATB 4EFEA 3OMAB 4N23A 1F7YA 4J10A 2WLHA 4CS3A 3BRCA 3H1HH 4B3SB 5EZYA 4TSFG 1N36O 3EFFK 4FFBA 3ZRXA 2ETNA 4GKJB 4ASUG 2A06H 4MVZA 4BAYA 5BMVB 2LQTA 2A7WA 5C93A 1M5IA 2QTSA 4DV0B 5IYCO 2EJRA 1H38A 3FB7C 1VEWA 4PD4F 3E22B 1AI5A 1NH2D 1BZKA 4KHPO 3R66A 3BFRA 3G67A 4P9PA 4FLTA 5A2QN 3QNEA 3CMEV 1YDXA 3K0GA 2DQ0A 1QCEA 3EXAA 2IJHA 3CXHF 1MOFA 4ABMA 4X66B 1XL4A 4KP4A 1KD1W 4JI1B 3K5NA 4MS2A 3E8BA 2EIKC 5CN0A 3S3WA 1CP9A 1OHHG 4BWAA 3H1IH 3LDEA 2ZXWC 3DXRB 1K9MW 1JVMA 5LHGA 1Y67A 5CB4A 4YJ3B 4PA3A 1WLEA 2GDSA 3E8HA 2BSKA 2YDEA 2HFEC 3ETDA 3KKYA 2Y69C 1N36B 2WA3A 3STZC 4DXWA 4H44B 1RM1B 4ZBMA 3CCMV 1QVFU 3IC7A 3J81N 4R8CA 1IBMO 2UXCO 5GTIZ 4DR2O 2RN9A 2XT9A 1GM8A 5KHHA 4JAUA 4IHJA 3Q4HA 3RGBA 4I4TB 4PA6A 4KHPB 2AHZA 2UXXA 1MMMA 2Q9LA 3QO8A 2MW2B 3C3TA 4MW3A 1XBLA 1M90W 4FM1A 4XDKA 1VQLV 1PD3A 4LNUB 1IZ3A 4X20A 1A32A 4WFEA 2YEVB 1Q81W 4TWKA 3LSSA 2V7QG 4IYIA 1HNXO 3TJTA 1VIBA 3CC7V 3L73H 3RT3C 1EM1A 2UXDO 2PI5A 4X9QA 4DR1O 3STLC 3DSQA 3FD9A 4K35A 1OZ0A 2WSSG 3MD0A 2Q0OC 4LC1A 4NXMO 2P90A 4B7EA 4YIPA 3BEHA 2P22C 5H2FZ 3SJCC 2GHYA 1HW7A 3B09A 5JQGB 2KG7B 3APOA 3A0RA 3DC6A 3K3WA 2F1MA 4F6EA 1IBMB 2UXCB 4DR2B 1ZL8A 1G1XB 3B8MA 1M57C 2EBOA 2YI8A 2UU9O 2RCVA 5JCOC 3ABKC 1SA0A 1K33A 4FPPA 1RSOB 3CCLV 2QWQB 4NTXA 1DGSA 4PJ0Z 3SYOA 4JTCB 1HNXB 4LF5O 1BQZA 1P49A 4DRXA 1NVPD 3CPWU 3MHHC 5J2UA 2UXDB 2R72A 3HKEB 3SJQC 4DR1B 4JAAA 1P7BA 3AG1C 1WNSA 5L3BA 4NXMB 4DK1A 1DK1A 4X1IB 3HKBA 2JS3A 3B2EE 3NR7A 3JALA 4MTOA 3E2EA 2PY5A 1EN4A 1QLNA 4J80A 3RYCA 1K4CC 4R6ZA 1FS0G 4OPAA 3ASOB 3B4SA 3OT7A 1TUBA 3AK1A 4TV8A 1IBKO 1OCOC 4UCRA 3JD1A 3SJAC 2BSKB 3J7AU 4UCVA 2XASA 5EIBC 1NBMG 2UU9B 1RPOA 2DMXA 2PF4E 3A0HZ 3THOA 5FPOA 4O4LB 5L3FA 1VQ8V 2PUSA 1WAZA 1AILA 4PA7A 1CEZA 5GONA 2OTLV 4YY3O 1M9NA 2XAGA 1P4RA 3SPHA 4IHJB 1PM9A 2EJ7A 2ILMA 4NTWA 4LF5B 2QWRB 4NVPA 2NN4A 1AJPA 2QEXV 3BA8A 4MW8A 1SZTA 4FLYA 1R6TA 4TV9A 5LXTA 1XNQO 3C90A 3RYFA 5JCOA 4J9YB 2HLDG 2XNDG 1JQ0A 2V1DA 5B3SB 4I55B 4E4EA 2VQFO 2CH7A 2IJJA 2OYQA 3CCUV 3G6BA 2GSMB 1N0NA 2EINB 1I08A 1R6NA 2ITDC 2JS5A 1LUVA 2Q4PA 4F6RB 1NH2B 1IBKB 1P7GA 3CWBH 5E1AC 1GKFA 3VQYA 3CRRA 5L3EA 2PYLA 4DV5O 5EBMC 5IY5B 1ZUQA 1YEWA 1O9HA 2CTQA 3E35A 2P5OA 3ZHQA 5BY1A 4YY3B 3VQVA 1THZA 2Z3YA 4UUJC 1KP2A 1ENVA 2A9HA 1VQPV 1G6UA 1N0JA 4EB6A 3LSUA 3KCXA 3SPGA 2F93B 1S5LZ 2UXNA 4J9ZB 2YSUB 5H6RA 1XNQB 2WAMA 1OV9A 1XQ8A 2X6CA 5EC2C 1R3JC 4CBCA 5C8YA 2HKOA 3ZHSA 3JASB 3O9OA 3TETA 2HEPA 2R70A 3SPJA 2XOKG 4CC6A 1GM9A 1XHZA 2JRIA 2VQFB 3JARA 1K3EA 1MABG 4WFAV 1SF9A 5H5NA 4YJ2A 2HG5C 4O4JA 4FLVA 4QPJA 1HNZO 4NR1A 1V55B 1NI8A 1KC8W 4DV5B 1L1FA 4X65O 3OTOO 4I0XA 1CPYA 4WFBV 4IIJA 3BPZA 3WB2A 1R3KC 2DYSB 2JGDB 4MVMA 5KX5A 3C3SA 4O4IA 4L8JA 4TV8B
chains in the Genus database with same CATH topology
2QE7G 3K03A 2IU0A 1YTFD 2ITCC 3OMNB 4BW5A 2D3OW 3RVYA 3TCUA 5KA6A 1GO3F 3MHSC 1BMFG 1FFTB 3ML0A 4UV8A 3AG4B 3E8GA 4HZ3A 3ABLC 2P6JA 3CP1A 2P67A 3HB3B 1AJNA 3K04A 1PNLA 3JYCA 4ZKIA 4U7OA 1QR9A 4MVSA 4GX2A 5KA5A 3ABUA 1Q82W 1OCCB 5FL7G 4KUMA 3FB5C 3JD3A 1OCCC 3ZRVA 3RVZA 2Y48A 2JIZG 2EIJB 4JPRA 3SPCA 1ZWIC 2ZR3A 3G4SV 3CCQV 2WLLB 1VQ5V 3OMAB 1IXMA 4N23A 2WLHA 3OGCC 4H37A 4GT1A 3PJSK 3WG7B 3RW0A 4TSFG 3EFFK 4EKWA 3ZRXA 4ASUG 3FB6C 2JEXA 4MVZA 4BAYA 1K8AW 1DF4A 2C2AA 5C93A 1GK9A 2DWEC 3CYOA 5B1BB 3CCEV 4QE7A 3QO5A 5IYCO 1OCRC 2EJRA 1H38A 2XAHA 3FB7C 3E89A 3ZMVA 3SYAA 3ZN0A 3ETGA 1AI5A 1NH2D 3CCRV 4GCZA 3SYQA 1HWYA 3ABTA 3OAAG 4FMTA 5B1OA 1K7DA 3H01A 3W7TA 4P9PA 1YJ9V 1JX9A 3QNEA 3CMEV 1M1KW 3K0GA 2DYRB 4MTFA 2DQ0A 3ASNB 1NVPB 5B1AB 1QCEA 3F7VC 2W6JG 1GTOA 2OCCB 3LSQA 3K08A 4PA9A 1S76D 2IJHA 1PNMA 3RBZA 2DYRC 4F4LA 3ASNC 1MOFA 3G71V 3UM7A 2ZDIC 1XL4A 2PI4A 2OCCC 1V54B 4KP4A 1KD1W 5LGUA 1KKDA 1BHAA 4MS2A 3F5WC 1VQ4V 3E8BA 2EIKC 5CN0A 5B1NA 1QBZA 2QKSA 1CP9A 1OHHG 1V54C 4PDRA 2WPDG 1S72V 1BL8A 3LDEA 3T2MA 4OXSA 5LGTA 1KP3A 2ZXWC 1YIJV 1K9MW 1JVMA 4JTDB 5LHGA 1QLEB 2B5UA 4PA3A 1WLEA 3M99B 5CBGA 2OTJV 1ROPA 3E8HA 3CCSV 2Y69B 4LBEC 1AR1B 1QLEC 3W7XA 2HFEC 4MVUA 1K5QA 3ETDA 3FYIB 4FK5C 4UVBA 5H9CA 3UKMA 2X0LA 2Y69C 1M56C 3STZC 3ABMB 4DXWA 1RM1B 3E8FA 4ZBMA 1ORQC 5LGNA 1YSCA 3CCMV 1QVFU 2R9IA 4JAVA 2BOCC 3IC7A 3CC4V 1RM1C 4MTGA 3AEIA 4GX1A 1VQOV 2XAFA 1R6KA 4R8CA 5CBFA 4JYBA 1GM7A 3LDDA 3X2QB 2YEVA 3K9AA 3P30A 2DQ3A 1H2GA 1GM8A 3OM3B 4JAUA 4UVAA 5KUMA 