2DWDC

Crystal structure of kcsa-fab-tba complex in tl+
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB HEAVY CHAIN
publication title Crystallographic Study of the Tetrabutylammonium Block to the KcsA K(+) Channel
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 42
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2dwdC00
4MW8A 3RVZA 3VOUA 2ATKC 4JTAB 4PDMA 3SPIA 3K0DA 3LNMB 2W0FC 3FB7C 4GX0A 2QTOA 4PDLA 4R50A 4R8CA 3F7VC 4WFEA 5EC2C 3R65A 3F5WC 4WFFA 3ZRSA 4G28B 4WFGA 5CBFA 3SYQA 4PDRA 2WLKA 2JK5C 2IH3C 3OR6C 4JTDB 5EBMC 1OCZC 4GX2A 5E1AC 2BOCC 2Y69C 4CBCA 3ABMC 3FB5C 3IFXA 3E83A 1ZWIC 3LUTB 3SPGA 3X2QC 1K4DC 4EKWA 4GX1A 4MVSA 3OUSA 3ABKC 3ASOC 4HZ3A 4HYOA 1OCRC 2HFEC 2HVKC 2HJFC 2WLJA 5B3SC 2P7TC 2H8PC 3F7YC 1BL8A 4H33A 4KFMA 4LP8A 4UUJC 4ZBMA 3JYCA 1JVMA 2WLNA 4PDVA 3K04A 5IY5C 3LDDA 3E89A 1R3IC 1ORQC 4J9ZB 2NLJC 3T4DA 4J9YB 4PA4A 2R9RB 3T4ZA 3RW0A 3T1CA 1G4YB 2WLLB 1QLEC 4PA9A 2WLHA 2Q6AA 4GX5A 2WLIB 2Q69A 4MVQA 4MVMA 4P9OA 2ZXWC 3AG2C 3E86A 3IGAC 4X88A 1P7BA 3FB6C 1V54C 4RUFA 4XDLA 5EBLC 4P9PA 3UKMA 2EIJC 3SPHA 4MTFA 2A9HA 4LCUC 4R6ZA 4TWKA 4PA7A 2A0LA 3KG2A 2X6AA 1KKDA 3SYAA 3TCUA 3E8GA 2WLLA 2ITCC 2EIMC 5KUMA 2QKSA 2WLIA 3ABLC 1R3LC 3AG1C 3ASNC 4WFHA 2Q67A 3OGCC 4MTGA 3RVYA 5EBWC 2X6BA 4DXWA 4QE9A 2HVJC 4MW3A 4P30A 3E8HA 5EK0A 3TETA 2X6CA 3STZC 3AG3C 3T2MA 1OCCC 1XL4A 2ZD9A 2Q68A 2WLMA 2KB1A 3LDEA 5B1BC 4RAIA 1J95A 2HG5C 4MTOA 3SJQC 4RUEA 1V55C 3PJSK 4LBEC 4F4LA 4MS2A 3SYCA 5B1AC 1S5HC 4PA6A 5CBHA 3FB8C 3BEHA 1XL6A 3UM7A 3SYPA 2DWDC 1M57C 2EIKC 3K06A 2BOBC 4XDKA 3E8BA 1OCOC 3SPCA 3SYOA 4QE7A 2DYRC 2OCCC 3SPJA 3ZJZA 2AHYA 2AHZA 4H37A 4QNHB 3GB7C 3K08A 4MVUA 4JTCB 3RBZA 5EC1C 3E8FA 4MVZA 4MVRA 2K1EA 2DWEC 3STLC 1R3JC 2EILC 2ITDC 2YEVA 3LDCA 1R3KC 4I9WA 3HPLC 3K0GA 3EFFK 2A79B 3OR7C 4R7CA 5J9PC 5KUKA 5BZBA 1LNQA 1K4CC 3OUFA 1M56C 4G27B 4X89A 4X8AA 3K03A 2EINC 2DYSC 4P2ZA 4XDJA 2IH1C 4RO2A 3WG7C 3AG4C 4MSWC 4MVOA 4PA3A 4BW5A 4OXSA 5CBGA
chains in the Genus database with same CATH superfamily
4J42A 4JTAB 1XNRO 1US6A 2ZE6A 4WFEA 1THZA 4FFKA 4LFBB 4L87A 2P4VA 2Y48A 3HKBB 2JK5C 1K7DA 3ICXA 1I08A 4DV5O 1HR0O 3TXQA 3X2QC 1NS1A 1B3QA 1H2LA 3RYIB 1GN2A 5JCOC 3C3SA 1HWYA 2ZCEA 3TXSA 4PDVA 1JR9A 1BQ0A 4LFBO 3HKCB 3ZMUA 1K33A 3ZIAG 4GLXA 2EILB 3RW0A 1XNQO 2QWRB 5JVDA 3ZRVA 2RQ6A 2UUBO 2UXBO 4P9PA 4LCUC 2Y0PA 2VWJA 4TV8A 5BR8B 1Y66A 1FS0G 5KUMA 4N23A 3M8AA 2JGDA 1R3LC 3RN4A 4UCVA 1NJIW 4AQYB 2YXLA 3STZC 4BAYA 2V7QG 3ZMZA 2ODMA 4NTYA 3X2QB 2DJVA 4DW0A 4RUEA 5LP6C 4JI2O 2UXCB 3CRRA 5BR8O 3W7SA 4FM1A 3ML0A 1Q90D 5EIBC 3JASB 5A2QN 3E2EA 4IYIA 5DM6V 1GM8A 2W0XA 2LP7A 2YEVA 1JQ0A 3LDCA 3EFFK 2A79B 5J9PC 5L3DA 4FLZA 3SJAC 1F7YA 1J5EB 3VOUA 1URFA 5JVDB 2UXCO 4NYKA 3BCCH 4JI7B 2OTJV 3R65A 4TV8B 5FPRA 4WFGA 2QM4A 1WLEA 2JGDB 5D5PA 4D7SA 3CCQV 4YJ2A 2PI5A 2IU3A 1DGSA 3ETDA 3IFXA 5LP6B 4EKWA 1K4DC 1VQ9V 2ZNIA 5H9CA 3CC7V 1J5EO 1KECA 1WB7A 1TVKA 1YITV 3N2KB 4ZBMA 1PL0A 1O9GA 4N21A 1MNGA 3E89A 1YDXA 2PTMA 2L6LA 3HR0A 2WLLB 1QLEC 4MVQA 4O4HB 1BHAA 5LBQA 4X1KA 1OV9A 4XBFA 3ZCCA 5EBLC 4JASA 3S3WA 2YEVB 3BAAA 2VQEO 1I0HA 3WB0A 3ABLC 1GN4A 2QM8A 1DLBA 1N0NA 3FAVA 3D3QA 1MZEA 2GUZB 1NKDA 3JCUZ 4O2AA 4DV1B 3K5LA 2WWWA 4BIOA 2KB1A 4NXMB 1YJ9V 2ADPA 3PJSK 3SDLA 2E5LB 1VQ7V 5EYPA 3UM7A 2FKXA 1H2GA 2FL4A 2CUGA 5K1XA 4QE7A 2AHZA 4JYYA 3RBZA 2UXNA 5ITZA 4JPRA 1QLEB 1M9NA 1TVKB 3STLC 1GMGA 5DN6G 3SR2C 1K4CC 4DV1O 3K03A 2EINC 2DYSC 4NXMO 2E76B 1VQPV 5AG2A 4OXSA 4K3AA 3AK3A 4H0LB 1H8EG 3ABLB 3FYEB 3MAQA 2L35A 2ZR3A 4OGQB 2KKWA 4DRXA 1K73W 4ZKIA 2XAGA 4MT8A 1QVFU 1KB9F 4O2AB 3ABKC 3D36A 5LA6B 2V1DA 5KA5A 4UUJC 2VQFO 4UVAA 3CPWU 3JYCA 3VQWA 1YCIA 5EYPB 2OYQA 4J9ZB 3T4DA 3T4ZA 2YXHA 3A0BZ 1G6UA 4FM0A 3TJTA 2EINB 2DYSB 3E86A 2YS8A 2IM9A 1RFYA 5ITZB 3K5NA 3N2GA 4CH3A 1OHHG 3O9OA 3KKYA 4PA7A 3Q4HA 3TGUH 2ITCC 4WFHA 2M7WA 1XDCA 1VQ5V 1ZUQA 3A2FA 1M90W 4MW3A 4P30A 1PNKA 4DR6B 4KHPB 3KZIZ 2X6CA 2QWQB 1E79G 3AG3C 5FLXN 1EZJA 1AR1B 2P67A 4X20A 1V55C 3ABKB 2EBOA 1WAZA 5L3FA 5EIBD 4JAUA 2EIKC 5CN0A 1BCCH 2AXTZ 4O2BA 3H1HH 2JJ1G 4JI4B 2MK3A 4DR6O 4DV2O 1JFFA 3OR7C 4CH4A 4GYCB 2P90A 4ICGA 4G27B 4X8AA 5FPOA 3CMEV 3EHBB 3NXSA 4RO2A 3L70H 4LF6B 2QEXV 3ZRWB 3CRAA 1KYOF 2XT9A 3SPIA 2P22C 3B2EE 1K5SA 4PDLA 4JZGA 1VQ8V 3Q4HB 2DOSA 3AG3B 1AP5A 3U11A 2QKCA 4JI4O 2IH3C 3OR6C 1Y4MA 5FL7G 5F2VO 2A7WA 1Q3EA 4CBCA 1V55B 2YIBA 2VRZA 3LUTB 4GT1A 4LF6O 3ZHTA 2EIKB 2IU0A 2HVKC 4IYHA 5GTIZ 4UB6Z 1N8RW 4X62O 4LF9O 2QWOB 4IL6Z 3K9SA 2WLIB 4WFAV 4U7NA 2ZXWC 4K8ZA 1AI7A 3KCYA 3B77A 3IC7A 1JFFB 1IDSA 4JI1O 1F4NA 5JJJB 1XMQO 3CRQA 4DW1A 1YHQV 4FMTA 3LSSA 4LFAO 2Q7GA 3DC6A 1L0NH 3JAKB 5KLVH 2ZD9A 2Q68A 4B3TB 2QGNA 2WLMA 2R9IA 3RYHA 3SJCC 3QVNA 4QGPA 1QR9A 1H2SB 3K59A 4JF3A 4NB5A 1NU1H 3ZMTA 1IX9A 5IJ9B 5J2TA 2K1EA 1MSDA 3L71H 3CP1A 2ZXWB 5C8YA 4X1IA 4B3TO 4FVMA 1XHZA 3OTOO 1H2KA 1GN3A 4F6RA 1G1XB 1HDJA 3UT5B 3ZEDA 1WA8B 1R6TA 2GHYA 1CP9A 1FYJA 1PPJH 1K8AW 1KKCA 2RNBA 2F43G 4B7KA 2UXDB 1M93A 2X7RB 3DXRA 4NTWA 1FFXA 2AGAA 2LFSA 5L3EA 4RWUA 2EZOA 2QM7A 3E83A 2D3OW 3B40A 5H6RA 1W0KG 1IZ3A 4A5UB 2KSDA 1P7GA 3T1HB 1TAEA 1PV0A 4K0KB 3RYHB 1XEQA 3OFNG 5LGUA 1VF5B 5IY5C 4LF5B 3CRCA 5CB4A 3ETGA 2NLJC 3SJBC 4LF4O 3JCZA 4PA9A 1AROP 1I94B 3TK1A 2Q69A 4LF7O 1NT2B 1P7BA 3CRMA 4I7ZB 1YI2V 2JRIA 2HJDA 4NKGB 5C8YB 3CMAV 2VS0A 4X1IB 3T1HO 4K0KO 4BIZA 5IYBO 3H9VA 2Q67A 1MG1A 4O4IA 2B1IA 3WB2A 1FXKA 3E22A 2YIDA 2HVJC 1IBLB 4TQDA 5EZYA 1P4RA 1I5XA 4QJFB 1HNWB 1FXKC 4YJ3A 1Q6HA 2XNDG 4UCTA 4MTXA 3FB8C 3W7UA 1S5JA 4UFZA 3SYPA 3JALA 4GKKB 3DXRB 4LWSB 1QR8A 2GTSA 3JAWA 1FFXB 2NNUA 1NTZH 4YIOA 5IY5B 2MW2B 5D5QA 4JTCB 2CH7A 2OTLV 4R7CA 5KUKA 1EM1A 5CB4B 1HNWO 3APOA 4PA3A 4BR6A 1IBKB 4BW9A 