2DWYA

Crystal structure analysis of gga1-gae
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
129
structure length
129
Chain Sequence
NILPVTVYDQHGFRILFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSGTELPAFNPIVHPSAITQVLLLANPQKEKVRLRYKLTFTMGDQTYNEMGDVDQFPPPETWGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADP-RIBOSYLATION FACTOR BINDING PROTEIN GGA1
publication title Molecular Basis for Autoregulatory Interaction Between GAE Domain and Hinge Region of GGA1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 15
structure length 129
sequence length 129
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2dwyA00
2A7BA 1GYWA 3HS8A 1B9KA 1KYUA 1OM9A 5CN1A 1KYDA 1W80A 2VJ0A 1KYFA 1P4UA 1IU1A 2YMTA 1KY7A 3ZHFA 1KY6A 3MNMA 1NA8A 5CN2A 1QTSA 2DWXA 1QTPA 3ZY7A 4BCXA 2E9GA 1GYUA 1GYVA 2DWYA
chains in the Genus database with same CATH superfamily
3ZLQC 2JCCA 3MFGB 2I85A 5DA4A 2BSTB 5T3ZE 4CGTA 1I31A 5J12C 4MA7H 3AVEA 1QFWL 1RY7B 3PHOB 2GJPA 4S1SH 3WNPA 2VJ8A 3IRPX 3JUZA 1XL6A 3OXRB 3WFDL 4H0IA 4X0KB 4KI5E 4WGKA 5I15H 3HN8A 1MWAL 3TWCH 3NSXA 5GGUA 4OFIA 4DPRA 2K7PA 5I1AA 4X9FA 5EV7A 2WTRB 4JZJC 2Y6SC 3EDFA 2C8NA 5EO9B 3ZHDA 1HI6B 3J8F7 3L3DB 3MLWL 1R6VA 1XR9B 4S1RL 2ZD0A 3PWVB 3AXHA 1SDDA 3ERXA 1S3KH 4GFTB 2KUTA 1NIBA 1MVUB 4XNQB 2H7WA 4IRSD 1HQ4A 5IQNA 4BXSV 2Q2LA 1KWGA 2J6EA 1ZCRA 3WSQH 2HG0A 3PWPB 5JIKA 3DXAE 1HHIB 2F58L 3ZKQD 5D96B 2Q6WA 1T22A 1W6WA 3NP3A 5GGSY 4I5BB 4I3SL 3FO0L 3S0PA 1CYWA 1UFGA 1N0XL 4OLZL 4YHPA 4PJ8D 4QHPA 3PAVA 1JZEA 3B8SA 1CGWA 3BP7A 4WEEA 3GXMA 2BVOA 1R75A 1GGTA 2HN7A 2PCYA 3F84A 3FQXA 4OZGE 3FULA 3GKWH 3RAJL 4DEUA 2DYSB 4JEGB 4I3GA 4L9LA 5DUJA 3AREB 5IEHB 2NY7L 3QIUC 1X5FA 5IQ7L 5DZLA 1AJ7H 4AENA 1F1GA 1IL1B 1KDJA 1ZLDA 3SPHA 1ET8A 2F54D 1F3JA 4KY1H 4UWQB 3GMRB 1WC7B 1T04B 3O11B 3FO1B 5F2FA 2I07A 1BXXA 2GC7C 2GSIA 3PHAA 4X5WA 2F74B 1QTSA 2O30A 2CRZA 1MIEL 5GJTH 1FE8H 2X87A 2YUXA 1LDPH 2VDQL 1CD9B 4D7BA 2ZWNA 3E38A 4Z3TA 1DFXA 1U9KA 4IOSA 1H5BB 3AM8C 4N2EA 3CFMA 2R9HD 2AQ2A 2BHYA 4HJGB 4K0OA 1ZT7B 4HJ0C 5DGQA 4J39A 4GSDL 4X5XA 3VD9A 1R3LA 2NUTA 5LAXA 3O4LD 3TJEH 5HGGS 3BE1H 3OZ9H 3MJWA 4HHGA 4HOWA 3WTXA 4LCCA 4Z0BL 4RNRB 2VLJA 3L9RA 4Q9RH 4NEHB 2WMPB 3CUPB 3D9AL 4KROD 1FPTH 4QTIH 2KPWA 4ZFFA 4OGAD 2P8LA 