2DWVA

Solution structure of the second ww domain from mouse salvador homolog 1 protein (mww45)
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
49
structure length
49
Chain Sequence
b'GSSGSSGPLEREGLPPGWERVESSEFGTYYVDHTNKRAQYRHPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Salvador homolog 1 protein
publication title Solution structure of an atypical WW domain in a novel beta-clam-like dimeric form
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 1
structure length 49
sequence length 49
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2dwvA01
2DK7A 2ZR6A 1YW5A 1NMVA 3KCEA 2YSFA 2XP7A 2ZR5A 3M85A 2XPAA 4QIBA 1F8AB 5CQ2A 3L4HA 1EG3A 4U86A 2M3OW 4E5RA 1WR7A 3TC5A 2XP3A 1K9RA 2YSGA 2EZ5W 3KADA 2YSHA 2YSBA 3KAFA 2MDIA 3OOBA 2ZQUA 2JV4A 2JXWA 1WMVA 1ZCNA 4U84A 2XP6A 1PINA 3CNGA 2XPBA 3ODKA 2ZQTA 2ZQSA 3KAGA 1O6WA 3KAHA 2XP4A 2M8JA 2LAJA 5AHTA 2E45A 2DWVA 3LE4A 1JMQA 2DJYA 3M7NA 1K9QA 3WH0A 2JMFA 4U85A 1EG4A 1TK7A 2BA1A 3TDBA 2ZAJA 2Q5AA 3KABA 2DMVA 2ZR4A 2KXQA 2F21A 2L4JA 2M8IA 2XP5A 1I5HW 2ZQVA 3KAIA 2YSIA 2RE3A 3NTPA 4REXA 2ITKA 2DK1A 2XP9A 2XP8A 3TCZA 2JX8A
chains in the Genus database with same CATH superfamily
2DK7A 2ZR6A 1YW5A 2Y8NB 1NMVA 3MQHA 3KCEA 2YSFA 2XP7A 2ZR5A 3M85A 2XPAA 4QIBA 5E64A 1F8AB 3L4HA 5CQ2A 1EG3A 4U86A 2M3OW 4E5RA 1WR7A 1FLCA 3TC5A 2XP3A 1K9RA 2YSGA 1TR8A 2EZ5W 3KADA 2YSHA 2YSBA 3KAFA 2MDIA 3PQHA 3OOBA 2ZQUA 2JV4A 3FSBA 2JXWA 1WMVA 2OWOA 1ZCNA 4U84A 2XP6A 1PINA 3CNGA 3FS8A 2XPBA 3ODKA 2ZQTA 5E62A 2ZQSA 3KAGA 1O6WA 3KAHA 2XP4A 2M8JA 2LAJA 5AHTA 2E45A 2DWVA 3LE4A 2WADA 3MQGA 1JMQA 5E66A 2DJYA 3M7NA 1K9QA 3WH0A 2JMFA 5E65A 4U85A 4A0TA 1RP5A 3LKXA 1EG4A 1TK7A 2YAJB 2BA1A 3TDBA 3MCBA 2ZAJA 2Q5AA 3KABA 2DMVA 2ZR4A 2KXQA 3LKXB 2WAEA 2F21A 2L4JA 2M8IA 2XP5A 1I5HW 5U47A 3MCBB 2ZQVA 3KAIA 4A0UA 2YSIA 2RE3A 3NTPA 4GLXA 4REXA 2ITKA 2DK1A 2XP9A 2XP8A 5E5WA 3TCZA 2QRVA 2JX8A 3FSCA
chains in the Genus database with same CATH topology
2DK7A 2ZR6A 1YW5A 2Y8NB 1NMVA 3MQHA 3KCEA 2YSFA 2XP7A 2ZR5A 3M85A 2XPAA 4QIBA 5E64A 1F8AB 3L4HA 5CQ2A 1EG3A 4U86A 2M3OW 4E5RA 1WR7A 1FLCA 3TC5A 2XP3A 1K9RA 2YSGA 1TR8A 2EZ5W 3KADA 2YSHA 2YSBA 3KAFA 2MDIA 3PQHA 3OOBA 2ZQUA 2JV4A 3FSBA 2JXWA 1WMVA 2OWOA 1ZCNA 4U84A 2XP6A 1PINA 3CNGA 3FS8A 2XPBA 3ODKA 2ZQTA 5E62A 2ZQSA 3KAGA 1O6WA 3KAHA 2XP4A 2M8JA 2LAJA 5AHTA 2E45A 2DWVA 3LE4A 2WADA 3MQGA 1JMQA 5E66A 2DJYA 3M7NA 1K9QA 3WH0A 2JMFA 5E65A 4U85A 4A0TA 1RP5A 3LKXA 1EG4A 1TK7A 2YAJB 2BA1A 3TDBA 3MCBA 2ZAJA 2Q5AA 3KABA 2DMVA 2ZR4A 2KXQA 3LKXB 2WAEA 2F21A 2L4JA 2M8IA 2XP5A 1I5HW 5U47A 3MCBB 2ZQVA 3KAIA 4A0UA 2YSIA 2RE3A 3NTPA 4GLXA 4REXA 2ITKA 2DK1A 2XP9A 2XP8A 5E5WA 3TCZA 2QRVA 2JX8A 3FSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DK7 A;  2ZR6 A;  1YW5 A;  1NMV A;  3KCE A;  2YSF A;  2XP7 A;  2ZR5 A;  3M85 A;  2XPA A;  4QIB A;  1F8A B;  5CQ2 A;  3L4H A;  1EG3 A;  4U86 A;  2M3O W;  4E5R A;  1WR7 A;  3TC5 A;  2XP3 A;  