3ASOC 3ZCCA 4PA6A 2P7TC 3SYCA 2AHZA 4QPKA 1RPRA 3P32A 3JD2A 2UXXA 2WWWA 4PDMA 3QO8A 3T4ZA 3ABLB 1OCZC 3OEHG 3BY6A 4MW3A 3E83A 2F43G 2HVJC 3GWOA 1M90W 1K92A 4XDKA 1VQLV 1PD3A 1W0JG 4U7NA 2FTKA 4H33A 1B6QA 4JASA 4UVCA 1E1RG 1FXHA 3LDCA 1KECA 3HPLC 4WFEA 2YEVB 1Q81W 4TWKA 2QTOA 3LSSA 2V7QG 1QVGU 1N8RW 5EBWC 1S77D 5IYBO 4QIWF 3CC7V 4RQEA 2IJKA 1K97A 1NR7A 3FB8C 2PI5A 4YXWG 1F51A 3STLC 3VBBA 5EK0A 4E2LA 4Z1MG 4MT8A 2QA4V 1OZ0A 2WSSG 3MD0A 4LC1A 1YJNV 1YJWV 2P90A 2NLJC 1SRYA 3TK1A 3BEHA 2JJ2G 2EZOA 4FJCC 2BOBC 2GHYA 2H8PC 3ZIAG 1OCRB 2ZDIA 3ZJZA 2IH1C 1VQNV 2DW4A 3A0RA 5B3SC 2JJ1G 1F4NA 4RO2A 2LFRA 1Y4MA 3K3WA 4KFMA 1WPXA 2Z5UA 1M57B 5CMUA 1AI6A 2W6IG 3B8MA 1XL6A 1M57C 2KB1A 2EBOA 3JD0A 3GB7C 2ZQMA 5LHIA 1SETA 2X6AA 1W2BU 1SESA 2IW5A 3CXCU 3ABKC 1AI7A 1K33A 4FPPA 5EC1C 3CCLV 2ATKC 2EIKB 3F7YC 2DWDC 3FYEB 1NQTA 2QM8A 1KQSU 1GMGA 2WLKA 5IY5C 4MTXA 1R73A 4P9OA 3ZN1A 1AROP 4JTAB 4N21A 2WLIA 2JEUA 3AG3C 3SYOA 4JTCB 1DF5A 4PELA 2ZXWB 1EBOA 5CA3A 2H94A 3CPWU 1NVPD 3MHHC 4HAMA 3ZMUA 2CK3G 3CMAV 2EILC 5H6QA 3SPIA 3AG1B 3JD4A 3SJQC 3ZRWA 4X8AA 2Q68A 2ZR2A 3T4DA 4WFHA 1P7BA 3AG1C 4WF9V 1M56B 2Q67A 5L3BA 4MVRA 1COWG 2X7RB 2Q6AA 3DTUB 4I9WA 2AHYA 1DLBA 3W7WA 3D36A 1K73W 2IJIA 5IYDO 1VQMV 2JDIG 2WLIB 5LBQA 4MTOA 3E2EA 3SYPA 2ZD9A 1QLNA 1K4CC 4PDVA 1FXKC 4R6ZA 2HJFC 1G8MA 1FS0G 1R3LC 1NR1A 1OCOB 3ASOB 3B77A 3W7UA 3CCJV 1K5SA 2LFSA 1SERA 4I5SA 3AG2C 1OCOC 3JD1A 1OCZB 3EHBB 2XAQA 1TUEB 3I56V 1PL0A 2XASA 1NBMG 1K4DC 1RPOA 1S3JA 1YTFB 2Q69A 5L3FA 1V55C 1VQ8V 2IH3C 1YHQV 3ZMSA 4PA7A 3CD6V 4P30A 1CEZA 2OTLV 3OUSA 5J9PC 4GX0A 2EIMB 5LHHA 1M9NA 2QM7A 2XAGA 3K06A 1P4RA 3SPHA 4Q20A 3OFNG 2DYSC 2HVKC 4G2KA 2EIMC 1Q7YW 4PDLA 1BHBA 1K34A 1VQKV 2WLLA 1AJPA 2QEXV 3IGAC 1I5YA 1E1QG 4MW8A 1SZTA 2MK3A 3KG2A 3OR7C 5BZBA 2R9RB 5CBHA 3W7SA 3AG4C 1VQ7V 1YITV 3ETEA 3OEEG 2M7WA 4J9YB 2HLDG 2XNDG 1JQ0A 1S5HC 2V1DA 5B3SB 1MSWD 3E86A 4JGSA 4P2ZA 4R50A 4R7CA 2JK5C 1EZJA 1PKXA 3ZMZA 2IJJA 3CCUV 4WCEV 5KUKA 5L3DA 2K1EA 2GSMB 1EFRG 1G4YB 4JF3A 4RAIA 3T1CA 1J95A 2EIJC 1VQ6V 2EINB 1YI2V 1H8EG 1R6NA 3CCVV 2ITDC 2OT5A 2EZPA 1NH2B 1E79G 2WLNA 2EINC 1JPXA 3OE7G 3LUTB 3OR6C 4LP8A 1GKFA 3ABKB 5E1AC 5DN6G 2B1GA 4WFGA 1H8HG 3WG7C 4CZZA 1R3IC 5L3EA 4FIPC 1LNQA 5EBMC 1S0VA 4UV9A 5IY5B 1W0KG 4LCUC 5GW7A 5IDJA 4MSWC 3AG3B 4QE9A 5B1BC 1AI4A 4UXNA 3E35A 4RUEA 1FXKA 1AJQA 5L3CA 1THZA 2EILB 3I55V 1F23A 1JJ2U 1PNKA 4RQFA 1MG1A 2Z3YA 2LP7A 4PA4A 3ZMTA 1DTOA 3IFXA 1KP2A 4UUJC 1ENVA 2A9HA 1VQPV 4WFFA 1QR8A 2B1IA 3LNMB 3SPGA 4G27B 2UXNA 3OUFA 4J9ZB 2X6BA 4L87A 5B1AC 3CC2V 2YSUB 1I5XA 5H6RA 3FKSG 2WAMA 2WLJA 2X6CA 5EC2C 1JCHA 1R3JC 1NJIW 4GX5A 4CBCA 3WFVA 2HKOA 4HYOA 2W0FC 2HR3A 2IU3A 2NNUA 4TT3G 1FXKB 3TETA 3JCZA 3SPJA 2XOKG 4JYCA 3ZRSA 1GM9A 3R65A 3G6EV 1K3EA 1MABG 4WFAV 4XDJA 3AG2B 1JOYA 3NXSA 4G28B 3ZRWB 4MVOA 1UJWB 3B8NA 3K79A 3D3IA 2HG5C 4X89A 5HFLA 4XDLA 4DO2A 3QO7A 4QPJA 1Y66A 2A79B 4BIUA 2A0LA 4QJFB 1VQ9V 1F4MA 4RUFA 1V55B 2XAJA 5EBLC 4X88A 1KC8W 3ABMC 3VOUA 5HFMA 1L1FA 4MVQA 2WLMA 4QNHB 3OW2U 3DGEA 1NKDA 1CPYA 5DM6V 4WFBV 3K0DA 5L3GA 1R3KC 2DYSB 4MVMA 3X2QC 1Q86W 3OMIB 4BIZA 4XBFA 1FXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QLE C;  3K03 A;  2ATK C;  2HFE C;  2ITC C;  4MVU A;  4BW5 A;  3F7Y C;  2DWD C;  3RVY A;  3TCU A;  2Y69 C;  3UKM A;  1M56 C;  3STZ C;  2WLK A;  4DXW A;  2K1E A;  4P9O A;  5IY5 C;  5KUK A;  1G4Y B;  4JTA B;  3E8F A;  4RAI A;  1J95 A;  1ORQ C;  3E8G A;  2EIJ C;  2WLI A;  3AG3 C;  4HZ3 A;  4ZBM A;  3T1C A;  3ABL C;  3SYO A;  4JTC B;  2BOC C;  2ITD C;  4MTG A;  3K04 A;  4GX1 A;  2WLN A;  3JYC A;  4R8C A;  5CBF A;  2EIN C;  3LUT B;  2EIL C;  3LDD A;  3OR6 C;  4LP8 A;  4MVS A;  5E1A C;  2YEV A;  3SPI A;  4GX2 A;  4WFG A;  3SJQ C;  3WG7 C;  4X8A A;  2Q68 A;  3T4D A;  1R3I C;  4WFH A;  1P7B A;  3FB5 C;  5KUM A;  1LNQ A;  3ASO C;  5EBM C;  3AG1 C;  4PA6 A;  2P7T C;  3SYC A;  2AHZ A;  1OCC C;  2Q67 A;  3RVZ A;  4MVR A;  4LCU C;  4MSW C;  2Q6A A;  4PDM A;  4QE9 A;  5B1B C;  4I9W A;  3T4Z A;  2AHY A;  3SPC A;  1ZWI C;  1OCZ C;  2WLL B;  4MW3 A;  3E83 A;  2HVJ C;  4RUE A;  2WLI B;  2WLH A;  3OGC C;  4XDK A;  4MTO A;  3SYP A;  2ZD9 A;  4H37 A;  3PJS K;  1K4C C;  4H33 A;  4PA4 A;  3IFX A;  4PDV A;  4R6Z A;  4UUJ C;  3RW0 A;  2HJF C;  1R3L C;  3EFF K;  2A9H A;  3LDC A;  4EKW