2DWEB

Crystal structure of kcsa-fab-tba complex in rb+
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB HEAVY CHAIN
publication title Crystallographic Study of the Tetrabutylammonium Block to the KcsA K(+) Channel
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 49
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2006-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dweB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dweB01
3KPOA 2X9YA 1FCGA 1QBLL 5D9SA 5DTFB 1YJDC 1XGUA 3EDFA 3N9GL 1I3VA 1EFXA 3C9NB 3CFKB 3OKEB 5EC2B 3WJJA 3CH1B 5IB1B 3ULUC 1G1YA 1I1CA 3QQ9D 4UTBL 1NGQH 3SDDD 3TBSB 4M7JH 2GK0B 3VH8B 4DUWA 3O9WD 5EO1A 2C3VB 2OI9B 4XCNB 4XPFH 1X5IA 3C5SB 4ERSH 5AD0B 4Y1AA 4JVPA 5C9KA 3QEGH 3GBMH 4BYHA 4PV8B 4WFFD 1O7VA 3IJYB 4U2ZA 2H3NB 3DX8B 3BWAB 2DKMA 1V3MA 1NGXA 5C0JA 3VE0B 4ODUB 2R4RL 4X6DA 3QA3B 3PHOB 5AUMA 5A2LH 3MREB 2Z31C 5EU3A 4YJZL 4OAWA 4V1DA 3BKYL 2XFXB 3DURA 3MUY1 2GY5A 5D7JB 3WHXA 5J1TC 4PJFF 2FR4B 1VFBA 4QHMB 4NHUB 1RJZA 1II4E 3ZHKA 3FN9A 3UJJH 5D6CB 1DTUA 2Z31A 1B4JL 2D9QB 4LHQB 2PO6C 2I5YL 3O6KH 4NKMA 5LVEA 1K3ZA 3T3PE 3LRSA 1XH3A 4U1SB 3CXHK 1KCRH 3BP6A 1KG0A 4J8RA 3U7WH 4OI8A 4OLYL 1F6LL 3ZE0F 2P5WB 2O61A 3MV8D 5E8OB 1R6VA 1I3UA 2VDML 2EKSB 4G8GA 1KACB 4KPHL 4FFVD 1CTNA 1KCUH 1TLKA 4HQQH 4S1SH 5J11C 3VXSA 4UDTB 1MQ8A 3OPZH 4Z76A 4OCSL 5ID1A 3DX9A 3WE6B 1FFNA 2JK5A 4OM1L 3LQMA 3ZMRA 5IEKB 4N0YH 4XNQB 2BOBB 4YC2C 4ZUUB 3GM0A 3OXRA 2YPLE 1VPOL 3I75B 3IU4L 2LVCA 3WFEL 3BGMA 5FUZL 5BZWA 5E03A 3SDYL 1KJMB 1AHWA 3OJVC 4GMSH 3RZCB 3WIHL 5C0DA 3O41B 1UWEL 3L3IA 5F7LB 4ZTPH 1A6UL 1U8NA 1N0XH 1B88A 5DJCA 2CK0L 3CSPA 4RDQF 5BJTA 4OI7A 4CVZB 1A3LL 3U0TB 4JFHE 4YGVB 1FNAA 4LSSH 4PJBE 3SN6N 3TT3L 1HXYB 3BZDA 4YDVA 5IQ9A 1WQVT 2B20A 1BEYL 4PREA 2QADB 1S7UB 3VRJA 1RULH 3BH8A 2GSIB 5FYLL 3MX0A 1JZ5A 1F00I 2EDFA 1C12B 5C2BH 3JTTA 1I7UA 3TN0C 1JWMA 4G43A 4R9HA 1GRWA 2D2OA 5F1OB 1MJ7L 5IGXH 1WT5A 1FVEB 1INQB 4DW2H 4PIRF 3A6CH 3MRKB 1IGTB 2QQLL 3MFFA 1D5XA 5B38G 2NY4C 3AS1A 4PY7B 3IDMB 1P7QB 1WZLA 3OZ9L 1UM4L 1LK3H 5FF6A 2CLRA 3KXFE 3PABA 1KNOB 1TNNA 3V8CA 2E3VA 3U1SH 3BJ91 3EOBB 1MCJA 1E4JA 2DTMH 1MEXH 3H9SB 4LCUA 5FCUH 1J10A 4LCYA 1LWRA 2H32B 4BFBD 2YPVH 4P3DA 1JK8B 2OBGA 5A2JH 3BIBX 1T2QH 3ZL4H 3NTCH 5M7QA 5DFWH 2O5YH 4LLVA 4XT1C 4Y1AE 3O2WH 3HPJA 5F88B 1OAXL 1T2XA 5L2KD 2B1AH 3QG7H 4FQQB 4NWUL 3E1F1 1S9WB 1TCRB 3QFJB 3OKKB 4PBVC 1WBXA 2IAMA 3K8MA 1N5YH 5E6IC 2VDOH 3Q6GH 3DNKA 4F2MB 4LPCA 3GSVB 2YUXA 3VD4A 2FX9H 2NYYD 3SDXE 1MCEA 4V1DE 2WNGA 2OTWB 4Z18A 5IG7A 2V5TA 3VCLB 2XN9B 3A0OA 3QO0B 4GRLA 2Y5TA 3D9AH 1S8DA 5F9DC 2QQQA 2E7LC 3P9WB 5DLMH 3BP7B 2BX5A 5ADPL 1RUQH 4ZUTA 1R3JA 3HLAA 2F58H 3UBXB 1NBQA 3ARED 4FRWA 4L3EE 3VFSB 4LQFL 1OM3L 2VR9A 1MFAL 5AAMA 4NZRH 5D7KD 1CGUA 2NY7H 2HTLC 1TJIL 5DVOA 4U3XA 4XCCH 3A67H 3M07A 2HRPH 4HS3B 1NBVL 3UC0H 1ADQH 3PIQA 2XRAL 4JVUA 4HT1L 3QIUC 3TFKD 2ZNXA 1P2CA 4Y88A 3B9EA 3UTQA 5GIRB 3ZKND 5BVJB 1WFTA 1INDL 1B2WL 1QA9B 5HYSB 2Q86A 4Y8DC 4GT7A 5KZCB 4YNYB 3WEXB 1IAOB 5EO9A 5FCSH 4OB5L 4PJ5A 2NZIA 5B8CB 2EDXA 4FZ8L 2IMNA 5DQ9A 3EO0B 1EAPB 1QFWI 3J8F7 2J4WH 2BRQA 5LCVH 3O2VH 4AIXA 4OFIA 4LQ1A 3VGHA 3TWCL 4QRRB 5F9JB 4I3RL 1JJUA 4PG2C 4K71B 3MBEC 4P23B 2RGSA 4M61A 3VGGA 1KLUB 2DQFB 4U1IA 4UV4H 1NLBL 3EZJB 5IMLA 3QYCA 5BW7A 4JPKH 3AMLA 3L3HA 3WFCL 4WU7A 5CP7A 2BHZA 3MZGB 4PG2A 4GKZA 3GJEA 3CDCA 4NZJA 4PJAE 2NNAA 4QHNB 4U3CA 3FQXB 5LBSH 1YNTA 1TVBB 1IM9D 4UIKH 2AJZA 1YYMH 3RZWA 5LQBL 2ZCLH 1CU4L 4DGIH 1MHPH 2YC1A 4O2CB 2R0LL 1G9MH 4P9HH 5I66A 1P7KB 4KFZC 5F8QC 5ID0A 3IXTA 2A9NH 5TE6L 1S9VB 4JCMA 3F7YB 4OCWL 4IJ3B 1G7LB 4NO2A 2BJML 4CBPA 3FAWA 1QNZH 3W9EB 4NPYA 2FIKB 5J1AA 3DVGB 4QOKB 3LPWA 1J8HA 1EZVY 3BESR 1PDKA 1IM3B 1JUFA 4MSWA 2DKSA 5DRZA 1S9XB 1PD6A 4GXUM 1CXKA 1WBYA 5I75B 1FRGH 1JPTH 2D7OA 5FHBL 3SJVB 2EDOA 3UYPA 2Y7QA 4ZD3H 2XZAL 2JJUA 1IAMA 4ZFGH 1NMCB 4LHUG 4W70A 4JFPA 4L4VB 1CLZH 3GBNH 3GO1L 3U36B 3WD5L 5IMKA 1BWWA 3S4SA 1MFDH 4KVCH 3BQUD 3LB6C 4B7LA 1S9YB 1J1PL 3D87B 5I8KL 4MCZA 4NQSB 2JE8A 1OP3H 1TPXC 3MXVL 4WNQA 5GSVA 2XT1B 1Y18B 5B39G 1GPOL 5I18H 5CEZH 3LN4A 5C0AB 3TT1L 1U8HA 2CDFB 2C1OB 3HG1A 4LMQE 2A0LD 3CU1A 4LVHC 2ZPKH 1RUKL 2UYLA 2X4SB 1DBBH 3KS0J 4NHCL 1QRNE 3MR9B 4Y19D 2VZVA 4J4PD 1SJHB 3ZKMC 3O0RL 3UYOD 2NY0D 4R0LC 1OAQH 2EXYD 2VDPH 4GKSB 4HXAL 2R8SH 3LEYL 3OKMB 4OFPA 4GW1B 3LPGA 4PGBB 1H0DB 3W11D 1R3LA 2Y07L 4J6RL 4DZBA 1VGKB 1KC5L 3BKMH 2AVGA 3C60C 4JY6A 5BV7C 3LS4L 2R1WA 2VDLL 5IW6A 2LU3A 3I9GH 2XG4A 4EI5D 2D7TH 3SCMD 1XEDA 3R1GL 4KRPC 4OCXL 5DMGC 2HJFB 2OZ4H 3PGDA 1G7HB 4PJ7A 2AXGA 3RJDA 4P4KC 5MI0B 1VFAA 1F3DH 3C60A 2EIDA 4YHIA 2V7HA 4OZ4A 5KN5B 4ODTH 1P6AB 1V7NL 4X98A 3W9DA 1CBVL 4K8RL 5I76A 1KB9K 1B0RB 2APFA 3P4MA 5CEXB 4GS7C 1WCBB 5HHMB 5HVWA 3QCVL 1EV2E 4OGYH 5E2VH 1MAJA 2ZOKB 3TCXA 4XC3L 3KNBA 4ETQA 1T2JA 2BXZA 4TQEH 5ICYA 4KUZL 4H20L 3HC4H 2DLGA 5FYKL 2BRRL 2KUTA 1MREH 4ORGB 3ARDA 1UXWA 1UXSB 5DJDB 5JXEC 2FO1A 4XP9L 1T5WB 1QP1A 4FFYL 3REWA 4P3CL 4NP4L 1Q72L 2DIJA 2Y9RT 5GRJL 2P7TA 3KLAB 4LIQL 2B4CL 1WLHA 1N7MH 2HT3C 3GSRB 4R97C 