3V4PH 4CC4A 5KS9F 1MCOL 4ZS6C 3FB5A 2XQYG 2O5XL 2J73A 4XBGB 4MD5A 4PJIF 4YFLF 4MMZC 1NFIA 3OR7B 3T4YB 4F7CA 3M7OA 1PLGL 4B7IA 3HAEH 1YMHA 3LNIA 4N26A 4QUOA 4DUXA 2OR7A 1DQLL 3D0LB 4Q56A 4U1SA 1VFOA 2R2EA 3TTSA 2IH1A 3BMVA 4FFTA 1BQHB 1K5WA 3ZT7A 2BP0B 2HCZX 3D6GA 2BSRA 4K07A 2A74C 2IPUK 1U8HB 2V5RA 2P24A 4LPXA 4MZ2A 5FO2A 1MFBH 4YDKH 1KJ2B 1OGTB 2XBZA 2B7DT 1SJEA 5E24E 1SY6A 1T6WA 1N19A 1PD6A 2R56H 2WLMA 1WEJH 2LGNA 2HLFC 1TTUA 2DKMA 2ICWB 5C7ZA 1PYWA 3NT0A 2X6BA 3HCVB 1OK0A 2NY3D 4F7EB 1DJZA 2IQ9H 5D7JC 4DP5X 2LOEA 4QRRE 5C71A 1C1EL 2ZAGA 5DJDA 4CU6A 1AD9B 4N2IA 5FYLD 3VXSD 2M2DA 4MXVF 2QGDA 2AK4A 4Y4HB 12E8L 1WHOA 4IW4C 4OGXL 3WAKA 2ADIA 2AMUA 2Y5TA 1OM3L 2YAHA 4XMZA 2YPVA 1L7TH 1RZFL 1UD4A 2XSKA 4R83A 4Z7QF 3DUUA 3A0OA 4F24A 4ZMZA 2VLJE 4XWGH 4QHMA 3B9KB 2HXAA 3D3VD 3QZNA 5B1BB 3TBWA 5JW3H 2BS9A 1U6AH 4G42A 4Z7UE 3U36A 1JGDA 5ICXB 1Y7VA 4H8UA 3FUHA 4A2DA 4LLYA 3MUJA 4OVUA 3HN5A 2G3XA 1RIUH 2GJ6E 2Q3ZA 1YJDL 2VKXA 4U3XA 3DRTA 1ETZB 1OP9A 1UQSB 5FYLL 1XF4B 3TO2A 4OCWL 3JV6A 2X3BA 4EDXA 3R7RA 3D0AA 3HHSA 5CCKL 4ZW8A 3G6JE 4Z5RA 4G6FD 5GGVH 1RLBA 2Q5BA 3GRWH 2FO8A 5FYJH 2AV1A 2QQNL 5HHQA 5F7AA 4N5EC 1ZLUK 1RIVL 1UCBH 4M6MH 3AUWB 3ARQA 3KH4A 1CD0A 1NAMB 4UMSA 3KPLA 3UDWA 3GBDA 4WKZA 1DQJB 4N8VA 2HYMA 2Z8SA 4LOVA 2YOAA 4GI9A 5L6YH 2XWZA 3T77A 5DZJA 3S5YA 5DA0B 1G1OA 5JPNC 2CGYA 2X9ZA 3SE8L 4JY6A 3T0ED 4EI5A 4F37F 1KB9J 3KYKL 1CGSL 1AQHA 3VG0L 4NKIH 4OUUA 4X8JA 2KZKA 3MJ9A 3EOTL 2C1OA 2CUHA 5IVXA 1N8ZB 3KPRD 3BAYA 2AK4E 1YUHB 1IIIA 5GZND 2OYPA 3MLRH 3BAEL 4K7PY 5DJYA 1CBVL 4UM9A 3WDHA 2QR0A 1MPAL 3H55A 5DI8A 3PS6A 4ZAKD 3MZGB 4E5XB 2VMJA 2XWRA 3UYRL 4RESB 3WLBB 2BNUB 2JELL 4XOAA 3G5VB 4AG4H 2R0ZL 2W65A 4EBQH 1I7RA 1N3NB 4AX3A 3LQAH 3VSVA 1C08B 3SDXB 3LS5H 3P11L 2JWYA 1DE4B 3KBPA 1OIOA 3BPCB 3X14A 2OTPA 5EBLB 3GXTA 5DRNA 2V9TA 2CDFA 1D9KD 4DGWC 1JZ2A 3MBEC 5KYWB 2QMJA 1KWKA 1NMAH 2HKFL 3DMMA 2WXNA 5ESAB 2QVIA 3QI9D 4ZUVA 1YEKL 1VFBA 2YPKB 3CVHL 4UZUA 1ZGLM 1BV8A 3GBNH 3EYOA 4F80A 3PL6B 4BFJA 1AVAA 4XPFH 5DQ9B 3B2UD 3NJFA 3FB7B 2KI6A 4N2FA 5M94B 1KBGL 4PLJD 1WP6A 4CMHC 2NY6B 3O6LH 3OLGA 2CO2A 1SHXA 1A5FL 1OTSD 3D25A 2OL3L 3GXFA 1E3ZA 3ZKXC 1BLNB 3QEHB 2X05A 2VUKA 1ND0A 5JORA 2XJKA 2P5WD 1OEZW 3UL4A 1KIRA 4NBXB 3VXQA 3WTWA 3MX0B 2OJZH 1W0VB 