A;  3HPL C;  4WFE A;  4WFF A;  4TWK A;  2QTO A;  5EBW C;  3FB6 C;  3LNM B;  4MVZ A;  3SPG A;  4G27 B;  3OUF A;  3AG2 C;  2DWE C;  4J9Z B;  1OCO C;  2X6B A;  4QE7 A;  5B1A C;  4R50 A;  3FB8 C;  1OCR C;  2WLJ A;  2X6C A;  5EC2 C;  3FB7 C;  1R3J C;  3STL C;  3E89 A;  4GX5 A;  5EK0 A;  4CBC A;  1K4D C;  3SYA A;  4HYO A;  2W0F C;  3SYQ A;  3TET A;  2Q69 A;  4P9P A;  3SPJ A;  2NLJ C;  1V55 C;  3ZRS A;  2IH3 C;  3R65 A;  3BEH A;  4PA7 A;  4P30 A;  4XDJ A;  3K0G A;  3OUS A;  2BOB C;  4MTF A;  4GX0 A;  5J9P C;  4G28 B;  2H8P C;  3F7V C;  3K06 A;  3SPH A;  3K08 A;  2IH1 C;  4MVO A;  4PA9 A;  3ZJZ A;  3RBZ A;  2DYR C;  2DYS C;  2HG5 C;  2HVK C;  3ASN C;  4RO2 A;  2EIM C;  4X89 A;  4F4L A;  5B3S C;  4LBE C;  4PDL A;  4XDL A;  3UM7 A;  4KFM A;  1XL4 A;  2OCC C;  2WLL A;  2A79 B;  3IGA C;  1KKD A;  2A0L A;  4MS2 A;  3F5W C;  3E8B A;  2EIK C;  4RUF A;  5EBL C;  4MW8 A;  2QKS A;  4X88 A;  1V54 C;  3ABM C;  3KG2 A;  3OR7 C;  5BZB A;  2R9R B;  3VOU A;  5CBH A;  4PDR A;  4MVQ A;  3AG4 C;  1XL6 A;  1M57 C;  1BL8 A;  2KB1 A;  2WLM A;  3LDE A;  4OXS A;  3T2M A;  4QNH B;  2ZXW C;  1JVM A;  4JTD B;  4J9Y B;  3GB7 C;  3K0D A;  1S5H C;  2X6A A;  1R3K C;  4MVM A;  3E86 A;  4PA3 A;  5CBG A;  3E8H A;  3ABK C;  3X2Q C;  4P2Z A;  4R7C A;  5EC1 C;  2JK5 C; 
#chains in the Genus database with same CATH topology
 5KMG A;  5IJ0 A;  1YTF D;  4X1Y A;  5GTH Z;  2QKC A;  1I0H A;  3JAT A;  5KA6 A;  2W0X A;  1FFT B;  3ML0 A;  3AG4 B;  3E8G A;  2Q7G A;  3CRQ A;  1AJN A;  1PNL A;  1EZV H;  1X4T A;  4ZKI A;  1QR9 A;  1SQQ H;  4GX2 A;  1Q82 W;  4IT5 A;  3SGI A;  4JI5 O;  1BGY H;  1S5J A;  1SQF A;  2BTO A;  5BMV A;  3FB5 C;  3N2K A;  4JPR A;  3SPC A;  3CCQ V;  3E22 A;  4DR7 O;  1IXM A;  4GT1 A;  2Q8V A;  3QF7 A;  3RYF B;  4EKW A;  2YI9 A;  4CC5 A;  5KHI A;  2JEX A;  1HNZ B;  2C2A A;  5LP6 B;  3CYO A;  3CCE V;  5K1X A;  4D7T A;  4X65 B;  3OTO B;  2XAH A;  4JI2 O;  3E89 A;  3A0B Z;  2ZM6 O;  4GCZ A;  3OAA G;  1YF2 A;  3W7T A;  3M8A A;  4OGQ B;  5F2V O;  5J2T B;  2LW1 A;  1YJ9 V;  3DXR A;  2F23 A;  2DYR B;  3ASN B;  4YJ3 A;  1NVP B;  2OCC B;  3LSQ A;  1S76 D;  3RBZ A;  2NR5 A;  3UM7 A;  2PI4 A;  1V54 B;  4BIO A;  5LGU A;  5IT9 N;  1VQ4 V;  2QWO B;  5B1N A;  1QBZ A;  3L71 H;  4JI5 B;  4LF9 O;  1Z2G A;  4PDR A;  4B3T O;  1BL8 A;  3T2M A;  4OXS A;  2Q7H A;  2YS8 A;  4LF4 O;  4JI7 O;  5CBG A;  4DR6 O;  4DR7 B;  4I4T A;  1AR1 B;  1QLE C;  1K5Q A;  3FYI B;  4UVB A;  4J41 A;  5JJE B;  3ABM B;  1Q90 D;  1JA8 A;  3CSX A;  3L75 H;  2E5L O;  1YSC A;  3JCU Z;  4LNU A;  4JAV A;  3CC4 V;  2FKX A;  1R6K A;  5CBF A;  4JYB A;  2YEV A;  2DQ3 A;  4JI2 B;  5LA6 B;  3OM3 B;  4CH3 A;  4YJ2 B;  5KUM A;  3ASO C;  3ZCC A;  2ZM6 B;  1YZB A;  2P7T C;  3SYC A;  4QPK A;  1RPR A;  3P32 A;  3JD2 A;  4EEQ A;  2M6Y A;  2ADP A;  2WWW A;  3FX7 A;  2F43 G;  2HVJ C;  1Q6I A;  2HHH O;  4U7N A;  2JGU A;  3CRC A;  2FTK A;  2Y0I A;  1B6Q A;  4JAS A;  1E1R G;  1FXH A;  2B9Z A;  1B06 A;  3HPL C;  4HBN A;  5EBW C;  4ICG A;  2KG7 A;  4RQE A;  2UUB O;  4LF9 B;  1NR7 A;  5IJ0 B;  4B3T B;  4DW1 A;  4LF4 B;  4JI7 B;  3UO2 A;  2BE3 A;  4DR6 B;  1SRY A;  4ZOL B;  1SS3 A;  4FJC C;  3F5T A;  3CEI A;  1OCR B;  3ZJZ A;  2E5L B;  4O4H A;  1RSO A;  4B08 A;  1VQN V;  3KZI Z;  3N2K B;  5B3S C;  2JJ1 G;  2OCH A;  4RO2 A;  4LF6 O;  1WPX A;  4KL1 A;  1U97 A;  3A2F A;  1MA1 A;  1NTM H;  1XL6 A;  5IWA O;  2KB1 A;  3H1J H;  3BAB A;  3HKE A;  1SET A;  4J11 A;  1I7F A;  4JI3 O;  2IW5 A;  2HHH B;  4J42 A;  2YIA A;  4X1I A;  2DWD C;  2P4V A;  2QM8 A;  5IY5 C;  2WLK A;  4P9O A;  4N21 A;  2JEU A;  1LUW A;  2QSA A;  1EBO A;  5CA3 A;  4HAM A;  3ZMU A;  2UUB B;  2CK3 G;  3CMA V;  2HP8 A;  1O9G A;  3ZRW A;  2Q68 A;  3LNN A;  4IL6 Z;  4WFH A;  1P84 F;  4KXR A;  5D5P A;  4WF9 V;  4A5U B;  1KYO F;  2AHY A;  3RFR A;  3AK2 A;  2IJI A;  5IYD O;  5BR8 O;  4K3A A;  1VQM V;  2JDI G;  3FAV B;  2WLI B;  4O4L A;  3K5O A;  2HJF C;  4C7U A;  1R3L C;  4LF6 B;  1WA8 B;  3W7U A;  1K5S A;  2LFS A;  1NU1 H;  4I5S A;  5JJJ B;  3BVO A;  1OCZ B;  2O57 A;  3EHB B;  5LOV A;  2XAQ A;  1PL0 A;  5IWA B;  2H3O A;  2JVD A;  1D5N A;  1S3J A;  2VWJ A;  1YTF B;  4JI3 B;  5K1P A;  1V55 C;  5KAI Z;  2IH3 C;  1YHQ V;  1PP9 H;  1ZSP A;  4CS4 A;  4B3M O;  3OUS A;  3CHX A;  3UQ8 A;  