2DWVA

Solution structure of the second ww domain from mouse salvador homolog 1 protein (mww45)
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
49
structure length
49
Chain Sequence
GSSGSSGPLEREGLPPGWERVESSEFGTYYVDHTNKRAQYRHPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Salvador homolog 1 protein
publication title Solution structure of an atypical WW domain in a novel beta-clam-like dimeric form
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 1
structure length 49
sequence length 49
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2dwvA01
2ZR5A 4U85A 1NMVA 2XP4A 2ITKA 1F8AB 2XP7A 3M7NA 2Q5AA 4REXA 2XP9A 2M3OW 2XPBA 4U86A 3CNGA 2F21A 2ZQUA 5AHTA 1K9RA 2LAJA 3TCZA 1EG3A 2DK1A 3OOBA 2EZ5W 2JMFA 1EG4A 3LE4A 2YSFA 4U84A 2ZQVA 1I5HW 1O6WA 3ODKA 4E5RA 2XP6A 2DWVA 2XP5A 2XP8A 3WH0A 2JXWA 1ZCNA 2M8JA 2RE3A 2YSBA 2MDIA 3NTPA 2DK7A 1K9QA 2M8IA 2DJYA 3TDBA 2YSIA 3KAFA 2L4JA 2ZQSA 1WMVA 2E45A 2ZAJA 2YSHA 3KADA 2DMVA 2YSGA 1YW5A 3KABA 3L4HA 2ZQTA 3TC5A 4QIBA 1JMQA 2JV4A 3KAGA 1PINA 3KAHA 1TK7A 3KAIA 1WR7A 3M85A 5CQ2A 2XPAA 3KCEA 2KXQA 2ZR6A 2JX8A 2BA1A 2ZR4A 2XP3A
chains in the Genus database with same CATH superfamily
2ZR5A 4U85A 1NMVA 2OWOA 2XP4A 2ITKA 1F8AB 2XP7A 3M7NA 2Q5AA 4REXA 3PQHA 5U47A 3MCBB 2XP9A 2M3OW 2XPBA 5E66A 4U86A 3MQHA 3CNGA 2F21A 2YAJB 2ZQUA 5AHTA 1K9RA 2LAJA 3TCZA 1EG3A 2DK1A 3OOBA 2EZ5W 2JMFA 1EG4A 3LE4A 2YSFA 4U84A 2ZQVA 1I5HW 1FLCA 1O6WA 3ODKA 5E65A 3FSBA 4E5RA 2XP6A 2DWVA 2XP5A 2XP8A 3WH0A 2Y8NB 2JXWA 1ZCNA 2WAEA 3MQGA 3MCBA 5E62A 4A0UA 2M8JA 2RE3A 2YSBA 2MDIA 3NTPA 2DK7A 1K9QA 2WADA 2M8IA 2DJYA 3TDBA 2YSIA 3KAFA 3FSCA 3LKXB 4A0TA 2L4JA 2ZQSA 4GLXA 1WMVA 2E45A 2ZAJA 2YSHA 3KADA 2DMVA 2YSGA 1RP5A 1YW5A 3KABA 3L4HA 2QRVA 2ZQTA 5E64A 3TC5A 4QIBA 1JMQA 2JV4A 3KAGA 1PINA 3KAHA 1TK7A 3FS8A 3KAIA 1WR7A 3M85A 5CQ2A 5E5WA 1TR8A 2XPAA 3KCEA 2KXQA 2ZR6A 2JX8A 2BA1A 3LKXA 2ZR4A 2XP3A
chains in the Genus database with same CATH topology
2ZR5A 4U85A 1NMVA 2OWOA 2XP4A 2ITKA 1F8AB 2XP7A 3M7NA 2Q5AA 4REXA 3PQHA 5U47A 3MCBB 2XP9A 2M3OW 2XPBA 5E66A 4U86A 3MQHA 3CNGA 2F21A 2YAJB 2ZQUA 5AHTA 1K9RA 2LAJA 3TCZA 1EG3A 2DK1A 3OOBA 2EZ5W 2JMFA 1EG4A 3LE4A 2YSFA 4U84A 2ZQVA 1I5HW 1FLCA 1O6WA 3ODKA 5E65A 3FSBA 4E5RA 2XP6A 2DWVA 2XP5A 2XP8A 3WH0A 2Y8NB 2JXWA 1ZCNA 2WAEA 3MQGA 3MCBA 5E62A 4A0UA 2M8JA 2RE3A 2YSBA 2MDIA 3NTPA 2DK7A 1K9QA 2WADA 2M8IA 2DJYA 3TDBA 2YSIA 3KAFA 3FSCA 3LKXB 4A0TA 2L4JA 2ZQSA 4GLXA 1WMVA 2E45A 2ZAJA 2YSHA 3KADA 2DMVA 2YSGA 1RP5A 1YW5A 3KABA 3L4HA 2QRVA 2ZQTA 5E64A 3TC5A 4QIBA 1JMQA 2JV4A 3KAGA 1PINA 3KAHA 1TK7A 3FS8A 3KAIA 1WR7A 3M85A 5CQ2A 5E5WA 1TR8A 2XPAA 3KCEA 2KXQA 2ZR6A 2JX8A 2BA1A 3LKXA 2ZR4A 2XP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZR5 A;  4U85 A;  1NMV A;  2XP4 A;  2ITK A;  1F8A B;  2XP7 A;  3M7N A;  2Q5A A;  4REX A;  2XP9 A;  2M3O W;  2XPB A;  4U86 A;  3CNG A;  2F21 A;  2ZQU A;  5AHT A;  1K9R A;  2LAJ A;  3TCZ A;  1EG3 