3TC9A 2I60L 4OUUB 3VDBA 4BH8B 3VXTB 5JXEA 1N8ZA 1UZ8A 2R23A 3FB7A 1A1MA 5C07A 3OKDB 3BUYB 3D1MC 3AFLA 4PRDB 3GSUB 4XX1G 1J8HE 1I7ZA 1CFVL 3DXAA 1BGXH 3ULVH 2YMXL 1AGBA 2FJHA 1MUJA 1FORL 1PLGH 2WSKA 5IBUG 1OQOA 3CXHJ 3IDIA 5EB9A 3GSWB 2IG2L 4HS6B 5T3XH 1ZS8B 1OAUL 2XQBL 2CLZA 5K9KB 3W81A 4P5TB 3MXWH 2FHCA 3D18A 4LSPL 2BZDA 1OGAE 1O0VA 1BIIB 5I1CL 3IDUA 4MJ6B 5E7BA 4F3FB 4XMLL 1IGMH 3FOLA 3MO1A 1W8OA 4OV5A 2VOTA 4OCLC 2VITA 4CJ1A 2QLVB 2V5MA 4K07A 1ZSDA 2ID5A 2X09A 3MNZA 4NNXA 3FHAA 3ZYOA 1XF2B 3QUZD 4U0RB 3LH2H 3B6SA 2AK4B 5ERWA 4OGXH 4DOHE 1LEKA 1YC7A 3PL6B 4ACPA 1N6QL 1FAIL 4WI2A 43CAB 3HG1E 3RFZC 3TVMA 2BERA 3JWOH 1JGUH 1F13A 1MIEL 2AGJL 3T04D 1I4FB 3HR5B 1HCVA 3R06B 4Q9QH 1YEDB 5KSBB 3TBTB 1UWXH 3CLFL 3T65B 2IC2A 1S7RB 5D5MB 1JPSL 4JFFB 1FYTA 4KK5D 4ONFH 4U0QB 4Y4FC 1KENH 3O45A 3MRNB 3RWIB 2ICEA 5LAXA 1IGIL 1OSPL 5E1AB 5DJAA 5DQDL 4ZFFB 3SKNB 2PYEA 3MUGB 4Z78B 3NCCB 1R3KB 4ZNEE 4IIQA 5ICZA 4KJQD 4WFHE 3TNNB 5HHOA 1R3HB 4WWKD 2DRUA 5HYJB 1NFDE 4M1DL 1JV5B 4QWWC 1AGEA 1NJ9A 2QQKL 3F5WA 4GG8A 2WZPD 1C5CL 1MFEH 2JB6A 1P6FA 3MRMA 1IGCH 4V2CB 2SEBB 4UINH 5DK0B 4ZPVA 3VWJC 1KFAL 4PJ7E 4FTVA 2CK2A 3UYRL 3STBA 3LN5A 5I73B 1E4WH 2L7JA 5KAQF 4WEBL 4PLKC 4RFNB 4EEEA 4U2YA 4R7NA 2GFBB 2VDNH 3SE3C 2CO6B 3N1MC 1HDMA 4LCWD 5ALBL 2OXHA 3K46A 4XWOD 1T03H 5JHDB 4HD9A 3DRTA 1FCCA 2UZIH 1EHLL 2FJGA 4TUJB 3H42L 3GM8A 1FZKB 2EYRA 4M5ZH 3ETBF 3O6FA 3VFTB 2BVQB 2R2EA 1EO8H 4XMKL 3MCKB 4N0UB 1LO3L 3DGGA 2GT9B 1T04A 5GGTL 4U1LA 1RJLA 1DVFA 4XRCB 1A4JB 3MODH 3RWDA 4Z8FH 4G6KH 1JGLH 5GS2H 4AIZB 5IOPA 4U1MB 4L4JA 4CN4A 3B5GA 4I1NB 4X7DC 3C08L 2K1MA 2L4OA 2DLIA 3BZ4B 4TNWF 5E8NA 3T3ME 3F6LA 5JIPA 3P9MB 1RZJL 1CL7L 4RA0C 4QF1B 5EA0H 4ODHH 5C07E 3QNZB 1T6WA 5T1KB 3OG4B 2N1KA 3FFCB 1F58L 3DXAE 2F19L 4P2RE 4F7EA 4S1RL 2C4FU 4N0FA 1AP2B 4JKMA 1HHIB 4GW5B 1PYWB 1A6TA 1RU9H 1W0VA 3SO3C 1BQHA 5KSVA 4OF8A 2JF1A 4GXVL 1DZBA 1BFOA 3BX7C 4LRIA 4P49A 4HBCL 2PETA 3TNMA 2P5WD 3RY4A 3EOTL 4GMTL 5EBMB 3P11H 5DUBA 5CKAA 4OTXH 3SGDI 1Q0XH 3SOBH 5HVFB 3DECA 1IZKA 4QT5B 3X3GL 3PNWB 3GMQA 5TDPB 4XHJC 5FO7A 2VDKL 3SQOH 2DTSA 2A6KB 1FGVL 2HYMA 5FDWA 1LEIB 3RUGF 2Z92A 4HIEA 1J8KA 4X4YA 3IVKA 1YMMA 4JFEB 5ITBL 1FJ1B 2E27L 4O02L 5KW9H 1JZ3A 4XGZB 5MENB 4ODXB 3OHXB 3H3PH 4G9DB 4F7TB 1IKFH 4GUPB 3GSXA 5MERB 1NAKH 5E24E 1WC7A 1JWSB 1F4HA 1LVEA 4KHXH 1FG9C 3Q0HA 4NWTH 43C9B 4PJIE 4G6AD 4C56E 5FUCE 4JFOB 1FYTE 2EXWC 3CGTA 4PRPB 1CDCA 1A7PH 4JM2F 5D1XA 5E5UB 4FABL 4PG9A 2PYEE 4MA8L 3IXAB 2Z91A 3M8OL 5GRUL 2WIMA 3U0WL 4ZDHB 4HMDA 5HHOE 1DEEB 2CPCA 3LKOA 3NFPB 4YEEA 5AZEH 4OBSA 3NZ8A 3VW3L 1B0GA 1SBBA 3UJIL 5BS0E 4HIHB 5CD3A 1ZT7A 3GMOB 1J11A 3F12A 2ZUXA 4N8CL 4XNXL 1GAFL 4GRMB 5I30H 1YEGL 3BRGC 1TIUA 2BHUA 1P7QD 2NXZB 1CICB 2BOCB 5GZNC 2Q8AH 4TTGA 4LGSB 5A2KH 5E56A 5IVZB 1U58B 4NSKA 1BFVH 4DUXA 4OIIL 1XIWA 4JDZB 2EIBA 2ICES 3H9SD 2XKNB 4G8EB 5GGSY 4FQIL 1LK2A 4X4MA 1IAIL 2VLKA 1BLNB 1CFQA 3RVUD 1F97A 5F89B 1IRAY 2DM7A 1A14H 2EZ0D 2OL3A 5C6TL 4MAUL 4ONGH 1HXMB 4HUKB 1F4YL 2UVFA 3GKWH 1BD2B 3HI1A 3TJHC 3TPKA 4YFEA 1DBAL 3HI6L 2H41A 4L1DA 2R0ZL 4N68A 1AQKL 25C8L 3BIKB 4QXUL 4XP1L 2P5EE 4CMHB 1DBML 3QFJD 4I0PA 5CIPA 4X6EA 1F90H 2N4IA 2V9QA 4XPBL 2XACC 4Z7UB 5D1ZC 5FKPB 4BKLA 4IRJC 2AJVL 4OLEA 3RL1B 4LSUH 3L6FB 3GSNH 4WO4B 5J9PA 3KPRA 4TSBH 3RA7H 1K9TA 5TQ2L 2XN9D 3CZJA 3UTOA 3T1WA 4OI9A 5HI4D 3FRUA 1OL0A 4LHUA 5EU7C 3IU3B 1QFUL 2BSRB 5I1AA 2VXQL 3SGEI 2WM0A 4QCIA 4J3TA 1JHKL 3QXTA 3ZYZA 3X12B 4FQLH 2BCKB 5DC9B 4EUPB 1KEML 1WZ1H 2DQJL 1MF2L 1F8TL 2R2BA 3KYKL 2VDQH 3UTTA 3NFNA 5CINL 1WBZB 2YPKB 2OR7A 3CK0H 1YQ2A 3SDAB 1P9MC 1RIHH 1BJ1H 3BT2L 3LKSB 3NACL 4EXPX 3DROB 4YPGA 5K59E 1NCCL 4R7DA 1F4XL 3UTSB 1GYAA 5JQ6H 4BFGA 4WUUA 2GIYA 3PWUA 1MCHA 2AW2A 4JVWA 5KZCD 2DQUH 4EIGB 4FQ2H 4OKVB 1P9MA 1QFHA 2PKDA 3RTQB 3V52L 3T4AA 4A6YA 2D03H 1YNLL 3BPOB 5BQ7A 3BPLB 4I5BA 1X5FA 3ULVF 4JRXE 3GMPB 4M3KB 4KROC 4RISL 2R2HB 3D39B 2FJFA 4P99A 5AYUH 1VHPA 3NABL 4JO4L 1NGWB 4QRRD 3TO4B 4W81A 1E4XI 1KPRA 4MQTB 1KB9J 1PZ5B 4HV8B 5IK3A 1I8MA 2HH0L 4NNPL 1BPVA 1CE6A 4LK4A 5JHLL 2ICWJ 4JZOA 1D6VL 1CN4A 4P23D 1X5AA 3AC0A 4TYUA 1LO2L 4L8SA 2ZUQC 4JFQB 3BP5A 1QHPA 3HE6C 5T1MA 3LV3A 3QDJA 4UTAL 1H15B 4TPRL 5C8JA 5GGVL 4H8WH 2AV7A 2H6PB 4P59L 3VXME 2UWEA 3OR6A 1HIMH 3ARFD 1MSPA 4PUBH 5EOTA 4F7MA 2HJKB 2PR4L 5IMMB 3MRPB 1KCSH 1LP9F 4PS4L 4K3DH 4G7YH 2Q7NA 1TXKA 5C08B 3LKQA 1WFNA 5E94B 1FVDB 1FIEA 4YHML 1FL3A 2BVOB 4Y5VC 5F9WB 1FZMB 1QKZH 5SWSA 4YDLB 2NY6C 4NQDB 5HGGS 3B8YA 2MFNA 5HPOA 4I3GA 2M26A 3DV4A 3BEVA 1CG9B 1EUTA 4QOKD 3B3IA 4YHPA 1T7WA 4S1QH 1IZJA 1Q94A 5BMFH 2VLKE 2EYTB 4Y5VA 3MNWA 3OSKA 4XAKD 5EOCL 5E2UL 5EO0A 3EYOB 1C08A 3FQUB 1IC7H 2G5BA 3CMOL 4K7FA 3SDDA 3VJ6B 3O9WA 4HKBB 5KSAD 3WUZA 5FECA 4P3WA 2XPGB 3K74B 3SJVD 3D5OF 4FZEL 4EDXB 4IMLB 4MQSB 2DYPB 1S5IL 1OWRM 3PHQA 3E8UH 3WXWL 4L4VD 3HNSL 4GQ9L 1PSKH 1YEFH 4QRPE 4M7LL 1U8KA 5I0DA 2R4SL 1XGTA 1NMAL 1I9RH 1JNLL 4D9LH 3TJEH 2YN5A 5DD6A 3DHMA 5DZNA 5D4QA 2LVEA 4PRNB 5EU4A 1MCCA 5H2BB 4I48B 3U46A 4JE4B 1RPQA 4RGOH 1RMFH 1NDMA 1AGCB 3QNYA 3RWCA 3TYGL 2LTQB 