2RJZA 1D5NA 5JJEB 5EC2C 3F5WC 1PD3A 1Z5WA 1Y76B 4EB6A 4PDRA 1DF5A 5E79Z 2O57A 4TV9A 4X66B 4O4IB 2QR4A 1FXKB 3E22B 4RQFA 1QLNA 1AJPA 3OGIB 2CTPA 4CH6A 2QA4V 4HYOA 3CHXA 1AI4A 1Q6UA 2CTRA 2ZDIA 1IBKO 4JYCA 2G38A 2BTQA 5KHIA 3U0ZA 4HNAA 1TUBA 2JS3A 3JAWB 1G4YB 1X4TA 2WLHA 5B1OA 3HKDA 1K9MW 3AG2C 3IGAC 2BE3A 3ZRXA 3H1IH 5LMUO 3SGIA 3AK2A 3KG2A 2IJHA 3MHSC 4UVCA 1OJHA 3LSUA 5IWAB 4MTGA 4H13B 1GTOA 3I56V 3H1JH 4YY3B 4FLVA 3CCSV 1HP8A 2CTWA 5L3BA 4LC1A 2RMKB 4BWAA 4EB6B 1N34B 4HBNA 1PP9H 1VMGA 4TV9B 5CMUA 3K5MA 3G4SV 4DR4B 2AHYA 4QNHB 3U10A 1SETA 4MVRA 2Q5ZA 4I4TA 4YY3O 5BMVA 5LHGA 2EJRA 3AG2B 2BTQB 3DGEA 4HNAB 2IW5A 3WG7C 4BW5A 1N34O 3HKDB 2ZT9B 1AI6A 4PI2A 1ZL8A 2HKOA 3NR7A 4DR4O 2DQ0A 4AQYO 1KBHA 2JDIG 5B66Z 2WLKA 3P3PA 4JTDB 3CCJV 4UB8Z 1FFTB 4UV8A 4TSFG 1CXZB 4EFBA 1AVMA 4WF9V 1GK9A 2GBOA 5KHHA 4OPAA 2R70A 2CAZC 3K04A 5CA1A 5GONA 1SQXH 2Q6AA 1B6QA 3H1KH 3M7MX 4JYAB 3WG7B 3CJHA 4H44B 4I4TB 1T5EA 5BMVB 1SQGA 4LR3A 1BQZA 4G2KA 4JAVA 1YTFB 3C3TA 4JI7O 3RVYA 4Q6GA 3D8CA 2Q7HA 2GSMB 2ZE5A 1QBZA 4Q20A 5JH7A 3RYFA 2W6IG 3LDEA 4JI6B 4Z2WA 3RFRA 1N32B 5B1AC 2OT5A 1S3JA 2ZKOA 1IBMB 3E8BA 1OCOC 4PI0A 1N33B 1UFIA 4X1YA 3T1YB 4L8JA 5IYZA 1SQBH 2YC0A 4MVZA 4LF8B 1XQ8A 1NH2B 3K0GA 1SZXA 2YIAA 4ABMA 2LJ2A 1WNSA 4JI6O 5GONB 1V9PA 1N32O 3B8NA 5CBGA 3G6EV 2UUAB 4YJ2B 3J80N 2W0FC 2Z5UA 2Q0AA 2QTOA 3CJHB 3T1YO 1SA0A 2UUCB 1FXHA 1XILA 4LF8O 5LXTA 1GM7A 5IJ0A 2A3QA 5B1AB 3K5OA 2F23A 5CA0A 1Q86W 2E5LO 1OCRC 1OCOB 4W4LA 3RYFB 4X1KB 4CS4A 1ORQC 1RPOA 4PJ0Z 4TT3G 3RT3C 4X1YB 1A32A 3BA8A 3ZHQA 4FLUA 3FAVB 4XDLA 2N05A 1KMIZ 3VBBA 5JWPA 1XMOB 4D7TA 2IBZH 5TISZ 1SC5B 2QWNB 3LSQA 3KCXA 1Q81W 1Z2GA 2IJIA 3JSLA 3E8HA 3TETA 3ZMSA 3DSQA 3D36C 4U3JA 2Q0OC 1NVPB 2EIJB 1MMMA 5BY1A 4FZ1A 1HW7A 1OCRB 2E74B 1XMOO 2YUAA 2BOBC 2ZIMA 1PM9A 2GTAA 4FK5C 1S77D 3SPJA 3ZJZA 5CA0B 3JD1A 3CCEV 1BMFG 5HFLA 1R3KC 2R72A 4QPJA 4FLXA 1M56C 2PUSA 2RDCA 4XDJA 4DRXB 2W6JG 4PHZA 1YTFD 1FPOA 3EXAA 3CCMV 1L1FA 2CK3G 2FMLA 3QO8A 1KD1W 4DK0A 4FPPA 1XREA 3A0RA 4KHPO 1W2BU 1U96A 2JS5A 4B3MB 5E1AC 1MOFA 4KL1A 1YEWA 1PKXA 3OUSA 4U3JB 2B9ZA 2FYUH 1F23A 2DMXA 4LP8A 2ZNJA 3CSXA 2XTAA 4UV9A 3WU2Z 1S72V 3N2GB 4CC6A 1NH2D 1Q8IA 2E3CA 4J11A 1SQFA 1M56B 5KMGA 4FLYA 1R6KA 1UPGA 3D3IA 1Y74A 2LGWA 3OE7G 4ZHQA 5LHHA 1R1BA 1EBOA 1JOYA 4X20B 2P5OA 5A9GA 2X6BA 2P6JA 4OPHA 4DR3B 1S5LZ 1KC8W 1BT8A 1VP7A 5KHKA 2KQXA 1J95A 3FFQA 4O2BB 4IGGA 2F95B 1SQPH 1LUWA 1XHXA 1Q6IA 4UCOA 1M4UA 1K34A 1NR7A 2DWDC 3E35A 2ETNA 3LNNA 3SPCA 2PF4E 2BTOA 5GW7A 2OCCC 3L74H 4H37A 1N36B 2ARHA 3BY6A 1R3JC 4I5SA 1JJ2U 1L0LH 3HPLC 1WJZA 3BABA 1KU9A 3R66A 3UO3A 4DV6B 2ZIOA 4I55A 3J81N 3AG4C 2XAHA 1VEWA 3ETQA 4JI5B 1YSCA 5KMGB 3CWBH 5IYDO 4KUMA 1K92A 2E75B 2OCHA 4J41A 4ASUG 4DV4B 4R8CA 1QQCA 1HNXB 1Y74B 1N36O 4ZHQB 2HR3A 3W7TA 5DEDA 3AG7A 1VQOV 5LMNB 5EBMC 2PZSA 5KX5A 3UQ8A 2Y69C 1VQNV 2RN9A 1ZLZA 1BSMA 4HZ3A 1GH6A 4EEQA 2V4DA 5BXZA 2OCCB 1QCEA 1ZAUA 4JI0B 3B09A 1JVMA 3F5TA 1NTKH 2ZM6B 4DV4O 2PYLA 1HNXO 3T1CA 3A8TA 5LMNO 2FB5A 1IXBA 5FNVA 1V54C 3K3WA 4J7KA 3AG4B 5LYJA 2A9HA 4NVPA 2X6AA 3SYAA 4LH6A 2ZINA 1E1RG 2C2AA 3BVOA 5L3CA 4CS2A 3ETEA 3PN1A 4B3RB 1ZX3A 3CCRV 2ZM6O 2DE0X 3CXCU 4TUYA 2UXDO 1XI1A 1NZ6A 2Y69B 3QO7A 1KP2A 3W7WA 5J2TB 1Q5OA 4JGSA 2YICA 4YHHB 5KHGA 2AW9A 5KX5B 3VQVA 1OZ0A 2DYRC 1VQ6V 4GKJB 2LGQA 4B3RO 4LF5O 4F6RB 2BCCH 3DC5A 1KQSU 4RQEA 5B5EZ 4DR2B 5KA6A 1I94O 1V54B 3ABTA 4DV0B 1XOUA 2JIZG 2AZ0A 3RVZA 1JPXA 4YHHO 5FNVB 1LUVA 4K35A 3FB7C 4GX0A 2XHBA 4DR1B 1S0VA 1Q7YW 3CS5A 4ZOLA 3ZRSA 2DW4A 3CD6V 1IBLO 1SQVH 3ZN1A 4GX2A 4AHCA 1YIJV 2YI9A 3P32A 3SPGA 3CE2A 2HFEC 4WCEV 2HJFC 3HKBA 1SKVA 4PD4F 5B3SC 1DK1A 4GKKO 2P7TC 2DYRB 2XAFA 2YDEA 1VF6A 3B4SA 1DTOA 1KP3A 4DR1O 2Q9LA 2H94A 1DF4A 3ABUA 1HNZB 3JD0A 4X64B 4O4LA 1PNLA 2LW7A 3QNEA 4WBNA 2EJ7A 2PY5A 1MA1A 2A0LA 3IJ4A 1WPBA 2YIBD 5EZYB 4YXWG 3WB1A 1KKDA 3E8GA 2QKSA 3AG1C 4YJ3B 3OGCC 1ZTEA 2XOKG 3WFVA 1MSWD 2QSAA 4DO2A 4FFBA 1GKFA 3JALB 2CTQA 1H2MA 2ZDIC 5DECA 1HNZO 3BFRA 4X64O 4X66O 3ZHSA 1QHTA 4RAIA 4AI8A 3SJQC 4KXRA 2CH7B 3K9AA 4PA6A 3JATA 4CS3A 5B3SB 4DR7B 2FTKA 5CA3A 2Y0IA 1XBLA 1S76D 2QJ1A 1GM9A 4UCUA 1VQKV 3JD3A 1AJQA 3OT7A 4FLWA 1XNQB 1I5YA 5JJNB 3L9DA 4I9QA 3RYCA 3JAMN 3MHHC 5JCOA 4DK1A 3OUFA 1JX9A 1WPXA 2UUBB 2UXBB 2HEPA 3JASA 1XUQA 4MW8A 3OEEG 1VQ4V 3AG1B 5H6QA 4DR7O 4X65B 4O4LB 3RWRD 3AEIA 4WBNB 4R50A 4JI8B 5IWAO 3I55V 2ZQMA 1EZVH 1TUEB 3SYQA 1B04A 1AP6A 3ZBHA 4B3SB 3IAYA 2LO1A 2HHHB 3ABMC 1TUBB 4FFBB 4J7JA 4JI2B 3OD4A 2XASA 2WLJA 4H33A 4X65O 4J7ZA 3G71V 2WLNA 3QF7A 1ENVA 3OMNB 4JI8O 3JATB 1VQMV 1MZFA 5LP6A 1NQTA 4DR5B 5LL6Y 2DN9A 3N27A 2Q4PA 3N2KA 4MVMA 4UCSA 4B3SO 1BGYH 2HHHO 3P3NA 1H2NA 1LR1A 3GWOA 3RYCB 3DTUB 3JARA 2Q8VA 3OAAG 5LGNA 2WLLA 2CGOA 1SS3A 4O4HA 1YXBA 1OCCC 4DR5O 2QWPB 2EX3A 1I7FA 3ABMB 5B1BC 4IT5A 4PV1B 1FKAO 2P4KA 2GUZA 2IJKA 1B06A 4E4EA 2BSKA 4XDKA 3MD0A 3M99B 3SYOA 1Z5VA 2WPDG 4DV7B 2QTSA 5LGTA 2EULA 5EC1C 1AR5A 1BZKA 2ITDC 4I9WA 4NTXA 1ZL8B 4X89A 2LW1A 3CCVV 1BE3H 1Y6XA 4JYAO 2VQEB 3APQA 2F1MA 1JCHA 1W59A 1U97A 1EN4A 1GAXA 1ZSPA 2F93B 2WA4A 3LNMB 2PGGA 4DV7O 2UU9B 4J10A 3JARB 1OCCB 1P49A 2HLDG 4QIWF 5B1BB 2BOCC 2M6YA 5CA1B 1H38A 3GWKC 1ZWIC 2RCVA 4ZIBA 5IT9N 4GX1A 4B08A 3ASOC 1EFRG 2OIEA 5GTHZ 1IBMO 3ZS8C 1W0JG 3UCSC 1N33O 2WSSG 4E2LA 3LDDA 2UU9O 2BSKB 3AK1A 4FIPC 1YZBA 2D2CB 5LA6A 3OW2U 5K1PA 2YSUB 4I0XA 4X88A 2A06H 4FM2A 4RUFA 1CEZA 5H5NA 1QVGU 2EIJC 4MTFA 1L8DA 3UO2A 3FKSG 5JH7B 4YIPA 1JJOA 2UUAO 4K8XA 3BPZA 1PNMA 3ZMVA 3G6BA 3K79A 1AILA 3S3XA 2UUCO 2R9AA 3QO5A 5IYZB 2VWKA 3A0HZ 3ASOB 4O4JA 3K06A 2VQFB 2XUMA 1N4CA 3BRCA 1Q43A 3K08A 1M5IA 3E8FA 3JD4A 2DWEC 4D6TH 3JD2A 4LFCB 2XAJA 4TOIA 4TQFA 3OTFA 1RSOA 4P2ZA 3HB3B 5C93A 1SA0B 