2EIM B;  1BE3 H;  4I55 A;  2QM7 A;  1H2S B;  5IJ9 B;  3OFN G;  1FKA O;  2DYS C;  2HVK C;  1SZX A;  1UFI A;  4PDL A;  1K34 A;  2ZCE A;  3TXQ A;  1X59 A;  1GRJ A;  3HKC B;  2CE4 A;  3KG2 A;  3S3X A;  1NTK H;  5BZB A;  2R9R B;  4F6R A;  5CBH A;  3W7S A;  3AG4 C;  1ZLZ A;  4DK0 A;  2AZ0 A;  3OEE G;  1S5H C;  1MSW D;  3E86 A;  2F4V O;  5BR8 B;  2CTW A;  1EN5 A;  4P2Z A;  4R50 A;  2JK5 C;  2UUA O;  3ZMZ A;  3HKD B;  5KUK A;  5L3D A;  2K1E A;  4K8Z A;  1G4Y B;  1Z5V A;  2EZP A;  3WB0 A;  4JV5 O;  1SC5 B;  3LUT B;  3OR6 C;  4LP8 A;  5DED A;  1ZX3 A;  3ZHT A;  3L72 H;  3BCC H;  1R3I C;  4FFK A;  5JH7 A;  1LNQ A;  1S0V A;  4UV9 A;  4RWU A;  4O4H B;  5IDJ A;  4MSW C;  2AXT Z;  4JYA O;  4UXN A;  2YXL A;  2QR4 A;  5EYP B;  4B3M B;  4RUE A;  3JAS A;  3P3P A;  5L3C A;  1PNK A;  2LP7 A;  1JR9 A;  4WFF A;  2GTA A;  3L9D A;  4ZI7 A;  4IYH A;  1WP7 A;  1HDJ A;  2X6B A;  4L87 A;  2ZKO A;  5JWP A;  1Z5W A;  2ZNI A;  4X62 O;  2HR3 A;  5B5E Z;  2F4V B;  1BSM A;  4I50 A;  1ZTE A;  4JYC A;  2UUA B;  1Q6U A;  3G6E V;  4XDJ A;  3AG2 B;  1IDS A;  2JGD A;  3QVN A;  3UT5 B;  3ZRW B;  1L0L H;  4X89 A;  5HFL A;  4XDL A;  2LGQ A;  3QO7 A;  5LMN O;  4JV5 B;  1XDC A;  1F4M A;  4RUF A;  3K5M A;  3ABM C;  4JI6 O;  4WBN A;  2WLM A;  3K5L A;  3DGE A;  1NKD A;  4O2A A;  3N27 A;  4JYA B;  3OMI B;  3ZMV A;  4W4K A;  2QE7 G;  2IU0 A;  2ITC C;  3OMN B;  3K9S A;  4DR5 O;  5LOV B;  1BMF G;  4HZ3 A;  3JAW B;  3IJ4 A;  2P6J A;  1TVK B;  3CP1 A;  1URF A;  3JYC A;  4U3F H;  4MVS A;  3VQX A;  1LR1 A;  4DYL A;  1XOU A;  4LWS B;  3SJB C;  2IM9 A;  2YC0 A;  4KUM A;  3RYH B;  5LP6 A;  4X62 B;  5IE9 A;  3JD3 A;  1OCC C;  1QNM A;  1XUQ A;  2JIZ G;  4J7J A;  4D7S A;  4DV2 O;  4UCU A;  4UCT A;  5J2T A;  4H37 A;  3PJS K;  1AP5 A;  3RW0 A;  2CGN A;  4DV3 O;  5LMN B;  4FLX A;  3FB6 C;  1US6 A;  1K8A W;  5B1B B;  4QE7 A;  4HNA B;  5D5Q A;  4JI6 B;  1OCR C;  3QG5 A;  2GV9 A;  4LR3 A;  3SYQ A;  3ABT A;  5B1O A;  4FMT A;  2VQE O;  1BT8 A;  3JSL A;  4I7Z B;  2YIB D;  5JVD B;  4DR5 B;  4MTF A;  5B1A B;  4Q6G A;  1GTO A;  3DC5 A;  4PA9 A;  1PNM A;  5JH7 B;  4F4L A;  4X1K B;  2OWO A;  2Y0P A;  1KKD A;  2QWN B;  4JI0 O;  2QKS A;  4JZ2 A;  4W4L A;  2QDO A;  1FPO A;  5LGT A;  1YIJ V;  2F66 C;  4JTD B;  5LA6 A;  1JFF A;  4DUY O;  2B5U A;  3CJH A;  4DV2 B;  1B3Q A;  5LL6 Y;  3M99 B;  1Y76 B;  4ZI7 B;  5LYJ B;  2Y69 B;  2UXB O;  5BXZ A;  4FK5 C;  2X0L A;  1VF6 A;  3E8F A;  5LGN A;  1ORQ C;  4DV3 B;  3CX5 F;  1FJG O;  4JI8 O;  4X64 O;  4JYY A;  3RN4 A;  1HP8 A;  4I50 B;  1RM1 C;  4MTG A;  1VAR A;  1VQO V;  2KQX A;  2XAF A;  3LDD A;  1GN3 A;  4TQD A;  3X2Q B;  3K9A A;  3P30 A;  1H2G A;  3O65 A;  2ARH A;  1XEQ A;  2YXY A;  4UVA A;  1Y74 B;  1RP3 B;  2VQE B;  2N04 A;  3KCY A;  3T4Z A;  1N34 O;  4D6T H;  4ZHQ B;  1OCZ C;  1XHX A;  3GWO A;  4FLZ A;  5KAF Z;  5IYZ B;  2Y4T A;  4DV7 O;  4ZOL A;  4NB5 A;  4WBN B;  2ZIN A;  4UVC A;  1M93 A;  2GBO A;  1N8R W;  4O2A B;  3CB2 A;  4JI0 B;  5IYB O;  4QIW F;  1KMI Z;  4TUY B;  3N2G B;  1F51 A;  4FVM A;  2CAZ C;  4Z2W A;  4LFC O;  2FML A;  4MT8 A;  2QA4 V;  4DUY B;  4B7K A;  1JMK C;  3JAK B;  1YJN V;  1YJW V;  2NLJ C;  2YIC A;  2FYU H;  2PGG A;  2UXB B;  2EZO A;  3MDS A;  2KKW A;  2YIB A;  2H8P C;  3IC9 A;  5FNV B;  2QM4 A;  1FJG B;  2L35 A;  4JI8 B;  4X64 B;  2QWP B;  1F4N A;  2LFR A;  3ZBH A;  1Y4M A;  3I5D A;  4KFM A;  1VF7 A;  1M57 B;  5KHK A;  5CMU A;  1SQP H;  4AIL C;  1AI6 A;  3WU2 Z;  4JI4 O;  2XTA A;  1YCI A;  3JD0 A;  4B3R O;  3GB7 C;  5LHI A;  1N34 B;  2X6A A;  1WJZ A;  1NT2 B;  1SES A;  3CXC U;  4NXN O;  5EC1 C;  2DJV A;  3U0Z A;  1U96 A;  4DV7 B;  4H13 B;  1Q5O A;  3BA9 A;  3FYE B;  1NQT A;  1T5E A;  1FYJ A;  1GMG A;  4MTX A;  3ZN1 A;  1ARO P;  3FAV A;  4DUZ O;  2WLI A;  2EX3 A;  4PEL A;  4PI0 A;  3SPI A;  1WA8 A;  3AG1 B;  2DN9 A;  2QGN A;  4LFC B;  1XMO O;  4GLX A;  1M56 B;  2L6L A;  3ZX6 A;  2X7R B;  2Q6A A;  2BTQ B;  1Q3E A;  2Y4U A;  1K73 W;  5LBQ A;  2E76 B;  3SYP A;  1KBH A;  4FZ0 A;  1D5A A;  4TQF A;  4PDV A;  1G8M A;  1OCO B;  1B04 A;  3CCJ V;  1JFF B;  3H1L H;  3CJH B;  5IJ9 A;  2VRZ A;  3AG2 C;  4Z1V A;  1IX9 A;  1QU7 A;  5B66 Z;  3I56 V;  4JI4 B;  4B3R B;  3HKC A;  4QGP A;  4DV6 O;  4NXN B;  3ZMS A;  4GX0 A;  3PN1 A;  4DR3 O;  3CRA A;  3K06 A;  