2E7MA 3UTTE 4HK0B 4N8VG 2FLRT 3MV8A 5DA0B 1MWAH 5DYOA 3QI9A 1QBMH 2OXGA 3AU1B 3NCJH 5KVEH 1B4RA 3FMGL 4KDTC 2HFTA 1U0QA 4M6OH 4HK3N 2YRPA 5K9JH 4WUUE 3MV7E 4YX2L 1KELL 4BSWA 4QHKI 3U2SA 5IR1A 1MFBH 3WL9B 4OF7A 3P30H 1V3JA 2ADFH 3OV6A 2W9LA 4GKOA 3JTSB 4MJ2A 5TGBB 1TTGA 4RWYH 1FO0H 2HLFC 5DRNB 1K4DA 3BISA 2Z93B 3BEWB 5E6ZA 2NW3A 1G7IA 1KTLA 4DTGL 3MRRA 4K7PY 3MRQA 1CGSH 3B5HA 3IDJA 1OLLA 4HG4K 5A43C 5FKAB 2NLJA 3PWJA 1XAUA 4K8RD 1ADQA 4JHAL 4JKPH 3B43A 1U8JB 1HYRC 2VISA 4WI6A 1P84K 1FPTL 3LIZH 5IBTL 2V2XB 2IMMA 3FONA 5HHMD 4X7SH 4UNUA 1I9EA 5DSCB 2J8UE 3HZVA 3DUHA 4F9LA 3QDJE 5IMOB 5IJVA 5AEAA 1WTLA 5A16A 5SWQA 3S8WA 3V5DB 2UWEE 4HUWB 5DI8B 3QDGB 2JB5H 1NAMH 1J0IA 1MLCB 4P46B 3OR7A 4MZ2A 4DVRH 3GFUA 4P57B 3FQWA 1CZ8H 2ENYA 1A7OH 2AP2A 2NCMA 3PDOA 4HUUB 3EZ8A 3VFOA 4KK8C 1FNSL 3GJFK 5DA4A 2PYFA 1YPZE 5F3HA 3C8KA 3RX7A 1JPFA 4JQIH 5INCA 3OGCB 1K8IB 2OR9H 4DGVH 4OUOA 2EYSA 1SY6A 4MMXC 4F15C 4LLQA 3L3JA 2ADGB 3CCHB 3MV01 5HYQA 4QRSA 3CX5K 3G5VB 1G9MC 4NCC1 1FL6A 2R0KL 1YDPB 4P9HC 1T4KA 4X8JA 1YC8A 1SBSL 3PWPB 3VMPA 5BO1H 1IL1B 2NXYD 4WUKH 2IEPA 1FLRL 4U1HB 5GJSL 1MHEB 4D8PB 1NGZB 1IGYB 4MQ7B 3V6OA 2ATPA 3W5NA 4XX1E 1QG3A 5L2KA 3LSOA 1UB6A 1QYGH 3TIDB 1T89A 4LAQL 1YJDL 3C2AH 5CP3A 4O5LH 3K80A 3OXSB 4P48A 1K3IA 4ORZC 4XP6H 1MHCA 4UILH 3ULUL 3VXQB 1YN7B 1FV1B 4DAGL 4LSTL 4D9RD 4NRXA 3SDCC 4HKJB 3N1FC 1NCBL 5E8DL 3S35L 2VAAA 4WEMB 1HI6B 1DUZA 4HKZB 3EO9H 4JM2C 3QHFL 1BAFH 2AEPL 1UB5B 5L6YL 2W65B 1JGEA 4F9PA 3STLA 3F7PC 2H1PL 3G6JB 2CGRH 3BGAA 4G5ZH 4WCYL 3AREA 4MDJB 1AC0A 2C7UB 1OARL 4PTTA 1S5HB 3TFKC 1ETZA 3HUJB 1JRHH 4AYFA 1LEGA 2OTUA 4JFFD 4NM4H 2DQTH 3O6LL 4HKXB 1M05B 5J8OA 1SVZA 2FATH 5F44A 5DHXB 5F93C 4MA3A 3MLZL 2HWZH 5F1SA 1VESA 2PO6B 4LPVA 4I2XB 3V5KB 1P53A 5EZJB 2ZOLB 3RGVD 1UJ3C 4Y5XC 4ZUSA 4XXDB 3QUXB 4J7RA 1BJ8A 2A74A 2X4UA 3OKNA 5HYJD 1P69B 4U6YA 3RIAF 3IFOA 4OLUH 3KAAA 5IHUH 3HMWL 3GSQA 5J11B 3OKLA 1QFWL 2CUIA 4ZUWB 5IB5A 4DGYH 3HNTL 4XBPA 3W39B 1FFQA 3OAUL 1VENA 3TBYB 3QJHB 1J0ZA 2XKUA 4HFUL 2JELH 2LAGB 3GEWB 4ZYKA 1V5JA 2XY1A 4YIQA 4PJHA 1FL5B 2QV2A 5JHDD 1T7YA 4KTDL 3MRDA 1YY9C 3SE9H 4GG6B 4QXGL 3H7BA 3PP4H 5AWNH 5TPWH 3V0VA 3GUTA 5J3HD 3T8XA 3QUMH 5IF0A 2HG5A 1LO4H 1HQ4B 4APQB 1G7JB 3ZDXE 2HKFH 5BZDA 5IEHB 3TIEA 3DBXA 5J57B 2VKXA 2ITCA 5IFAL 4NO5A 5DJ6A 1TJHL 1IM9A 5L0QC 3QULA 3JV5A 4ELKA 2FD6L 2ZG2A 4X5WA 5IT2L 4MMZC 2HKHH 3HE7B 3VXUB 4C58B 4RMWA 1GH7A 3QDME 3NOIA 5JMOC 3O3AA 4NQVA 2WLYA 4LRNL 4U05A 1CYGA 4KZDH 1IC4L 4HIIA 1LO0H 3JV0A 5T1DH 4CNIA 1KTDA 5FGBA 4DQOH 1TMCB 5BRZE 3RVTC 3S3SA 1ZT4A 5GISH 5HHNA 2I07A 4KKBC 4OZIF 4M1CD 1BZ9A 2W59A 3L9RB 2NY4B 3MYJB 4N5UA 3F58H 1N59B 1D5MB 1K2DA 3QIBC 1Z9LA 5FYJL 4MNGA 4GW4B 2P8PB 1AR2A 3P77B 5IW1B 1T66D 1Y0LA 3SY0B 4L3CA 3JV4A 3V6OE 3RKDC 5C0EA 5I1HL 2P45B 2MHAB 5DS8A 2X2YA 3VWKD 1A21A 1KJ3L 5JW5B 1VKXB 5CJOH 3FT3A 3ULVC 3ALPA 4PJXF 5JA8B 5E5MB 3QQNA 2CIKA 3O6MH 3HCVB 4HCRH 3KWWA 3UBXG 1WIUA 2VNCA 3BQUA 3EYQC 3C5JA 4IS6B 5A1AA 2A0LC 5T1LB 4HH8A 4WHYG 5LGHL 5TDNA 2XOTA 1MJJB 4JFED 5JXAL 2B1HL 5MEND 4U1GC 1R24A 1W8NA 1BOGA 1VGEH 3LKRA 3MUHL 4J4PC 4QKXB 3RPIA 1QLEL 2H2PC 1AO7B 2AEWA 3V0WH 5HGAA 1R5WB 3PV7A 3GB7B 3SE4A 2YA2A 1UYWL 4WW2A 4OLZH 2IH1B 2J8OA 1Q9WB 2A77H 5L7XL 5D7KE 4Y19A 4J4PA 5DD0L 5DFVC 4OFKA 1T1ZB 2ZUTA 5ESVB 4KMLB 5F1IB 1EXUB 4Z7OE 3FN0L 1HOCA 2OP4H 3WN5A 3JWOC 4WGWB 5KVFL 4X83A 3TO2B 3BXNA 2BXYA 1MRFL 3SCMC 4X80L 2QKIA 4DKFH 3DO7A 4FFZL 4TULL 3S34H 1CQKA 2BC4B 1HSAB 1VEPA 4XBGA 3RWHA 1LP9A 2DAVA 3X13A 1NFIA 3RQ3A 3ZTNL 1FVCA 5HGHA 5KJRH 5CILH 4QNPF 2ZUYA 4ZPTA 2BSED 4MLSA 1BBJA 4X6BB 4EI5A 4ODWB 4LU5H 4NFDA 5IJKA 3QIUB 3GGWB 4AENA 3QUYC 5ANMA 3ARBC 4WEUD 2FRGP 3FQRB 5EOCJ 2NXZD 1CICD 3VXPA 3OJDA 4JY5L 5D7LB 1AC6A 5HSFA 3CJJA 2FBOJ 3HMXA 4TN9A 4PJHE 4PRIE 4CMMB 3K8KA 5I1LB 5I1IH 5ITFB 1G9EA 2E9BA 5CWSB 1A4KB 2QJDA 4MQXD 3Q2CA 3BVNB 5DUMH 1J5OH 3CSBA 2YKLL 1HSBA 1N4XH 1JI1A 3L3GA 1KTKE 5M94B 2W60B 3QXVA 3VD5A 5FOJA 3MBEB 1BD2D 3MJ9H 3V7AE 1J7VR 2DQGH 5C09E 1DQDL 2NY2B 4LNRB 3WSQL 4Q0XL 1QSEB 3ESUF 4EBQH 1HN1A 3V5HA 5HXMA 4DVBA 4EZMA 1RVFH 5GGSB 3VFVB 1ZAGA 2X6MA 2ESVB 4ZO9A 1UENA 4WO4D 1XF3A 4L8BA 3P9LA 1I8KA 1A5FH 2DLFL 3QEHB 5DHVB 3HKFA 1AY1L 3T0DA 4N0CD 4JFZL 4YWGH 5DK2A 4Z95H 5IVXB 1I1AC 2NW2B 4KXZI 1ORSB 4H0GA 3N0PB 3RRQA 4OIAA 4MNGE 3AXLA 2HFEA 4DN3L 3X14A 3VU2A 2XI9A 5EN2A 5J6GA 2HT2C 35C8L 1ZLVK 1JZ7A 3ESVF 2A83B 2EDYA 1OAYL 1ORQA 5LWYL 4RZCA 5T3ZL 4AMKH 4HDIA 5DJZA 2Q76B 3QIWC 1KCVH 2WINA 4UQ2B 3SDAD 3NIFF 2ZCHH 4OZGA 1Z5LB 2W9DH 3IAGC 4HWBL 2F8OA 3GI9L 3I50L 4WJ5A 2BSTA 1MRDH 3UTSD 1TZIA 4ZO8A 4N8VA 3CDYA 2HFFB 3QUZA 1A9BB 4MB3A 4PJ8D 5AZ2L 2YHGA 4JLRA 2X70A 3GRWA 4AH2B 3RTQD 2I9TB 1DANU 3O4LB 1X7QB 4MX7B 5DD1H 5H37H 2WUBH 4HG4J 3GHBL 3D39D 5L8KB 4QHLA 5IB2B 1TPXB 3TO4D 1S7VA 1P84J 2IBGA 2XZZA 3QEQB 4AEIL 1RZ7H 4LPUA 2YUVA 3OQ3B 5EIIB 5C0FA 5CD5D 4JJ5B 3QXDB 4ODSH 3L95A 5JIHA 5BCAA 4E5XB 5I1JH 4Z9KB 2APBA 2VDRL 4LVHB 1UC6A 1UADC 2Y06H 4U1KA 4NM8H 4I4WB 4WWKA 5MEOA 1WICA 3STZA 3DVNA 4MD5A 3D25B 3MGTA 4J2XA 4R0LB 5D70H 2CKBB 1YUHA 3QHZH 