3HI6L 1CICD 3S4SG 1SXCA 2EXYD 2H5UA 4Z7NB 2R1WB 1BVNT 4JPQA 3C5XA 3MO1A 5DZ9A 5KOVC 3CZGA 1YC7A 4IRJB 2XG5A 3SGKA 2LE9A 3UX9B 5I1DB 4LSVL 4EQ3A 5BVPH 3JWOL 1P1ZB 1FBIH 3AB0C 3QJVB 2R29H 3W81A 3FONA 3RUGB 4JFOB 4WI6A 1YDPA 1ONQA 5GSRB 1QLRA 3LRKA 4TRPH 4PGZA 5J0BA 3B2VL 5EZJA 1FNGA 4LLQA 4GW1A 5C0ND 3EFFA 3ARXA 3D4GA 1CD1A 1T2XA 3CN1A 3QRGL 3VNZA 3WEXB 4OJCA 2O6PA 4FCAA 4XP1H 1FL3A 3MLTB 5ABAA 1LWJA 5CLZA 3QQ9D 2HJLA 4HETA 4NPYB 5L8KB 4DKEH 4Z3HA 1OB1A 4YPGB 4JR9L 3WFHA 4OFYD 1J48A 1AE6H 4G7YH 4Y19B 3R0MA 3AC0A 2DV6A 3CDCA 4NO0D 4YHYC 4I8DA 2IGFL 4YUEH 3ZE0E 4S0HA 5C3IA 5E08L 5FA4B 4S1DD 2GI0A 2GSMB 4QKXB 2MHAA 2H3XC 1JSYA 4TN9A 4EN3C 3E2HB 1YNTB 2CUMA 4WHDA 4ZFZA 1AYOA 3D39B 1EEYA 3OD3A 2ZXQA 1ASPA 2VWEC 3S35L 3DV6A 2XXFA 4HCRH 3PRZA 4AQZA 2NQDA 4WV1B 1DQVA 4E41A 5BW7C 4G72B 3BZEA 2BZ7A 3ARDD 3MRNB 3AY2A 4Y7MA 5K9QG 3DRQB 2CK0H 4PRHA 5B1JC 1H6TA 1CYGA 5HDBF 4NQEB 2RAMA 2FJFA 1CDUA 4NQDD 1N6QL 5GS1A 1PTZA 4MDIB 1PY0A 3P77B 4O2EB 3ZQWA 5GS3A 4MYWB 2EH7H 1DLHB 4NKOA 8CGTA 3IN0A 2R1XB 2ZNXA 4LNRB 5FO8B 2KBGA 1QW8A 1WD9A 2JJTA 4G8GE 3SGEH 3WKNA 3C08H 4JDTL 4PBWD 2XWBB 3SQBB 3UDWC 1JWMA 4UBDD 4NQVB 3SJVD 2HH0H 2ZQKA 3ISWA 5LGJA 5J4MA 1A4AA 3Q2CA 1QSFE 3MLYH 3ZHFA 4KK8D 2JCCB 2V2WB 4LBEA 1EEUA 2GT9A 2HT4C 1A9BA 2Y23A 3GSVA 4DEPC 2FYVA 3IVKB 3BVVA 3WEBA 1UT2A 3RWDA 1L9RA 1NJ9A 2ZE0A 2B2XL 4G11A 4G5ZL 3FF7A 1KV3A 5I1AB 2L7QA 4F37K 1ZAGA 2L04A 3NCCB 4DTGL 1REIA 3QHTC 4AEIH 5ICZA 3ZDXE 1UA7A 2ZP8A 4NXKA 5AYTA 43C9B 4K8RD 2RFXB 1RJZB 2BFVH 4XVSH 5SWSE 6FABL 4KKAD 2VMEA 4E0RA 3TBSA 4DGYL 4IMLB 3SOBL 1BFSA 1I9JH 4PI0A 4E41E 3BD5A 3V4VH 4O58L 2WKOF 1NKRA 1M7IB 4HKZA 1F3RB 3WOVA 1QNZH 4A7SA 5C0GB 4I87A 4NKQB 5L4FA 1DBJL 3CPLA 3T8XB 3AITA 4QF1B 4ZUUB 3HUJA 3T6VA 4RAUA 4I3RL 3WLWC 5JPNB 2J21A 4NENA 2BLFA 4JL1A 4CC1A 2H6PB 3B9AA 4PTTA 3B2DC 2IADA 4MAZA 5AVTB 3MA7A 2XN0A 5L4IA 4FXGC 3BT2H 5JQIB 2BP8B 2FYYA 4P05A 2ESVA 2VR7A 3MBWA 4NT6A 3BP7B 4K8RL 3B5GA 2HN7B 3BPNB 3FQXB 3N43B 5EU4A 4DP8X 3ILEA 3MRQA 4L9LB 4QHKJ 4KKCD 2XVBA 3N44F 5FW6A 2E9GA 4HJIA 4PD4K 5FK9A 2WP3O 3ML9A 1IB5A 4EXKA 5I6LA 1F3JB 2C9RA 1R0AH 3HOGA 1CDGA 3UBGA 4KNTA 5CKAA 5ITFB 2WSPA 2OCJA 2GSIB 2WQ8A 4X5WB 4Q9QH 2R8SL 1J5IA 2MNJB 1C5BH 3UACA 1NDTA 3QWOB 1LO4L 3MBEB 4XPTL 1I3RA 4HUNB 2VXTH 