4DUZ B;  3AG7 A;  5TIS Z;  4G2K A;  4GKK O;  1BHB A;  3HKD A;  3BAA A;  3IGA C;  1I5Y A;  1E1Q G;  2LGW A;  2MK3 A;  5FPR A;  4CH4 A;  1XMO B;  2ODM A;  5KHG A;  1YIT V;  2ZIO A;  3RWR D;  1Y6X A;  3ETE A;  2M7W A;  2ZT9 B;  1KU9 A;  1EZJ A;  2CTP A;  2E74 B;  1PKX A;  5E79 Z;  4UCS A;  3QTC A;  4PI2 A;  1Q8I A;  1TA8 A;  4UFZ A;  5EYP A;  4JF3 A;  2F95 B;  3T1C A;  1J95 A;  1VQ6 V;  3FFQ A;  1H8E G;  2Q0A A;  1E79 G;  2EIN C;  3HR0 A;  2B1G A;  4WFG A;  4CZZ A;  3D3Q A;  1W0K G;  4DV6 B;  3AG3 B;  4QE9 A;  1M4U A;  5B1B C;  5KHJ A;  2RNB A;  4PV1 B;  1PPJ H;  2Q7E A;  4DR3 B;  2EIL B;  3I55 V;  1JJ2 U;  1MG1 A;  2ZE6 A;  3ZMT A;  3IFX A;  4GKK B;  3UT5 A;  3LNM B;  4DR4 O;  1WB8 A;  4U3J B;  1Q43 A;  2FL4 A;  2VS0 A;  5LMU O;  4LFA O;  5B1A C;  1I5X A;  3FKS G;  1RFY A;  2WLJ A;  3JAM N;  1VMG A;  1NJI W;  3WFV A;  5ITZ B;  2W0F C;  1FXK B;  3JCZ A;  4BW9 A;  3ZRS A;  2GUZ B;  1HNW O;  2P06 A;  1SQB H;  3U11 A;  1BCC H;  4YIO A;  1SQG A;  1XMQ O;  4JZG A;  1UJW B;  2FB5 A;  3D3I A;  4DO2 A;  5KLV H;  1VQ9 V;  4O2B B;  1QHT A;  3JAW A;  1TVK A;  3VOU A;  5HFM A;  2QKA A;  4MVQ A;  2D2C B;  3M7M X;  1NS1 A;  4QNH B;  5DM6 V;  4DV4 O;  4LWS A;  5L3G A;  3RYH A;  3X2Q C;  4BIZ A;  5CA0 B;  3ETQ A;  1MZE A;  3K03 A;  2KSD A;  4BW5 A;  2D3O W;  3TCU A;  1FFX B;  4UV8 A;  1HR0 O;  4UB8 Z;  3ZHR A;  4DR4 B;  5FLX N;  3ZHU A;  2P67 A;  3HB3 B;  5LMU B;  4LFA B;  2CUG A;  3GVM A;  5FL7 G;  4LF8 O;  3BHP A;  2IBZ H;  1I94 O;  4HNA A;  1D2D A;  2Y48 A;  2EIJ B;  1GH6 A;  2ZR3 A;  3G4S V;  2UUC O;  1HNW B;  3RYI B;  1VQ5 V;  3OGC C;  2V4D A;  1XMQ B;  5CA1 B;  4LFB O;  3ZED A;  3WG7 B;  3TXS A;  5JVD A;  1XIL A;  2LO1 A;  1DF4 A;  1GK9 A;  2DWE C;  1GN2 A;  4X1K A;  3QO5 A;  1N32 O;  5LP6 C;  3B40 A;  3SYA A;  3ZN0 A;  3ETG A;  4CS2 A;  4DV4 B;  2CDY A;  3CCR V;  1HWY A;  1KUQ A;  1K7D A;  3H01 A;  3H9V A;  1AR4 A;  1V9P A;  1JX9 A;  5EZY B;  4YHH O;  2A3Q A;  3U10 A;  4FFB B;  1M1K W;  1Y76 A;  3F7V C;  5LYJ A;  2W6J G;  1HR0 B;  4AHC A;  3K08 A;  2DYR C;  3ASN C;  3G71 V;  2ZDI C;  2OCC C;  3UO3 A;  4AI8 A;  1BHA A;  3F5W C;  4LF8 B;  1V54 C;  1IUR A;  1I94 B;  1N33 O;  2WPD G;  1S72 V;  1KP3 A;  2YXH A;  2PTM A;  1QLE B;  4I9Q A;  2UUC B;  2OTJ V;  1Y74 A;  1ROP A;  3CCS V;  4LBE C;  2LW7 A;  3SR2 C;  3W7X A;  2Q73 A;  4MVU A;  4LFB B;  4FM0 A;  5H9C A;  1TAE A;  3UKM A;  4ZHQ A;  1M56 C;  1YXB A;  2R9I A;  2BOC C;  2N05 A;  5IYZ A;  3AEI A;  4GX1 A;  1AVM A;  2ZIM A;  1GM7 A;  2YID A;  4NKG B;  1CXZ B;  5EIB D;  1N32 B;  4GUN A;  1GN4 A;  5CB4 B;  3CS5 A;  2HJD A;  3AK3 A;  4TUY A;  3CE2 A;  3N2G A;  4PDM A;  3ABL B;  4DV1 O;  1EN6 A;  3OEH G;  4YHH B;  3BY6 A;  3E83 A;  1FAF A;  1NZ6 A;  1WPB A;  1K92 A;  3JAK A;  1W0J G;  3D36 C;  3JSN A;  1VF6 C;  4J7K A;  4H33 A;  2ZNJ A;  3LDC A;  1KEC A;  1XRE A;  1QQC A;  2QTO A;  3K59 A;  1QVG U;  1XNR O;  3GWK C;  1S77 D;  5FNV A;  1SQX H;  3EVK A;  3MAQ A;  3Q4H B;  2IJK A;  1N33 B;  1K97 A;  3FB8 C;  1J5E O;  4YXW G;  4FLU A;  3J80 N;  3IAY A;  3VBB A;  5EK0 A;  3ICX A;  4E2L A;  4Z1M G;  1MSD A;  3H1K H;  4GYC B;  2Q5Z A;  3A8T A;  3TK1 A;  4X20 B;  4UCO A;  1AP6 A;  4OX9 O;  2JJ2 G;  1PL4 A;  2BOB C;  1IVS A;  1WN7 A;  3ZIA G;  2ZDI A;  1UPG A;  2IH1 C;  2DW4 A;  1JJO A;  5JJN B;  2K9P A;  2Z5U A;  1FD9 A;  2W6I G;  2P4K A;  1IBL O;  3ZHV A;  2ZQM A;  4DV1 B;  1W2B U;  3UCS C;  1AI7 A;  4NYK A;  1XI1 A;  2ATK C;  2CTR A;  4FM2 A;  2EIK B;  3F7Y C;  2BTQ A;  3WB1 A;  1KQS U;  2DOS A;  1R73 A;  3P3N A;  4JTA B;  4LH6 A;  3AG3 C;  1XNR B;  1DF5 A;  4UB6 Z;  2ZXW B;  2GTS A;  1VF5 B;  4BR6 A;  1ZL8 B;  2H94 A;  4J7Z A;  2PZS A;  2EIL C;  1J5E B;  5H6Q A;  3CRM A;  3JD4 A;  4X8A A;  2ZR2 A;  5A9G A;  3T4D A;  1VP7 A;  1SA0 B;  2Q67 A;  2OIG A;  4MVR A;  2OIE A;  1COW G;  4TOI A;  4ZIB A;  3DTU B;  4I9W A;  1H2M A;  1DLB A;  3W7W A;  3D36 A;  4OX9 B;  3K57 A;  3T1H O;  4H0L B;  2ZD9 A;  2CGO A;  4DRX B;  2BCC H;  1FXK C;  5J2U B;  3SDL A;  1NR1 A;  3B77 A;  1SER A;  4IGG A;  3ZS8 C;  4CH5 A;  1R1B A;  1TUE B;  2AZ2 A;  1IBL B;  1L8D A;  3HKB B;  2XHB A;  1Q6H A;  1K4D C;  4LF7 O;  2Q69 A;  4DW0 A;  3JAL B;  2XUM A;  3APQ A;  3RYC B;  2DE0 X;  3CD6 V;  4P30 A;  5J9P C;  1NTZ H;  5LHH A;  1GAX