1GGBL 3AROA 4LHJB 1F11A 4NQUA 5IKCA 4RFEA 1EO7A 1YPZF 5C08D 3FCTA 5KSUB 4OD2B 2YXMA 4N1HB 2I9LA 2LU7A 1N6UA 5D8JH 4AEFA 5SWZE 2AJ3B 5BV7B 3WS3B 4LCWA 2E7BA 3DUUB 5BV7L 3CX5J 5DTFA 2OI9C 3V2AR 3ARVA 4KRPB 2Z9TA 4P4RB 2V7NB 3C9NA 4RNRB 5C0CE 3CFKA 3OKEA 3RNKB 2W0FB 5EC2A 5JO5B 3EDJA 3CH1A 4YUEH 2E7HA 5B21A 4P4KB 1XT5A 5IB1A 3KLDA 4NOFA 4PGDB 3W2DH 1F42A 1KPVB 2XZCH 1GGIH 4KVNH 3TBSA 2GK0A 3VH8A 1P4BL 1XGYH 4M1GH 2X05A 2C3VA 4Q9RL 4WU5B 4EUPH 4UUJB 2OK0H 3G9VA 4J1UB 5I74B 4PV8A 4GS7B 3IJYA 4K55A 4K3HA 1FDLL 1J1OL 2DYPD 4O2FA 4Z7NE 2H3NA 5D7JC 4BQBA 3BWAA 5DJ2B 1OOAA 2EEDA 3ZSSA 1G7QB 3VE0A 3MOBH 4ODUA 3TLRA 2KPNA 3QA3A 1S78C 5ESQA 3AY4C 5ILTH 4UT9L 3MREA 4I18B 3NPSB 1MJUL 3PXJA 4PJFB 5TFSL 3C5ZC 5CZVL 2DL2A 2XFXA 4F8TA 3LY6A 3BDYH 4LSVH 3JVGC 1JNNH 3RKPA 4CAGA 1T1YB 2X44D 4JRYE 4QHMA 4NHUA 2VUYA 4O9HH 1T83A 3AY4A 4YR6B 5D6CA 1JHTB 5C6WH 3L5XH 3K7UA 2XA8L 4JJHA 1NCDH 5JNYB 1OP5K 1W72B 4H1LG 1UM6H 4NRYB 5L9DH 1E6OH 2P5WA 3SPVB 4P2CG 5E8OA 2X4PB 2X4NB 4G8IB 2EKSA 4TVPH 4MLIA 2WBKA 5E2TL 2NR6D 4XNYH 3MRHA 5JPMB 1YEEH 5ISZB 4OZGE 1GIGH 1T7ZA 4UDTA 4MA7H 2FEDC 3RZCC 3WE6A 5IEKA 3QPXH 4AT6B 4XPTH 4OFDA 4LBEA 4OFYD 4ZUUA 2BOBA 1ZOXA 2DQDL 3HPLA 3PQYB 3BAEL 3I75A 1PFCA 1V8HA 1MCQA 4G42B 2CRIA 5E4IA 4IOFC 1KJMA 1RUAH 5FO9B 2VR5A 3LS5L 1N5AB 3WIHA 5D72L 3O41A 3AUVA 2QADC 4F7PB 1UA6H 4LEXH 4O00A 4F57L 3ZE1F 4G3YL 5DWUH 5GGQH 2VL4A 1UCTA 1ZLWK 4W4OA 4R4FH 4PLJC 3VG9C 4CVZA 3U0TA 4YGVA 4BELD 1V3KA 1HXYA 3IETB 4Y4KB 3MCLH 1EMTL 1S7UA 5D5MF 3LEXB 2DWEB 2GK2A 4Y2DB 5JW3L 2HTKC 1IBGL 5JR1H 1CVSC 1IEAB 4X4ZA 3BGFC 4N9OB 1RJYB 4XBEH 2WWMD 1NC2B 3QDGD 1T1WB 4JO3L 4P46D 3EGSB 4M4PA 3KDMB 1FVEA 4LKXB 4PJEB 1WITA 2R15A 2HJLB 4K7PL 5C0IB 4F37F 3MRKA 4NZTH 1JE6A 4AG4L 1IGTA 1S7XB 5A3ID 3MRJB 3D69B 5HI3D 1CS6A 1GHFH 1ZMYA 3IDMA 1P7QA 4H8WC 4O2EB 3MBXH 1KNOA 4P2OD 1U3HB 1ZANL 2GTZA 4Y2OA 5HPMB 1RAMA 3EOBA 4LCWE 4LLMA 4FA8A 1U6AH 2G5RA 1EA9C 2Y23A 4JQXC 1NLDH 5D7IB 5EZIL 1IT9H 3MTRA 5FB8B 2RCSH 3H9SA 4HK3J 2FGZA 2BNUB 3NCFB 2H32A 5E99L 1DBKL 3H3KA 3V4VH 1JK8A 1U2HA 3MOQA 3PWPD 2DQIH 2HN7B 5EBGA 4Z7QE 2XWJA 4LSDA 4FQJH 4ONOA 3G08B 4JG1L 2V2WB 4FQXC 4HC1L 5F88A 2XWTB 3FO2B 4FQQA 3UZEA 4XVTL 3QFJA 5HHQA 3OKKA 1PG7H 4R96B 3T2PA 4AK1A 5JQHC 3ULUD 4PJDA 1T20A 3DV6B 4F2MA 3R8QA 3FB8B 4JHZA 1I7RB 2OR8A 3D2UB 4DKEH 3VCLA 2XN9A 3QH3B 3FJTA 3QO0A 3ZE2E 1SEQH 1MAMH 1ZTXH 1KIQA 3IS1X 3P2TA 4QGTA 2DDQL 5EUOA 1G1CA 3BP7A 3QCTL 1HHHB 4IOIB 2CO7B 1FE8L 4PB0L 1R5VA 3UBXA 1C7SA 3WHE1 1RZKH 3HC3L 4ZTOL 5EFIB 5CJXA 3OKOB 2C3XA 3VFSA 2JTDA 4K3JL 2GJ6B 5JORB 3ZTJG 4NDMB 2P5WE 1G6RB 1CK0H 2D4FA 4TSCL 1RIUH 2DS4A 3EJJX 3PV6B 1UZ6E 2PXYC 2AKRB 4HS3A 3BKCH 2PO6D 4ZQKB 4XWGL 5B8CC 5ECJE 2WUCL 1E28B 5GIRA 5BVJA 2WWKO 5DJ0B 3AM8A 5HYSA 2PCPB 5CGTA 1EGJL 4YNYA 3WEXA 1IAOA 3R0MA 4YHZL 2DB8A 3ELAT 5B8CA 2O5XH 4K71C 1QBBA 3WKML 5ICXB 3CFBA 3NPZB 3WNOA 1NC4B 3UJTH 1EAPA 1H3WM 3P0VH 5D2NE 5LG1A 3WFDL 3SHSA 2ITDA 4PBXA 4GAGL 3VG0L 2G75B 4M3JA 3E2HC 3BZEB 1ULVA 4JDTL 4QRRA 5F9JA 5L8JB 4M9OA 1WVZA 2WIIB 2XYCA 4FNLH 1F4AA 4GKNB 2PTTB 4P23A 1T1XA 5FYLE 3QCUL 1KLUA 4NO3B 4BJLA 2I5YH 2DQFA 5GRZA 3FN3A 5DQJB 1OCWL 4LEOA 3QFDA 1I85C 5CSBA 3VFMB 2FCBA 4APQD 4NQXB 3LCYA 2OM5A 2MMXA 2GTWB 3ARFA 3FQXA 2ARJB 4AEHL 4R8WH 2XV6B 4S2SB 2APVA 4FG6C 1AQDB 3RX8A 4O2CA 3VXUD 1X6NA 3SKMA 5MHSD 1R0AL 5EU6B 3TN0D 5A2IH 3S36L 4OJFH 2YWYA 3REVB 1RIVH 1S9VA 2PW2B 4X0KB 1A6WH 1G7LA 1XF4B 2FZ3B 3SDYH 4PRHB 1T6VN 1L7IH 3W9EA 5M95B 4YFLI 2MQ3A 1KN4L 3H9SE 3CVHH 3DVGA 4QOKA 3RY6A 1UCBH 5FYJD 2NY4D 2EE2A 4E42B 1IM3A 3VI3E 1QPXA 1BFSA 2CK0H 3DI2B 1DLFH 4UOW1 3MMEB 4WFED 1F6AB 4NYLB 3I3EA 1S9XA 1NL0H 7FABL 5KSAA 2OL3L 1UEYA 2IQ9L 3SJVA 3LN9A 5IB3B 5FK9B 3QFJE 4U6HB 3T0XA 4OKDA 4L4TB 3MJ7B 1IC5H 5K93A 4NC1C 4PJDE 1T0NA 4L4VA 3U36A 4OLVL 4OM0L 2VH5L 4RX4D 3QRGH 4Z7UF 2LE9A 2DWDA 1S9YA 1A6ZB 2P43B 2XN9E 4KUCF 5EBWB 1MI5D 1Y18A 5E6ID 5EUOE 5D1ZB 1RURH 2X40A 4IRJB 2CDFA 2Z8VC 1T0PB 2C1OA 3HN3A 4PPTA 4OD3H 1GZQB 3ZHDA 1CF8H 4XVSH 5A2FA 1EEYB 1NGQL 4M7JL 4UNVA 4JHWH 2X4SA 4KKLC 4XPFL 1CDHA 4ERSL 2R9HC 3UBXI 5F70A 3QEGL 3GBML 3MR9A 3UPRB 2EDEA 1AKJB 2X89D 4NQCD 2AAVA 1SJHA 5DO2C 5F7FA 5JUEH 1WAAA 4R3SB 3V95A 4GKSA 2XTLA 1RSFA 3DPBA 1KPUB 2C5DC 4GW1A 4HX1B 1H0DA 3G6AB 1JTOA 5DDHB 5DT1H 1ZLUH 2GCYB 2F74B 2HTLD 3CH8A 4Y0GA 3KPNB 3QNXB 2BVYA 1OGTB 3IFNH 1U8QB 3QIUD 3UJJL 3MSPA 2HJFA 4MJIB 1G7HA 4ZXBC 3VRLF 1KCRL 1AD0B 1KV3A 2GJZB 4QRRE 1GOGA 5D7LD 1V05A 3U7WL 3IRZA 4UIMB 1PKQE 1UKQA 4LVOB 5FA3B 2UY6A 5ADPH 5KTEH 1B0RA 5CEXA 1WCBA 5DRWB 3CVIH 2YRLA 1KCUL 4KROB 5F7NC 8FABB 4S1SL 4HQQL 4UV7L 2ZOKA 2BNRE 3OPZL 5GJTH 2FWOB 3V6ZB 4XCFH 2M2DA 3RDTC 4G6FB 4N0YL 2IQAA 5TJWK 5I2IB 3MBED 4ORGA 1INEL 4TNVK 4CVWA 5DJDA 3IDYC 1I1RA 2Z8WC 4JAMB 2D7PA 2VERN 1T5WA 2ZUQB 2VXSH 2X7LB 3HE6B 3TESA 2XA3A 2BNQE 2Z35B 4HGWB 4ZTPL 1N0XL 1PGRB 1ZHKB 3KLAA 4K3GA 3GSRA 1VACB 4OUUA 2ESVD 4BH8A 3VXTA 2WV3A 4LSSL 3ZDZE 3I6LD 4JZJB 4PB9H 2C9AA 5D1QB 5F6IC 3BUYA 1P1ZB 4YXKH 4PRDA 4QOKE 3QQ3B 1RULL 4P5TC 2MQCA 3NA9H 3OG6B 5C9JA 1A7QL 5C2BL 4MZ3A 3GSWA 2HA1A 4L8CB 