4PRBB 1JRHI 3MLXL 3OLDA 3F58L 4U1KA 1NIFA 3CU7A 1EGJL 2F68X 2WO3B 2O5ZL 1JGLL 1R3LB 1Z7JA 3BSZH 3QQNA 3P3UA 5LAXB 4CMMA 2YJQA 3FH5A 15C8L 4L1BA 4F9PC 4UU9A 1K4DA 4LCCB 3WFBH 3ECUA 5I1KH 4CMHB 2CBPA 2VLJB 2FQFA 3L9RB 4GNKB 3GHEH 1I1FA 1AI1H 5LAPA 4KRPD 3TBYB 4JRXE 2P8LB 3NYKA 4ODWA 3ZKXB 4JO3L 2XBTA 1F13A 3FB5B 5C0IA 1XIWC 1V05A 4HEME 4PLOB 4LMQE 3V4PA 5GS0H 4LEEA 3NIFB 3DETC 1NFIB 1I3GH 4DVBA 4WI9A 1CN4A 1YMHB 1R3IH 4U1SB 4LEOA 2IH1B 4YHZL 5FGRA 2BY3A 1OD9A 1BZDA 3CDZB 2E7LA 2BSRB 5J1SC 2VM4A 4DUWA 3T4AA 2P48B 3DOHA 2P24B 1YQVL 3BHBA 3BZ4B 1Z5LA 1SJEB 4N20A 2AV7A 2ZG1A 5HYJD 1AZNA 3LEYH 5KBNC 3ETTA 2BNQD 2J1ZA 3NA9L 1CR9L 3FW6A 1PYWB 2WZ0A 2DLTA 2UXGA 2Q3AA 4O2CB 4P57A 3HA0A 4FTVA 1L9SA 5DJDB 3P69A 4JFFA 2NY2B 3RY4A 3FSOA 3OHMB 4KGJA 4G82A 2FX8L 2ADIB 2Y5TB 3ELQA 4WEBH 3FHEA 3MLVH 2FLRT 1BVOA 3T3MB 2YRBA 2RR3A 3NJNA 4JFZH 1DBKL 4N4YB 4OCSH 3T6XA 3DUUB 3L48A 4J3OG 3S36H 5EF3A 4OV5B 1CFVL 4QHMB 3NZHL 4L3CA 1I1YB 4OBSA 4LFHD 5TFSH 4G42B 3F7RA 3T3PB 4LLYB 4JPVL 2AJVH 3LYRA 1J1XH 4ZOAA 2V33A 3KXFB 3L3GA 4KK6D 3AJ7A 4OZ4A 1U92B 3DRTB 2HA1A 1I8KB 4U7KA 4L8SC 5KTEL 3TO2B 3FCBA 1TMCB 2VLLA 3JV6B 4EDXB 3PJNA 5AZUA 3IDNA 3HHSB 3CC1A 2AW2A 3NH7H 4WNJA 4Z5RB 1A1OB 3KNBB 3VCLA 3ARFC 4FQIL 2AV1B 1TQTA 1DJXA 2I9TB 2BSCA 5HHQB 4MXWH 1L3WA 3UP6A 4N0CD 4AK1A 2AHIA 2F7PA 1S7TA 5I74C 3P4NA 5TE7H 2HLAA 2VTFA 4RAVA 4AZ8A 1JPEA 3O45A 3N85L 1R4XA 1HU8A 1LEIB 1E43A 1RZ8A 5EF2A 3T77B 2J6WA 1ACYH 5CIPH 1OGSA 1RUPH 2A0LC 1G9MH 4JY6B 3SODB 2EYRA 2NW3A 3BWZA 4YK4C 1KFGA 3T08A 2J8UE 4BRVA 1RPUA 2R39A 2NZIA 4LKXA 4OUUB 1J7VR 1FI8C 2B5IC 3AABA 3C5SA 5E2VH 3W37A 1OCCB 2X7LA 2C1OB 5IVXB 3E8UH 5ESQA 2ZWYA 2BW4A 3L3OA 1NMBL 3FYEB 4GIPD 2QR0B 2EDMA 5E23A 4UM9B 1T0NA 5DI8B 2NDFA 1QFHA 1IM9D 2IBZY 2OQJA 3RU8L 2EDHA 3TC9A 4MMXA 1I7RB 1UOWA 3B83A 4Y5VC 3V52L 3UO1H 2ZUUA 3FRPB 5C0BA 3ETBF 1U8IA 2J71A 4Z8FH 4GRWH 2Q86A 3MRDB 4MFHA 5DRNB 5E2JA 2CDFB 4IRZH 4L9DA 2AEQH 1SBSH 5DFTA 5CGTA 1F45A 5CR8A 1KGWA 2ITCA 1NEPA 2CM5A 3EHBB 3FT3A 3DMMB 3PLYA 1MZYA 4ZUVB 1SXSA 3QDJD 1VFBB 3RNKA 4Z3IA 3IDIB 1CI3M 4CSSA 1FO0L 1SXBA 3EYOB 4LLAA 1GAFH 2V3EA 4P2QD 4DGVL 5L7XL 3JWDC 2CLZA 2PR9A 3N04A 1KIUA 1PEZA 2ZCKH 2ILLA 2VLKD 5C0AA 1FCCA 5DO2C 3D25B 4UCFA 3VI3F 1NCBH 2FHBA 3D87B 1ND0B 1YNKH 3SPCA 