A;  1TUB B;  4Q20 A;  4PHZ A;  4EFB A;  4OPH A;  4AQY O;  1SKV A;  2EIM C;  1Q7Y W;  1VQK V;  2WLL A;  2YUA A;  1MNG A;  3OR7 C;  2ZE5 A;  3T1Y O;  3D8C A;  1VQ7 V;  5GON B;  1GN6 A;  4K0K O;  4JGS A;  3VQW A;  4R7C A;  1PV0 A;  3T1H B;  2AGA A;  1L0N H;  2ZE8 A;  3OD4 A;  4WCE V;  2G38 A;  1EFR G;  4RAI A;  2EIJ C;  1YI2 V;  1ZAU A;  3G80 A;  4TV9 B;  3CCV V;  5LXT B;  2LJ2 A;  1W59 A;  2OT5 A;  2RQ6 A;  2WLN A;  1JPX A;  3OE7 G;  2RDC A;  3ABK B;  5DN6 G;  1TGO A;  1H8H G;  1YVW A;  3WG7 C;  4NTY A;  3L70 H;  4U3J A;  4FIP C;  4LF7 B;  1H2K A;  2Z0A A;  2CH7 B;  4LCU C;  5GW7 A;  1WP8 A;  1AI4 A;  5ITZ A;  1FXK A;  1AJQ A;  1F23 A;  4K8X A;  4RQF A;  2PYJ A;  4PA4 A;  1DTO A;  4AQY B;  5DEC A;  2GUZ A;  2VWK A;  1QR8 A;  2E3C A;  2B1I A;  3OGI B;  2E75 B;  4G27 B;  1KKC A;  3OUF A;  3CC2 V;  3T1Y B;  1H2L A;  1JCH A;  3OTF A;  4GX5 A;  1N4C A;  4HYO A;  4O2B A;  2IU3 A;  2NNU A;  4K0K B;  4TT3 G;  2QJ1 A;  2WA4 A;  3R65 A;  2AW9 A;  4FLW A;  1JOY A;  3NXS A;  4EB6 B;  4G28 B;  5AG2 A;  4CH6 A;  1BQ0 A;  5CA0 A;  4B3S O;  4MVO A;  3B8N A;  3K79 A;  1KB9 F;  1WB7 A;  2ADQ B;  4GZR B;  2EUL A;  4GKJ O;  1Y66 A;  2A79 B;  2RMK B;  4BIU A;  2A0L A;  2RJZ A;  4QJF B;  5C8Y B;  1FFX A;  2XAJ A;  5EBL C;  3TGU H;  4X88 A;  4DV0 O;  4LH7 A;  4FZ1 A;  3OW2 U;  3JAR B;  1IXB A;  3K0D A;  1Q86 W;  4XBF A;  1FXV A;  1BS3 A;  4O4J B;  3RVY A;  1H2N A;  3RYI A;  2N74 A;  1GO3 F;  2R9A A;  3MHS C;  1SQV H;  3ABL C;  5CA1 A;  4X66 O;  1AB3 A;  1MZF A;  3K04 A;  4JI1 O;  4U7O A;  4I0X B;  5KA5 A;  3ABU A;  1OCC B;  4IIJ B;  3L74 H;  5JQG A;  5KX5 B;  4O4I B;  3ZRV A;  5KMG B;  3RVZ A;  1AR5 A;  4X1Y B;  1OJH A;  1ZWI C;  3K58 A;  2ZE7 A;  2WLL B;  3JAT B;  4EFE A;  3OMA B;  4N23 A;  1F7Y A;  4J10 A;  2WLH A;  4CS3 A;  3BRC A;  3H1H H;  4B3S B;  5EZY A;  4TSF G;  1N36 O;  3EFF K;  4FFB A;  3ZRX A;  2ETN A;  4GKJ B;  4ASU G;  2A06 H;  4MVZ A;  4BAY A;  5BMV B;  2LQT A;  2A7W A;  5C93 A;  1M5I A;  2QTS A;  4DV0 B;  5IYC O;  2EJR A;  1H38 A;  3FB7 C;  1VEW A;  4PD4 F;  3E22 B;  1AI5 A;  1NH2 D;  1BZK A;  4KHP O;  3R66 A;  3BFR A;  3G67 A;  4P9P A;  4FLT A;  5A2Q N;  3QNE A;  3CME V;  1YDX A;  3K0G A;  2DQ0 A;  1QCE A;  3EXA A;  2IJH A;  3CXH F;  1MOF A;  4ABM A;  4X66 B;  1XL4 A;  4KP4 A;  1KD1 W;  4JI1 B;  3K5N A;  4MS2 A;  3E8B A;  2EIK C;  5CN0 A;  3S3W A;  1CP9 A;  1OHH G;  4BWA A;  3H1I H;  3LDE A;  2ZXW C;  3DXR B;  1K9M W;  1JVM A;  5LHG A;  1Y67 A;  5CB4 A;  4YJ3 B;  4PA3 A;  1WLE A;  2GDS A;  3E8H A;  2BSK A;  2YDE A;  2HFE C;  3ETD A;  3KKY A;  2Y69 C;  1N36 B;  2WA3 A;  3STZ C;  4DXW A;  4H44 B;  1RM1 B;  4ZBM A;  3CCM V;  1QVF U;  3IC7 A;  3J81 N;  4R8C A;  1IBM O;  2UXC O;  5GTI Z;  4DR2 O;  2RN9 A;  2XT9 A;  1GM8 A;  5KHH A;  4JAU A;  4IHJ A;  3Q4H A;  3RGB A;  4I4T B;  4PA6 A;  4KHP B;  2AHZ A;  2UXX A;  1MMM A;  2Q9L A;  3QO8 A;  2MW2 B;  3C3T A;  4MW3 A;  1XBL A;  1M90 W;  4FM1 A;  4XDK A;  1VQL V;  1PD3 A;  4LNU B;  1IZ3 A;  4X20 A;  1A32 A;  4WFE A;  2YEV B;  1Q81 W;  4TWK A;  3LSS A;  2V7Q G;  4IYI A;  1HNX O;  3TJT A;  1VIB A;  3CC7 V;  3L73 H;  3RT3 C;  1EM1 A;  2UXD O;  2PI5 A;  4X9Q A;  4DR1 O;  3STL C;  3DSQ A;  3FD9 A;  4K35 A;  1OZ0 A;  2WSS G;  3MD0 A;  2Q0O C;  4LC1 A;  4NXM O;  2P90 A;  4B7E A;  4YIP A;  3BEH A;  2P22 C;  5H2F Z;  3SJC C;  2GHY A;  1HW7 A;  3B09 A;  5JQG B;  2KG7 B;  3APO A;  3A0R A;  3DC6 A;  3K3W A;  2F1M A;  4F6E A;  1IBM B;  2UXC B;  4DR2 B;  1ZL8 A;  1G1X B;  3B8M A;  1M57 C;  2EBO A;  2YI8 A;  2UU9 O;  2RCV A;  5JCO C;  3ABK C;  1SA0 A;  1K33 A;  4FPP A;  1RSO B;  3CCL V;  2QWQ B;  4NTX A;  1DGS A;  4PJ0 Z;  3SYO A;  4JTC B;  1HNX B;  4LF5 O;  1BQZ A;  1P49 A;  4DRX A;  1NVP D;  3CPW U;  3MHH C;  5J2U A;  2UXD B;  2R72 A;  3HKE B;  3SJQ C;  4DR1 B;  4JAA A;  1P7B A;  3AG1 C;  1WNS A;  5L3B A;  4NXM B;  4DK1 A;  1DK1 A;  4X1I B;  3HKB A;  2JS3 A;  3B2E E;  3NR7 A;  3JAL A;  4MTO A;  3E2E A;  2PY5 A;  1EN4 A;  1QLN A;  4J80 A;  3RYC A;  1K4C C;  4R6Z A;  1FS0 G;  4OPA A;  3ASO B;  3B4S A;  3OT7 A;  1TUB A;  3AK1 A;  4TV8 A;  1IBK O;  1OCO C;  4UCR A;  3JD1 A;  3SJA C;  2BSK B;  3J7A U;  4UCV A;  2XAS A;  5EIB C;  1NBM G;  2UU9 B;  1RPO A;  2DMX A;  2PF4 E;  3A0H Z;  3THO A;  5FPO A;  4O4L B;  