2DWLA

Crystal structure of the pria protein complexed with oligonucleotides
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
105
structure length
105
Chain Sequence
MPVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDASELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*(DC))-3'
publication title Structural basis of the 3'-end recognition of a leading strand in stalled replication forks by PriA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 14
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.-:
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17764 PriA_3primeBD 3â?² DNA-binding domain (3â?²BD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.630 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dwlA01
2D7HA 2DWNA 2DWMA 2D7GA 4NL4H 2DWLA 2D7EA
chains in the Genus database with same CATH superfamily
2Y0QA 4GHLA 5EXTA 3GLGE 2CHGA 3PVSA 4L78A 3SC3A 3KOXE 1ZAEA 1OIZA 2LBCA 1HNWM 3L28A 3GLFB 3KOZE 3BXWA 3THGA 2RRUA 3K8ZA 1XHBA 1R4GA 4FWHA 1NY6A 2RGOA 1IXSA 1PRBA 2Y21A 3HHWA 2L7HA 5L8RF 3J81S 3OTOM 3GPYA 2XZFA 1R2YA 4LGMA 1R5LA 1J09A 1IBMM 1UFZA 1LTMA 1NO1A 1ZMWA 2YR0A 1VDDA 4XK8F 2DAKA 3GO8A 3GLHA 1GO5A 2CP8A 4NOOB 3KP0E 4ZPXA 1SXJD 3U6PA 4MM3B 3FTEA 4FCVA 2DHYA 2AHMA 1QQWA 4IBGA 2EUCA 1G59A 1J7KA 1CUKA 1GJSA 1L1TA 1VG5A 2HHHM 4KODA 1GVNA 1IQPA 2P5TA 1OTRA 2YNMD 3LCUA 4LJ6A 1HT2E 3DA1A 3A45A 2M5ZA 2CV1A 2JY5A 4OX9M 2DZOB 3SATA 8CATA 1IN7A 2EA0A 4M9XA 5EQTA 1PM5A 2KXEA 4GKJM 3C3EA 2VDBB 4RNAA 4LCBA 3MMPA 1YE9A 4QOSA 3B7ZA 4I4LA 1NNJA 3U5ZB 4L6V6 2QENA 2CHVA 4LF6M 4GKKM 3HZJA 3C58A 2W82A 3GLHE 3U61A 4DR6M 3SBJA 3RGSA 2QSFX 7CATA 3W68A 3HHXA 1A5TA 3E46A 4QNMA 1XMQM 2LVNC 4R3DA 4LFCM 1WJ7A 4GHAA 1GJTA 1IN4A 1Z5CA 4DR5M 4QHSA 2ZAOA 3H4MA 3FUTA 4CHTB 4G4QA 2R4JA 4LJ8A 4G4OA 1V33A 3U6LA 4JI0M 4HEOA 1T6OA 4R71A 3WHLA 3GPPA 3UK6A 5A2QS 1V34A 3AOGA 2OOBA 3KVWA 4DV7M 3R9XB 3GPUA 3J80S 4DR1M 1IXSB 2CRUA 2FNAA 3AOEC 1Q3CA 1MU5A 1QZMA 1QVRA 4WP2A 3FE3A 3VK8A 2JZ1A 3C3DA 2ZANA 5FTLA 5LMUM 2LXEA 2MH8A 3KDSE 1N77A 3TWKA 4HLQA 3GLHB 3AOEA 3MHVC 2QBYA 3LVVA 2FS1A 1NJFA 2QCUA 1MN3A 2Z4SA 2R4EA 1ZQ9A 3HX3A 5EXSA 1QYRA 4LFBM 3SHFA 2APLA 1E9RA 3JR5A 3HKPA 2UXCM 5KQDA 2V1CA 1XNRM 4JI2M 4GITA 4IIWA 4JI8M 2KRKA 2JA2A 2KW0A 5C1BA 1TDZA 4LF5M 2DHRA 3JAMS 1S3SA 3BBZA 4DUZM 2YFQA 2BJVA 3FUVA 2JWSA 1Z6TA 2XF3A 3T38A 4BB9A 2KZUA 2VIIA 4GRIA 5IT9S 4JN6A 4IBJA 4LG2A 1PJTA 4FCTA 5IREB 1X37A 2C98A 3J7BA 4AG6A 1IY1A 3RE8A 4CIZA 3SMPA 4XGIA 2KNAA 3JR4A 4B3SM 1NV8A 3K9OA 4REZA 2ZM6M 3GLGA 3U61B 1QAMA 3FTCA 1C1KA 5ITUA 2QNJA 1XC8A 2UU9M 4DV5M 4QHTA 1HT1E 2KEBA 4ITQA 3HJQA 1PJIA 1OFHA 1OKSA 3U6QA 1E94E 5IZ7D 1NNUC 3KOYE 2KNZA 1V92A 4B7GA 2C96A 2LHCA 4DR7M 2G5GX 1K3WA 2MR9A 4LJ7A 1TGUA 2JZ0A 3EIEA 4G3OA 3HJSA 5IWAM 3AFHA 1QDTA 2WSCF 4LJ5A 1W5TA 1NY5A 3AKZA 1PJSA 1ORYB 3KSXA 1HNXM 2DWNA 4B3TM 1ZV1A 2LVAA 4LF7M 2JP7A 2QP9X 1WR1B 2LWXA 5ITXE 2XGNA 1WXQA 4MGHA 1L1ZA 2BWEA 3VFDA 3L25A 3KOWE 4FVMA 1J5EM 1DO0A 1QUSA 4IJEA 3D8BA 3J7AS 1AUAA 3QAUA 2CV2A 2DAIA 2DKLA 3E9SA 4YHHM 1XNQM 1EIJA 1GL7A 2QBYB 1GLNA 4LZZA 1TH3A 1JQJC 1FJGM 4X66M 1TDHA 3H4JA 1Q3BA 1YLAA 2C5RA 3I51A 4RKUF 4IBBA 4DV3M 3TWLA 2GNOA 1TH2A 4PCZA 4AKGA 2X8AA 4X65M 2O5RA 3FRHA 3FUUA 4IBDA 4WURA 1OJLA 2R46A 3GQ5A 2FOIC 1I4WA 1BVSA 4FWDA 2K6BA 4G6ZA 5DFLA 3SYLA 2WZJA 4LJ9A 1IM2A 3ZH9B 2UXBM 3CF0A 5KPTA 1QZEA 2EO2A 3T15A 3W0FA 3HU3A 2LH0A 5KO3A 3UZUA 2XLJA 4DR3M 2H1RA 1N34M 4D81A 2J7OA 3K9PA 4AKIA 4NRWA 2K9DA 3PNVA 1C7YA 1Q39A 3SAUA 4AW4A 1EE8A 3GLGB 4M0DA 1OAOC 3FD9A 4NL4H 3B7NA 4IBFA 3FYCA 2UUBM 1FNNA 2KDLA 4RF1A 4Y28F 