A;  2DK1 A;  3OOB A;  2EZ5 W;  2JMF A;  1EG4 A;  3LE4 A;  2YSF A;  4U84 A;  2ZQV A;  1I5H W;  1O6W A;  3ODK A;  4E5R A;  2XP6 A;  2DWV A;  2XP5 A;  2XP8 A;  3WH0 A;  2JXW A;  1ZCN A;  2M8J A;  2RE3 A;  2YSB A;  2MDI A;  3NTP A;  2DK7 A;  1K9Q A;  2M8I A;  2DJY A;  3TDB A;  2YSI A;  3KAF A;  2L4J A;  2ZQS A;  1WMV A;  2E45 A;  2ZAJ A;  2YSH A;  3KAD A;  2DMV A;  2YSG A;  1YW5 A;  3KAB A;  3L4H A;  2ZQT A;  3TC5 A;  4QIB A;  1JMQ A;  2JV4 A;  3KAG A;  1PIN A;  3KAH A;  1TK7 A;  3KAI A;  1WR7 A;  3M85 A;  5CQ2 A;  2XPA A;  3KCE A;  2KXQ A;  2ZR6 A;  2JX8 A;  2BA1 A;  2ZR4 A;  2XP3 A; 
#chains in the Genus database with same CATH topology
 2ZR5 A;  4U85 A;  1NMV A;  2OWO A;  2XP4 A;  2ITK A;  1F8A B;  2XP7 A;  3M7N A;  2Q5A A;  4REX A;  3PQH A;  5U47 A;  3MCB B;  2XP9 A;  2M3O W;  2XPB A;  5E66 A;  4U86 A;  3MQH A;  3CNG A;  2F21 A;  2YAJ B;  2ZQU A;  5AHT A;  1K9R A;  2LAJ A;  3TCZ A;  1EG3 A;  2DK1 A;  3OOB A;  2EZ5 W;  2JMF A;  1EG4 A;  3LE4 A;  2YSF A;  4U84 A;  2ZQV A;  1I5H W;  1FLC A;  1O6W A;  3ODK A;  5E65 A;  3FSB A;  4E5R A;  2XP6 A;  2DWV A;  2XP5 A;  2XP8 A;  3WH0 A;  2Y8N B;  2JXW A;  1ZCN A;  2WAE A;  3MQG A;  3MCB A;  5E62 A;  4A0U A;  2M8J A;  2RE3 A;  2YSB A;  2MDI A;  3NTP A;  2DK7 A;  1K9Q A;  2WAD A;  2M8I A;  2DJY A;  3TDB A;  2YSI A;  3KAF A;  3FSC A;  3LKX B;  4A0T A;  2L4J A;  2ZQS A;  4GLX A;  1WMV A;  2E45 A;  2ZAJ A;  2YSH A;  3KAD A;  2DMV A;  2YSG A;  1RP5 A;  1YW5 A;  3KAB A;  3L4H A;  2QRV A;  2ZQT A;  5E64 A;  3TC5 A;  4QIB A;  1JMQ A;  2JV4 A;  3KAG A;  1PIN A;  3KAH A;  1TK7 A;  3FS8 A;  3KAI A;  1WR7 A;  3M85 A;  5CQ2 A;  5E5W A;  1TR8 A;  2XPA A;  3KCE A;  2KXQ A;  2ZR6 A;  2JX8 A;  2BA1 A;  3LKX A;  2ZR4 A;  2XP3 A; 
#chains in the Genus database with same CATH homology
 2ZR5 A;  4U85 A;  1NMV A;  2OWO A;  2XP4 A;  2ITK A;  1F8A B;  2XP7 A;  3M7N A;  2Q5A A;  4REX A;  3PQH A;  5U47 A;  3MCB B;  2XP9 A;  2M3O W;  2XPB A;  5E66 A;  4U86 A;  3MQH A;  3CNG A;  2F21 A;  2YAJ B;  2ZQU A;  5AHT A;  1K9R A;  2LAJ A;  3TCZ A;  1EG3 A;  2DK1 A;  3OOB A;  2EZ5 W;  2JMF A;  1EG4 A;  3LE4 A;  2YSF A;  4U84 A;  2ZQV A;  1I5H W;  1FLC A;  1O6W A;  3ODK A;  5E65 A;  3FSB A;  4E5R A;  2XP6 A;  2DWV A;  2XP5 A;  2XP8 A;  3WH0 A;  2Y8N B;  2JXW A;  1ZCN A;  2WAE A;  3MQG A;  3MCB A;  5E62 A;  4A0U A;  2M8J A;  2RE3 A;  2YSB A;  2MDI A;  3NTP A;  2DK7 A;  1K9Q A;  2WAD A;  2M8I A;  2DJY A;  3TDB A;  2YSI A;  3KAF A;  3FSC A;  3LKX B;  4A0T A;  2L4J A;  2ZQS A;  4GLX A;  1WMV A;  2E45 A;  2ZAJ A;  2YSH A;  3KAD A;  2DMV A;  2YSG A;  1RP5 A;  1YW5 A;  3KAB A;  3L4H A;  2QRV A;  2ZQT A;  5E64 A;  3TC5 A;  4QIB A;  1JMQ A;  2JV4 A;  3KAG A;  1PIN A;  3KAH A;  1TK7 A;  3FS8 A;  3KAI A;  1WR7 A;  3M85 A;  5CQ2 A;  5E5W A;  1TR8 A;  2XPA A;  3KCE A;  2KXQ A;  2ZR6 A;  2JX8 A;  2BA1 A;  3LKX A;  2ZR4 A;  2XP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...