4HHAA 5ETUB 1KYOJ 1ZS8A 2NY6B 4MXVE 2EH8H 2CD0A 4M48H 3K2MC 3SJVE 5ACZB 6FABH 5K9KA 5T3ZD 4NJAL 4DW2L 3A6CL 5CBEA 4L5FH 1BIIA 1EHXA 4OIBA 4I9WD 4MJ6A 4F3FA 1P7HL 4U0RC 5IQ7H 2Q8BH 2E9IA 4GAFB 5E08H 1LK3L 4JY4B 3PL6C 1NH6A 3ZT5A 1MCRA 5GGRA 3U1SL 4KJPD 2FGWL 1OAZH 3CFEB 4H1LA 1H3TA 5DXWA 4WHTB 1XF2A 5I1DB 1U93B 2DTML 1MEXL 1QO3B 2VZ3A 4NJ9H 2VZUA 2VXVH 3BWUC 4XP5H 3MJGX 3MLRH 2HMID 3O4LD 5FCUL 3N1QC 3VGEA 2YPVL 3ZLQC 2H8PB 43CAA 1AR1C 4LLDA 1IFHH 3AMKA 5H35B 3PDDA 3O2DH 1BP3B 3T1FB 1I4FA 1T2QL 3NTCL 3HR5A 3R06A 2MTPA 2O5YL 4PJBB 3ARGB 1CDIA 1YEDA 5KSBA 2NPLX 3TBTA 3TGXA 3T65A 1S7RA 1TQCC 2B1AL 4JFFA 2ZUWA 2GUOB 3QG7L 3QEQD 3FKUS 2RQ8A 2ZG3A 2AJXH 4HPYH 3SKOB 5EWIH 1DN0B 3GI8H 4HCRA 4K23H 4RAVB 4PYGA 3NN8A 1N5YL 5E1AA 3VFRA 2VDOL 1HWGB 4ZFFA 3Q6GL 3WIFA 1KIRB 2JCCF 1J86A 3SKNA 3MUGA 2GW5A 3RGVA 4Z78A 2VL5B 3MLYH 4EI6B 1R3KA 2FX9L 1E27B 2HVJB 3WDHA 3T09A 3WDJA 3TNNA 2JJTA 1R3HA 5HYJA 1ZGLA 2RIKA 3G6DH 3CZFB 1JV5A 2OSLA 5I73C 1NEZG 2XZAH 2ZJSH 3H8NA 3ZKMD 3D9AL 1MLBA 3DHJA 4JFYA 5D2LE 1ZLSH 4P5KB 5DLML 3B2VH 1RV6X 1RUQL 2SEBA 5DK0A 3EAKA 4WI7A 2F58L 2WQ8A 2VLRE 2A9MH 4ODBD 1J1PH 4FOMA 3HZMB 3KPOB 3NZHH 3P0YL 1QSFE 1EERB 4QTHB 2GFBA 5D9SB 5IFJB 2A73B 3T0AA 1JRHI 4RQQB 1AGFB 1CGXA 4NZRL 4ENEC 2NY7L 1EFXB 1XF5A 4XCCL 1JNJA 3A67L 5JHDA 2HRPL 2DQCH 3V6BR 4B7IA 4KRPD 1ADQL 5DMGD 1B6UA 4TUJA 4E9LA 1FZKA 1CWVA 3JV6B 3VFTA 4P4KD 2BVQA 4AM0A 1R5IB 5EO1B 5FYKE 4Y1AB 3MCKA 4N0UA 2JJSC 4TNWK 3VFPB 3M17B 5GGTA 1LE9B 4Z7WE 5LXGH 4MJ5B 4XRCA 3KJ4B 4RGNE 1A4JA 2NY3C 2AJUL 3BP4B 3OAZH 5HYIA 5CSZB 1ZHBB 4U1MA 4PJCF 5J56B 1EDQA 5DC4B 4LIQE 3K8LA 3MOAH 5DEFB 3SDXB 2J4WL 1VFUA 3BZ4A 2CKNA 4Y89A 5LCVL 4OCNC 3O2VL 2MPAH 1A0QH 2EKJA 1UACH 1BZ7B 4I77H 4QF1A 2VZSA 2VDLH 1T66C 5BOZG 5CZXD 4IMKC 2EEBA 3R1GH 4LLUB 5T5NF 3CFJB 4UV4L 1SY6L 3SQBA 4G6JH 4ELMF 4XTRC 4L3EB 3QDHA 2HT3D 3WNNA 1KG0B 1OPGH 1HHIA 3QWRD 1NCUA 4YZFE 1PYWA 4GO6B 4QXWA 4M03A 1CBVH 4X6CF 3MV9B 5FA4A 5LBSL 3WYRA 4F15B 4UIKL 1YYML 3HI5H 3VWKA 1L9NA 2GI7A 5EBMA 1G9ML 3DX7A 3KYAA 1PQZA 3DX9B 4P9HL 5ISZD 1H3UA 2VXTH 1OY3B 4D9RE 3PNWA 2A9NL 5C92A 1OWWA 3RUGB 5K9QG 5TDPA 2A6KA 1FNEB 4YLQT 5EUKB 1LEIA 1A47A 1AGDA 4I3SH 1QNZL 5F1NB 3PQYD 1IQDA 1AHWB 4JFEA 1FJ1A 3VGFA 4OGZA 5JOEA 3L3IB 4XGZA 5MENA 2VN4A 5IM7B 4ODXA 4CDHA 4GUPA 2ENSA 5DJCB 5MERA 3MRCB 3WUWB 3SDCB 2CKBH 5BJTB 2QHLA 2ZKHH 1JWSA 2APWA 5CCKH 2BDNH 1FC1A 1X5YA 4KDVA 2W9EH 3G6JF 43C9A 5KSBE 2G60L 3F7RA 1FRGL 1JPTL 2CRYA 2HP4A 4JFOA 3RX5A 3W0WD 4ZD3L 2P4AB 1OP3K 2YWZA 4PGZA 4M6MH 3HAEB 3EYFB 1CLZL 2FBJH 2FEEL 3GBNL 1JWMB 4Y2DD 3PE9A 3IXAA 1A7NL 1IC1A 4PJAB 5DHYB 1MFDL 1SHMA 4KVCL 5FAAA 4K2UH 2EE3A 4YBQC 4ZDHA 2P47B 1NC2D 1DEEA 3NFPA 1ITBB 1N2RB 4Y4FD 5F6HI 3ZKQD 2NXZC 1CFNB 3KR3L 4FS0A 5CJQH 3GMOA 5CEZL 2YN3A 1ITCA 3PABB 4LL9A 4Y5XB 2VLJB 3LVEA 5I1GH 4KMQA 3S96A 4DEPC 4MQXC 4BFIB 1CICA 2BOCA 3NIGF 4QRTB 2ZPKL 4R26L 3BZFB 4X5XB 2XQYK 3GZKA 1U3HD 4QWWD 5IVZA 1LDPL 2YUZA 3SGKC 4YE4L 4JDZA 2C3GA 2C1PB 1DBJH 1OAQL 2VDPL 3V4PH 3VWJD 3GMRB 2R8SL 1D5BA 4CMHC 4PGEB 1TVDA 1HINH 3O3EB 1BLNA 4POZC 32C2B 5F89A 1MRCH 4N0UE 1Z9MA 3V4UH 3S6CA 3BKML 4GG6F 1CVRA 4IRSC 4IDLA 3K1DA 1BD2A 2AK1H 4WO4C 2HT4D 3I9GL 5JW4M 5HHVH 3VGAB 2D7TL 1J1XH 1EBAA 3KYOA 4B53A 4D3CH 2OZ4L 4Z7UA 2PUQT 3RL1A 1A6VH 5IG7B 2CJUH 1QLRB 3G9AB 5DMJB 4WO4A 5F7EH 4GRLB 4KQ3H 2Y5TB 3L5WB 2QQKH 1SJXA 4ODTL 2X1OA 3D2UD 1AI1H 5D7SL 4A2MA 5HD8D 3BMWA 2P8MA 3NMEA 4OQTH 1YECH 1UM5H 3IU3A 3EFDH 2CMRH 2BSRA 3QISA 4HEPG 5E2VL 2EC9U 4WEBH 3B83A 2BCKA 4TQEL 3SDAC 3HC4L 3QR2A 3IKCA 1NCNA 4ODVL 1QRNB 1BQSA 3E3QC 2VZOA 4G9FB 4J3OC 3U6RB 4QHKJ 4IBLT 1MREL 2EDTA 4AQ1B 2GJ6D 2P1YA 4HIXH 1RK0B 1Q8MA 1X44A 1WBZA 1PX3A 2ZCKH 2YPKA 3QIBB 1DQMH 3UTQB 1MVUB 3SDAA 3RTQC 2Q3AA 3X3FL 3DROA 1N7ML 3BPOC 3BPLC 5EO9B 3S3PA 4Y7MA 3BE1L 5IIEB 5A40E 4OZFB 3UTSA 4H5SB 4OGAC 3U9PL 3A6BH 1UH2A 3RWEB 4RIRB 4PJ8A 4JPIA 4JFEE 4OKVA 1KBGH 3UEZA 1UT9A 3C08H 3TO4C 3RTQA 2MOVA 2FX8L 1BGXL 3ULVL 1IKNC 2D0HA 2IPUG 4GJTB 2BMKB 1PLGL 1RZ8A 1NC4D 2ILLA 1MCFA 1ODAA 4XHJD 3D39A 3EIFA 1NGWA 4KZEH 3TO4A 4KMTH 1X5ZA 1PZ5A 4HV8A 1F58H 3MXWL 5D96C 5KS9F 1CD8A 4N5EC 1HE7A 1IGML 2X4TB 3G5YB 3KPMA 4JFQA 1H15A 2NNAB 1GOFA 4S1DC 2H6PA 4GXVH 3IJSB 4HWEH 5JMRA 4LVEA 2EXWD 2AJYH 4X9HA 3LH2L 4GMTH 5F9WC 2HJKA 4OGXL 5IMMA 1ZVYA 1G9NH 4YDLC 3MRPA 3IXTB 3EYVB 5C08A 3JWOL 1JGUL 4NT6B 3KYMA 4U33A 5E94A 1FGVH 1FVDA 3ES6B 5EU6D 5TE7H 4NO2B 5C1MB 4LFHD 4Q9QL 2J5LB 1NGYB 2BVOA 4NUGH 1FZMA 3GMMA 2VAJA 4UBDC 1TQBB 4ONFL 1OW0A 1KENL 1JWUB 1L6XA 4PRHD 3FFDB 3T0EE 5INDB 1UVQB 1TVHB 1CG9A 3WO4B 1FH5H 4Z7VF 5EULV 2XZQH 3QUYB 1JUFB 1IVLA 3ARBB 1JBJA 4MSWB 1SJEB 5GZND 4RMUA 2QBWA 3RWGA 5H94B 3FQUA 1IAII 4C4KO 3VJ6A 1I1YA 1OGAB 1VSCA 1BD2E 2XPGA 5E8PB 1BHGA 4HUXB 1MFEL 2Y6SC 4EDXA 4IMLA 2DYPA 1IGCL 4W6WB 4UINL 4LCCC 5IMKB 5HDQH 4GH7B 3VFWB 1NDGB 3VMOA 1IILE 1E4WL 1KJ2H 2RFXB 2VDNL 5GSVB 2P46B 1BVLA 2H9GB 2ERJB 3WHE0 1P4IH 1A1NA 2LTQC 1XGRA 3CIQA 4KY1H 3LN4B 4U1JB 2ARWA 4N8CH 1T03L 1GAFH 3KPLB 4RCAA 4Y5YC 2UZIL 1RHHB 5C0NC 4PRNA 5D1ZD 4RBPK 4IRJD 5F72S 4M5ZL 2F9BT 