5FTMA 4MGKE 2H5XA 4S12A 4K0KM 4NSOB 1IXRC 2Q2EB 4DUYM 3SYKA 3ZQJA 3U6CA 2BJWA 4JV5M 1TTEA 3HU2A 4IBEA 1WIVA 3UJNA 2QQ8A 4X62M 1JR3D 4GC9A 4LRTA 1GKIA 4LF9M 2C9OA 1WGLA 2DWZB 1NJGA 2MGWA 3ILKA 1IY0A 2XZUA 3E4RA 2OPFA 1KFVA 2LVQD 5H37D 4G4NA 1NSFA 3K92A 2F5SA 4W5WA 3KFUG 3MJ5A 1PJJA 1DGGA 3NBIA 2JY8A 4NRVA 5ITRA 3SASA 2I7NA 4KHPM 3U6EA 3U6OA 1E9SA 3UGJA 4Q7JA 2JXNA 4XBOA 3WHKA 4OW0A 1IBLM 3VK7A 1NHWC 4LFAM 1QAOA 2JNHA 4II7A 5FTKA 3GRYA 2DZNB 3B89A 2VQEM 2C9CA 4NSRA 1VEGA 1H6UA 1QUTA 4AQYM 3R8FA 3K2LA 2WSFF 3MK6A 4MH0E 2MROB 4P16A 4RF0A 4KO8A 5EJCA 2E5LM 5EP3A 1NV9A 1Z5AA 5KPRA 3VKHA 2R18A 2B3TA 3SAVA 1R2ZA 1R7RA 2R6FA 5C18A 1GABA 2KZSA 3TWMA 4IBIA 1G8PA 1XB2B 3CF2A 1DO2A 4KT0F 2DENA 3I4VA 1QAQA 1TH4A 1G3IA 1F4IA 2HKJA 2F5OA 2FE8A 3SARA 3VDPA 4L8RC 2Y20A 1K82A 4BLCA 1IN6A 3A42A 3HWSA 3GLIA 2F5NA 5E26A 2V1UA 2DAMA 4L4UA 3M6AA 3QYEA 4AKHA 1HQCA 1OQYA 5ITXA 2ZBKB 1L2DA 3KXEC 3NBXX 4GC5A 2UUCM 2JY6B 3J2PB 3KSJA 1D0MA 2NQ8C 2XFSA 3FYDA 2XSZD 2QHOB 2DAEA 4HL4A 2X49A 2R44A 2LHGA 3FUWA 2CE7A 4I5SA 5DYGA 4FCWA 2UUAM 3AV0A 1NHGC 4JXJA 2O25A 5KQ8A 3K1JA 4DR4M 4GH9A 3UMMA 1Y8GA 3TPZA 1VQ1A 4FW9A 3GRUA 5EXXA 3VLFB 2DXIA 3DZDA 3B7QA 1G71A 1XXHE 3HU1A 1JB0F 3T6PA 4PD2A 5GKNA 1N36M 4LF8M 3GLIE 1N33M 5F3WA 3LQQA 1MJGM 3DFZA 4D82A 3M7GA 4KLNA 3L26A 3FUXA 2KNVA 1PJQA 2R62A 2D7EA 3KW6A 3E21A 1IY2A 1ZMVA 2XFTA 3HHZA 2R65A 2HL7A 4GIPA 2JUJA 1EFUB 1Q02A 2L2DA 5FTJA 4DV4M 4IJFA 4LJAA 3ZCBB 4I8OA 4AZFA 1VDLA 2FFJA 3M0EA 4NXMM 3CGWA 2RGHA 3IG8A 2CEAA 2A5YB 4L16A 3B74A 2M60A 2EKFA 2HAKA 2I7PA 4BBAA 3TL4X 2VQFM 2HWJA 1L2CA 1K3XA 3I01M 4EIWA 1HNZM 1HJPA 2OQ4A 4LY6A 4JI5M 3GP1A 3GLIB 2UXDM 1D0KA 3J27B 3D8LA 2DWLA 3LCVB 1N78A 3EIHA 2LVPC 2OOAA 4PDGA 1DGFA 2D7HA 1R6BX 4X64M 3NWLA 3L27A 1N75A 2KA6B 1XWIA 3HGIA 1I94M 1KYIA 3U60A 4JI1M 4MB7A 1OFIA 4AG5A 1SXJC 2BWBA 3B9PA 2JY7A 3LMMA 4JI4M 4TUWA 3W0LB 4NC6A 3I4YA 2X4AA 4LF4M 1PGYA 5FTNA 1DGBA 3TE6A 1WGNA 2Y0TA 2Z3XA 4AI6A 2J5YA 3T1HM 2L7IA 2R45A 1SXJA 3A98B 4F1IA 3Q8XA 3LQRA 3U6DA 4JYAM 4DV2M 3FTDA 1UM8A 3U6SA 2DWMA 2KHHA 4JI3M 3FTFA 4FD2A 1IFYA 2L4FA 3GPXA 4NXNM 4LRSA 1DV0A 5EP4A 2YQZA 5EP1A 2Z4RA 2DI0A 3ZC7B 2F5QA 4ANRA 2BNKA 3F92A 4GMQA 4DV1M 5ITYA 2DNAA 3HJ8A 2Z8YM 1Z5BA 4B08A 1MX0A 3RFWA 1T3TA 3CTWB 2K47A 1WHCA 2C99A 4JI7M 1JR3A 1RU3A 3W67A 3A46A 4R7GA 3PXGA 1SXJE 1NVMA 3IG5A 3V76A 3VDUA 5FSWA 5ITQA 5BR8M 2CFOA 2ERCA 4B7HA 4OU7A 2O01F 3TQSA 5BPVA 4CISA 1GL6A 3C9PA 2CHQA 1DGHA 1YSYA 5KPZA 3DOAA 1AIPC 2CUZA 2XH9A 2ZAMA 3PFIA 2L09A 1SG9A 2EKKA 4IBKA 4YY3M 4B3MM 2OO9A 2CWBA 4G4RA 4PT5A 3SFZA 1HQYE 2FH0A 4OVZA 3FRIA 3U60B 1HR0M 2G8LA 1JR3E 2L6OA 1VEJA 4LGYA 1XXHA 2L4EA 2Z7JA 4L15A 2LTUA 5ITTA 3GRVA 5DNYA 4JI6M 3AL0C 3I04M 4WW0A 1SXJB 2WSEF 1IXZA 2LVOC 4GEWA 2XEPA 3SHGB 2D7GA 3HY5A 2QZ4A 2VF7A 1KSFX 3GLFA 3U6MA 2GQFA 3KS4A 3SAWA 4MGZE 1LV7A 3GQ3A 1IN5A 1N32M 3IHPA 2KRUA 3VKGA 1P3QQ 3RGPA 3HHYA 4CJ6A 1IBKM 1E32A 1TF0B 4DV0M 4PDIA 1TR8A 1XMOM 1QDRA 2HCBA 3KP1E 2QPAA 2MJ5B 3BOSA 5JI3E 5DYIA 4QNRA 3SMSA 2G3QA 2XSZA 4CGYB 2DAGA 5E6JA 1L2BA 4D80A 4DR2M 1YUBA 4P17A 1OIPA 1Z59A 5EP2A 3QWLA 5EXPA 3CF6E 4M9ZA 1T43A 3AJIB 4Z8XA 3GLFE 3QYBA 4A3VB 2F5PA 4Z6YA 2DZLA 1DGHB 4MGIE 4B7FA 4DV6M 3L29A 4MGYE 2V6ZM 5JI2E 4LJ4A 3GQ4A 2RKOA 1OAIA 4IBCA 4F2LA 1D0LA 3LW5F 5LMNM 2CV0A 1QANA 4B3RM 1L8QA 1W5SA 5FLXS 4LZJA 4FWGA 3L2AA 3KS8A 1G4AE 2N35A 2EJSA 4M0WA 3U5ZA 2F4VM 4OVZB 3PNYA 2R0IA 3GRRA 2K0BX 4UN2B 3FKEA 1ZMUA 1D2NA 1VEKA 2VF8A 1XXHB 1IN8A 3IECA 3LVWA 1G41A 4M9SA 4DBGB 3T1YM 2ZTCA 4I81A 2ZTDA 2J7NA 3Q8GA 2LNHC 4QOZC 2DVWB
chains in the Genus database with same CATH topology