4MVOA 3ZHVA 4UVBA 5LXTB 4I0XB 2P06A 1YJNV 5IJ0B 2Z3YA 3ZX6A 4JYBA 1IURA 1VF7A 1RP3B 4JI3B 4DYLA 4CC5A 1X59A 2ZR2A 3F7VC 3GVMA 1SQQH 2B5UA 3CXHF 4ZI7A 3ZRWA 1E1QG 4QPKA 3HKEA 4UCRA 5KAIZ 4LFCO 2X0LA 1JMKC 3L75H 4DUYB 4MVSA 1RM1C 4FJCC 4W4KA 4Z1VA 2PI4A 4CZZA 4JI3O 3EVKA 5L3GA 3ZHRA 4O4JB 4DV2B 2CE4A 4GX5A 3THOA 5JQGA 4FZ0A 3VQXA 4JZ2A 3FB6C 4LNUA 1WN7A 4DUYO 5IE9A 2Z0AA 4R6ZA 3RGBA 1FD9A 3OM3B 2WLIA 1RSOB 3ASNC 1N0JA 3FD9A 4AILC 1P84F 5H2FZ 4DXWA 3FX7A 4QE9A 1YJWV 3IC9A 3G80A 3T2MA 4Z1MG 5IDJA 4B3MO 2UXXA 2N04A 5HFMA 4F4LA 1RM1B 2JVDA 4MS2A 4ZI7B 3CYOA 5CBHA 3BEHA 3HKEB 3OMAB 1XL6A 1R73A 1CPYA 3P30A 3G67A 3JAKA 3VQYA 2NN4A 4X62B 4MVUA 4JV5B 4LF9B 4DV3B 2CGNA 4OX9B 5BZBA 5LHIA 4IIJA 3B8MA 3I5DA 4JI1B 5IJ9A 2QKAA 5JQGB 3CEIA 1XMQB 4U7OA 3ASNB 4PDMA 4LNUB 4DUZB 4NXNB 4LFAB 4IHJA 2WAMA 4JV5O 5CBFA 4DV3O 1IXMA 1AI5A 3UT5A 4I50A 4DR3O 1WA8A 4OX9O 2Y4UA 3FB5C 3CB2A 4GCZA 1IVSA 3CC4V 3K57A 1YVWA 2H8PC 1BL8A 4DUZO 4NXNO 1R3IC 2IJJA 4J9YB 4PA4A 1NVPD 4F6EA 2CDYA 3OTOB 1K5QA 1EN6A 3QG5A 1FAFA 2Y4TA 3UKMA 4DV6O 1SESA 1AR4A 2N74A 4TWKA 1AJNA 2B1GA 1D5AA 3TCUA 2K9PA 2AZ2A 1MABG 2EIMC 4JI5O 1F4MA 4IIJB 5EBWC 1SZTA 4GUNA 2F4VB 3J7AU 2LQTA 4WFBV 1G8MA 5B1NA 2JGUA 1WB8A 1RPRA 2ILMA 1M1KW 4IHJB 1KUQA 1R6NA 2XAQA 2HG5C 4HAMA 2JEUA 3W7XA 3SYCA 4FLTA 1GO3F 1K3EA 1SRYA 1GN6A 4I50B 1M57C 2QDOA 4GZRB 2NR5A 1WP7A 5KAFZ 1WP8A 4I55B 3BA9A 3GB7C 4JI0O 5IYCO 1TGOA 4LF4B 1FJGB 3L72H 2GV9A 2F4VO 4LF7B 1K97A 3FYIB 4KP4A 4LWSA 1PL4A 1LNQA 2KG7A 2WA3A 5J2UA 4U3FH 2IH1C 2PYJA 1QNMA 4CH5A 1D2DA 2EIMB 4UXNA 3MDSA 2ATKC 3H01A 3K0DA 1H8HG 1SERA 4WFFA 1FJGO 2ZE7A 3CCLV 4G28B 3ZHUA 3BHPA 1OCZC 1VQLV 3CC2V 1GRJA 4JAAA 3QTCA 3C90A 4LH7A 1M57B 1Y76A 3O65A 1VARA 2H3OA 1YF2A 5LOVA 3F7YC 4KFMA 1NR1A 5LYJB 5KHJA 3CCUV 4GKJO 2R9RB 2OIGA 2YXYA 4P9OA 1Y67A 4DR2O 1FXVA 3SPHA 4DV0O 1Q82W 4TUYB 1EN5A 4B7EA 3L73H 2KG7B 4J80A 4NR1A 4C7UA 5J2UB 2LFRA 1NTMH 2JJ2G 1ROPA 5EK0A 3ZN0A 1SF9A 2DQ3A 1BHBA 3RYIA 1OCZB 4BIUA 1XL4A 3OEHG 1VF6C 4MTOA 4LBEC 1S5HC 1COWG 1TA8A 3HKCA 2HP8A 1JA8A 1NBMG 1QU7A 1XNRB 1UJWB 2QE7G 2YI8A 2ZE8A 2ADQB 2OWOA 3CX5F 5LOVB 2EILC 2GDSA 3JSNA 3K58A 1O9HA 1NI8A 2F66C 2Q7EA 2EZPA 4X9QA 4DV5B 1HR0B 1AB3A 2JEXA 5LMUB 3H1LH 3OMIB 2Q73A 4PELA 4ZOLB 4EFEA 4MSWC 1BS3A 1F51A 1VIBA
chains in the Genus database with same CATH topology
1JCHA 4JTAB 2GHYA 1CP9A 3LNMB 3CCMV 1L1FA 2CK3G 4WFEA 1K8AW 1THZA 3QO8A 1KD1W 2F43G 4FPPA 4L87A 2Y48A 1OCCB 3A0RA 2X7RB 2JK5C 1W2BU 2HLDG 1K7DA 4QIWF 5E1AC 1MOFA 5B1BB 2BOCC 2LFSA 5L3EA 2EZOA 1H38A 2QM7A 3E83A 2D3OW 1ZWIC 3X2QC 5H6RA 1W0KG 1PKXA 4GX1A 3OUSA 3ASOC 1EFRG 1F23A 4LP8A 4UV9A 1HWYA 1W0JG 1S72V 3OFNG 5LGUA 2WSSG 4PDVA 4E2LA 5IY5C 3LDDA 1NH2D 3ETGA 2NLJC 3ZMUA 1K33A 4FIPC 3ZIAG 2EILB 3RW0A 3JCZA 4PA9A 1AROP 3TK1A 2Q69A 3OW2U 2YSUB 1M56B 4X88A 3ZRVA 1P7BA 1YI2V 4RUFA 1R6KA 1CEZA 4P9PA 3D3IA 2EIJC 1QVGU 4MTFA 4LCUC 3OE7G 5LHHA 3CMAV 3FKSG 1Y66A 1FS0G 5KUMA 4N23A 1EBOA 4BIZA 1JOYA 1R3LC 5IYBO 2Q67A 1MG1A 2B1IA 1FXKA 1NJIW 2X6BA 2P6JA 1PNMA 2HVJC 3ZMVA 3STZC 3K79A 1KC8W 4BAYA 3QO5A 1P4RA 1I5XA 4QJFB 1FXKC 2V7QG 3ZMZA 2XNDG 1J95A 3X2QB 4MTXA 4RUEA 3ASOB 3FB8C 3W7UA 3SYPA 1K34A 1NR7A 1QR8A 2DWDC 3E35A 3K06A 3W7SA 3SPCA 5GW7A 3ML0A 2NNUA 5IY5B 2OCCC 4H37A 3K08A 4JTCB 3E2EA 3E8FA 3JD4A 5DM6V 2OTLV 1GM8A 2DWEC 3BY6A 1R3JC 2LP7A 2YEVA 3JD2A 1JQ0A 3LDCA 4I5SA 1JJ2U 3HPLC 3EFFK 2A79B 4R7CA 5J9PC 5KUKA 2XAJA 5L3DA 4P2ZA 3HB3B 5C93A 3AG4C 2XAHA 4MVOA 4PA3A 4UVBA 3VOUA 1YJNV 2Z3YA 1YSCA 4JYBA 5IYDO 2OTJV 4KUMA 1K92A 4ASUG 4R8CA 2ZR2A 3F7VC 5EC2C 3R65A 3F5WC 1PD3A 2B5UA 4WFGA 2HR3A 3W7TA 4PDRA 3ZRWA 1E1QG 1DF5A 4QPKA 1WLEA 1VQOV 2X0LA 5EBMC 1FXKB 3CCQV 2PI5A 4RQFA 1QLNA 2IU3A 2Y69C 1AJPA 1VQNV 3ETDA 3IFXA 4EKWA 1K4DC 1VQ9V 4MVSA 1RM1C 4HZ3A 2QA4V 5H9CA 4HYOA 4FJCC 3CC7V 1KECA 1AI4A 1YITV 2ZDIA 4ZBMA 2PI4A 1PL0A 4N21A 2OCCB 1QCEA 4CZZA 1JVMA 4JYCA 5L3GA 3E89A 3T1CA 1G4YB 2WLLB 1QLEC 2WLHA 4GX5A 5B1OA 4MVQA 1BHAA 1K9MW 3AG2C 3IGAC 5LBQA 3FB6C 1V54C 3K3WA 4XBFA 3AG4B 5EBLC 3ZCCA 3ZRXA 4JASA 2A9HA 2YEVB 4R6ZA 3KG2A 2IJHA 2X6AA 3SYAA 3MHSC 3OM3B 4UVCA 1E1RG 2WLIA 2C2AA 3ABLC 2QM8A 3ASNC 5L3CA 3ETEA 4MTGA 1DLBA 1GTOA 3CCRV 4DXWA 4QE9A 3I56V 1YJWV 1NKDA 3CXCU 3CCSV 3T2MA 4Z1MG 5IDJA 5L3BA 4LC1A 2Y69B 2WWWA 3QO7A 2UXXA 5HFMA 2KB1A 1YJ9V 1KP2A 4F4LA 3PJSK 1RM1B 3W7WA 4MS2A 3CYOA 5CBHA 3BEHA 1VQ7V 3OMAB 1XL6A 4JGSA 3UM7A 1CPYA 1R73A 5CMUA 1H2GA 3P30A 3G4SV 4QE7A 1OZ0A 2DYRC 1VQ6V 2AHYA 2AHZA 4QNHB 1SETA 4MVUA 3RBZA 2UXNA 4MVRA 4JPRA 1QLEB 1M9NA 3STLC 1KQSU 1GMGA 5LHGA 2EJRA 4RQEA 3AG2B 5DN6G 5KA6A 5BZBA 5LHIA 1K4CC 1V54B 3DGEA 3ABTA 3K03A 2EINC 2DYSC 2JIZG 1VQPV 2IW5A 3B8MA 3WG7C 4BW5A 4OXSA 3RVZA 4U7OA 1AI6A 1H8EG 1JPXA 3ABLB 3ASNB 4PDMA 2HKOA 3FB7C 3FYEB 4GX0A 2ZR3A 2DQ0A 1S0VA 1Q7YW 2WAMA 3ZRSA 1K73W 2JDIG 5CBFA 2DW4A 1IXMA 4ZKIA 2XAGA 3CD6V 2WLKA 1AI5A 4MT8A 1QVFU 4JTDB 3ZN1A 4GX2A 3CCJV 1FFTB 4UV8A 1YIJV 4TSFG 3FB5C 3P32A 4GCZA 3SPGA 3ABKC 2HFEC 3D36A 2HJFC 5B3SC 4WCEV 1GK9A 4WF9V 3CC4V 2V1DA 2P7TC 2H8PC 1BL8A 5KA5A 4UUJC 2DYRB 2XAFA 4UVAA 3CPWU 3JYCA 3K04A 1DTOA 1KP3A 1R3IC 4J9ZB 2IJJA 3T4DA 2H94A 4J9YB 4PA4A 3T4ZA 1NVPD 2Q6AA 1B6QA 1DF4A 3ABUA 3JD0A 2EINB 2DYSB 3E86A 1PNLA 1K5QA 3QNEA 3WG7B 3UKMA 1SESA 1OHHG 4TWKA 1AJNA 2B1GA 4PA7A 2A0LA 4YXWG 1KKDA 3TCUA 3E8GA 1MABG 2EIMC 2ITCC 2QKSA 4G2KA 3AG1C 4JAVA 4WFHA 1YTFB 3OGCC 1F4MA 2M7WA 1VQ5V 2XOKG 3WFVA 3RVYA 1MSWD 5EBWC 1SZTA 1M90W 4MW3A 4P30A 1PNKA 4DO2A 1GKFA 4WFBV 2X6CA 1G8MA 1E79G 3AG3C 2GSMB 1QBZA 5B1NA 1EZJA 2ZDIC 4Q20A 1RPRA 1AR1B 1M1KW 2P67A 1R6NA 2W6IG 2XAQA 3LDEA 4RAIA 2HG5C 4HAMA 3SJQC 1V55C 2JEUA 3ABKB 2EBOA 3K9AA 5B1AC 4PA6A 3SYCA 2OT5A 3W7XA 1K3EA 1GO3F 1S3JA 1SRYA 