4NFCA 4XC1L 4JG0H 5H2BA 4I48A 1EO8L 4MAYB 1MY5A 1YEKL 2NR6C 1NBZB 4KHTH 3H9ZA 4KI5E 5B4MC 5I1EL 1QOKA 3PWNB 4HK0A 3MODL 4Z8FL 2DKUA 2QHRH 3BYTA 2FECL 1JGLL 1I1AB 1AKJD 3ZDYF 3VDCA 4BZ1H 1WZMA 4LVNC 1HH9B 4EOWH 1ZK9A 5EORH 2N56A 1RZKC 3I6KB 2DLTA 5DRXB 5AAWA 3LQZB 1NFDB 1JYVA 4OF3A 3Q5OA 1BM3H 4MB5A 5EA0L 4ODHL 2R1WB 2R0ZH 4FQCL 4OFYA 5CHNB 5IW6B 5T33H 4FQ1H 1HQRA 1IEHA 5JW4R 3WL9A 3QIWB 3PGDB 3ARSA 1M7XA 3JTSA 1YN6A 5TGBA 4U7MA 4GXUN 5DRNA 2Z93A 3BEWA 4JQVA 1URLA 3EYUH 3P4OB 1MCWW 1RU9L 2DD8H 3D39E 4YHKH 4X98B 3W9DB 4HXBL 2BFVL 5I76B 5IFHH 3SGJA 1RZIB 4XPGL 5FKAA 1JZ6A 1U8JA 1QBAA 3VFGH 2ORBH 4P46C 3U9UA 1H8OA 4BM7A 3I85A 2V2XA 4IHOB 2EDJA 4OTXL 4OLWL 5ICYB 1Q0XL 4KROD 3SOBL 1UG9A 1MF2H 5IMOA 4YQXH 4PRBB 2KH2B 3V5DA 4G6FD 4HUWA 5DI8A 4L3AA 1ZA3B 3QDGA 4Y16C 4X7EC 4CGTA 1MLCA 4P46A 4J3WA 5KW9L 2IANB 4Q2ZB 3ROLB 4P57A 1ZA6B 3BT2H 1JTPA 4TVSa 3H3PL 2P7TB 3ILPB 4O51B 4HUUA 4M7KH 2B2XH 4HZAA 4F58H 1NAKL 2OCFD 3QG6B 2K7QA 2DL9A 4L1HA 3HE6D 1EZVX 3KPPB 4KHXL 1VADA 3OTTA 5CMAB 3OGCA 5FYJU 1K8IA 4M6AA 4NWTL 4FQPA 4P2OA 2O5ZH 3HZKB 4UOW0 3DXAB 4P2RB 1A7PL 4ZFOB 3EDKA 3F7VB 1QHOA 1NUNB 3CCHA 4ZFOL 4KKCC 3PHSA 2E6JA 3NABH 4YAQB 3PWPA 2XWBB 1WJ3A 4U1HA 3IFPB 5D93B 1NGZA 2NY6D 1IGYA 2RR3A 2C4XA 5AZEL 4JGMA 1MFNA 1I9IH 2A1WL 4TUOB 5E8EA 3BRFA 2I24N 3TIDA 4JEGB 3RI5F 3WJLC 1JYNA 3S37H 1RY7B 5I30L 3OXSA 3CD4A 1ONQB 3AVEA 3MRGA 1GJIA 1YN7A 1FV1A 2IGFL 3MUJA 1HI6A 2VWEE 3C6LC 1BFVL 3LQAH 4G6MH 4HKZA 1PAMA 1UB5A 2W65A 4E41D 2YD4A 4LSRH 3G6JA 4JN1H 3EHBC 4D0DB 2ED9A 4PJIB 4C56B 5T5FH 4U4BA 4MDJA 2C7UA 3HRPA 3O4OC 4FQHB 4ONGL 1S5HA 3C5ZB 4M7ZC 2F5BH 3HUJA 3ARGD 3CLEH 2EH7H 2ICEB 2PNDA 3ISWA 1FIGH 5EG6C 3QUXC 3TPUA 1M05A 2PYEB 5MEPB 1F90L 1XCQA 4JHBA 4ZOCA 4NKQB 4MYWB 2OYPA 3RIAK 3ME0A 2PO6A 4IIQB 4YHOH 5ICZB 3V5KA 3KG5A 2JIXB 5DVMA 4LSUL 3GSNB 2ZOLA 3WNMA 3GSNL 1AGEB 3MRFB 1T0MB 4ZO7A 3SE8H 4RDQG 5BS0B 4XXDA 3RVWC 3BHBB 4IRZH 4TSBL 4A2LA 3MA9H 3RA7L 3CSYB 4MDIB 4CVXB 4Z77B 4HBQA 3WXWH 2KQNA 5HY9A 4GQ9H 1DSFH 1GGCH 4KDWA 2OJZL 2EDBA 5E9DE 5JTWA 3NIDF 3U79A 4FQLL 3EO1B 4ZUWA 2FSEB 1WZ1L 3W39A 1HDMB 3Q1SH 3TBYA 1XGQA 3QJHA 2VDQL 3BN9C 5ENWB 1RD6A 4APQC 5B38B 2FJGB 1FL5A 1JL8A 1WIPA 3G04A 3LKPB 4YHNB 3CK0L 3O6FB 3IDXH 2HLFD 5B3JE 1RIHL 3QEUB 1H3XA 3TYGH 3RWFB 4NFBA 2YD9A 2R29H 2MNUA 1HQ4A 1T3FA 5I1KH 4APQA 3HE7C 5IEHA 1F3DJ 3QDGE 1G7MB 3VG9B 3QT2A 2P44B 4GRWE 4KGJA 2DQUL 3OAYH 2P5EB 4FQ2L 1LO5B 2EICA 3T2NH 2D03L 3L5IA 5I0ZA 2B0SH 3MJ8B 3K0WA 3MGOB 1T21B 3BGFB 3MGAA 3VXUA 3NBNA 2XNAA 1F02I 4DJMA 4PJEF 1WV7T 3TN0A 1X5HA 5AYUL 3VXNB 2F15A 3T4YB 1DLHB 2YD7A 4OZIB 4XH2B 1IQWH 1FC2D 1KT2B 3HB3C 1DJSA 4KK8D 1WZKA 3MYJA 3MLWH 4LKCB 1N59A 1D5MA 3X11B 1IE5A 3P40A 2WW8A 5D7IF 3P0GB 3IRPX 4L3ED 3FO1A 4GW4A 4H8WL 2P8PA 3QXUA 4QO1A 3P77A 5IW1A 2KZ1B 3SY0A 1HIML 4L8DA 4OCRH 1DANT 3RVVC 3TNMB 1YEJH 3RBSA 4PUBL 3MV9D 3P73B 1M7IB 3PWVB 1FGNH 2MHAA 4PJXB 1U91B 5JW5A 1VKXA 1KCSL 4PJGF 3WDIA 4G7YL 2EDHA 3GMQB 3ULUE 5FO7B 4JANA 5E5MA 1AXSB 1CI5A 4RX4A 2DI8A 3M1BB 4X6DE 2CXKA 3OX8B 4GRWH 2D9CA 3CUPB 4FQXB 4IS6A 2Y5EA 1AH1A 4WTXA 1I7TB 1YQVH 4DWHA 4ZUVB 1DEDA 1HEZB 1BQHG 1MJJA 1MI5A 4JRXB 4NZUH 1WC7B 5E6IA 4X9IA 4S1QL 5HVHB 5BMFL 5TF1L 5C0RH 3SDCD 1XR9B 4JRWA 3BKJH 1IC7L 1R5WA 2F54B 3GB7A 3GJFH 3HUJE 4ISVB 4JN2A 4C54A 5D1XB 5K9QI 2IH1A 1N3NB 1Q9WA 5CJBA 3AS3A 4JM2D 2UUDK 4C83B 5I8CB 1G0DA 2X89A 1T5XB 1ZHNB 4NQCA 4RMRA 4YBLC 2R0KH 2E7LA 5E2JA 2AEQL 1T1ZA 1MCOH 3E8UL 4BQ9A 1UGNA 5F1IA 4G8GE 1EXUA 3UO1H 4C59B 3VXMB 5DVNA 1YEFL 3TO2A 1O7SA 5KVDH 3VXSE 2DJSA 4POUB 2DN7A 5C7XL 2DM4A 1I9RL 5ABDE 2BC4A 4D9LL 1D3CA 1HSAA 3TJEL 1DN2A 3FQTA 4NUJB 3KGRA 2V5RA 1NCAH 5CEZD 2PXYB 5DJ8B 5GGVY 4ODWA 3QIUA 2YD5A 3GGWA 2C26A 5J6HB 4RGOL 1RMFL 2VLJD 3FQRA 3HR6A 3HFMH 3GDBA 5D7LA 5C3TA 4NQEB 1EFQA 4CMMA 2DMKA 5I1LA 1MWAB 2IADA 4X7CC 4OZHA 5ITFA 2ED8A 1MWAL 5CS7A 5CWSA 1A4KA 1QBML 3BVNA 1QQDB 5KVEL 1OARH 2BY0A 2NY2C 4M6OL 3E2HB 5K9JL 4JPVH 3HI1B 4Q6IB 1RQ5A 3CU7A 4W68A 4FMKA 1AJ7L 2W60A 5CIPB 5F9OH 3MBEA 1MFBL 3EJZD 4D0CB 2KDGA 1M6OB 2ADFL 4LDEB 1ACZA 4EDWH 1FO0B 4CKVX 1YY9D 3S7GA 4LNRA 1JMZA 1DQLH 4QRPB 3VXUE 2X9WA 5MHSE 3EOAB 2Q1EA 4NBYB 4KK6D 4E0RB 3WFBH 5GGSA 3VFVA 2Z0BA 2YR3A 1CGSL 2ESVA 1WEJH 1JF5A 1MELA 1NEUA 1MCBA 3QEHA 5KOVC 3EYSH 5DHVA 4JKPL 3OJ2C 3NFSH 3LIZL 5IVXA 1QFWH 1X4XA 2NW2A 3JZ7A 5FYJE 4X7SL 1ORSA 3S9DB 5KG9B 3KHOA 4WFEE 2E8YA 5DR5H 1NAMB 3UTTB 1Y6KR 3WNLA 4XXCC 1QRND 2JB5L 1NAML 5B39B 1SMOA 4G9FD 1CT8A 1TJGH 3QWOB 3RVTD 4W4NA 1S7TA 2A83A 4M5YH 3TYFB 1CZ8L 2EIZA 4KJPC 4KKBD 1A7OL 1D5IH 2Q76A 3QIBD 1J0KA 4UQ2A 4RFOH 1NKRA 4HWBA 4JQIL 3MV7B 4XNZB 2HMIC 5C71A 1L0YA 4J3XA 3CFDB 3HAEH 2OR9L 1OSZA 2GKIA 3RKDD 1CDBA 5JZ7C 4I0KA 4R90H 2IBZY 4U6VH 2HFFA 1A9BA 2CDEB 2E5EA 1MI5E 4CW1B 1AFVH 1Q0YL 5IT2H 3VD3A 4AH2A 1ZWIB 1JZ8A 3ULVD 2I9TA 3L5HA 3O4LA 1X7QA 2FB4H 2K9UA 3GIZH 2VC2H 5BO1L 5T3XD 2WBJC 4WUKL 3GIVB 1I8MB 3EYQD 1A6AB 1T7XA 5DJXA 5IB2A 1CE6B 5SX4I 5HDBF 2DI7A 1QYGL 5TDOB 3QEQA 1Q9LA 4L8SB 4NQCE 3C2AL 3QQ4B 2J8UB 4O5LL 1XCTB 3QDJB 2H2PD 4XP6L 2RHEA 5EIIA 4UILL 4JJ5A 