5L3F A;  1VQ8 V;  2PUS A;  1WAZ A;  1AIL A;  4PA7 A;  1CEZ A;  5GON A;  2OTL V;  4YY3 O;  1M9N A;  2XAG A;  1P4R A;  3SPH A;  4IHJ B;  1PM9 A;  2EJ7 A;  2ILM A;  4NTW A;  4LF5 B;  2QWR B;  4NVP A;  2NN4 A;  1AJP A;  2QEX V;  3BA8 A;  4MW8 A;  1SZT A;  4FLY A;  1R6T A;  4TV9 A;  5LXT A;  1XNQ O;  3C90 A;  3RYF A;  5JCO A;  4J9Y B;  2HLD G;  2XND G;  1JQ0 A;  2V1D A;  5B3S B;  4I55 B;  4E4E A;  2VQF O;  2CH7 A;  2IJJ A;  2OYQ A;  3CCU V;  3G6B A;  2GSM B;  1N0N A;  2EIN B;  1I08 A;  1R6N A;  2ITD C;  2JS5 A;  1LUV A;  2Q4P A;  4F6R B;  1NH2 B;  1IBK B;  1P7G A;  3CWB H;  5E1A C;  1GKF A;  3VQY A;  3CRR A;  5L3E A;  2PYL A;  4DV5 O;  5EBM C;  5IY5 B;  1ZUQ A;  1YEW A;  1O9H A;  2CTQ A;  3E35 A;  2P5O A;  3ZHQ A;  5BY1 A;  4YY3 B;  3VQV A;  1THZ A;  2Z3Y A;  4UUJ C;  1KP2 A;  1ENV A;  2A9H A;  1VQP V;  1G6U A;  1N0J A;  4EB6 A;  3LSU A;  3KCX A;  3SPG A;  2F93 B;  1S5L Z;  2UXN A;  4J9Z B;  2YSU B;  5H6R A;  1XNQ B;  2WAM A;  1OV9 A;  1XQ8 A;  2X6C A;  5EC2 C;  1R3J C;  4CBC A;  5C8Y A;  2HKO A;  3ZHS A;  3JAS B;  3O9O A;  3TET A;  2HEP A;  2R70 A;  3SPJ A;  2XOK G;  4CC6 A;  1GM9 A;  1XHZ A;  2JRI A;  2VQF B;  3JAR A;  1K3E A;  1MAB G;  4WFA V;  1SF9 A;  5H5N A;  4YJ2 A;  2HG5 C;  4O4J A;  4FLV A;  4QPJ A;  1HNZ O;  4NR1 A;  1V55 B;  1NI8 A;  1KC8 W;  4DV5 B;  1L1F A;  4X65 O;  3OTO O;  4I0X A;  1CPY A;  4WFB V;  4IIJ A;  3BPZ A;  3WB2 A;  1R3K C;  2DYS B;  2JGD B;  4MVM A;  5KX5 A;  3C3S A;  4O4I A;  4L8J A;  4TV8 B; 
#chains in the Genus database with same CATH homology
 2QE7 G;  3K03 A;  2IU0 A;  1YTF D;  2ITC C;  3OMN B;  4BW5 A;  2D3O W;  3RVY A;  3TCU A;  5KA6 A;  1GO3 F;  3MHS C;  1BMF G;  1FFT B;  3ML0 A;  4UV8 A;  3AG4 B;  3E8G A;  4HZ3 A;  3ABL C;  2P6J A;  3CP1 A;  2P67 A;  3HB3 B;  1AJN A;  3K04 A;  1PNL A;  3JYC A;  4ZKI A;  4U7O A;  1QR9 A;  4MVS A;  4GX2 A;  5KA5 A;  3ABU A;  1Q82 W;  1OCC B;  5FL7 G;  4KUM A;  3FB5 C;  3JD3 A;  1OCC C;  3ZRV A;  3RVZ A;  2Y48 A;  2JIZ G;  2EIJ B;  4JPR A;  3SPC A;  1ZWI C;  2ZR3 A;  3G4S V;  3CCQ V;  2WLL B;  1VQ5 V;  3OMA B;  1IXM A;  4N23 A;  2WLH A;  3OGC C;  4H37 A;  4GT1 A;  3PJS K;  3WG7 B;  3RW0 A;  4TSF G;  3EFF K;  4EKW A;  3ZRX A;  4ASU G;  3FB6 C;  2JEX A;  4MVZ A;  4BAY A;  1K8A W;  1DF4 A;  2C2A A;  5C93 A;  1GK9 A;  2DWE C;  3CYO A;  5B1B B;  3CCE V;  4QE7 A;  3QO5 A;  5IYC O;  1OCR C;  2EJR A;  1H38 A;  2XAH A;  3FB7 C;  3E89 A;  3ZMV A;  3SYA A;  3ZN0 A;  3ETG A;  1AI5 A;  1NH2 D;  3CCR V;  4GCZ A;  3SYQ A;  1HWY A;  3ABT A;  3OAA G;  4FMT A;  5B1O A;  1K7D A;  3H01 A;  3W7T A;  4P9P A;  1YJ9 V;  1JX9 A;  3QNE A;  3CME V;  1M1K W;  3K0G A;  2DYR B;  4MTF A;  2DQ0 A;  3ASN B;  1NVP B;  5B1A B;  1QCE A;  3F7V C;  2W6J G;  1GTO A;  2OCC B;  3LSQ A;  3K08 A;  4PA9 A;  1S76 D;  2IJH A;  1PNM A;  3RBZ A;  2DYR C;  4F4L A;  3ASN C;  1MOF A;  3G71 V;  3UM7 A;  2ZDI C;  1XL4 A;  2PI4 A;  2OCC C;  1V54 B;  4KP4 A;  1KD1 W;  5LGU A;  1KKD A;  1BHA A;  4MS2 A;  3F5W C;  1VQ4 V;  3E8B A;  2EIK C;  5CN0 A;  5B1N A;  1QBZ A;  2QKS A;  1CP9 A;  1OHH G;  1V54 C;  4PDR A;  2WPD G;  1S72 V;  1BL8 A;  3LDE A;  3T2M A;  4OXS A;  5LGT A;  1KP3 A;  2ZXW C;  1YIJ V;  1K9M W;  1JVM A;  4JTD B;  5LHG A;  1QLE B;  2B5U A;  4PA3 A;  1WLE A;  3M99 B;  5CBG A;  2OTJ V;  1ROP A;  3E8H A;  3CCS V;  2Y69 B;  4LBE C;  1AR1 B;  1QLE C;  3W7X A;  2HFE C;  4MVU A;  1K5Q A;  3ETD A;  3FYI B;  4FK5 C;  4UVB A;  5H9C A;  3UKM A;  2X0L A;  2Y69 C;  1M56 C;  3STZ C;  3ABM B;  4DXW A;  1RM1 B;  3E8F A;  4ZBM A;  1ORQ C;  5LGN A;  1YSC A;  3CCM V;  1QVF U;  2R9I A;  4JAV A;  2BOC C;  3IC7 A;  3CC4 V;  1RM1 C;  4MTG A;  3AEI A;  4GX1 A;  1VQO V;  2XAF A;  1R6K A;  4R8C A;  5CBF A;  4JYB A;  1GM7 A;  3LDD A;  3X2Q B;  2YEV A;  3K9A A;  3P30 A;  2DQ3 A;  1H2G A;  1GM8 A;  3OM3 B;  4JAU A;  4UVA A;  5KUM A;  3ASO C;  3ZCC A;  4PA6 A;  2P7T C;  3SYC A;  2AHZ A;  4QPK A;  1RPR A;  3P32 A;  3JD2 A;  2UXX A;  2WWW A;  4PDM A;  3QO8 A;  3T4Z A;  3ABL B;  1OCZ C;  3OEH G;  3BY6 A;  4MW3 A;  3E83 A;  2F43 G;  2HVJ C;  3GWO A;  1M90 W;  1K92 A;  4XDK A;  1VQL V;  1PD3 A;  1W0J G;  4U7N A;  2FTK A;  4H33 A;  1B6Q A;  4JAS A;  4UVC A;  1E1R G;  1FXH A;  3LDC A;  1KEC A;  3HPL C;  4WFE A;  2YEV B;  1Q81 W;  4TWK A;  2QTO A;  