5B3SB 5L3FA 4JAUA 2EIKC 1M57C 2FTKA 5CA3A 3E8BA 1OCOC 1S76D 1GM9A 1VQKV 5CN0A 3GB7C 1AJQA 3JD3A 5IYCO 1I5YA 2JJ1G 4MVZA 2MK3A 1K97A 3FYIB 4KP4A 3MHHC 1NH2B 3K0GA 3OR7C 1LNQA 2P90A 4G27B 3OUFA 1JX9A 4X8AA 1WPXA 3CMEV 3EHBB 3NXSA 2IH1C 4RO2A 3B8NA 2QEXV 3ZRWB 5CBGA 3G6EV 4MW8A 2EIMB 4UXNA 3OEEG 1VQ4V 2ATKC 3AG1B 5H6QA 3H01A 3SPIA 3K0DA 1H8HG 2W0FC 3AEIA 2Z5UA 1K5SA 2QTOA 4PDLA 4R50A 3I55V 1VQ8V 2ZQMA 1SERA 4WFFA 1TUEB 3AG3B 3CCLV 4G28B 1FXHA 3SYQA 1GM7A 2IH3C 3OR6C 1Y4MA 5FL7G 1OCZC 1VQLV 4CBCA 1V55B 3ABMC 3CC2V 5B1AB 1Q86W 3LUTB 4GT1A 2EIKB 1M57B 2XASA 1OCRC 2IU0A 2HVKC 2WLJA 1OCOB 3F7YC 4KFMA 4H33A 1NR1A 3G71V 2WLNA 1ENVA 3OMNB 3CCUV 1VQMV 1ORQC 1RPOA 1N8RW 2R9RB 1NQTA 4TT3G 2WLIB 4WFAV 4MVMA 4U7NA 4P9OA 2ZXWC 1AI7A 4XDLA 1FXVA 3B77A 3GWOA 3SPHA 3VBBA 1Q82W 3IC7A 3DTUB 3OAAG 5LGNA 2WLLA 1F4NA 3LSQA 2LFRA 2JJ2G 1YHQV 1Q81W 1ROPA 2IJIA 4FMTA 3LSSA 3E8HA 5EK0A 3ZN0A 2DQ3A 3TETA 3ZMSA 1BHBA 1OCZB 4BIUA 1OCCC 1XL4A 2ZD9A 2Q68A 3ABMB 2WLMA 2R9IA 1NVPB 2EIJB 3OEHG 5B1BC 4MTOA 4LBEC 1COWG 1S5HC 1OCRB 1QR9A 2IJKA 1NBMG 2BOBC 4XDKA 3MD0A 4JF3A 3M99B 3SYOA 1UJWB 2WPDG 4FK5C 2QE7G 1S77D 3SPJA 3ZJZA 3JD1A 5LGTA 3CCEV 3ZMTA 5EC1C 1BMFG 2K1EA 5HFLA 2EILC 2ITDC 1R3KC 3CP1A 4I9WA 2ZXWB 4QPJA 2EZPA 4X89A 1M56C 3CCVV 2JEXA 3OMIB 4XDJA 4PELA 4MSWC 2W6JG 1YTFD 1F51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MW8 A;  3RVZ A;  3VOU A;  2ATK C;  4JTA B;  4PDM A;  3SPI A;  3K0D A;  3LNM B;  2W0F C;  3FB7 C;  4GX0 A;  2QTO A;  4PDL A;  4R50 A;  4R8C A;  3F7V C;  4WFE A;  5EC2 C;  3R65 A;  3F5W C;  4WFF A;  3ZRS A;  4G28 B;  4WFG A;  5CBF A;  3SYQ A;  4PDR A;  2WLK A;  2JK5 C;  2IH3 C;  3OR6 C;  4JTD B;  5EBM C;  1OCZ C;  4GX2 A;  5E1A C;  2BOC C;  2Y69 C;  4CBC A;  3ABM C;  3FB5 C;  3IFX A;  3E83 A;  1ZWI C;  3LUT B;  3SPG A;  3X2Q C;  1K4D C;  4EKW A;  4GX1 A;  4MVS A;  3OUS A;  3ABK C;  3ASO C;  4HZ3 A;  4HYO A;  1OCR C;  2HFE C;  2HVK C;  2HJF C;  2WLJ A;  5B3S C;  2P7T C;  2H8P C;  3F7Y C;  1BL8 A;  4H33 A;  4KFM A;  4LP8 A;  4UUJ C;  4ZBM A;  3JYC A;  1JVM A;  2WLN A;  4PDV A;  3K04 A;  5IY5 C;  3LDD A;  3E89 A;  1R3I C;  1ORQ C;  4J9Z B;  2NLJ C;  3T4D A;  4J9Y B;  4PA4 A;  2R9R B;  3T4Z A;  3RW0 A;  3T1C A;  1G4Y B;  2WLL B;  1QLE C;  4PA9 A;  2WLH A;  2Q6A A;  4GX5 A;  2WLI B;  2Q69 A;  4MVQ A;  4MVM A;  4P9O A;  2ZXW C;  3AG2 C;  3E86 A;  3IGA C;  4X88 A;  1P7B A;  3FB6 C;  1V54 C;  4RUF A;  4XDL A;  5EBL C;  4P9P A;  3UKM A;  2EIJ C;  3SPH A;  4MTF A;  2A9H A;  4LCU C;  4R6Z A;  4TWK A;  4PA7 A;  2A0L A;  3KG2 A;  2X6A A;  1KKD A;  3SYA A;  3TCU A;  3E8G A;  2WLL A;  2ITC C;  2EIM C;  5KUM A;  2QKS A;  2WLI A;  3ABL C;  1R3L C;  3AG1 C;  3ASN C;  4WFH A;  2Q67 A;  3OGC C;  4MTG A;  3RVY A;  5EBW C;  2X6B A;  4DXW A;  4QE9 A;  2HVJ C;  4MW3 A;  4P30 A;  3E8H A;  5EK0 A;  3TET A;  2X6C A;  3STZ C;  3AG3 C;  3T2M A;  1OCC C;  1XL4 A;  2ZD9 A;  2Q68 A;  2WLM A;  2KB1 A;  3LDE A;  5B1B C;  4RAI A;  1J95 A;  2HG5 C;  4MTO A;  3SJQ C;  4RUE A;  1V55 C;  3PJS K;  4LBE C;  4F4L A;  4MS2 A;  3SYC A;  5B1A C;  1S5H C;  4PA6 A;  5CBH A;  3FB8 C;  3BEH A;  1XL6 A;  3UM7 A;  3SYP A;  2DWD C;  1M57 C;  2EIK C;  3K06 A;  2BOB C;  4XDK A;  3E8B A;  1OCO C;  3SPC A;  3SYO A;  4QE7 A;  2DYR C;  2OCC C;  3SPJ A;  3ZJZ A;  2AHY A;  2AHZ A;  4H37 A;  4QNH B;  3GB7 C;  3K08 A;  4MVU A;  4JTC B;  3RBZ A;  5EC1 C;  3E8F A;  4MVZ A;  4MVR A;  2K1E A;  2DWE C;  3STL C;  1R3J C;  2EIL C;  2ITD C;  2YEV A;  3LDC A;  1R3K C;  4I9W A;  3HPL C;  3K0G A;  3EFF K;  2A79 B;  3OR7 C;  4R7C A;  5J9P C;  5KUK A;  5BZB A;  1LNQ A;  1K4C C;  3OUF A;  1M56 C;  4G27 B;  4X89 A;  4X8A A;  3K03 A;  2EIN C;  2DYS C;  4P2Z A;  4XDJ A;  2IH1 C;  4RO2 A;  3WG7 C;  3AG4 C;  4MSW C;  4MVO A;  4PA3 A;  4BW5 A;  4OXS A;  5CBG A; 
#chains in the Genus database with same CATH topology
 4J42 A;  4JTA B;  1XNR O;  1US6 A;  2ZE6 A;  4WFE A;  1THZ A;  4FFK A;  4LFB B;  4L87 A;  2P4V A;  2Y48 A;  3HKB B;  2JK5 C;  1K7D A;  3ICX A;  1I08 A;  4DV5 O;  1HR0 O;  3TXQ A;  3X2Q C;  1NS1 A;  1B3Q A;  1H2L A;  3RYI B;  1GN2 A;  5JCO C;  3C3S A;  1HWY A;  2ZCE A;  3TXS A;  4PDV A;  1JR9 A;  1BQ0 A;  4LFB O;  3HKC B;  3ZMU A;  1K33 A;  3ZIA G;  4GLX A;  2EIL B;  3RW0 A;  1XNQ O;  2QWR B;  5JVD A;  3ZRV A;  2RQ6 A;  2UUB O;  2UXB O;  4P9P A;  4LCU C;  2Y0P A;  2VWJ A;  4TV8 A;  5BR8 B;  1Y66 A;  1FS0 G;  5KUM A;  4N23 A;  3M8A A;  2JGD A;  1R3L C;  3RN4 A;  4UCV A;  1NJI W;  4AQY B;  2YXL A;  3STZ C;  4BAY A;  2V7Q G;  3ZMZ A;  2ODM A;  4NTY A;  3X2Q B;  2DJV A;  4DW0 A;  4RUE A;  5LP6 C;  4JI2 O;  2UXC B;  3CRR A;  5BR8 O;  3W7S A;  4FM1 A;  3ML0 A;  1Q90 D;  5EIB C;  3JAS B;  5A2Q N;  3E2E A;  4IYI A;  5DM6 V;  1GM8 A;  2W0X A;  2LP7 A;  2YEV A;  1JQ0 A;  3LDC A;  3EFF K;  2A79 B;  5J9P C;  5L3D A;  4FLZ A;  3SJA C;  1F7Y A;  1J5E B;  3VOU A;  1URF A;  5JVD B;  2UXC O;  4NYK A;  3BCC H;  4JI7 B;  2OTJ V;  3R65 A;  4TV8 B;  5FPR A;  4WFG A;  2QM4 A;  1WLE A;  2JGD B;  5D5P A;  4D7S A;  3CCQ V;  4YJ2 A;  2PI5 A;  2IU3 A;  1DGS A;  3ETD A;  3IFX A;  5LP6 B;  4EKW A;  1K4D C;  1VQ9 V;  2ZNI A;  5H9C A;  3CC7 V;  1J5E O;  1KEC A;  1WB7 A;  1TVK A;  1YIT V;  3N2K B;  4ZBM A;  1PL0 A;  1O9G A;  4N21 A;  1MNG A;  3E89 A;  1YDX A;  2PTM A;  2L6L A;  3HR0 A;  2WLL B;  1QLE C;  4MVQ A;  4O4H B;  1BHA A;  5LBQ A;  4X1K A;  1OV9 A;  4XBF A;  3ZCC A;  5EBL C;  4JAS A;  3S3W A;  2YEV B;  3BAA A;  2VQE O;  1I0H A;  3WB0 A;  3ABL C;  1GN4 A;  2QM8 A;  1DLB A;  1N0N A;  3FAV A;  3D3Q A;  1MZE A;  2GUZ B;  1NKD A;  3JCU Z;  4O2A A;  4DV1 B;  3K5L A;  2WWW A;  4BIO A;  2KB1 A;  4NXM B;  1YJ9 V;  