5JORB 4H2CA 4W9GC 1KPVB 3SE9L 2YLKA 1QUNA 4K3DL 1KIRB 4ENED 1ET7A 1NSNL 5ANME 2F19L 5CF3A 1B88A 4W9KC 3U7YH 1C5CL 4UUJA 4M6NH 2J1YA 2AJYL 3MO1B 3TLRA 1A25A 2XG5B 5KWYC 4PRPB 2A9DA 2AVGA 5JZ7C 4ZZFA 5AG9A 2P1YA 3FONB 3GIZH 3JXAA 4HZAA 2W88A 3OF6D 1HINL 1YDPB 1ONQB 2UVFA 3UG5A 1MF2L 1QLRB 2UWEE 2VRQA 3S98A 2YFNA 1QR1A 5EZJB 1FNGB 1FRGL 3UJTH 2R29A 4GW1B 1IX2A 2NY4D 3HS9A 1NLBH 1CD1B 1NBVL 3QDGB 5GZOD 2ZCLL 2QV4A 4NNYA 2DQ6A 3OX8A 1C7SA 3P9MA 3VDAA 2AS5M 1FNEB 4HIEA 4PV8A 3WIHL 1MFNA 3CAFA 1CCZA 4K7PX 2BRRL 1EAOA 2Q87A 5ITBH 5DD6A 4YFLI 4MJJA 1XIWB 2CO7B 5HGHA 3WFHB 1ODUA 5EUOF 4E9RA 2QJDA 2ZUQC 3HTLX 1OALA 4WUKH 1JHLH 4G80A 5IW1A 1MCIA 3R8QA 2X6UA 5I8CA 3QFDA 4JJ5A 4FI8A 1RMFL 2MHAB 2IAAC 5LQBH 3CU1A 4JX0A 2E9IA 4PN6A 2HFTA 4ZFZB 3OXSB 1EEYB 3EH3B 4XP6H 5CUSH 1HXYA 1RZJH 3DLQR 4LLMA 1L0XA 4DFIA 3DV6B 5HVFB 5CZXC 5IM7A 4GLRI 1XCTA 1G0DA 3F6LA 3SPVA 3BZEB 3IS0X 5INDB 3QDAA 4HCRA 4ABQA 1JK8B 4BSVB 4IIQA 4PRHB 3BN9D 1A2YA 3CHQA 2R0KL 3B9DA 2HX8A 5FLVA 1QATA 2FWOB 2IMNA 5CN1A 5E4EC 4CKVX 4K7PH 4PV1C 2OMYA 3IMTA 1GMEA 1NIDA 3U1QA 1YEIH 1HOCB 2P5PA 3VDBA 4JG1H 3V0AC 4UQ3A 4EVNA 5J1AA 4MZ3A 3VXPA 4BINA 3AGWA 3UAFA 1LE9A 3APNA 4XX1G 2A6KB 3SDDA 4I18C 2DMHA 1JWMB 5K69A 3QSKB 2Z8VC 1KPUA 4UNUA 1CLOL 5BRZB 5LGJB 2WCPA 3BFQG 1S9WA 1AZBA 3PWPD 4PJ7F 4NB7A 4G7RB 5FCUL 5LDUA 3I3BA 2VQ4A 4LBEB 1K3ZA 2GT9B 3GSVB 1A9BB 1UXLA 3MUZ1 1UZ8A 2G0KA 2YD6A 1T03L 1SVCP 1S9XA 1KB5H 2XRAH 3P4MA 3RWDB 2JQMA 2VRAA 1NJ9B 3MCLL 4L8SB 2WXPA 3K46A 2F7IA 3MYJA 4HIQA 4WK0B 4WKXA 1MCDA 1THCA 5ICZB 1VAHA 5EPMA 1KXVA 2VXUH 3O3EA 2AJUH 2ZCHH 1BECA 4Y1AA 1ZK5A 1ROCA 2Y1AA 1LE5A 4DN3L 1NEZB 3K5RA 4E0RB 1XXFC 3TBSB 2ETWA 2IWGA 3PG2A 2OR9L 3BOVA 5JDSB 32C2A 4HKZB 1D5ZA 2MCPH 3ZTJG 3CPLB 2ATKA 3SKOA 3ZL4H 2CLVA 5PCYA 3V4VA 4BSWA 1T1WA 3HUJB 2QVFB 4RAUB 1M9WA 4L4VB 4AIOA 5L2KA 1J9CT 2ROYA 2CDGA 2EDDA 4KVPA 1WWAX 2WLKA 1IM3B 4PTTB 4EDWH 2DWSA 2I5YH 1A8ZA 2EABA 4YK4B 2IADB 2FATL 3LZQA 4AEFA 2OZ4A 4KTEL 2FYYB 2WOYA 3A4EA 3TM6A 1HKFA 2ESVB 2YJLA 2W95A 3MBWB 4Z95L 2WZPA 2IANB 3G6DH 5D7LD 3CXHJ 4BUGA 5H35A 5EU4B 1YMMD 2X28A 1PZAA 1L9QA 4WAFA 1L9OA 3FDWA 4UZSA 1A7RL 1CL7I 2EE6A 3MRQB 2E6PA 1GVIA 1YUKB 3WNKA 1KXQA 1E6JL 4M1CD 1CBJA 3ALPA 1P4IL 1MRFH 4XNUH 1G7LA 2PETA 5E56A 1TU2B 1VGEL 3ULVD 