3QXDA 2XTJC 4BZ2H 2Y25A 4E5XA 3JWDH 5DD3H 1A64A 3VI4F 4I4WA 1ZEAH 1CQYA 2L0DA 5DFVD 3EO9L 1S7WB 3D25A 1BAFL 4B41A 4HIJB 4OFVA 2FLBT 2X4QB 4R0LA 2AS5M 3FO0H 1YPZB 3GMLA 3QZWB 4PJ5E 2CGRL 5GRWA 3MA7B 5KSUA 4JO2H 4OD2A 2VE6B 3L7EB 2A6JB 1RUPH 5D7LE 4YHLH 1JRHL 4PP2B 1HHGB 2FNBA 3UPAA 3WS3A 3Q6FA 2I25N 4NM4L 2DQTL 2NY1C 3DUUA 4OZHE 3C2SA 1H5BC 2FATL 4K94H 3MNWB 1HHKB 3QUYD 4RNRA 3ARBD 5I74C 4BSJA 1EAJA 3RNKA 2W0FA 4K7FB 5JO5A 4P4KA 4ZXBB 4HUMB 5JA9A 4L9DA 4PGDA 1KPVA 3F8UB 3L7FA 2BK8A 3BJLA 4HAFA 5DD0H 3N1PC 4JFXB 1OGAD 4WIQA 4WU5A 1M71B 4I18C 4UUJA 3NPSC 4OLUL 4J1UA 5IBUB 3T08A 3WBDA 5IHUL 4K3EL 5F7MC 5CZXC 1RFDH 3K1KC 4LP4A 5E95B 4X80H 5DJ2A 3QJFB 1XGTB 1G7QA 2YSSB 3RDTB 4KQ4H 3B4NA 3GMNA 1HH6A 2ESVE 3NH7H 5DD6B 2JELL 4PJFA 3I6LE 3ZSTA 2ZWLT 3MNVB 3IDYB 5C6PB 1B3JA 1T1YA 4WRLA 4OZFH 1HCFX 5IVXE 3U46B 3IFLH 5JPNB 2VQTA 1NDMB 4WDIB 3QUMB 4KGLA 5AWNL 3PP4L 5TPWL 4YR6A 1LO4L 3FO9B 5JLZB 1C7TA 1JHTA 3QWRA 4L29B 2CXGA 2HKFL 4MAYD 5H8DA 3UZVB 2A6IB 2VO5A 3T3PF 1NANH 1CFTB 5F6IB 5JNYA 1W72A 5T3ZE 5GS2D 4NRYA 3QI9B 1I1AD 1WF5A 1FFOA 4OCYH 4XNMB 3SPVA 2X4PA 2X4NA 2YKLH 4G8IA 3T2OA 3BFOA 1KEGH 3UTPD 5JPMA 5ISZA 3KPSD 2YEZB 2Z8SA 4G7VH 4WFHD 1LO0L 2HT2D 2HFGH 2VXUL 4H26B 5T1DL 4AT6A 5DFTA 4DQOL 1FZOB 3PP3H 3TV3L 4TUKH 2A6DB 3PQYA 1DQDH 4G42A 3QIWD 3F58L 1N5AA 4HPOH 1BJ1J 3MRQB 4TRPH 5IROC 3ARZA 1AXTH 4Y4KC 2J6EA 4N8PA 5GGUB 5DVLA 2NLJB 4Y2DC 5FHAH 4XI5C 2BSSB 3VDAA 2CRZA 4HWZA 5FV2A 3L1OH 4JFZH 1BREA 4WW1B 1LE5A 3QEQE 3LRHA 3FONB 3DX6B 3W0WA 2IPTL 3HZVB 3IETA 4PJBF 5CJOL 5IROA 2CIIB 4J23A 5SWQB 1CTOA 2DWEA 2GYSA 4MXWH 4Y2DA 4F37K 3O6ML 1IEAA 4HCRL 3OR7B 5KAQG 4RMVA 4ZOEA 1NC2A 1GZPB 1T1WA 1TQCB 4Y4FA 3PDOB 1U3HC 2IAND 3KDMA 5F3HB 3FOMA 5HGDB 2HJLA 5C0IA 5K33A 1DCLA 1B6DA 1VGEL 3QDMB 4UU9B 1ZLVH 1S7XA 3C8HA 4LSQH 1BZQK 3GI9H 3D48R 3D69A 3MRJA 3V0WL 4O2EA 3ALXA 5MEQB 2WK2A 5BRZB 1U3HA 4OLZL 4LLQB 2A77L 5HPMA 4GLRI 5F9AC 3DXAD 4QRSB 4BK4A 4P2RD 3BMVA 5D7IA 3WXVH 1G9NC 4X8JB 5FB8A 3VWJA 2BNUA 5IWLC 2OP4L 2HT4C 1ZE3C 4U7KA 4WWID 4DKFL 3S34L 4PLOB 1C16B 4GAYA 3SE3A 2HN7A 2J7LA 3C6SA 4DUVA 2D7NA 5DF0A 4PGJA 3G08A 4HJJL 1L7TL 4HC1A 2V2WA 5J89A 4BUHA 5KJRL 4J12A 2W91A 2R1XB 5CILL 3VFUB 3EKCA 3FO2A 4JO1H 5L88H 1VDGA 1KLGB 4R96A 2NY5L 5HD8C 3O3DB 1JFQH 2C3HA 2HLAA 3DV6A 4K9EL 1OLZA 3FB8A 3MROB 3WKNA 1JF6A 1X5XA 4S0SD 4PJFE 1WISA 3PWLA 2D3VA 3SDXF 3V79C 1I3GH 1G84A 1MJ8H 2NY3B 3D2UA 1HILA 1H8NA 1NMBH 5I1IL 3QH3A 1UFUA 5D7JD 1KB5B 2VKWA 1LD9B 3AREB 3FT2B 3VXRB 5DUML 1J5OL 1HHHA 1N4XL 1OTSC 4IOIA 2DLEA 2XG5A 1S78D 2QSTA 3E6HA 4C56D 5EFIA 3OKOA 3C5ZD 3VA2C 4XPHH 2VLLB 3RL2B 3ZE0E 2GJ6A 3IDNB 2DQGL 1G6RA 1ZVHA 4XB8A 2ZSVB 1D6EB 1ZT1A 3C09C 3PV6A 1CCZA 4EBQL 5ISZE 1U3ZA 4ZS7H 4ZQKA 2J8HA 2JIXD 1RVFL 3WUWG 2GQHA 1E28A 1KN2L 4HLZH 2VIRB 3WLBB 5BS0D 5DJ0A 2PCPA 1EGJA 4K7PX 5I8EB 1A5FL 2P42B 2V2TB 1FQ9C 3GSQB 3U30B 1FLTX 1J1OH 4YWGL 4Z95L 1F5WA 1HKFA 1HNGA 5E4EB 2GAZA 2Y1VA 3MLXH 1HYSD 5ALCH 2Q20A 3NA4A 1SYVB 4M6NH 2BY3A 1NC4A 2FO4B 2FEDD 3RZCD 4LP5A 4PJHB 2G75A 4PRIB 2IF7A 3U82B 3FL7A 3BZEA 3TCLA 2WIIA 4M4RA 3W0WE 4GKNA 2PTTA 5DUPH 4IOFD 2YZ1A 3O11B 4AMKL 3B9DA 3H7BB 5TQ0H 4NKIH 4FXKB 2VR4A 1KCVL 1WWCA 3T8XB 1HHJB 4IM8A 4NO3A 3TH2T 2ZCHL 4WI3A 2QADD 5DQJA 2QQNH 3DBXB 2W9DL 3B2UC 1I3RB 5I19H 4Z0BH 3VFMA 1NCWL 1MRDL 4NQXA 4WFGD 5E6YA 3L3DB 4PLJD 1NUGA 4DN4L 5C09B 5ADOH 2P5ED 2YXFA 4PJAF 2QL1A 2ARJA 3SGDH 4R4BB 2F53B 3EOYG 4AL8H 4NQVB 3WS6C 3HNVH 2PF6A 1AQDA 2HTKD 3O8XC 2E6PA 5DD1L 1QR1A 1KGCD 3LHPH 2XQYG 2YRZA 1GSMA 2WUBL 5EU6A 4FTVE 3REVA 1ZT4B 5HHNB 2PW2A 4X0KA 3DSNA 1XF4A 4XAWH 4PRHA 1RZ7L 1LILA 4G8FB 4M93C 4IDJH 1BX2B 1PJ9A 4ODSL 3VRIA 4E42A 2MKLC 3BD4A 4MD0A 3MPCA 4DEPB 5I1JL 2Y06L 3MMEA 1RK1B 4NNYB 1F6AA 4NM8L 4NYLA 4EKXA 3MV11 4PJ9C 2IJ0C 5EZLB 2YD3A 5HGBB 4D2NA 5D70L 5IB3A 5FK9A 4U6HA 1NGPH 3QHZL 5I6XC 1FAKT 1IBGH 4O4YH 2DQHL 3MJ7A 3EDDA 1ZHLB 1YEIH 5GPRA 3DIFB 3BH9B 2VJXA 4IRSB 5D8JL 4FQXD 1VCAA 3R0NA 3G5ZB 3HZYB 4UQ3A 4JRXD 4OSUH 4DK3A 4NO0B 5D1ZA 4WV1C 3N85H 4IRJA 1EVUA 4YUEL 2CLVA 1GC1H 3U4BH 1KOAA 1CR9H 1GZQA 1C5DB 3QRFM 1NSNH 2XZCL 1GGIL 3L5JA 4KVNL 1EEYA 2F54D 4LPXA 1V7MH 4M1GL 1I1FB 2GJ6E 2WLZA 3LQAC 4EN3C 2OK0L 3UPRA 2O93L 1J05B 1AKJA 1I8IB 2IFFH 2DIBA 4RAUA 1DBKH 2MCG1 4R3SA 4LCIH 4UDUB 3MOBL 3VXMD 1KPUA 3GSOA 4HX1A 5F21B 3CFCH 3L3OB 2GCYA 2F74A 4LSVL 1JNNL 3MLUH 4GAJH 1YMME 3KPNA 3MYZA 2V9TA 3QNXA 4JPWH 1DFBH 2PXYD 1OGTA 4MJ4A 3S36X 1U8QA 2CRMA 3WFHB 1L6ZA 1DL7H 4LVOC 2JJWA 1IGJA 3TBVB 1U92A 3L5XL 5SWZB 1YZZA 3PGCB 1SEBB 1G0YR 1NCDL 1AD0A 1Q9OB 2GJZA 4LF3B 4S0TD 1N64H 4NQED 1JGVH 1UM6L 5MP6H 3SGEH 5L9DL 2Q7YB 1E6OL 4UIMA 5C0CB 4UI2A 3MRLB 4KJYB 4TVPL 1UQSB 3PG2A 5JOFB 1YEEL 5DRWA 8FABA 1GIGL 3IJHB 4M02A 4O58H 5KOMC 2AXHA 2FWOA 4FHBD 4MA7L 1Z2KA 1U3YA 3QPXL 1BECA 4XPTL 3MZTA 4XP4L 5D96B 5I2IA 3WO3B 3MRIB 1E6JH 1F4WH 1HKLL 4JREB 3VFNB 1L4IA 1RUAL 4ZNCD 4JAMA 5J4MA 3V5HB 4JZJC 5D1QC 2X7LA 5DD5H 4HS8L 4YHYC 3HE6A 4QRPD 3GK8H 4QXTB 4OF5A 3B5TA 1UA6L 1TETH 2ZSWA 4L8BB 5EU6E 1ZHKA 1NFKA 3P9LB 1YEHL 5DWUL 5GGQL 1VACA 2FL5B 4R4FL 1D9KC 4JRYB 