2ADP A;  3PJS K;  3SDL A;  2E5L B;  1VQ7 V;  5EYP A;  3UM7 A;  2FKX A;  1H2G A;  2FL4 A;  2CUG A;  5K1X A;  4QE7 A;  2AHZ A;  4JYY A;  3RBZ A;  2UXN A;  5ITZ A;  4JPR A;  1QLE B;  1M9N A;  1TVK B;  3STL C;  1GMG A;  5DN6 G;  3SR2 C;  1K4C C;  4DV1 O;  3K03 A;  2EIN C;  2DYS C;  4NXM O;  2E76 B;  1VQP V;  5AG2 A;  4OXS A;  4K3A A;  3AK3 A;  4H0L B;  1H8E G;  3ABL B;  3FYE B;  3MAQ A;  2L35 A;  2ZR3 A;  4OGQ B;  2KKW A;  4DRX A;  1K73 W;  4ZKI A;  2XAG A;  4MT8 A;  1QVF U;  1KB9 F;  4O2A B;  3ABK C;  3D36 A;  5LA6 B;  2V1D A;  5KA5 A;  4UUJ C;  2VQF O;  4UVA A;  3CPW U;  3JYC A;  3VQW A;  1YCI A;  5EYP B;  2OYQ A;  4J9Z B;  3T4D A;  3T4Z A;  2YXH A;  3A0B Z;  1G6U A;  4FM0 A;  3TJT A;  2EIN B;  2DYS B;  3E86 A;  2YS8 A;  2IM9 A;  1RFY A;  5ITZ B;  3K5N A;  3N2G A;  4CH3 A;  1OHH G;  3O9O A;  3KKY A;  4PA7 A;  3Q4H A;  3TGU H;  2ITC C;  4WFH A;  2M7W A;  1XDC A;  1VQ5 V;  1ZUQ A;  3A2F A;  1M90 W;  4MW3 A;  4P30 A;  1PNK A;  4DR6 B;  4KHP B;  3KZI Z;  2X6C A;  2QWQ B;  1E79 G;  3AG3 C;  5FLX N;  1EZJ A;  1AR1 B;  2P67 A;  4X20 A;  1V55 C;  3ABK B;  2EBO A;  1WAZ A;  5L3F A;  5EIB D;  4JAU A;  2EIK C;  5CN0 A;  1BCC H;  2AXT Z;  4O2B A;  3H1H H;  2JJ1 G;  4JI4 B;  2MK3 A;  4DR6 O;  4DV2 O;  1JFF A;  3OR7 C;  4CH4 A;  4GYC B;  2P90 A;  4ICG A;  4G27 B;  4X8A A;  5FPO A;  3CME V;  3EHB B;  3NXS A;  4RO2 A;  3L70 H;  4LF6 B;  2QEX V;  3ZRW B;  3CRA A;  1KYO F;  2XT9 A;  3SPI A;  2P22 C;  3B2E E;  1K5S A;  4PDL A;  4JZG A;  1VQ8 V;  3Q4H B;  2DOS A;  3AG3 B;  1AP5 A;  3U11 A;  2QKC A;  4JI4 O;  2IH3 C;  3OR6 C;  1Y4M A;  5FL7 G;  5F2V O;  2A7W A;  1Q3E A;  4CBC A;  1V55 B;  2YIB A;  2VRZ A;  3LUT B;  4GT1 A;  4LF6 O;  3ZHT A;  2EIK B;  2IU0 A;  2HVK C;  4IYH A;  5GTI Z;  4UB6 Z;  1N8R W;  4X62 O;  4LF9 O;  2QWO B;  4IL6 Z;  3K9S A;  2WLI B;  4WFA V;  4U7N A;  2ZXW C;  4K8Z A;  1AI7 A;  3KCY A;  3B77 A;  3IC7 A;  1JFF B;  1IDS A;  4JI1 O;  1F4N A;  5JJJ B;  1XMQ O;  3CRQ A;  4DW1 A;  1YHQ V;  4FMT A;  3LSS A;  4LFA O;  2Q7G A;  3DC6 A;  1L0N H;  3JAK B;  5KLV H;  2ZD9 A;  2Q68 A;  4B3T B;  2QGN A;  2WLM A;  2R9I A;  3RYH A;  3SJC C;  3QVN A;  4QGP A;  1QR9 A;  1H2S B;  3K59 A;  4JF3 A;  4NB5 A;  1NU1 H;  3ZMT A;  1IX9 A;  5IJ9 B;  5J2T A;  2K1E A;  1MSD A;  3L71 H;  3CP1 A;  2ZXW B;  5C8Y A;  4X1I A;  4B3T O;  4FVM A;  1XHZ A;  3OTO O;  1H2K A;  1GN3 A;  4F6R A;  1G1X B;  1HDJ A;  3UT5 B;  3ZED A;  1WA8 B;  1R6T A;  2GHY A;  1CP9 A;  1FYJ A;  1PPJ H;  1K8A W;  1KKC A;  2RNB A;  2F43 G;  4B7K A;  2UXD B;  1M93 A;  2X7R B;  3DXR A;  4NTW A;  1FFX A;  2AGA A;  2LFS A;  5L3E A;  4RWU A;  2EZO A;  2QM7 A;  3E83 A;  2D3O W;  3B40 A;  5H6R A;  1W0K G;  1IZ3 A;  4A5U B;  2KSD A;  1P7G A;  3T1H B;  1TAE A;  1PV0 A;  4K0K B;  3RYH B;  1XEQ A;  3OFN G;  5LGU A;  1VF5 B;  5IY5 C;  4LF5 B;  3CRC A;  5CB4 A;  3ETG A;  2NLJ C;  3SJB C;  4LF4 O;  3JCZ A;  4PA9 A;  1ARO P;  1I94 B;  3TK1 A;  2Q69 A;  4LF7 O;  1NT2 B;  1P7B A;  3CRM A;  4I7Z B;  1YI2 V;  2JRI A;  2HJD A;  4NKG B;  5C8Y B;  3CMA V;  2VS0 A;  4X1I B;  3T1H O;  4K0K O;  4BIZ A;  5IYB O;  3H9V A;  2Q67 A;  1MG1 A;  4O4I A;  2B1I A;  3WB2 A;  1FXK A;  3E22 A;  2YID A;  2HVJ C;  1IBL B;  4TQD A;  5EZY A;  1P4R A;  1I5X A;  4QJF B;  1HNW B;  1FXK C;  4YJ3 A;  1Q6H A;  2XND G;  4UCT A;  4MTX A;  3FB8 C;  3W7U A;  1S5J A;  4UFZ A;  3SYP A;  3JAL A;  4GKK B;  3DXR B;  4LWS B;  1QR8 A;  2GTS A;  3JAW A;  1FFX B;  2NNU A;  1NTZ H;  4YIO A;  5IY5 B;  2MW2 B;  5D5Q A;  4JTC B;  2CH7 A;  2OTL V;  4R7C A;  5KUK A;  1EM1 A;  5CB4 B;  1HNW O;  3APO A;  4PA3 A;  4BR6 A;  1IBK B;  4BW9 A;  2RJZ A;  1D5N A;  5JJE B;  5EC2 C;  3F5W C;  1PD3 A;  1Z5W A;  1Y76 B;  4EB6 A;  4PDR A;  1DF5 A;  5E79 Z;  2O57 A;  4TV9 A;  4X66 B;  4O4I B;  2QR4 A;  1FXK B;  3E22 B;  4RQF A;  1QLN A;  1AJP A;  3OGI B;  2CTP A;  4CH6 A;  2QA4 V;  4HYO A;  3CHX A;  1AI4 A;  1Q6U A;  2CTR A;  2ZDI A;  1IBK O;  4JYC A;  2G38 A;  2BTQ A;  5KHI A;  3U0Z A;  4HNA A;  1TUB A;  2JS3 A;  3JAW B;  1G4Y B;  1X4T A;  2WLH A;  5B1O A;  3HKD A;  1K9M W;  3AG2 C;  3IGA C;  2BE3 A;  3ZRX A;  3H1I H;  5LMU O;  3SGI A;  3AK2 A;  3KG2 A;  2IJH A;  3MHS C;  4UVC A;  1OJH A;  3LSU A;  5IWA B;  4MTG A;  4H13 B;  1GTO A;  3I56 V;  3H1J H;  4YY3 B;  4FLV A;  3CCS V;  1HP8 A;  2CTW A;  5L3B A;  4LC1 A;  2RMK B;  4BWA A;  4EB6 B;  1N34 B;  4HBN A;  1PP9 H;  1VMG A;  4TV9 B;  5CMU A;  3K5M A;  3G4S V;  4DR4 B;  2AHY A;  4QNH B;  3U10 A;  1SET A;  4MVR A;  2Q5Z A;  4I4T A;  4YY3 O;  5BMV A;  5LHG A;  2EJR A;  3AG2 B;  2BTQ B;  3DGE A;  4HNA B;  2IW5 A;  3WG7 C;  4BW5 A;  1N34 O;  3HKD B;  2ZT9 B;  1AI6 A;  4PI2 A;  1ZL8 A;  2HKO A;  3NR7 A;  4DR4 O;  2DQ0 A;  4AQY O;  1KBH A;  2JDI G;  5B66 Z;  2WLK A;  3P3P A;  4JTD B;  3CCJ V;  4UB8 Z;  1FFT B;  4UV8 A;  4TSF G;  1CXZ B;  4EFB A;  1AVM A;  4WF9 V;  1GK9 A;  2GBO A;  5KHH A;  4OPA A;  2R70 A;  2CAZ C;  3K04 A;  5CA1 A;  5GON A;  1SQX H;  2Q6A A;  1B6Q A;  3H1K H;  3M7M X;  4JYA B;  3WG7 B;  3CJH A;  4H44 B;  4I4T B;  1T5E A;  5BMV B;  1SQG A;  4LR3 A;  1BQZ A;  4G2K A;  4JAV A;  1YTF B;  3C3T A;  4JI7 O;  3RVY A;  4Q6G A;  3D8C A;  2Q7H A;  2GSM B;  2ZE5 A;  1QBZ A;  4Q20 A;  5JH7 A;  3RYF A;  2W6I G;  3LDE A;  4JI6 B;  4Z2W A;  3RFR A;  1N32 B;  5B1A C;  2OT5 A;  1S3J A;  2ZKO A;  1IBM B;  3E8B A;  1OCO C;  4PI0 A;  1N33 B;  1UFI A;  4X1Y A;  3T1Y B;  4L8J A;  5IYZ A;  1SQB H;  2YC0 A;  4MVZ A;  4LF8 B;  1XQ8 A;  1NH2 B;  3K0G A;  1SZX A;  2YIA A;  4ABM A;  2LJ2 A;  1WNS A;  4JI6 O;  5GON B;  1V9P A;  1N32 O;  3B8N A;  5CBG A;  3G6E V;  2UUA B;  4YJ2 B;  3J80 N;  2W0F C;  2Z5U A;  