5SWQA 4LVEA 4JO1H 2XX0A 5FKAA 4MVBC 5IFHH 5E6YA 3I6GA 5EUKB 1NCHA 1PU0A 1I3RB 1E8ZA 2NZ1A 4HLJA 4V11A 5JHDE 3UZVA 1LP9F 4U1KB 5EOQL 3DKHA 4O9HL 5E2UL 1NQBA 4OR1A 4IBSA 4QHNA 1UH3A 5B4MC 2ZSWA 2EO9A 2VN3A 2LFEA 1AC0A 4WFHD 2EICA 2OTWA 3QRBA 4CMMB 4Y1AE 1KY7A 3F7KA 3QARA 5E2WL 3RB5A 2Y69B 4NP4H 3ZDZF 1K4DB 4PREA 4Z7OE 4GPVA 3BSZA 4PAZA 1I1FB 4F33B 2XG4A 3FT2A 4OLWH 4ODWB 4DETA 4FJ6A 1V7NH 3W9EA 4QOKA 4NO5A 2WUBL 1TOXA 3KW7A 4AQAA 1HHGB 2JJWA 1D7FA 5C0IB 2QEJA 1WH0A 2EIMB 1RL1A 4DVBB 4Y4HD 2VSMB 4UT9A 2WGNB 4X9GA 4XR8C 4LDCA 3ZO9A 3BC9A 3CC5B 2H26A 4YL9A 5MHSD 1IQDA 1T4KA 1VACA 3GJEA 4P9HC 4EEEA 5FPIA 1KJ2L 2C9XA 4H0LC 2PW2A 3T4AB 4YVNA 2QSTA 1VEPA 3B9KD 5CCHE 5CGBA 5SX4I 2NY0D 3WFCH 3HBGA 5AVYB 5L2JA 1XGRA 4PVLA 4WIQA 1SVBA 2E47A 2E7HA 4H5SA 4JKPH 5D6CB 5SWZB 1QG3A 3KLLA 2NR6D 1AHKA 2VR9A 4PLKD 1AQDA 4P57B 4FTVB 2EYSA 4GSQA 1NAKL 3NACL 1SYSB 3L5IA 4JFFB 1W16A 4U7SA 2BSED 3BLPX 3L4YA 3RVWD 1GPOH 3VNYA 4P2RA 2YD0A 2BVTA 2EVJA 1HILA 1VENA 4NM4L 2VN7A 3GSNH 4DUVA 4KKZA 2DQHH 4NCDA 1Z0MA 3Q2VA 5JR1H 2EE9A 4AJ0A 3VFSA 1WCBA 1A7NH 1AKPA 3QPXH 3OWEA 3OV6A 4FFYA 5SX5K 4U1MA 2ATPB 4ZFOA 3WGUB 1HEJC 3VQ2C 3WKMH 1UWGH 4L3CB 3Q48A 4LOUD 2GCYA 4GQPH 4BXVA 1M1XA 2VERN 4XCFH 4QOKE 3LIZH 5LNEA 2ZYSA 4PJBE 4BH8B 3ABLB 4OZ4B 4L0ZA 3VA6A 4H26A 2OYLA 2YD9A 1DBAL 5IJKA 1MAMH 1LVEA 2B77A 2I26N 2LU5A 2QQKH 2DD8H 4Y4FA 5E4EB 5BV7C 1T21A 3UGEA 1U8CA 4Z76A 3V6FB 5I66A 1RP9A 4WWKC 1GC1H 2VSKB 4LSUL 4W68A 5F8QC 3HPLA 3RTQA 3P0VH 2FO4B 1NAML 3KCPA 3V0WL 3B7YA 4K9EL 1RIHL 1XTMA 2Y2TA 3CQQA 3NEOA 2P28B 1V3MA 3GZOA 1KOAA 3PGFL 5EH1A 1S7TB 4R4BA 4OLXL 3P4NB 4NC2B 2HLAB 3E6FB 4RAVB 4TTDD 1NUFA 3E7JA 5IB5B 3O45B 4JNXA 4NBZB 2UXFA 2APBA 4LSDA 5TE4L 3TBVA 2WYHA 4HJJL 2F53D 2EYRB 2CJSA 2NW3B 2Y06L 4PB9L 4H20L 4LKXB 3C5SB 5AKRA 5EA0L 2X7LB 5CIPA 3QP3A 3PL6D 3QJUB 1JYVA 1AR2A 3AROA 2PO6D 4TVPD 4XGZA 4XPHL 5E6RB 5ESQB 3L3OB 3VXME 2NY6D 1CE6B 1T0NB 4ODHH 5AOZA 4UIMB 3UTTA 4AUYA 1RJLA 3UJIH 4X5RA 1XO8A 4N3TA 4JFDB 5DQDL 4Z18A 3WJMB 4ZMPA 2OQJB 3NK3A 6CGTA 4MHHG 2WBXA 3SQOL 5CN2A 4Q4IA 2XN9E 2NNAA 3ULVF 2BWQA 3BDBA 3K74B 1O6TA 4MMXB 2MTAA 1HE8A 1E8XA 2E4FA 3UERA 2Z34A 5C0BB 1U8IB 5I1IH 3GEWB 4H8WH 3EYSL 2Q86B 5GQBA 3MUGA 2CAKA 1SOXA 5IB3B 2VZSA 1ZEAL 2OYKA 2ITCB 2XPGB 2A6DA 3FT3B 