2Y0QA 4GHLA 5EXTA 2CHGA 3PVSA 4L78A 3SC3A 3KOXE 1ZAEA 1HNWM 3L28A 3GLFB 3KOZE 3THGA 3K8ZA 1XHBA 4FWHA 1NY6A 2RGOA 2Y21A 3HHWA 3J81S 3GPYA 2L7HA 3OTOM 2XZFA 1R2YA 4LGMA 1J09A 1IBMM 2YR0A 1VDDA 3GO8A 3GLHA 4NOOB 3KP0E 4ZPXA 1SXJD 3U6PA 4MM3B 3FTEA 4FCVA 2AHMA 1QQWA 4IBGA 2EUCA 1G59A 1J7KA 1L1TA 2HHHM 4KODA 1GVNA 1IQPA 2P5TA 2YNMD 4LJ6A 1HT2E 3DA1A 3A45A 2M5ZA 2CV1A 4OX9M 2DZOB 3SATA 8CATA 1IN7A 2EA0A 4M9XA 5EQTA 1PM5A 2KXEA 4GKJM 4RNAA 4LCBA 1YE9A 4QOSA 4I4LA 1NNJA 3U5ZB 4LF6M 2QENA 2CHVA 4GKKM 3C58A 2W82A 3U61A 4DR6M 3SBJA 3RGSA 7CATA 3HHXA 1XMQM 4QNMA 4R3DA 4LFCM 4GHAA 1IN4A 1Z5CA 4DR5M 4QHSA 2ZAOA 3H4MA 3FUTA 4CHTB 4G4QA 2R4JA 4LJ8A 4G4OA 3U6LA 4JI0M 3WHLA 3GPPA 3UK6A 5A2QS 3AOGA 3KVWA 4DV7M 3R9XB 3GPUA 3J80S 4DR1M 1IXSB 2FNAA 3AOEC 1Q3CA 1MU5A 1QZMA 1QVRA 3VK8A 2ZANA 5FTLA 5LMUM 2LXEA 3KDSE 1N77A 3TWKA 4HLQA 3GLHB 3AOEA 3MHVC 2QBYA 3LVVA 2QCUA 1NJFA 2Z4SA 2R4EA 1ZQ9A 5EXSA 4LFBM 1QYRA 3SHFA 1E9RA 3JR5A 3HKPA 5KQDA 2V1CA 1XNRM 4JI2M 4GITA 4IIWA 4JI8M 2KRKA 2JA2A 2KW0A 5C1BA 1TDZA 4LF5M 2DHRA 3JAMS 1S3SA 4DUZM 2YFQA 2BJVA 3FUVA 1Z6TA 2XF3A 3T38A 4BB9A 2KZUA 2VIIA 4GRIA 5IT9S 4JN6A 4IBJA 4LG2A 4FCTA 5IREB 1X37A 2C98A 3J7BA 4AG6A 1IY1A 3RE8A 3JR4A 3SMPA 4XGIA 4B3SM 4REZA 2ZM6M 3GLGA 3U61B 1QAMA 3FTCA 1C1KA 5ITUA 1XC8A 2C5RA 2UU9M 4DV5M 4QHTA 1HT1E 2KEBA 4ITQA 3HJQA 1PJIA 1OFHA 3U6QA 1E94E 5IZ7D 1NNUC 3KOYE 4B7GA 2C96A 4DR7M 2G5GX 1K3WA 4LJ7A 1TGUA 3EIEA 5IWAM 3HJSA 3AFHA 4LJ5A 1HNXM 2DWNA 1W5TA 1NY5A 3AKZA 3KSXA 1ORYB 4B3TM 4LF7M 2QP9X 5ITXE 2LWXA 2XGNA 1WXQA 4MGHA 1L1ZA 3VFDA 3L25A 3KOWE 4FVMA 1J5EM 1DO0A 4IJEA 3J7AS 3D8BA 3QAUA 2CV2A 1XNQM 3E9SA 4YHHM 1GL7A 2QBYB 1GLNA 4LZZA 1TH3A 1JQJC 1FJGM 4X66M 1TDHA 1Q3BA 3I51A 4IBBA 4DV3M 3TWLA 1TH2A 4PCZA 4AKGA 2X8AA 4X65M 2O5RA 3FUUA 4IBDA 4WURA 3GQ5A 1OJLA 2R46A 2UXCM 2FOIC 1I4WA 4FWDA 4G6ZA 3SYLA 3ZH9B 2UXBM 4LJ9A 1IM2A 3CF0A 5KPTA 2EO2A 3T15A 3W0FA 3HU3A 2LH0A 5KO3A 3UZUA 2XLJA 4DR3M 2H1RA 1N34M 4D81A 2J7OA 4AKIA 4NRWA 3PNVA 1Q39A 3SAUA 4AW4A 1EE8A 3GLGB 4M0DA 3FD9A 4NL4H 4IBFA 3FYCA 2UUBM 1FNNA 4RF1A 5FTMA 4MGKE 4S12A 4K0KM 4NSOB 1IXRC 2Q2EB 4DUYM 3SYKA 3U6CA 2BJWA 4JV5M 3HU2A 4IBEA 3UJNA 4X62M 1JR3D 4GC9A 4LRTA 1GKIA 4LF9M 2C9OA 2DWZB 1NJGA 3ILKA 1IY0A 2XZUA 3E4RA 2OPFA 1KFVA 5H37D 4G4NA 1NSFA 3K92A 2F5SA 4W5WA 3KFUG 3MJ5A 1PJJA 1DGGA 3NBIA 4NRVA 5ITRA 3SASA 2I7NA 4KHPM 3U6EA 3U6OA 1E9SA 3UGJA 4XBOA 3WHKA 4OW0A 1IBLM 3VK7A 1NHWC 4LFAM 1QAOA 4II7A 5FTKA 3GRYA 2DZNB 2VQEM 2C9CA 4NSRA 1H6UA 4AQYM 3R8FA 3K2LA 3MK6A 4P16A 4MH0E 4RF0A 5EJCA 4KO8A 2E5LM 5EP3A 5KPRA 1Z5AA 3VKHA 2R18A 3SAVA 1R2ZA 1R7RA 5C18A 2KZSA 3TWMA 4IBIA 1G8PA 3CF2A 1DO2A 3I4VA 1QAQA 1TH4A 1G3IA 2HKJA 2F5OA 2FE8A 3SARA 3VDPA 4L8RC 2Y20A 1K82A 4BLCA 1IN6A 3A42A 3HWSA 3GLIA 2F5NA 5E26A 2V1UA 4L4UA 3M6AA 4AKHA 1HQCA 5ITXA 2ZBKB 1L2DA 3KXEC 4GC5A 2UUCM 3KSJA 3J2PB 2NQ8C 2XFSA 3FYDA 2XSZD 4HL4A 2X49A 3FUWA 2CE7A 4I5SA 5DYGA 4FCWA 2UUAM 3AV0A 1NHGC 4JXJA 5KQ8A 3K1JA 4DR4M 4GH9A 3UMMA 3TPZA 4FW9A 2DXIA 3GRUA 5EXXA 3VLFB 3DZDA 3HU1A 4PD2A 4LF8M 1N36M 5GKNA 1N33M 5F3WA 3LQQA 3DFZA 4D82A 3M7GA 4KLNA 3L26A 3FUXA 2R62A 2D7EA 3KW6A 1IY2A 2XFTA 3HHZA 2R65A 2HL7A 4GIPA 5FTJA 4DV4M 4IJFA 4LJAA 3ZCBB 4I8OA 4AZFA 2FFJA 3M0EA 4NXMM 2RGHA 3IG8A 2CEAA 2A5YB 4L16A 2M60A 2I7PA 4BBAA 3TL4X 2VQFM 1L2CA 1K3XA 4EIWA 1HNZM 2OQ4A 4LY6A 4JI5M 3GP1A 3GLIB 2UXDM 3J27B 3D8LA 2DWLA 1N78A 3EIHA 4PDGA 1DGFA 2D7HA 1R6BX 4X64M 3NWLA 3L27A 1N75A 2KA6B 1XWIA 3HGIA 1I94M 1KYIA 3U60A 4JI1M 4MB7A 1OFIA 4AG5A 1SXJC 3B9PA 3LMMA 4TUWA 4JI4M 3W0LB 3I4YA 2X4AA 4LF4M 5FTNA 1DGBA 3TE6A 2Y0TA 2Z3XA 