2Q0A A;  2QTO A;  3CJH B;  3T1Y O;  1SA0 A;  2UUC B;  1FXH A;  1XIL A;  4LF8 O;  5LXT A;  1GM7 A;  5IJ0 A;  2A3Q A;  5B1A B;  3K5O A;  2F23 A;  5CA0 A;  1Q86 W;  2E5L O;  1OCR C;  1OCO B;  4W4L A;  3RYF B;  4X1K B;  4CS4 A;  1ORQ C;  1RPO A;  4PJ0 Z;  4TT3 G;  3RT3 C;  4X1Y B;  1A32 A;  3BA8 A;  3ZHQ A;  4FLU A;  3FAV B;  4XDL A;  2N05 A;  1KMI Z;  3VBB A;  5JWP A;  1XMO B;  4D7T A;  2IBZ H;  5TIS Z;  1SC5 B;  2QWN B;  3LSQ A;  3KCX A;  1Q81 W;  1Z2G A;  2IJI A;  3JSL A;  3E8H A;  3TET A;  3ZMS A;  3DSQ A;  3D36 C;  4U3J A;  2Q0O C;  1NVP B;  2EIJ B;  1MMM A;  5BY1 A;  4FZ1 A;  1HW7 A;  1OCR B;  2E74 B;  1XMO O;  2YUA A;  2BOB C;  2ZIM A;  1PM9 A;  2GTA A;  4FK5 C;  1S77 D;  3SPJ A;  3ZJZ A;  5CA0 B;  3JD1 A;  3CCE V;  1BMF G;  5HFL A;  1R3K C;  2R72 A;  4QPJ A;  4FLX A;  1M56 C;  2PUS A;  2RDC A;  4XDJ A;  4DRX B;  2W6J G;  4PHZ A;  1YTF D;  1FPO A;  3EXA A;  3CCM V;  1L1F A;  2CK3 G;  2FML A;  3QO8 A;  1KD1 W;  4DK0 A;  4FPP A;  1XRE A;  3A0R A;  4KHP O;  1W2B U;  1U96 A;  2JS5 A;  4B3M B;  5E1A C;  1MOF A;  4KL1 A;  1YEW A;  1PKX A;  3OUS A;  4U3J B;  2B9Z A;  2FYU H;  1F23 A;  2DMX A;  4LP8 A;  2ZNJ A;  3CSX A;  2XTA A;  4UV9 A;  3WU2 Z;  1S72 V;  3N2G B;  4CC6 A;  1NH2 D;  1Q8I A;  2E3C A;  4J11 A;  1SQF A;  1M56 B;  5KMG A;  4FLY A;  1R6K A;  1UPG A;  3D3I A;  1Y74 A;  2LGW A;  3OE7 G;  4ZHQ A;  5LHH A;  1R1B A;  1EBO A;  1JOY A;  4X20 B;  2P5O A;  5A9G A;  2X6B A;  2P6J A;  4OPH A;  4DR3 B;  1S5L Z;  1KC8 W;  1BT8 A;  1VP7 A;  5KHK A;  2KQX A;  1J95 A;  3FFQ A;  4O2B B;  4IGG A;  2F95 B;  1SQP H;  1LUW A;  1XHX A;  1Q6I A;  4UCO A;  1M4U A;  1K34 A;  1NR7 A;  2DWD C;  3E35 A;  2ETN A;  3LNN A;  3SPC A;  2PF4 E;  2BTO A;  5GW7 A;  2OCC C;  3L74 H;  4H37 A;  1N36 B;  2ARH A;  3BY6 A;  1R3J C;  4I5S A;  1JJ2 U;  1L0L H;  3HPL C;  1WJZ A;  3BAB A;  1KU9 A;  3R66 A;  3UO3 A;  4DV6 B;  2ZIO A;  4I55 A;  3J81 N;  3AG4 C;  2XAH A;  1VEW A;  3ETQ A;  4JI5 B;  1YSC A;  5KMG B;  3CWB H;  5IYD O;  4KUM A;  1K92 A;  2E75 B;  2OCH A;  4J41 A;  4ASU G;  4DV4 B;  4R8C A;  1QQC A;  1HNX B;  1Y74 B;  1N36 O;  4ZHQ B;  2HR3 A;  3W7T A;  5DED A;  3AG7 A;  1VQO V;  5LMN B;  5EBM C;  2PZS A;  5KX5 A;  3UQ8 A;  2Y69 C;  1VQN V;  2RN9 A;  1ZLZ A;  1BSM A;  4HZ3 A;  1GH6 A;  4EEQ A;  2V4D A;  5BXZ A;  2OCC B;  1QCE A;  1ZAU A;  4JI0 B;  3B09 A;  1JVM A;  3F5T A;  1NTK H;  2ZM6 B;  4DV4 O;  2PYL A;  1HNX O;  3T1C A;  3A8T A;  5LMN O;  2FB5 A;  1IXB A;  5FNV A;  1V54 C;  3K3W A;  4J7K A;  3AG4 B;  5LYJ A;  2A9H A;  4NVP A;  2X6A A;  3SYA A;  4LH6 A;  2ZIN A;  1E1R G;  2C2A A;  3BVO A;  5L3C A;  4CS2 A;  3ETE A;  3PN1 A;  4B3R B;  1ZX3 A;  3CCR V;  2ZM6 O;  2DE0 X;  3CXC U;  4TUY A;  2UXD O;  1XI1 A;  1NZ6 A;  2Y69 B;  3QO7 A;  1KP2 A;  3W7W A;  5J2T B;  1Q5O A;  4JGS A;  2YIC A;  4YHH B;  5KHG A;  2AW9 A;  5KX5 B;  3VQV A;  1OZ0 A;  2DYR C;  1VQ6 V;  4GKJ B;  2LGQ A;  4B3R O;  4LF5 O;  4F6R B;  2BCC H;  3DC5 A;  1KQS U;  4RQE A;  5B5E Z;  4DR2 B;  5KA6 A;  1I94 O;  1V54 B;  3ABT A;  4DV0 B;  1XOU A;  2JIZ G;  2AZ0 A;  3RVZ A;  1JPX A;  4YHH O;  5FNV B;  1LUV A;  4K35 A;  3FB7 C;  4GX0 A;  2XHB A;  4DR1 B;  1S0V A;  1Q7Y W;  3CS5 A;  4ZOL A;  3ZRS A;  2DW4 A;  3CD6 V;  1IBL O;  1SQV H;  3ZN1 A;  4GX2 A;  4AHC A;  1YIJ V;  2YI9 A;  3P32 A;  3SPG A;  3CE2 A;  2HFE C;  4WCE V;  2HJF C;  3HKB A;  1SKV A;  4PD4 F;  5B3S C;  1DK1 A;  4GKK O;  2P7T C;  2DYR B;  2XAF A;  2YDE A;  1VF6 A;  3B4S A;  1DTO A;  1KP3 A;  4DR1 O;  2Q9L A;  2H94 A;  1DF4 A;  3ABU A;  1HNZ B;  3JD0 A;  4X64 B;  4O4L A;  1PNL A;  2LW7 A;  3QNE A;  4WBN A;  2EJ7 A;  2PY5 A;  1MA1 A;  2A0L A;  3IJ4 A;  1WPB A;  2YIB D;  5EZY B;  4YXW G;  3WB1 A;  1KKD A;  3E8G A;  2QKS A;  3AG1 C;  4YJ3 B;  3OGC C;  1ZTE A;  2XOK G;  3WFV A;  1MSW D;  2QSA A;  4DO2 A;  4FFB A;  1GKF A;  3JAL B;  2CTQ A;  1H2M A;  2ZDI C;  5DEC A;  1HNZ O;  3BFR A;  4X64 O;  4X66 O;  3ZHS A;  1QHT A;  4RAI A;  4AI8 A;  3SJQ C;  4KXR A;  2CH7 B;  3K9A A;  4PA6 A;  3JAT A;  4CS3 A;  5B3S B;  4DR7 B;  2FTK A;  5CA3 A;  2Y0I A;  1XBL A;  1S76 D;  2QJ1 A;  1GM9 A;  4UCU A;  1VQK V;  3JD3 A;  1AJQ A;  3OT7 A;  4FLW A;  1XNQ B;  1I5Y A;  5JJN B;  3L9D A;  4I9Q A;  3RYC A;  3JAM N;  3MHH C;  5JCO A;  4DK1 A;  3OUF A;  1JX9 A;  1WPX A;  2UUB B;  2UXB B;  2HEP A;  3JAS A;  1XUQ A;  4MW8 A;  3OEE G;  1VQ4 V;  3AG1 B;  5H6Q A;  4DR7 O;  4X65 B;  4O4L B;  3RWR D;  3AEI A;  4WBN B;  4R50 A;  4JI8 B;  5IWA O;  3I55 V;  2ZQM A;  1EZV H;  1TUE B;  3SYQ A;  1B04 A;  1AP6 A;  3ZBH A;  4B3S B;  3IAY A;  2LO1 A;  2HHH B;  3ABM C;  1TUB B;  4FFB B;  4J7J A;  4JI2 B;  3OD4 A;  2XAS A;  2WLJ A;  4H33 A;  4X65 O;  4J7Z A;  3G71 V;  2WLN A;  3QF7 A;  1ENV A;  3OMN B;  4JI8 O;  3JAT B;  1VQM V;  1MZF A;  5LP6 A;  1NQT A;  4DR5 B;  5LL6 Y;  2DN9 A;  3N27 A;  2Q4P A;  3N2K A;  4MVM A;  4UCS A;  4B3S O;  1BGY H;  2HHH O;  3P3N A;  1H2N A;  1LR1 A;  3GWO A;  3RYC B;  3DTU B;  3JAR A;  2Q8V A;  3OAA G;  5LGN A;  2WLL A;  2CGO A;  1SS3 A;  4O4H A;  1YXB A;  1OCC C;  4DR5 O;  2QWP B;  2EX3 A;  1I7F A;  3ABM B;  5B1B C;  4IT5 A;  4PV1 B;  1FKA O;  2P4K A;  2GUZ A;  2IJK A;  1B06 A;  4E4E A;  2BSK A;  4XDK A;  3MD0 A;  3M99 B;  3SYO A;  1Z5V A;  2WPD G;  4DV7 B;  2QTS A;  5LGT A;  2EUL A;  5EC1 C;  1AR5 A;  1BZK A;  2ITD C;  4I9W A;  4NTX A;  1ZL8 B;  4X89 A;  2LW1 A;  3CCV V;  1BE3 H;  1Y6X A;  4JYA O;  2VQE B;  3APQ A;  2F1M A;  1JCH A;  1W59 A;  1U97 A;  1EN4 A;  1GAX A;  1ZSP A;  2F93 B;  2WA4 A;  3LNM B;  2PGG A;  4DV7 O;  2UU9 B;  4J10 A;  3JAR B;  1OCC B;  1P49 A;  2HLD G;  4QIW F;  5B1B B;  2BOC C;  2M6Y A;  5CA1 B;  