2OLDA 4JZJA 4JZNB 4OD1H 1U41A 4DZ8A 5HBBA 4FG6D 3GHEH 2HFEB 3QQ3A 4S10A 4HSQA 2EDNA 2WQRA 1ACYL 5JIKA 5EN2B 5JR1L 4X4ME 5GS3A 1E4XH 4XBEL 3IAQA 5CLWA 2AJSL 3LMJH 5ETUA 1OF2A 5IESH 4RZCB 4Y4HB 5DJZB 1WIOA 3QDAA 3K2UH 5ACZA 2WINB 3N06B 2BHYA 4NZTL 1C5BH 4OZGB 3I6GB 4QYOB 5BVPH 4LOUD 5I16B 3OB0K 2W0KA 2R56H 1GHFL 3MV7D 2NTFB 3MBXL 4JY4A 4AEHH 2QSQA 3IKKA 1TZGH 1UWGL 3CFEA 3KPRE 3UDWC 1U6AL 3WMSA 1NLDL 1IT9L 4QRUB 1QO3A 2RCSL 2AV1A 3ARGC 4OT1H 5F7DB 4LCCB 4E41A 5FM5M 1JP5A 1EEQA 3ILQC 1KXQE 1U8MB 2H8PA 4HZLA 5IBLD 5C0AD 5H35A 2DQIL 1S7VB 3T1FA 2F8VA 4FQJL 4PJBA 1S7SB 5CJ8A 3ARGA 5F6HJ 3O3BA 5CEYB 4ETYA 5ESAB 4Y5YB 2GUOA 5EU7E 2F5AH 4MHHG 2LABA 1ZGLP 3LKNB 2X1XR 1PG7L 4WY7L 2JCCB 1DN0A 3TA3B 4TOYH 4TTDD 2B5IC 1KIRA 2VL5A 2DJ4A 3H9HB 4EI6A 3MLSH 1E27A 2HVJA 4KKLD 3IGAA 2R9HD 1YUHB 4DKEL 3ZKXC 5KVGH 1NFDF 1SEQL 3CC5B 4HH9A 5IKCB 4LVNB 5DO2D 1MAML 1ZTXL 5CIPH 1QACA 4P5KA 2VH5H 3DTXB 3Q3GA 1HZHH 4KDTA 4N90D 4AJ0A 3WJJC 4PRAB 5E70A 2I9LB 4M7LT 1RZKL 5IB4B 4LLWA 1CFSB 4PJ7F 3IT8D 3F7QA 4LCWB 3HZMA 1RUMH 1EHAA 1U8IA 4LDLB 2B7DT 4QTHA 5IFJA 2A73A 3I84A 1AGFA 4RQQA 5DJYB 4PLNC 4CL7A 1CK0L 5EU5B 1RIUL 4X6FB 5C2UB 5EZOL 3BKCL 3KJ4C 2MQ0A 2E8ZA 1SMAA 2H45A 2HVKB 1ND0B 3JV6A 3TH3T 1T80A 1R5IA 4ZXBD 1WSST 4ZOBA 3VFPA 4XPAH 5FOBB 3M17A 4CN6A 1LE9A 5FIEA 4O2FB 4MJ5A 4YXHH 2EC9T 1U8LB 1K4CB 4G80B 3CDFA 4PJCB 2O5XL 3BP4A 3H2WA 5CSZA 1ZHBA 1MNUH 5ESQB 1J12A 5DEFA 4NKDB 1X4YA 3UJTL 3P0VL 2IH3B 1SM3H 3SDXA 4XCEB 1BMGA 3RDTD 3T3MF 1UH4A 4Y16B 2DIAA 4KRMB 2YBRB 1KTRL 3BOVA 1BZ7A 4FNLL 4RA3A 5SWSE 4N0RA 3VH8G 4LLUA 4A6YH 4ELMB 4Q97A 3SKJH 3CFJA 3E6FA 1OB1B 1GCFA 4LLAA 4L3EA 1GVIA 2OTPA 4X6CB 1JMXA 2EEAA 1KCKA 1X5LA 4KC3B 1PZUB 5FGCE 1BOYA 3MV9A 1CE1H 4NGHH 4R8WL 2X4RB 4YO0B 1GL4B 3MRHB 3QI9D 1J18A 3QPQC 4AQOA 4P5TD 4WFFE 4UV7H 4XMPL 1IAKA 5FGSA 1AHWC 3P3YA 5F8RC 1XR8A 4JB9L 4LBEB 4OJFL 1YNKH 1RIVL 4M9PA 3HPLB 3RUGA 3QXAB 4U1NB 2ZUVA 1INEH 1FNEA 5EUKA 1A6WL 4NN7C 3DYMA 1L7IL 12E8H 3CVHB 3F65A 5F1NA 2BY1A 4BK5A 1DR9A 3CVHL 1UCBL 1A6PA 4E41E 1YA5A 5IM7A 5D2NB 2D31B 2AK4D 5TH2B 1P5UA 3MRCA 3WUWA 2AI0H 1DLFL 5IP4A 1YYLH 3PL6D 3SDCA 3T2QA 1XGPB 1QUNA 4HJ0C 1MQKH 2VQ1B 3C6LB 1NL0L 1JN6A 4PJIF 3HRZB 1JPGB 4JM2A 5IHZB 1WT5C 1U42A 1BQLH 4MWFB 3MV8E 1A7QH 1FP5A 3U0PB 1IC5L 3HAEA 4HFWB 1AR1D 4KAQH 3EYFA 3QAZC 4FXGB 3BDBA 1UEMA 3O4OB 3QRGL 4PJAA 1FSKC 5DHYA 4M7ZB 1LNUB 8CGTA 1RZFL 3D85B 2I27N 4NJAH 1N2RA 4ZOAA 1CFNA 2J88L 2ZP0T 3VMNA 1RURL 3QDMD 4I0CC 5C0GA 1TTFA 1UJ3A 1QEWB 2PTUA 3JWDC 1J87A 1CF8L 2VLJA 4OD3L 2GTZB 4Y5XA 1F2QA 2FGWH 4XVSL 4BFIA 3RNQB 4LLMB 3H6JA 4QRTA 4JHWL 3BZFA 1KIPB 4X5XA 5BRZD 3U7AA 2W92A 4V2BA 4PR5B 3CSGA 5I17B 1ZLUK 5JUEL 2C1PA 3EJZC 1DQJB 1H3VA 2IAMC 3GMRA 4EVNA 1Q1JH 2XWJB 4PGEA 4BH7A 3VGAC 3O3EA 32C2A 4BFEA 4NIKB 1OAKH 1T7VA 5DT1L 2R69H 4KK6C 4ENED 5HHQB 1BWMA 4JM4H 4GRLC 1R3IH 4K94C 4M43H 4UB0H 4PJDB 5BXFB 1T20B 2CDGA 3IFNL 2YUWA 2FDBP 2OZ4A 5GHWH 5F1KC 2FH6A 4URTB 3KYNB 2QR0B 3RHWK 1Z3GH 4XVJH 3DETC 1QLRA 1T22B 1EEZA 4HUVA 3S88L 3L5WA 5SV4A 5GSRA 1KIQB 5JOPD 2NY3D 3DVIA 5EUOB 1IEBA 4D0BA 3RVXC 5KTEL 1R5VB 5T1KD 3CVIL 3FFCD 4LGRB 1DQQB 4MCYA 5FXCH 1S3KH 3VXRD 5GJTL 4NN5C 3P0YH 4F33A 4XCFL 1TCMA 4QY8B 1JCKA 1PY9A 5HJ3B 1QRNA 4HF5H 4G9FA 3U6RA 3MV9E 3LAFA 2OJEB 4QRQA 1KXTB 1RK0A 3EW3B 5L2KE 2VXSL 3QIBA 4XTRD 1MVUA 3RIFK 3CXDH 4ZSOB 2MWCA 2Q87A 5K59F 5F97E 3RUGE 3LPFA 5IIEA 3DVFA 4OZFA 4H5SA 2AJUH 4PB9L 3RWEA 2CR3A 4RIRA 4M62H 4YXKL 1QZ1A 3BPCB 4ALAH 3QO1B 3CFBB 4WHDA 3FB5B 1H9VA 1BQUA 3NA9L 2ITDB 1FG2A 2BMKA 5BW7C 1QFOA 2BVPA 5D71H 2EH8L 4PRID 2IPUK 4M48L 1PKQB 5KS9B 1T1XB 6FABL 5DMKB 1CD1B 5HYSG 1SY6H 4L5FL 4PD4K 3MLTB 4LEOB 3QFDB 1WGOA 2N7AA 4PRPD 2BNRB 5IQ7L 2Q8BL 4AZ8A 3FQNB 2X4TA 5E08L 3G5YA 2IALA 3KLHC 3ZO0A 3HC0B 3ARFB 1QVOA 2FEEI 1FNGB 3LZFH 1OAZL 2L7UA 1MHHB 3IJSA 4YGAB 5EIQA 3MLPA 4XVUC 5C09D 2J5LC 4NJ9L 4AEEA 4YBLB 1FZJB 2VXVL 5CEZE 3V6FB 4XP5L 3SKMB 3MLRL 2F53D 2BNQB 1TQBC 5CP3H 2FYYB 3WFZA 5C86A 2GEEA 1AIFB 1IFHL 2J3SA 2VMFA 3EYVA 2VLJE 3SCMA 3WO4C 4BA8A 4NT6A 3O2DL 4M8QB 5CLTA 3ES6A 4YBQD 2VN7A 1DUYA 1NGYA 5FO8B 1TZHB 3MACL 3G5XB 3AAZB 1JWUA 4Z7VB 5HHXH 3FFDA 5INDA 1MFCH 2AJXL 1UVQA 1TVHA 4HPYL 5EWIL 3LDBC 3GI8L 2BVUA 4K23L 4QHUB 2XKSA 3FAXA 3EFFB 3RY5A 3QUYA 3ARBA 3RU8H 1U8OB 5E0QA 1SJEA 4MA1B 3MLYL 3NCYS 1KB5H 5KSAB 2G60H 5H94A 3G6DL 2GJJA 2GITB 4YDKH 4PGCB 1K6QL 1OGAA 2ZJSL 3OL2A 2V5YA 5E8PA 1KJVB 1EEUA 4HUXA 2QSCH 1T0NB 5ACLA 1ZLSL 2ERJC 2YD8A 3BO8A 3B2VL 4U3HA 3JXAA 2OQJA 1A7NH 5GS0D 4WI9A 5J12C 3BW9B 4POZD 2A9ML 3VFWA 1BVKB 1NDGA 2DWDB 4R4NC 1UKSA 2CQVA 2RFXA 3NZHL 1X9QA 3GNMH 1MCPL 3KR3H 4IRSD 4KUCD 2Z4QB 4MAYC 4YEFA 2H9GA 5GS1B 3UTZA 4U1JA 3KPLA 2DQCL 4YDIH 1EIBA 4NO0D 1RHHA 3NGBC 3OAZK 3BIAX 4R26H 1ES0B 4MAYA 4ONHB 1NBZA 1LDPH 4LMQI 4G9FE 3PWNA 1S9KC 5I8OH 5LXGL 1B90A 4YE4H 2Q6WB 1EO5A 1OTUC 5HDOA 3U7YH 1I1AA 1HH9A 2ICCA 3NAAH 3OGOE 3FZUC 3MOAL 2IFGA 4ZNEA 3KPSA 4EQ3A 4X7TB 1CLYH 2MPAL 3I6KA 5DRXA 1A0QL 3LQZA 1NFDA 2V17H 1G7PA 1UACL 4I77L 4ZFZA 1BF2A 3ZT6A 3BSZL 5CHNA 4X4XB 5D2LB 3INUH 2CH8A 4GSDH 3ULVE 3D0LB