4AI6A 3T1HM 2L7IA 2R45A 1SXJA 3A98B 3Q8XA 3LQRA 3U6DA 4JYAM 4DV2M 3FTDA 1UM8A 3U6SA 2DWMA 4JI3M 3FTFA 4FD2A 3GPXA 4NXNM 4LRSA 5EP4A 2YQZA 5EP1A 2Z4RA 3ZC7B 2F5QA 2BNKA 4GMQA 4DV1M 5ITYA 3HJ8A 4B08A 1Z5BA 1MX0A 3RFWA 1T3TA 3CTWB 2K47A 2C99A 4JI7M 1JR3A 3A46A 4R7GA 3PXGA 1SXJE 1NVMA 3IG5A 3VDUA 5BR8M 5FSWA 5ITQA 4OU7A 2CFOA 2ERCA 4B7HA 3TQSA 5BPVA 4CISA 1GL6A 2CHQA 1DGHA 1YSYA 5KPZA 3DOAA 2CUZA 2XH9A 2ZAMA 3PFIA 2L09A 4IBKA 4YY3M 4B3MM 4G4RA 4PT5A 3SFZA 1HQYE 4OVZA 3U60B 1HR0M 2G8LA 2L6OA 4LGYA 1XXHA 2Z7JA 4L15A 5ITTA 5DNYA 3GRVA 4JI6M 3AL0C 4WW0A 1SXJB 1IXZA 2XEPA 3SHGB 2D7GA 3GLFA 2QZ4A 1KSFX 3U6MA 3KS4A 3SAWA 4MGZE 1LV7A 3GQ3A 1IN5A 1N32M 2KRUA 3VKGA 3RGPA 3HHYA 1IBKM 1E32A 4DV0M 4PDIA 1XMOM 2HCBA 3KP1E 2QPAA 3BOSA 5JI3E 5DYIA 4QNRA 3SMSA 2XSZA 4CGYB 5E6JA 1L2BA 4D80A 4DR2M 1YUBA 1Z59A 5EP2A 3QWLA 5EXPA 3CF6E 4M9ZA 3AJIB 4Z8XA 4A3VB 2F5PA 4Z6YA 1DGHB 4MGIE 4B7FA 4DV6M 3L29A 4MGYE 2V6ZM 5JI2E 4LJ4A 3GQ4A 2RKOA 4IBCA 2CV0A 5LMNM 4B3RM 1QANA 1L8QA 1W5SA 5FLXS 4LZJA 4FWGA 3L2AA 3KS8A 1G4AE 4M0WA 3U5ZA 2F4VM 4OVZB 3PNYA 3GRRA 3FKEA 1D2NA 1XXHB 1IN8A 3LVWA 4M9SA 1G41A 3T1YM 4I81A 2J7NA 2LNHC 4QOZC 2DVWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D7H A;  2DWN A;  2DWM A;  2D7G A;  4NL4 H;  2DWL A;  2D7E A; 
#chains in the Genus database with same CATH topology
 2Y0Q A;  4GHL A;  5EXT A;  3GLG E;  2CHG A;  3PVS A;  4L78 A;  3SC3 A;  3KOX E;  1ZAE A;  1OIZ A;  2LBC A;  1HNW M;  3L28 A;  3GLF B;  3KOZ E;  3BXW A;  3THG A;  2RRU A;  3K8Z A;  1XHB A;  1R4G A;  4FWH A;  1NY6 A;  2RGO A;  1IXS A;  1PRB A;  2Y21 A;  3HHW A;  2L7H A;  5L8R F;  3J81 S;  3OTO M;  3GPY A;  2XZF A;  1R2Y A;  4LGM A;  1R5L A;  1J09 A;  1IBM M;  1UFZ A;  1LTM A;  1NO1 A;  1ZMW A;  2YR0 A;  1VDD A;  4XK8 F;  2DAK A;  3GO8 A;  3GLH A;  1GO5 A;  2CP8 A;  4NOO B;  3KP0 E;  4ZPX A;  1SXJ D;  3U6P A;  4MM3 B;  3FTE A;  4FCV A;  2DHY A;  2AHM A;  1QQW A;  4IBG A;  2EUC A;  1G59 A;  1J7K A;  1CUK A;  1GJS A;  1L1T A;  1VG5 A;  2HHH M;  4KOD A;  1GVN A;  1IQP A;  2P5T A;  1OTR A;  2YNM D;  3LCU A;  4LJ6 A;  1HT2 E;  3DA1 A;  3A45 A;  2M5Z A;  2CV1 A;  2JY5 A;  4OX9 M;  2DZO B;  3SAT A;  8CAT A;  1IN7 A;  2EA0 A;  4M9X A;  5EQT A;  1PM5 A;  2KXE A;  4GKJ M;  3C3E A;  2VDB B;  4RNA A;  4LCB A;  3MMP A;  1YE9 A;  4QOS A;  3B7Z A;  4I4L A;  1NNJ A;  3U5Z B;  4L6V 6;  2QEN A;  2CHV A;  4LF6 M;  4GKK M;  3HZJ A;  3C58 A;  2W82 A;  3GLH E;  3U61 A;  4DR6 M;  3SBJ A;  3RGS A;  2QSF X;  7CAT A;  3W68 A;  3HHX A;  1A5T A;  3E46 A;  4QNM A;  1XMQ M;  2LVN C;  4R3D A;  4LFC M;  1WJ7 A;  4GHA A;  1GJT A;  1IN4 A;  1Z5C A;  4DR5 M;  4QHS A;  2ZAO A;  3H4M A;  3FUT A;  4CHT B;  4G4Q A;  2R4J A;  4LJ8 A;  4G4O A;  1V33 A;  3U6L A;  4JI0 M;  4HEO A;  1T6O A;  4R71 A;  3WHL A;  3GPP A;  3UK6 A;  5A2Q S;  1V34 A;  3AOG A;  2OOB A;  3KVW A;  4DV7 M;  3R9X B;  3GPU A;  3J80 S;  4DR1 M;  1IXS B;  2CRU A;  2FNA A;  3AOE C;  1Q3C A;  1MU5 A;  1QZM A;  1QVR A;  4WP2 A;  3FE3 A;  3VK8 A;  2JZ1 A;  3C3D A;  2ZAN A;  5FTL A;  5LMU M;  2LXE A;  2MH8 A;  3KDS E;  1N77 A;  3TWK A;  4HLQ A;  3GLH B;  3AOE A;  3MHV C;  2QBY A;  3LVV A;  2FS1 A;  1NJF A;  2QCU A;  1MN3 A;  2Z4S A;  2R4E A;  1ZQ9 A;  3HX3 A;  5EXS A;  1QYR A;  4LFB M;  3SHF A;  2APL A;  1E9R A;  3JR5 A;  3HKP A;  2UXC M;  5KQD A;  2V1C A;  1XNR M;  4JI2 M;  4GIT A;  4IIW A;  4JI8 M;  2KRK A;  2JA2 A;  2KW0 A;  5C1B A;  1TDZ A;  4LF5 M;  2DHR A;  3JAM S;  1S3S A;  3BBZ A;  4DUZ M;  2YFQ A;  2BJV A;  3FUV A;  2JWS A;  1Z6T A;  2XF3 A;  3T38 A;  4BB9 A;  2KZU A;  2VII A;  