1H38 A;  3GWK C;  1ZWI C;  2RCV A;  4ZIB A;  5IT9 N;  4GX1 A;  4B08 A;  3ASO C;  1EFR G;  2OIE A;  5GTH Z;  1IBM O;  3ZS8 C;  1W0J G;  3UCS C;  1N33 O;  2WSS G;  4E2L A;  3LDD A;  2UU9 O;  2BSK B;  3AK1 A;  4FIP C;  1YZB A;  2D2C B;  5LA6 A;  3OW2 U;  5K1P A;  2YSU B;  4I0X A;  4X88 A;  2A06 H;  4FM2 A;  4RUF A;  1CEZ A;  5H5N A;  1QVG U;  2EIJ C;  4MTF A;  1L8D A;  3UO2 A;  3FKS G;  5JH7 B;  4YIP A;  1JJO A;  2UUA O;  4K8X A;  3BPZ A;  1PNM A;  3ZMV A;  3G6B A;  3K79 A;  1AIL A;  3S3X A;  2UUC O;  2R9A A;  3QO5 A;  5IYZ B;  2VWK A;  3A0H Z;  3ASO B;  4O4J A;  3K06 A;  2VQF B;  2XUM A;  1N4C A;  3BRC A;  1Q43 A;  3K08 A;  1M5I A;  3E8F A;  3JD4 A;  2DWE C;  4D6T H;  3JD2 A;  4LFC B;  2XAJ A;  4TOI A;  4TQF A;  3OTF A;  1RSO A;  4P2Z A;  3HB3 B;  5C93 A;  1SA0 B;  4MVO A;  3ZHV A;  4UVB A;  5LXT B;  4I0X B;  2P06 A;  1YJN V;  5IJ0 B;  2Z3Y A;  3ZX6 A;  4JYB A;  1IUR A;  1VF7 A;  1RP3 B;  4JI3 B;  4DYL A;  4CC5 A;  1X59 A;  2ZR2 A;  3F7V C;  3GVM A;  1SQQ H;  2B5U A;  3CXH F;  4ZI7 A;  3ZRW A;  1E1Q G;  4QPK A;  3HKE A;  4UCR A;  5KAI Z;  4LFC O;  2X0L A;  1JMK C;  3L75 H;  4DUY B;  4MVS A;  1RM1 C;  4FJC C;  4W4K A;  4Z1V A;  2PI4 A;  4CZZ A;  4JI3 O;  3EVK A;  5L3G A;  3ZHR A;  4O4J B;  4DV2 B;  2CE4 A;  4GX5 A;  3THO A;  5JQG A;  4FZ0 A;  3VQX A;  4JZ2 A;  3FB6 C;  4LNU A;  1WN7 A;  4DUY O;  5IE9 A;  2Z0A A;  4R6Z A;  3RGB A;  1FD9 A;  3OM3 B;  2WLI A;  1RSO B;  3ASN C;  1N0J A;  3FD9 A;  4AIL C;  1P84 F;  5H2F Z;  4DXW A;  3FX7 A;  4QE9 A;  1YJW V;  3IC9 A;  3G80 A;  3T2M A;  4Z1M G;  5IDJ A;  4B3M O;  2UXX A;  2N04 A;  5HFM A;  4F4L A;  1RM1 B;  2JVD A;  4MS2 A;  4ZI7 B;  3CYO A;  5CBH A;  3BEH A;  3HKE B;  3OMA B;  1XL6 A;  1R73 A;  1CPY A;  3P30 A;  3G67 A;  3JAK A;  3VQY A;  2NN4 A;  4X62 B;  4MVU A;  4JV5 B;  4LF9 B;  4DV3 B;  2CGN A;  4OX9 B;  5BZB A;  5LHI A;  4IIJ A;  3B8M A;  3I5D A;  4JI1 B;  5IJ9 A;  2QKA A;  5JQG B;  3CEI A;  1XMQ B;  4U7O A;  3ASN B;  4PDM A;  4LNU B;  4DUZ B;  4NXN B;  4LFA B;  4IHJ A;  2WAM A;  4JV5 O;  5CBF A;  4DV3 O;  1IXM A;  1AI5 A;  3UT5 A;  4I50 A;  4DR3 O;  1WA8 A;  4OX9 O;  2Y4U A;  3FB5 C;  3CB2 A;  4GCZ A;  1IVS A;  3CC4 V;  3K57 A;  1YVW A;  2H8P C;  1BL8 A;  4DUZ O;  4NXN O;  1R3I C;  2IJJ A;  4J9Y B;  4PA4 A;  1NVP D;  4F6E A;  2CDY A;  3OTO B;  1K5Q A;  1EN6 A;  3QG5 A;  1FAF A;  2Y4T A;  3UKM A;  4DV6 O;  1SES A;  1AR4 A;  2N74 A;  4TWK A;  1AJN A;  2B1G A;  1D5A A;  3TCU A;  2K9P A;  2AZ2 A;  1MAB G;  2EIM C;  4JI5 O;  1F4M A;  4IIJ B;  5EBW C;  1SZT A;  4GUN A;  2F4V B;  3J7A U;  2LQT A;  4WFB V;  1G8M A;  5B1N A;  2JGU A;  1WB8 A;  1RPR A;  2ILM A;  1M1K W;  4IHJ B;  1KUQ A;  1R6N A;  2XAQ A;  2HG5 C;  4HAM A;  2JEU A;  3W7X A;  3SYC A;  4FLT A;  1GO3 F;  1K3E A;  1SRY A;  1GN6 A;  4I50 B;  1M57 C;  2QDO A;  4GZR B;  2NR5 A;  1WP7 A;  5KAF Z;  1WP8 A;  4I55 B;  3BA9 A;  3GB7 C;  4JI0 O;  5IYC O;  1TGO A;  4LF4 B;  1FJG B;  3L72 H;  2GV9 A;  2F4V O;  4LF7 B;  1K97 A;  3FYI B;  4KP4 A;  4LWS A;  1PL4 A;  1LNQ A;  2KG7 A;  2WA3 A;  5J2U A;  4U3F H;  2IH1 C;  2PYJ A;  1QNM A;  4CH5 A;  1D2D A;  2EIM B;  4UXN A;  3MDS A;  2ATK C;  3H01 A;  3K0D A;  1H8H G;  1SER A;  4WFF A;  1FJG O;  2ZE7 A;  3CCL V;  4G28 B;  3ZHU A;  3BHP A;  1OCZ C;  1VQL V;  3CC2 V;  1GRJ A;  4JAA A;  3QTC A;  3C90 A;  4LH7 A;  1M57 B;  1Y76 A;  3O65 A;  1VAR A;  2H3O A;  1YF2 A;  5LOV A;  3F7Y C;  4KFM A;  1NR1 A;  5LYJ B;  5KHJ A;  3CCU V;  4GKJ O;  2R9R B;  2OIG A;  2YXY A;  4P9O A;  1Y67 A;  4DR2 O;  1FXV A;  3SPH A;  4DV0 O;  1Q82 W;  4TUY B;  1EN5 A;  4B7E A;  3L73 H;  2KG7 B;  4J80 A;  4NR1 A;  4C7U A;  5J2U B;  2LFR A;  1NTM H;  2JJ2 G;  1ROP A;  5EK0 A;  3ZN0 A;  1SF9 A;  2DQ3 A;  1BHB A;  3RYI A;  1OCZ B;  4BIU A;  1XL4 A;  3OEH G;  1VF6 C;  4MTO A;  4LBE C;  1S5H C;  1COW G;  1TA8 A;  3HKC A;  2HP8 A;  1JA8 A;  1NBM G;  1QU7 A;  1XNR B;  1UJW B;  2QE7 G;  2YI8 A;  2ZE8 A;  2ADQ B;  2OWO A;  3CX5 F;  5LOV B;  2EIL C;  2GDS A;  3JSN A;  3K58 A;  1O9H A;  1NI8 A;  2F66 C;  2Q7E A;  2EZP A;  4X9Q A;  4DV5 B;  1HR0 B;  1AB3 A;  2JEX A;  5LMU B;  3H1L H;  3OMI B;  2Q73 A;  4PEL A;  4ZOL B;  4EFE A;  4MSW C;  1BS3 A;  1F51 A;  1VIB A; 
#chains in the Genus database with same CATH homology
 1JCH A;  4JTA B;  2GHY A;  1CP9 A;  3LNM B;  3CCM V;  1L1F A;  2CK3 G;  4WFE A;  1K8A W;  1THZ A;  3QO8 A;  1KD1 W;  2F43 G;  4FPP A;  4L87 A;  2Y48 A;  1OCC B;  3A0R A;  2X7R B;  2JK5 C;  1W2B U;  2HLD G;  1K7D A;  4QIW F;  5E1A C;  1MOF A;  5B1B B;  2BOC C;  2LFS A;  5L3E A;  2EZO A;  1H38 A;  2QM7 A;  3E83 A;  2D3O W;  1ZWI C;  3X2Q C;  5H6R A;  1W0K G;  1PKX A;  4GX1 A;  3OUS A;  3ASO C;  1EFR G;  1F23 A;  4LP8 A;  4UV9 A;  1HWY A;  1W0J G;  1S72 V;  3OFN G;  5LGU A;  2WSS G;  4PDV A;  4E2L A;  5IY5 C;  3LDD A;  1NH2 D;  3ETG A;  2NLJ C;  3ZMU A;  1K33 A;  4FIP C;  3ZIA G;  2EIL B;  3RW0 A;  3JCZ A;  4PA9 A;  1ARO P;  3TK1 A;  2Q69 A;  3OW2 U;  2YSU B;  1M56 B;  4X88 A;  3ZRV A;  1P7B A;  1YI2 V;  4RUF A;  1R6K A;  1CEZ A;  4P9P A;  3D3I A;  2EIJ C;  1QVG U;  4MTF A;  4LCU C;  3OE7 G;  5LHH A;  3CMA V;  3FKS G;  1Y66 A;  1FS0 G;  5KUM A;  4N23 A;  1EBO A;  4BIZ A;  1JOY A;  1R3L C;  5IYB O;  2Q67 A;  1MG1 A;  2B1I A;  1FXK A;  1NJI W;  2X6B A;  2P6J A;  1PNM A;  2HVJ C;  3ZMV A;  3STZ C;  3K79 A;  1KC8 W;  4BAY A;  3QO5 A;  1P4R A;  1I5X A;  4QJF B;  1FXK C;  2V7Q G;  3ZMZ A;  2XND G;  1J95 A;  3X2Q B;  4MTX A;  4RUE A;  3ASO B;  3FB8 C;  3W7U A;  3SYP A;  1K34 A;  1NR7 A;  1QR8 A;  2DWD C;  3E35 A;  3K06 A;  3W7S A;  3SPC A;  5GW7 A;  3ML0 A;  2NNU A;  5IY5 B;  2OCC C;  4H37 A;  3K08 