1K9R A;  2YSG A;  2EZ5 W;  3KAD A;  2YSH A;  2YSB A;  3KAF A;  2MDI A;  3OOB A;  2ZQU A;  2JV4 A;  2JXW A;  1WMV A;  1ZCN A;  4U84 A;  2XP6 A;  1PIN A;  3CNG A;  2XPB A;  3ODK A;  2ZQT A;  2ZQS A;  3KAG A;  1O6W A;  3KAH A;  2XP4 A;  2M8J A;  2LAJ A;  5AHT A;  2E45 A;  2DWV A;  3LE4 A;  1JMQ A;  2DJY A;  3M7N A;  1K9Q A;  3WH0 A;  2JMF A;  4U85 A;  1EG4 A;  1TK7 A;  2BA1 A;  3TDB A;  2ZAJ A;  2Q5A A;  3KAB A;  2DMV A;  2ZR4 A;  2KXQ A;  2F21 A;  2L4J A;  2M8I A;  2XP5 A;  1I5H W;  2ZQV A;  3KAI A;  2YSI A;  2RE3 A;  3NTP A;  4REX A;  2ITK A;  2DK1 A;  2XP9 A;  2XP8 A;  3TCZ A;  2JX8 A; 
#chains in the Genus database with same CATH topology
 2DK7 A;  2ZR6 A;  1YW5 A;  2Y8N B;  1NMV A;  3MQH A;  3KCE A;  2YSF A;  2XP7 A;  2ZR5 A;  3M85 A;  2XPA A;  4QIB A;  5E64 A;  1F8A B;  3L4H A;  5CQ2 A;  1EG3 A;  4U86 A;  2M3O W;  4E5R A;  1WR7 A;  1FLC A;  3TC5 A;  2XP3 A;  1K9R A;  2YSG A;  1TR8 A;  2EZ5 W;  3KAD A;  2YSH A;  2YSB A;  3KAF A;  2MDI A;  3PQH A;  3OOB A;  2ZQU A;  2JV4 A;  3FSB A;  2JXW A;  1WMV A;  2OWO A;  1ZCN A;  4U84 A;  2XP6 A;  1PIN A;  3CNG A;  3FS8 A;  2XPB A;  3ODK A;  2ZQT A;  5E62 A;  2ZQS A;  3KAG A;  1O6W A;  3KAH A;  2XP4 A;  2M8J A;  2LAJ A;  5AHT A;  2E45 A;  2DWV A;  3LE4 A;  2WAD A;  3MQG A;  1JMQ A;  5E66 A;  2DJY A;  3M7N A;  1K9Q A;  3WH0 A;  2JMF A;  5E65 A;  4U85 A;  4A0T A;  1RP5 A;  3LKX A;  1EG4 A;  1TK7 A;  2YAJ B;  2BA1 A;  3TDB A;  3MCB A;  2ZAJ A;  2Q5A A;  3KAB A;  2DMV A;  2ZR4 A;  2KXQ A;  3LKX B;  2WAE A;  2F21 A;  2L4J A;  2M8I A;  2XP5 A;  1I5H W;  5U47 A;  3MCB B;  2ZQV A;  3KAI A;  4A0U A;  2YSI A;  2RE3 A;  3NTP A;  4GLX A;  4REX A;  2ITK A;  2DK1 A;  2XP9 A;  2XP8 A;  5E5W A;  3TCZ A;  2QRV A;  2JX8 A;  3FSC A; 
#chains in the Genus database with same CATH homology
 2DK7 A;  2ZR6 A;  1YW5 A;  2Y8N B;  1NMV A;  3MQH A;  3KCE A;  2YSF A;  2XP7 A;  2ZR5 A;  3M85 A;  2XPA A;  4QIB A;  5E64 A;  1F8A B;  3L4H A;  5CQ2 A;  1EG3 A;  4U86 A;  2M3O W;  4E5R A;  1WR7 A;  1FLC A;  3TC5 A;  2XP3 A;  1K9R A;  2YSG A;  1TR8 A;  2EZ5 W;  3KAD A;  2YSH A;  2YSB A;  3KAF A;  2MDI A;  3PQH A;  3OOB A;  2ZQU A;  2JV4 A;  3FSB A;  2JXW A;  1WMV A;  2OWO A;  1ZCN A;  4U84 A;  2XP6 A;  1PIN A;  3CNG A;  3FS8 A;  2XPB A;  3ODK A;  2ZQT A;  5E62 A;  2ZQS A;  3KAG A;  1O6W A;  3KAH A;  2XP4 A;  2M8J A;  2LAJ A;  5AHT A;  2E45 A;  2DWV A;  3LE4 A;  2WAD A;  3MQG A;  1JMQ A;  5E66 A;  2DJY A;  3M7N A;  1K9Q A;  3WH0 A;  2JMF A;  5E65 A;  4U85 A;  4A0T A;  1RP5 A;  3LKX A;  1EG4 A;  1TK7 A;  2YAJ B;  2BA1 A;  3TDB A;  3MCB A;  2ZAJ A;  2Q5A A;  3KAB A;  2DMV A;  2ZR4 A;  2KXQ A;  3LKX B;  2WAE A;  2F21 A;  2L4J A;  2M8I A;  2XP5 A;  1I5H W;  5U47 A;  3MCB B;  2ZQV A;  3KAI A;  4A0U A;  2YSI A;  2RE3 A;  3NTP A;  4GLX A;  4REX A;  2ITK A;  2DK1 A;  2XP9 A;  2XP8 A;  5E5W A;  3TCZ A;  2QRV A;  2JX8 A;  3FSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...