4IRJD 3GM8A 4XHQA 5GRVL 4D8PA 3RNKB 2X38A 4IRZA 3T9WA 1U4FA 3DWTA 4HHAA 4U4BA 5B38B 3IJEA 3QIWA 4NZRH 3TEXA 1J0ZA 1KENL 1I8IA 4HIPA 3FZUC 1H6EA 1CU4L 2HT2D 5C0AB 3DROA 2D7MA 4HAGA 3B2XA 3QEGH 4FE9A 4LEBA 1RK7A 2XWJA 3MJ6A 3EO0A 4YE4H 1OP3K 4FQJH 4UQAA 3UC0L 4HUWA 3T0BA 1JNHA 1ZE3H 2AXHA 3LPFA 4KI5D 4H44C 4Y19D 1PSKL 4WY7L 3P3SA 4NAMA 5I8KL 1F11A 2WQRA 2DICA 3P0YH 4PJ9C 5DK0A 3DX3A 3DIVA 4N85A 4UUJB 5B3JF 1ZOXA 2NY5H 4ODSL 5E8OB 1JPGB 4RGMC 5E6ZA 3ZYIA 4WJ5A 4D9QE 3O2VL 1H3PL 4PWEA 5K9OA 3UXFA 1J9RA 4RSVA 5EU6A 5AW9B 5LG1A 1AGDA 1B0IA 1QR1B 3RYMA 3O6MH 4QKTA 4PCTA 3GUTA 3ULUD 4I0PA 4WUUA 3CHOA 4NNYB 3OX8B 2DBLL 4ZBJA 4PV8B 4BA0A 3EF4A 4GG8A 3HE6A 1U3JA 2EXWD 4YHLH 1AGBA 5DD6B 1PIGA 3S3BB 3DOSA 1RH8A 2IBZX 4GRWE 4XN4A 1CGYA 5BCAA 4G80B 4F92B 1ORSA 5I8CB 3MRIA 4JJ5B 3OAUH 1GJWA 1SPDA 3PXHA 3GBLA 5KAQG 3ARBC 4TOYL 1BG9A 1HXYB 2OMZB 2QTVA 3DDGA 4JFEA 5DHVH 3UPRA 2XKSA 3OBAA 3ULUL 2YD3A 3HIZA 1WGVA 4B97A 1IEBB 3P1VA 4N0FA 5I28A 5CLWA 4P2YA 3RWIA 4EJ1C 4H0HB 5AAWA 3RDTA 5HD8C 4IIQB 4YLCA 4LDOB 1TYRA 4EUPA 3QGVA 5D7IB 4LO9A 3HBZA 4MNGA 1FUNA 1HKLH 1NCDH 3PFUA 4WO4A 2OMYB 5T5NG 1OT4A 5TGBB 3Q0HA 3QJXA 4JFQA 3VI4A 4XNDA 5AZ2L 2VYRE 5DWPA 4FEIA 4PGDA 4EVNB 3ASOB 3ZT6A 5J1AB 3VXPB 4M9OA 1BQRA 2CG9X 2YS4A 2BSSA 4WFFE 4M4RA 3SDDB 1U0QA 4I85A 4PJAA 1FHGA 1QLEH 1WFIA 1U3HC 1OW0C 2VC2H 1VRSA 2YPLE 3V0JA 1KPUB 4LPYA 1Q1JH 1G7IA 3S37X 4F5CE 2X5PA 4Q6YA 4WUUE 3TH4T 1JDCA 1X7SA 4EZJA 1UADC 3LZRA 5I1JH 2VQ1A 5DK2A 5KANG 1NZRA 5LUMA 2VO8A 3PV7A 4U31A 4YPJA 4RFNC 1F8TL 3H2QA 1HC1A 3P4MB 4Q0XH 1NGXA 3WNIA 5F72S 4X5LA 4P5TC 4WW1A 2VDRB 3LB6D 1KB5A 3MYJB 4X5PA 4PWHA 5EZOL 2Y2YA 2GJZA 1YG9A 3O3EB 5EPMB 1KGUA 3Q44A 3B1TA 4ZMLA 4YH6A 5IG7A 3HR5A 1JTOA 5BMFH 4JFEE 1TJGH 1NMCC 5C07A 7PCYA 2J6EL 4MWFB 3V5DA 2R4SH 4M7LT 4J12A 3NRFA 1D5ZB 4XMXA 4AL8H 2ATKB 1Z3RA 3SKOB 2CLVB 2HAZA 2RQ8A 3KPTA 3S37H 4BSWB 1T1WB 2FL5A 1YEDA 5I6NA 1KZYA 1KTJA 1P6AB 5L2KB 5MEQB 2CDGB 4IOSD 3ETSA 3GJFK 4MNGE 4NQUA 1EO8H 2KLTA 4Q58C 1E2WA 1N68A 1EHXA 5EZIH 5J6SA 1XF2B 2GTZA 2BVPA 3BUYB 2CHWA 4K3JL 2IDCA 2KPNA 3MBXL 3TF4A 1KYOJ 5H35B 2VLJD 2UY7A 3P3RA 1T83C 4HV8A 4RZCA 3NQIA 4MA8L 4OZIB 1XGQA 2F5BH 2W92A 3CJJA 1DUZB 4PTUA 5CJOL 2HFGL 4KI5F 1MCRA 2YK1H 5JIPA 5A1AA 1G7LB 4Y5XC 1YO4A 5DVOA 3L9BA 3L7EA 