3LSS A;  2V7Q G;  1QVG U;  1N8R W;  5EBW C;  1S77 D;  5IYB O;  4QIW F;  3CC7 V;  4RQE A;  2IJK A;  1K97 A;  1NR7 A;  3FB8 C;  2PI5 A;  4YXW G;  1F51 A;  3STL C;  3VBB A;  5EK0 A;  4E2L A;  4Z1M G;  4MT8 A;  2QA4 V;  1OZ0 A;  2WSS G;  3MD0 A;  4LC1 A;  1YJN V;  1YJW V;  2P90 A;  2NLJ C;  1SRY A;  3TK1 A;  3BEH A;  2JJ2 G;  2EZO A;  4FJC C;  2BOB C;  2GHY A;  2H8P C;  3ZIA G;  1OCR B;  2ZDI A;  3ZJZ A;  2IH1 C;  1VQN V;  2DW4 A;  3A0R A;  5B3S C;  2JJ1 G;  1F4N A;  4RO2 A;  2LFR A;  1Y4M A;  3K3W A;  4KFM A;  1WPX A;  2Z5U A;  1M57 B;  5CMU A;  1AI6 A;  2W6I G;  3B8M A;  1XL6 A;  1M57 C;  2KB1 A;  2EBO A;  3JD0 A;  3GB7 C;  2ZQM A;  5LHI A;  1SET A;  2X6A A;  1W2B U;  1SES A;  2IW5 A;  3CXC U;  3ABK C;  1AI7 A;  1K33 A;  4FPP A;  5EC1 C;  3CCL V;  2ATK C;  2EIK B;  3F7Y C;  2DWD C;  3FYE B;  1NQT A;  2QM8 A;  1KQS U;  1GMG A;  2WLK A;  5IY5 C;  4MTX A;  1R73 A;  4P9O A;  3ZN1 A;  1ARO P;  4JTA B;  4N21 A;  2WLI A;  2JEU A;  3AG3 C;  3SYO A;  4JTC B;  1DF5 A;  4PEL A;  2ZXW B;  1EBO A;  5CA3 A;  2H94 A;  3CPW U;  1NVP D;  3MHH C;  4HAM A;  3ZMU A;  2CK3 G;  3CMA V;  2EIL C;  5H6Q A;  3SPI A;  3AG1 B;  3JD4 A;  3SJQ C;  3ZRW A;  4X8A A;  2Q68 A;  2ZR2 A;  3T4D A;  4WFH A;  1P7B A;  3AG1 C;  4WF9 V;  1M56 B;  2Q67 A;  5L3B A;  4MVR A;  1COW G;  2X7R B;  2Q6A A;  3DTU B;  4I9W A;  2AHY A;  1DLB A;  3W7W A;  3D36 A;  1K73 W;  2IJI A;  5IYD O;  1VQM V;  2JDI G;  2WLI B;  5LBQ A;  4MTO A;  3E2E A;  3SYP A;  2ZD9 A;  1QLN A;  1K4C C;  4PDV A;  1FXK C;  4R6Z A;  2HJF C;  1G8M A;  1FS0 G;  1R3L C;  1NR1 A;  1OCO B;  3ASO B;  3B77 A;  3W7U A;  3CCJ V;  1K5S A;  2LFS A;  1SER A;  4I5S A;  3AG2 C;  1OCO C;  3JD1 A;  1OCZ B;  3EHB B;  2XAQ A;  1TUE B;  3I56 V;  1PL0 A;  2XAS A;  1NBM G;  1K4D C;  1RPO A;  1S3J A;  1YTF B;  2Q69 A;  5L3F A;  1V55 C;  1VQ8 V;  2IH3 C;  1YHQ V;  3ZMS A;  4PA7 A;  3CD6 V;  4P30 A;  1CEZ A;  2OTL V;  3OUS A;  5J9P C;  4GX0 A;  2EIM B;  5LHH A;  1M9N A;  2QM7 A;  2XAG A;  3K06 A;  1P4R A;  3SPH A;  4Q20 A;  3OFN G;  2DYS C;  2HVK C;  4G2K A;  2EIM C;  1Q7Y W;  4PDL A;  1BHB A;  1K34 A;  1VQK V;  2WLL A;  1AJP A;  2QEX V;  3IGA C;  1I5Y A;  1E1Q G;  4MW8 A;  1SZT A;  2MK3 A;  3KG2 A;  3OR7 C;  5BZB A;  2R9R B;  5CBH A;  3W7S A;  3AG4 C;  1VQ7 V;  1YIT V;  3ETE A;  3OEE G;  2M7W A;  4J9Y B;  2HLD G;  2XND G;  1JQ0 A;  1S5H C;  2V1D A;  5B3S B;  1MSW D;  3E86 A;  4JGS A;  4P2Z A;  4R50 A;  4R7C A;  2JK5 C;  1EZJ A;  1PKX A;  3ZMZ A;  2IJJ A;  3CCU V;  4WCE V;  5KUK A;  5L3D A;  2K1E A;  2GSM B;  1EFR G;  1G4Y B;  4JF3 A;  4RAI A;  3T1C A;  1J95 A;  2EIJ C;  1VQ6 V;  2EIN B;  1YI2 V;  1H8E G;  1R6N A;  3CCV V;  2ITD C;  2OT5 A;  2EZP A;  1NH2 B;  1E79 G;  2WLN A;  2EIN C;  1JPX A;  3OE7 G;  3LUT B;  3OR6 C;  4LP8 A;  1GKF A;  3ABK B;  5E1A C;  5DN6 G;  2B1G A;  4WFG A;  1H8H G;  3WG7 C;  4CZZ A;  1R3I C;  5L3E A;  4FIP C;  1LNQ A;  5EBM C;  1S0V A;  4UV9 A;  5IY5 B;  1W0K G;  4LCU C;  5GW7 A;  5IDJ A;  4MSW C;  3AG3 B;  4QE9 A;  5B1B C;  1AI4 A;  4UXN A;  3E35 A;  4RUE A;  1FXK A;  1AJQ A;  5L3C A;  1THZ A;  2EIL B;  3I55 V;  1F23 A;  1JJ2 U;  1PNK A;  4RQF A;  1MG1 A;  2Z3Y A;  2LP7 A;  4PA4 A;  3ZMT A;  1DTO A;  3IFX A;  1KP2 A;  4UUJ C;  1ENV A;  2A9H A;  1VQP V;  4WFF A;  1QR8 A;  2B1I A;  3LNM B;  3SPG A;  4G27 B;  2UXN A;  3OUF A;  4J9Z B;  2X6B A;  4L87 A;  5B1A C;  3CC2 V;  2YSU B;  1I5X A;  5H6R A;  3FKS G;  2WAM A;  2WLJ A;  2X6C A;  5EC2 C;  1JCH A;  1R3J C;  1NJI W;  4GX5 A;  4CBC A;  3WFV A;  2HKO A;  4HYO A;  2W0F C;  2HR3 A;  2IU3 A;  2NNU A;  4TT3 G;  1FXK B;  3TET A;  3JCZ A;  3SPJ A;  2XOK G;  4JYC A;  3ZRS A;  1GM9 A;  3R65 A;  3G6E V;  1K3E A;  1MAB G;  4WFA V;  4XDJ A;  3AG2 B;  1JOY A;  3NXS A;  4G28 B;  3ZRW B;  4MVO A;  1UJW B;  3B8N A;  3K79 A;  3D3I A;  2HG5 C;  4X89 A;  5HFL A;  4XDL A;  4DO2 A;  3QO7 A;  4QPJ A;  1Y66 A;  2A79 B;  4BIU A;  2A0L A;  4QJF B;  1VQ9 V;  1F4M A;  4RUF A;  1V55 B;  2XAJ A;  5EBL C;  4X88 A;  1KC8 W;  3ABM C;  3VOU A;  5HFM A;  1L1F A;  4MVQ A;  2WLM A;  4QNH B;  3OW2 U;  3DGE A;  1NKD A;  1CPY A;  5DM6 V;  4WFB V;  3K0D A;  5L3G A;  1R3K C;  2DYS B;  4MVM A;  3X2Q C;  1Q86 W;  3OMI B;  4BIZ A;  4XBF A;  1FXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...