4GRI A;  5IT9 S;  4JN6 A;  4IBJ A;  4LG2 A;  1PJT A;  4FCT A;  5IRE B;  1X37 A;  2C98 A;  3J7B A;  4AG6 A;  1IY1 A;  3RE8 A;  4CIZ A;  3SMP A;  4XGI A;  2KNA A;  3JR4 A;  4B3S M;  1NV8 A;  3K9O A;  4REZ A;  2ZM6 M;  3GLG A;  3U61 B;  1QAM A;  3FTC A;  1C1K A;  5ITU A;  2QNJ A;  1XC8 A;  2UU9 M;  4DV5 M;  4QHT A;  1HT1 E;  2KEB A;  4ITQ A;  3HJQ A;  1PJI A;  1OFH A;  1OKS A;  3U6Q A;  1E94 E;  5IZ7 D;  1NNU C;  3KOY E;  2KNZ A;  1V92 A;  4B7G A;  2C96 A;  2LHC A;  4DR7 M;  2G5G X;  1K3W A;  2MR9 A;  4LJ7 A;  1TGU A;  2JZ0 A;  3EIE A;  4G3O A;  3HJS A;  5IWA M;  3AFH A;  1QDT A;  2WSC F;  4LJ5 A;  1W5T A;  1NY5 A;  3AKZ A;  1PJS A;  1ORY B;  3KSX A;  1HNX M;  2DWN A;  4B3T M;  1ZV1 A;  2LVA A;  4LF7 M;  2JP7 A;  2QP9 X;  1WR1 B;  2LWX A;  5ITX E;  2XGN A;  1WXQ A;  4MGH A;  1L1Z A;  2BWE A;  3VFD A;  3L25 A;  3KOW E;  4FVM A;  1J5E M;  1DO0 A;  1QUS A;  4IJE A;  3D8B A;  3J7A S;  1AUA A;  3QAU A;  2CV2 A;  2DAI A;  2DKL A;  3E9S A;  4YHH M;  1XNQ M;  1EIJ A;  1GL7 A;  2QBY B;  1GLN A;  4LZZ A;  1TH3 A;  1JQJ C;  1FJG M;  4X66 M;  1TDH A;  3H4J A;  1Q3B A;  1YLA A;  2C5R A;  3I51 A;  4RKU F;  4IBB A;  4DV3 M;  3TWL A;  2GNO A;  1TH2 A;  4PCZ A;  4AKG A;  2X8A A;  4X65 M;  2O5R A;  3FRH A;  3FUU A;  4IBD A;  4WUR A;  1OJL A;  2R46 A;  3GQ5 A;  2FOI C;  1I4W A;  1BVS A;  4FWD A;  2K6B A;  4G6Z A;  5DFL A;  3SYL A;  2WZJ A;  4LJ9 A;  1IM2 A;  3ZH9 B;  2UXB M;  3CF0 A;  5KPT A;  1QZE A;  2EO2 A;  3T15 A;  3W0F A;  3HU3 A;  2LH0 A;  5KO3 A;  3UZU A;  2XLJ A;  4DR3 M;  2H1R A;  1N34 M;  4D81 A;  2J7O A;  3K9P A;  4AKI A;  4NRW A;  2K9D A;  3PNV A;  1C7Y A;  1Q39 A;  3SAU A;  4AW4 A;  1EE8 A;  3GLG B;  4M0D A;  1OAO C;  3FD9 A;  4NL4 H;  3B7N A;  4IBF A;  3FYC A;  2UUB M;  1FNN A;  2KDL A;  4RF1 A;  4Y28 F;  5FTM A;  4MGK E;  2H5X A;  4S12 A;  4K0K M;  4NSO B;  1IXR C;  2Q2E B;  4DUY M;  3SYK A;  3ZQJ A;  3U6C A;  2BJW A;  4JV5 M;  1TTE A;  3HU2 A;  4IBE A;  1WIV A;  3UJN A;  2QQ8 A;  4X62 M;  1JR3 D;  4GC9 A;  4LRT A;  1GKI A;  4LF9 M;  2C9O A;  1WGL A;  2DWZ B;  1NJG A;  2MGW A;  3ILK A;  1IY0 A;  2XZU A;  3E4R A;  2OPF A;  1KFV A;  2LVQ D;  5H37 D;  4G4N A;  1NSF A;  3K92 A;  2F5S A;  4W5W A;  3KFU G;  3MJ5 A;  1PJJ A;  1DGG A;  3NBI A;  2JY8 A;  4NRV A;  5ITR A;  3SAS A;  2I7N A;  4KHP M;  3U6E A;  3U6O A;  1E9S A;  3UGJ A;  4Q7J A;  2JXN A;  4XBO A;  3WHK A;  4OW0 A;  1IBL M;  3VK7 A;  1NHW C;  4LFA M;  1QAO A;  2JNH A;  4II7 A;  5FTK A;  3GRY A;  2DZN B;  3B89 A;  2VQE M;  2C9C A;  4NSR A;  1VEG A;  1H6U A;  1QUT A;  4AQY M;  3R8F A;  3K2L A;  2WSF F;  3MK6 A;  4MH0 E;  2MRO B;  4P16 A;  4RF0 A;  4KO8 A;  5EJC A;  2E5L M;  5EP3 A;  1NV9 A;  1Z5A A;  5KPR A;  3VKH A;  2R18 A;  2B3T A;  3SAV A;  1R2Z A;  1R7R A;  2R6F A;  5C18 A;  1GAB A;  2KZS A;  3TWM A;  4IBI A;  1G8P A;  1XB2 B;  3CF2 A;  1DO2 A;  4KT0 F;  2DEN A;  3I4V A;  1QAQ A;  1TH4 A;  1G3I A;  1F4I A;  2HKJ A;  2F5O A;  2FE8 A;  3SAR A;  3VDP A;  4L8R C;  2Y20 A;  1K82 A;  4BLC A;  1IN6 A;  3A42 A;  3HWS A;  3GLI A;  2F5N A;  5E26 A;  2V1U A;  2DAM A;  4L4U A;  3M6A A;  3QYE A;  4AKH A;  1HQC A;  1OQY A;  5ITX A;  2ZBK B;  1L2D A;  3KXE C;  3NBX X;  4GC5 A;  2UUC M;  2JY6 B;  3J2P B;  3KSJ A;  1D0M A;  2NQ8 C;  2XFS A;  3FYD A;  2XSZ D;  2QHO B;  2DAE A;  4HL4 A;  2X49 A;  2R44 A;  2LHG A;  3FUW A;  2CE7 A;  4I5S A;  5DYG A;  4FCW A;  2UUA M;  3AV0 A;  1NHG C;  4JXJ A;  2O25 A;  5KQ8 A;  3K1J A;  4DR4 M;  4GH9 A;  3UMM A;  1Y8G A;  3TPZ A;  1VQ1 A;  4FW9 A;  3GRU A;  5EXX A;  3VLF B;  2DXI A;  3DZD A;  3B7Q