A;  4JTC B;  3E2E A;  3E8F A;  3JD4 A;  5DM6 V;  2OTL V;  1GM8 A;  2DWE C;  3BY6 A;  1R3J C;  2LP7 A;  2YEV A;  3JD2 A;  1JQ0 A;  3LDC A;  4I5S A;  1JJ2 U;  3HPL C;  3EFF K;  2A79 B;  4R7C A;  5J9P C;  5KUK A;  2XAJ A;  5L3D A;  4P2Z A;  3HB3 B;  5C93 A;  3AG4 C;  2XAH A;  4MVO A;  4PA3 A;  4UVB A;  3VOU A;  1YJN V;  2Z3Y A;  1YSC A;  4JYB A;  5IYD O;  2OTJ V;  4KUM A;  1K92 A;  4ASU G;  4R8C A;  2ZR2 A;  3F7V C;  5EC2 C;  3R65 A;  3F5W C;  1PD3 A;  2B5U A;  4WFG A;  2HR3 A;  3W7T A;  4PDR A;  3ZRW A;  1E1Q G;  1DF5 A;  4QPK A;  1WLE A;  1VQO V;  2X0L A;  5EBM C;  1FXK B;  3CCQ V;  2PI5 A;  4RQF A;  1QLN A;  2IU3 A;  2Y69 C;  1AJP A;  1VQN V;  3ETD A;  3IFX A;  4EKW A;  1K4D C;  1VQ9 V;  4MVS A;  1RM1 C;  4HZ3 A;  2QA4 V;  5H9C A;  4HYO A;  4FJC C;  3CC7 V;  1KEC A;  1AI4 A;  1YIT V;  2ZDI A;  4ZBM A;  2PI4 A;  1PL0 A;  4N21 A;  2OCC B;  1QCE A;  4CZZ A;  1JVM A;  4JYC A;  5L3G A;  3E89 A;  3T1C A;  1G4Y B;  2WLL B;  1QLE C;  2WLH A;  4GX5 A;  5B1O A;  4MVQ A;  1BHA A;  1K9M W;  3AG2 C;  3IGA C;  5LBQ A;  3FB6 C;  1V54 C;  3K3W A;  4XBF A;  3AG4 B;  5EBL C;  3ZCC A;  3ZRX A;  4JAS A;  2A9H A;  2YEV B;  4R6Z A;  3KG2 A;  2IJH A;  2X6A A;  3SYA A;  3MHS C;  3OM3 B;  4UVC A;  1E1R G;  2WLI A;  2C2A A;  3ABL C;  2QM8 A;  3ASN C;  5L3C A;  3ETE A;  4MTG A;  1DLB A;  1GTO A;  3CCR V;  4DXW A;  4QE9 A;  3I56 V;  1YJW V;  1NKD A;  3CXC U;  3CCS V;  3T2M A;  4Z1M G;  5IDJ A;  5L3B A;  4LC1 A;  2Y69 B;  2WWW A;  3QO7 A;  2UXX A;  5HFM A;  2KB1 A;  1YJ9 V;  1KP2 A;  4F4L A;  3PJS K;  1RM1 B;  3W7W A;  4MS2 A;  3CYO A;  5CBH A;  3BEH A;  1VQ7 V;  3OMA B;  1XL6 A;  4JGS A;  3UM7 A;  1CPY A;  1R73 A;  5CMU A;  1H2G A;  3P30 A;  3G4S V;  4QE7 A;  1OZ0 A;  2DYR C;  1VQ6 V;  2AHY A;  2AHZ A;  4QNH B;  1SET A;  4MVU A;  3RBZ A;  2UXN A;  4MVR A;  4JPR A;  1QLE B;  1M9N A;  3STL C;  1KQS U;  1GMG A;  5LHG A;  2EJR A;  4RQE A;  3AG2 B;  5DN6 G;  5KA6 A;  5BZB A;  5LHI A;  1K4C C;  1V54 B;  3DGE A;  3ABT A;  3K03 A;  2EIN C;  2DYS C;  2JIZ G;  1VQP V;  2IW5 A;  3B8M A;  3WG7 C;  4BW5 A;  4OXS A;  3RVZ A;  4U7O A;  1AI6 A;  1H8E G;  1JPX A;  3ABL B;  3ASN B;  4PDM A;  2HKO A;  3FB7 C;  3FYE B;  4GX0 A;  2ZR3 A;  2DQ0 A;  1S0V A;  1Q7Y W;  2WAM A;  3ZRS A;  1K73 W;  2JDI G;  5CBF A;  2DW4 A;  1IXM A;  4ZKI A;  2XAG A;  3CD6 V;  2WLK A;  1AI5 A;  4MT8 A;  1QVF U;  4JTD B;  3ZN1 A;  4GX2 A;  3CCJ V;  1FFT B;  4UV8 A;  1YIJ V;  4TSF G;  3FB5 C;  3P32 A;  4GCZ A;  3SPG A;  3ABK C;  2HFE C;  3D36 A;  2HJF C;  5B3S C;  4WCE V;  1GK9 A;  4WF9 V;  3CC4 V;  2V1D A;  2P7T C;  2H8P C;  1BL8 A;  5KA5 A;  4UUJ C;  2DYR B;  2XAF A;  4UVA A;  3CPW U;  3JYC A;  3K04 A;  1DTO A;  1KP3 A;  1R3I C;  4J9Z B;  2IJJ A;  3T4D A;  2H94 A;  4J9Y B;  4PA4 A;  3T4Z A;  1NVP D;  2Q6A A;  1B6Q A;  1DF4 A;  3ABU A;  3JD0 A;  2EIN B;  2DYS B;  3E86 A;  1PNL A;  1K5Q A;  3QNE A;  3WG7 B;  3UKM A;  1SES A;  1OHH G;  4TWK A;  1AJN A;  2B1G A;  4PA7 A;  2A0L A;  4YXW G;  1KKD A;  3TCU A;  3E8G A;  1MAB G;  2EIM C;  2ITC C;  2QKS A;  4G2K A;  3AG1 C;  4JAV A;  4WFH A;  1YTF B;  3OGC C;  1F4M A;  2M7W A;  1VQ5 V;  2XOK G;  3WFV A;  3RVY A;  1MSW D;  5EBW C;  1SZT A;  1M90 W;  4MW3 A;  4P30 A;  1PNK A;  4DO2 A;  1GKF A;  4WFB V;  2X6C A;  1G8M A;  1E79 G;  3AG3 C;  2GSM B;  1QBZ A;  5B1N A;  1EZJ A;  2ZDI C;  4Q20 A;  1RPR A;  1AR1 B;  1M1K W;  2P67 A;  1R6N A;  2W6I G;  2XAQ A;  3LDE A;  4RAI A;  2HG5 C;  4HAM A;  3SJQ C;  1V55 C;  2JEU A;  3ABK B;  2EBO A;  3K9A A;  5B1A C;  4PA6 A;  3SYC A;  2OT5 A;  3W7X A;  1K3E A;  1GO3 F;  1S3J A;  1SRY A;  5B3S B;  5L3F A;  4JAU A;  2EIK C;  1M57 C;  2FTK A;  5CA3 A;  3E8B A;  1OCO C;  1S76 D;  1GM9 A;  1VQK V;  5CN0 A;  3GB7 C;  1AJQ A;  3JD3 A;  5IYC O;  1I5Y A;  2JJ1 G;  4MVZ A;  2MK3 A;  1K97 A;  3FYI B;  4KP4 A;  3MHH C;  1NH2 B;  3K0G A;  3OR7 C;  1LNQ A;  2P90 A;  4G27 B;  3OUF A;  1JX9 A;  4X8A A;  1WPX A;  3CME V;  3EHB B;  3NXS A;  2IH1 C;  4RO2 A;  3B8N A;  2QEX V;  3ZRW B;  5CBG A;  3G6E V;  4MW8 A;  2EIM B;  4UXN A;  3OEE G;  1VQ4 V;  2ATK C;  3AG1 B;  5H6Q A;  3H01 A;  3SPI A;  3K0D A;  1H8H G;  2W0F C;  3AEI A;  2Z5U A;  1K5S A;  2QTO A;  4PDL A;  4R50 A;  3I55 V;  1VQ8 V;  2ZQM A;  1SER A;  4WFF A;  1TUE B;  3AG3 B;  3CCL V;  4G28 B;  1FXH A;  3SYQ A;  1GM7 A;  2IH3 C;  3OR6 C;  1Y4M A;  5FL7 G;  1OCZ C;  1VQL V;  4CBC A;  1V55 B;  3ABM C;  3CC2 V;  5B1A B;  1Q86 W;  3LUT B;  4GT1 A;  2EIK B;  1M57 B;  2XAS A;  1OCR C;  2IU0 A;  2HVK C;  2WLJ A;  1OCO B;  3F7Y C;  4KFM A;  4H33 A;  1NR1 A;  3G71 V;  2WLN A;  1ENV A;  3OMN B;  3CCU V;  1VQM V;  1ORQ C;  1RPO A;  1N8R W;  2R9R B;  1NQT A;  4TT3 G;  2WLI B;  4WFA V;  4MVM A;  4U7N A;  4P9O A;  2ZXW C;  1AI7 A;  4XDL A;  1FXV A;  3B77 A;  3GWO A;  3SPH A;  3VBB A;  1Q82 W;  3IC7 A;  3DTU B;  3OAA G;  5LGN A;  2WLL A;  1F4N A;  3LSQ A;  2LFR A;  2JJ2 G;  1YHQ V;  1Q81 W;  1ROP A;  2IJI A;  4FMT A;  3LSS A;  3E8H A;  5EK0 A;  3ZN0 A;  2DQ3 A;  3TET A;  3ZMS A;  1BHB A;  1OCZ B;  4BIU A;  1OCC C;  1XL4 A;  2ZD9 A;  2Q68 A;  3ABM B;  2WLM A;  2R9I A;  1NVP B;  2EIJ B;  3OEH G;  5B1B C;  4MTO A;  4LBE C;  1COW G;  1S5H C;  1OCR B;  1QR9 A;  2IJK A;  1NBM G;  2BOB C;  4XDK A;  3MD0 A;  4JF3 A;  3M99 B;  3SYO A;  1UJW B;  2WPD G;  4FK5 C;  2QE7 G;  1S77 D;  3SPJ A;  3ZJZ A;  3JD1 A;  5LGT A;  3CCE V;  3ZMT A;  5EC1 C;  1BMF G;  2K1E A;  5HFL A;  2EIL C;  2ITD C;  1R3K C;  3CP1 A;  4I9W A;  2ZXW B;  4QPJ A;  2EZP A;  4X89 A;  1M56 C;  3CCV V;  2JEX A;  3OMI B;  4XDJ A;  4PEL A;  4MSW C;  2W6J G;  1YTF D;  1F51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...