A;  1G71 A;  1XXH E;  3HU1 A;  1JB0 F;  3T6P A;  4PD2 A;  5GKN A;  1N36 M;  4LF8 M;  3GLI E;  1N33 M;  5F3W A;  3LQQ A;  1MJG M;  3DFZ A;  4D82 A;  3M7G A;  4KLN A;  3L26 A;  3FUX A;  2KNV A;  1PJQ A;  2R62 A;  2D7E A;  3KW6 A;  3E21 A;  1IY2 A;  1ZMV A;  2XFT A;  3HHZ A;  2R65 A;  2HL7 A;  4GIP A;  2JUJ A;  1EFU B;  1Q02 A;  2L2D A;  5FTJ A;  4DV4 M;  4IJF A;  4LJA A;  3ZCB B;  4I8O A;  4AZF A;  1VDL A;  2FFJ A;  3M0E A;  4NXM M;  3CGW A;  2RGH A;  3IG8 A;  2CEA A;  2A5Y B;  4L16 A;  3B74 A;  2M60 A;  2EKF A;  2HAK A;  2I7P A;  4BBA A;  3TL4 X;  2VQF M;  2HWJ A;  1L2C A;  1K3X A;  3I01 M;  4EIW A;  1HNZ M;  1HJP A;  2OQ4 A;  4LY6 A;  4JI5 M;  3GP1 A;  3GLI B;  2UXD M;  1D0K A;  3J27 B;  3D8L A;  2DWL A;  3LCV B;  1N78 A;  3EIH A;  2LVP C;  2OOA A;  4PDG A;  1DGF A;  2D7H A;  1R6B X;  4X64 M;  3NWL A;  3L27 A;  1N75 A;  2KA6 B;  1XWI A;  3HGI A;  1I94 M;  1KYI A;  3U60 A;  4JI1 M;  4MB7 A;  1OFI A;  4AG5 A;  1SXJ C;  2BWB A;  3B9P A;  2JY7 A;  3LMM A;  4JI4 M;  4TUW A;  3W0L B;  4NC6 A;  3I4Y A;  2X4A A;  4LF4 M;  1PGY A;  5FTN A;  1DGB A;  3TE6 A;  1WGN A;  2Y0T A;  2Z3X A;  4AI6 A;  2J5Y A;  3T1H M;  2L7I A;  2R45 A;  1SXJ A;  3A98 B;  4F1I A;  3Q8X A;  3LQR A;  3U6D A;  4JYA M;  4DV2 M;  3FTD A;  1UM8 A;  3U6S A;  2DWM A;  2KHH A;  4JI3 M;  3FTF A;  4FD2 A;  1IFY A;  2L4F A;  3GPX A;  4NXN M;  4LRS A;  1DV0 A;  5EP4 A;  2YQZ A;  5EP1 A;  2Z4R A;  2DI0 A;  3ZC7 B;  2F5Q A;  4ANR A;  2BNK A;  3F92 A;  4GMQ A;  4DV1 M;  5ITY A;  2DNA A;  3HJ8 A;  2Z8Y M;  1Z5B A;  4B08 A;  1MX0 A;  3RFW A;  1T3T A;  3CTW B;  2K47 A;  1WHC A;  2C99 A;  4JI7 M;  1JR3 A;  1RU3 A;  3W67 A;  3A46 A;  4R7G A;  3PXG A;  1SXJ E;  1NVM A;  3IG5 A;  3V76 A;  3VDU A;  5FSW A;  5ITQ A;  5BR8 M;  2CFO A;  2ERC A;  4B7H A;  4OU7 A;  2O01 F;  3TQS A;  5BPV A;  4CIS A;  1GL6 A;  3C9P A;  2CHQ A;  1DGH A;  1YSY A;  5KPZ A;  3DOA A;  1AIP C;  2CUZ A;  2XH9 A;  2ZAM A;  3PFI A;  2L09 A;  1SG9 A;  2EKK A;  4IBK A;  4YY3 M;  4B3M M;  2OO9 A;  2CWB A;  4G4R A;  4PT5 A;  3SFZ A;  1HQY E;  2FH0 A;  4OVZ A;  3FRI A;  3U60 B;  1HR0 M;  2G8L A;  1JR3 E;  2L6O A;  1VEJ A;  4LGY A;  1XXH A;  2L4E A;  2Z7J A;  4L15 A;  2LTU A;  5ITT A;  3GRV A;  5DNY A;  4JI6 M;  3AL0 C;  3I04 M;  4WW0 A;  1SXJ B;  2WSE F;  1IXZ A;  2LVO C;  4GEW A;  2XEP A;  3SHG B;  2D7G A;  3HY5 A;  2QZ4 A;  2VF7 A;  1KSF X;  3GLF A;  3U6M A;  2GQF A;  3KS4 A;  3SAW A;  4MGZ E;  1LV7 A;  3GQ3 A;  1IN5 A;  1N32 M;  3IHP A;  2KRU A;  3VKG A;  1P3Q Q;  3RGP A;  3HHY A;  4CJ6 A;  1IBK M;  1E32 A;  1TF0 B;  4DV0 M;  4PDI A;  1TR8 A;  1XMO M;  1QDR A;  2HCB A;  3KP1 E;  2QPA A;  2MJ5 B;  3BOS A;  5JI3 E;  5DYI A;  4QNR A;  3SMS A;  2G3Q A;  2XSZ A;  4CGY B;  2DAG A;  5E6J A;  1L2B A;  4D80 A;  4DR2 M;  1YUB A;  4P17 A;  1OIP A;  1Z59 A;  5EP2 A;  3QWL A;  5EXP A;  3CF6 E;  4M9Z A;  1T43 A;  3AJI B;  4Z8X A;  3GLF E;  3QYB A;  4A3V B;  2F5P A;  4Z6Y A;  2DZL A;  1DGH B;  4MGI E;  4B7F A;  4DV6 M;  3L29 A;  4MGY E;  2V6Z M;  5JI2 E;  4LJ4 A;  3GQ4 A;  2RKO A;  1OAI A;  4IBC A;  4F2L A;  1D0L A;  3LW5 F;  5LMN M;  2CV0 A;  1QAN A;  4B3R M;  1L8Q A;  1W5S A;  5FLX S;  4LZJ A;  4FWG A;  3L2A A;  3KS8 A;  1G4A E;  2N35 A;  2EJS A;  4M0W A;  3U5Z A;  2F4V M;  4OVZ B;  3PNY A;  2R0I A;  3GRR A;  2K0B X;  4UN2 B;  3FKE A;  1ZMU A;  1D2N A;  1VEK A;  2VF8 A;  1XXH B;  1IN8 A;  3IEC A;  3LVW A;  1G41 A;  4M9S A;  4DBG B;  3T1Y M;  2ZTC A;  4I81 A;  2ZTD A;  2J7N A;  3Q8G A;  2LNH C;  4QOZ C;  2DVW B; 
#chains in the Genus database with same CATH homology
 2Y0Q A;  4GHL A;  5EXT A;  2CHG A;  3PVS A;  4L78 A;  3SC3 A;  3KOX E;  1ZAE A;  1HNW M;  3L28 A;  3GLF B;  3KOZ E;  3THG A;  3K8Z A;  1XHB A;  4FWH A;  1NY6 A;  2RGO A;  2Y21 A;  3HHW A;  3J81 S;  3GPY A;  2L7H A;  3OTO M;  2XZF A;  1R2Y A;  4LGM A;  1J09 A;  1IBM M;  2YR0 A;  1VDD A;  3GO8 A;  3GLH A;  4NOO B;  3KP0 E;  4ZPX A;  1SXJ D;  3U6P A;  4MM3 B;  3FTE A;  4FCV A;  2AHM A;  1QQW A;  4IBG A;  2EUC A;  1G59 A;  1J7K A;  1L1T A;  2HHH M;  4KOD A;  1GVN A;  1IQP A;  2P5T A;  2YNM D;  4LJ6 A;  1HT2 E;  3DA1 A;  3A45 A;  2M5Z A;  2CV1 A;  4OX9 M;  2DZO B;  3SAT A;  8CAT A;  1IN7 A;  2EA0 A;  4M9X A;  5EQT A;  1PM5 A;  2KXE A;  4GKJ M;  4RNA A;  4LCB A;  1YE9 A;  4QOS A;  4I4L A;  1NNJ A;  3U5Z B;  4LF6 M;  2QEN A;  2CHV A;  4GKK M;  3C58 A;  2W82 A;  3U61 A;  4DR6 M;  3SBJ A;  3RGS A;  7CAT A;  3HHX A;  1XMQ M;  4QNM A;  4R3D A;  4LFC M;  4GHA A;  1IN4 A;  1Z5C A;  4DR5 M;  4QHS A;  2ZAO A;  3H4M A;  3FUT A;  4CHT B;  4G4Q A;  2R4J A;  4LJ8 A;  4G4O A;  3U6L A;  4JI0 M;  3WHL A;  3GPP A;  3UK6 A;  5A2Q S;  3AOG A;  3KVW A;  4DV7 M;  3R9X B;  3GPU A;  3J80 S;  4DR1 M;  1IXS B;  2FNA A;  3AOE C;  1Q3C A;  1MU5 A;  1QZM A;  1QVR A;  3VK8 A;  2ZAN A;  5FTL A;  5LMU M;  2LXE A;  3KDS E;  1N77 A;  3TWK A;  4HLQ A;  3GLH B;  3AOE A;  3MHV C;  2QBY A;  3LVV A;  2QCU A;  1NJF A;  2Z4S A;  2R4E A;  1ZQ9 A;  5EXS A;  4LFB M;  1QYR A;  3SHF A;  1E9R A;  3JR5 A;  3HKP A;  5KQD A;  2V1C A;  1XNR M;  4JI2 M;  4GIT A;  4IIW A;  4JI8 M;  2KRK A;  2JA2 A;  2KW0 A;  5C1B A;  1TDZ A;  4LF5 M;  2DHR A;  3JAM S;  1S3S A;  4DUZ M;  2YFQ A;  2BJV A;  3FUV A;  1Z6T A;  2XF3 A;  3T38 A;  4BB9 A;  2KZU A;  2VII A;  4GRI A;  5IT9 S;  4JN6 A;  4IBJ A;  4LG2 A;  4FCT A;  5IRE B;  1X37 A;  2C98 A;  3J7B A;  4AG6 A;  1IY1 A;  3RE8 A;  3JR4 A;  3SMP A;  4XGI A;  4B3S M;  4REZ A;  2ZM6 M;  3GLG A;  3U61 B;  1QAM A;  3FTC A;  1C1K A;  5ITU A;  1XC8 A;  2C5R A;  2UU9 M;  4DV5 M;  4QHT A;  1HT1 E;  2KEB A;  4ITQ A;  3HJQ A;  1PJI A;  1OFH A;  3U6Q A;  1E94 E;  5IZ7 D;  1NNU C;  3KOY E;  4B7G A;  2C96 A;  4DR7 M;  2G5G X;  1K3W A;  4LJ7 A;  1TGU A;  3EIE A;  5IWA M;  3HJS A;  3AFH A;  4LJ5 A;  1HNX M;  2DWN A;  1W5T A;  1NY5 A;  3AKZ A;  3KSX A;  1ORY B;  4B3T M;  4LF7 M;  2QP9 X;  5ITX E;  2LWX A;  2XGN A;  1WXQ A;  4MGH A;  1L1Z A;  3VFD A;  3L25 A;  3KOW E;  4FVM A;  1J5E M;  1DO0 A;  4IJE A;  3J7A S;  3D8B A;  3QAU A;  2CV2 A;  1XNQ M;  3E9S A;  4YHH M;  1GL7 A;  2QBY B;  1GLN A;  4LZZ A;  1TH3 A;  1JQJ C;  1FJG M;  4X66 M;  1TDH A;  1Q3B A;  3I51 A;  4IBB A;  4DV3 M;  3TWL A;  1TH2 A;  4PCZ A;  4AKG A;  2X8A A;  4X65 M;  2O5R A;  3FUU A;  4IBD A;  4WUR A;  3GQ5 A;  1OJL A;  2R46 A;  2UXC M;  2FOI C;  1I4W A;  4FWD A;  4G6Z A;  3SYL A;  3ZH9 B;  2UXB M;  4LJ9 A;  1IM2 A;  3CF0 A;  5KPT A;  2EO2 A;  3T15 A;  3W0F A;  3HU3 A;  2LH0 A;  5KO3 A;  3UZU A;  2XLJ A;  4DR3 M;  2H1R A;  1N34 M;  4D81 A;  2J7O A;  4AKI A;  4NRW A;  3PNV A;  1Q39 A;  3SAU A;  4AW4 A;  1EE8 A;  3GLG B;  4M0D A;  3FD9 A;  4NL4 H;  4IBF A;  3FYC A;  2UUB M;  1FNN A;  4RF1 A;  5FTM A;  4MGK E;  4S12 A;  4K0K M;  4NSO B;  1IXR C;  2Q2E B;  4DUY M;  3SYK A;  3U6C A;  2BJW A;  4JV5 M;  3HU2 A;  4IBE A;  3UJN A;  4X62 M;  1JR3 D;  4GC9 A;  4LRT A;  1GKI A;  4LF9 M;  2C9O A;  2DWZ B;  1NJG A;  3ILK A;  1IY0 A;  2XZU A;  3E4R A;  2OPF A;  1KFV A;  5H37 D;  4G4N A;  1NSF A;  3K92 A;  2F5S A;  4W5W A;  3KFU G;  3MJ5 A;  1PJJ A;  1DGG A;  3NBI A;  4NRV A;  5ITR A;  3SAS A;  2I7N A;  4KHP M;  3U6E A;  3U6O A;  1E9S A;  3UGJ A;  4XBO A;  3WHK A;  4OW0 A;  1IBL M;  3VK7 A;  1NHW C;  4LFA M;  1QAO A;  4II7 A;  5FTK A;  3GRY A;  2DZN B;  2VQE M;  2C9C A;  4NSR A;  1H6U A;  4AQY M;  3R8F A;  3K2L A;  3MK6 A;  4P16 A;  4MH0 E;  4RF0 A;  5EJC A;  4KO8 A;  2E5L M;  5EP3 A;  5KPR A;  1Z5A A;  3VKH A;  2R18 A;  3SAV A;  1R2Z A;  1R7R A;  5C18 A;  2KZS A;  3TWM A;  4IBI A;  1G8P A;  3CF2 A;  1DO2 A;  3I4V A;  1QAQ A;  1TH4 A;  1G3I A;  2HKJ A;  2F5O A;  2FE8 A;  3SAR A;  3VDP A;  4L8R C;  2Y20 A;  1K82 A;  4BLC A;  1IN6 A;  3A42 A;  3HWS A;  3GLI A;  2F5N A;  5E26 A;  2V1U A;  4L4U A;  3M6A A;  4AKH A;  1HQC A;  5ITX A;  2ZBK B;  1L2D A;  3KXE C;  4GC5 A;  2UUC M;  3KSJ A;  3J2P B;  2NQ8 C;  2XFS A;  3FYD A;  2XSZ D;  4HL4 A;  2X49 A;  3FUW A;  2CE7 A;  4I5S A;  5DYG A;  4FCW A;  2UUA M;  3AV0 A;  1NHG C;  4JXJ A;  5KQ8 A;  3K1J A;  4DR4 M;  4GH9 A;  3UMM A;  3TPZ A;  4FW9 A;  2DXI A;  3GRU A;  5EXX A;  3VLF B;  3DZD A;  3HU1 A;  4PD2 A;  4LF8 M;  1N36 M;  5GKN A;  1N33 M;  5F3W A;  3LQQ A;  3DFZ A;  4D82 A;  3M7G A;  4KLN A;  3L26 A;  3FUX A;  2R62 A;  2D7E A;  3KW6 A;  1IY2 A;  2XFT A;  3HHZ A;  2R65 A;  2HL7 A;  4GIP A;  5FTJ A;  4DV4 M;  4IJF A;  4LJA A;  3ZCB B;  4I8O A;  4AZF A;  2FFJ A;  3M0E A;  4NXM M;  2RGH A;  3IG8 A;  2CEA A;  2A5Y B;  4L16 A;  2M60 A;  2I7P A;  4BBA A;  3TL4 X;  2VQF M;  1L2C A;  1K3X A;  4EIW A;  1HNZ M;  2OQ4 A;  4LY6 A;  4JI5 M;  3GP1 A;  3GLI B;  2UXD M;  3J27 B;  3D8L A;  2DWL A;  1N78 A;  3EIH A;  4PDG A;  1DGF A;  2D7H A;  1R6B X;  4X64 M;  3NWL A;  3L27 A;  1N75 A;  2KA6 B;  1XWI A;  3HGI A;  1I94 M;  1KYI A;  3U60 A;  4JI1 M;  4MB7 A;  1OFI A;  4AG5 A;  1SXJ C;  3B9P A;  3LMM A;  4TUW A;  4JI4 M;  3W0L B;  3I4Y A;  2X4A A;  4LF4 M;  5FTN A;  1DGB A;  3TE6 A;  2Y0T A;  2Z3X A;  4AI6 A;  3T1H M;  2L7I A;  2R45 A;  1SXJ A;  3A98 B;  3Q8X A;  3LQR A;  3U6D A;  4JYA M;  4DV2 M;  3FTD A;  1UM8 A;  3U6S A;  2DWM A;  4JI3 M;  3FTF A;  4FD2 A;  3GPX A;  4NXN M;  4LRS A;  5EP4 A;  2YQZ A;  5EP1 A;  2Z4R A;  3ZC7 B;  2F5Q A;  2BNK A;  4GMQ A;  4DV1 M;  5ITY A;  3HJ8 A;  4B08 A;  1Z5B A;  1MX0 A;  3RFW A;  1T3T A;  3CTW B;  2K47 A;  2C99 A;  4JI7 M;  1JR3 A;  3A46 A;  4R7G A;  3PXG A;  1SXJ E;  1NVM A;  3IG5 A;  3VDU A;  5BR8 M;  5FSW A;  5ITQ A;  4OU7 A;  2CFO A;  2ERC A;  4B7H A;  3TQS A;  5BPV A;  4CIS A;  1GL6 A;  2CHQ A;  1DGH A;  1YSY A;  5KPZ A;  3DOA A;  2CUZ A;  2XH9 A;  2ZAM A;  3PFI A;  2L09 A;  4IBK A;  4YY3 M;  4B3M M;  4G4R A;  4PT5 A;  3SFZ A;  1HQY E;  4OVZ A;  3U60 B;  1HR0 M;  2G8L A;  2L6O A;  4LGY A;  1XXH A;  2Z7J A;  4L15 A;  5ITT A;  5DNY A;  3GRV A;  4JI6 M;  3AL0 C;  4WW0 A;  1SXJ B;  1IXZ A;  2XEP A;  3SHG B;  2D7G A;  3GLF A;  2QZ4 A;  1KSF X;  3U6M A;  3KS4 A;  3SAW A;  4MGZ E;  1LV7 A;  3GQ3 A;  1IN5 A;  1N32 M;  2KRU A;  3VKG A;  3RGP A;  3HHY A;  1IBK M;  1E32 A;  4DV0 M;  4PDI A;  1XMO M;  2HCB A;  3KP1 E;  2QPA A;  3BOS A;  5JI3 E;  5DYI A;  4QNR A;  3SMS A;  2XSZ A;  4CGY B;  5E6J A;  1L2B A;  4D80 A;  4DR2 M;  1YUB A;  1Z59 A;  5EP2 A;  3QWL A;  5EXP A;  3CF6 E;  4M9Z A;  3AJI B;  4Z8X A;  4A3V B;  2F5P A;  4Z6Y A;  1DGH B;  4MGI E;  4B7F A;  4DV6 M;  3L29 A;  4MGY E;  2V6Z M;  5JI2 E;  4LJ4 A;  3GQ4 A;  2RKO A;  4IBC A;  2CV0 A;  5LMN M;  4B3R M;  1QAN A;  1L8Q A;  1W5S A;  5FLX S;  4LZJ A;  4FWG A;  3L2A A;  3KS8 A;  1G4A E;  4M0W A;  3U5Z A;  2F4V M;  4OVZ B;  3PNY A;  3GRR A;  3FKE A;  1D2N A;  1XXH B;  1IN8 A;  3LVW A;  4M9S A;  1G41 A;  3T1Y M;  4I81 A;  2J7N A;  2LNH C;  4QOZ C;  2DVW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...