5D4IA 5SWQB 1C12A 3SKUD 3MC0A 2E7DA 4LIQH 2G60L 1KV7A 1LO2H 4X4KA 2D7TH 4ZS7L 1AHWA 1WZKA 4BIKA 4PHXA 3LN5B 1TEGA 4OCXL 4OIIL 4P46C 3UZVB 3WEMA 2XT1B 1URZA 2Q0ZX 4QHNB 2ZSWB 4LCWA 5JQ6H 3R1GH 1IC7H 2Z93A 2WBWB 1I9RH 1ZK9A 4PREB 5HHME 4LCUA 2F08A 4N0YL 3VWKC 4F8LA 4GP5B 2P9RA 4F15C 3B4NA 4X0NA 2BCKA 4OZFH 1X6NA 5F0LB 3FK3A 3W9EB 4NO5B 4AQAB 3K5SA 2QLVB 1H8LA 2Z31C 2CM6A 4FMFA 2NNRA 2AK4D 2NY2D 4YXLH 4X4YB 1KLFA 4M48L 2ED8A 4HSQA 4X4ZA 3CK0L 1FORH 3BZDA 1RK0A 1IT9L 2H26B 3I2CL 5FHBH 1IQDB 1VACB 4QMEA 5E5MA 2EXSA 3HNSH 3GJEB 3BAKA 2TAAA 1D6VH 4N90E 4KHXH 2EH8H 2PW2B 1VEOA 2JFCA 3F7YB 1SY6L 5HHVL 3DO4A 3SY0A 4JG0H 3ABGA 3DTXA 4R26L 3FT9A 1IBZA 1DLFL 1GGCL 3GO1H 3A47A 1GMIA 4F57H 1XGRB 5L2JB 1OOAA 3RVXC 1DZBA 3WNOA 3GGWB 3ORJA 1D6EA 4H5SB 2WTOA 4N9OB 3BH4A 4C83B 2ED6A 1QVOA 3QZOA 4HKXA 4B95C 1WBXA 5ETUA 4QWWC 1AQDB 4PRNA 5F71A 2N01B 3II2A 4Z3GA 4LPUA 3K6SA 1A6VL 1SJMA 2YPVL 4KV5E 1MELA 1ZLWH 4P2RB 2W1NA 4EN2A 1LNUA 4K23H 5E99L 1PAZA 2GHWB 3GHBH 3O3DA 3CZFB 1FZOA 1VDGA 1U3YA 3KMDA 3MLZL 1WT5A 5DRWA 5KSBA 1EUUA 4AQ1A 4ETQA 3KLHD 3ARBB 3VFOA 3GSNA 5IB2A 3O3UN 5D72L 3EOBA 4ZFOB 2CCVA 1NBYA 1ECZA 3KH3A 2Z7ZA 5IWLA 3LXCA 4MLSA 1M1XB 2BH0A 3TA3C 2DKSA 2AQQA 4EI5D 5C8JA 2EE0A 2XWXA 3AXIA 2GAZB 4FLRA 5AB1A 3BKYH 3OKDA 3R4RA 4L4JA 4K55A 1VSCA 3MUHL 4UV7H 4ALAC 3QUMB 1DL7H 4H26B 1RUML 2PXYA 3M46A 4GAJH 1N8OE 4KOBA 1AY1H 1A8JH 2FHCA 3DJSA 4LSSL 1URLA 5TPWL 1T21B 5EIIG 3ESUF 3N50A 4UM9D 4Z76B 1XH0A 4B7LA 5KVEH 2VH5L 2IPUG 3HPLB 3RTQB 4F8QA 2KLRA 3KCPB 1ULVA 5MEPA 1FL6A 3FFDA 3QHZH 4M61A 1FYTA 4XCEB 2OW6A 5FGCB 1BYNA 3H85A 1SJVA 1A0QH 3FB8A 2ORBL 4KHTL 1DVSA 3MYZA 4R4BB 4WW2C 3PNWA 4YSEA 1KBVA 1U3HB 4OB5L 5HGBA 1RUKL 3NDZE 4GW4A 1CLYL 2C26A 3LH9A 4ODTL 5L4JA 3SCMC 3TBVB 4OFDA 4NAQA 2VW6A 3CNKA 3MRPA 4BWWA 2GK0A 3HZKA 3MJ9L 3V9CA 3EHBD 1BQLH 3DMMD 1AXTH 2QT6A 4W9DC 5GXBB 4PVNA 5TF1H 5KSVA 2FCBA 4HFUH 5E1IA 5IHHA 3QZWG 4BE5A 5HJGA 5F44A 2IXQA 1P7KB 4JGMA 5D1ZC 3ZIMA 1AGFA 1JZ5A 4FXLA 3T0VA 2QHRL 3H2WA 4NN6B 5DVPA 5GS2D 3A6CL 3WY4A 5K9JH 3WO3B 2WZAA 2Y36H 2AK1L 4Z7UF 5C6TH 3UTTB 1G84A 1MAJA 3L3HA 3L5XL 4JHVA 2LABA 4C55A 3ZGHA 2DWEA 2YC1A 3GZQA 35C8L 5F96H 1D5BB 1N26A 1JPST 1NICA 4R7DA 3TV3L 4U0RC 4WTWA 4KI1A 3WS3B 4IYKA 2D4FA 3H3KA 5EBGA 3QS3A 3QXUA 4A67A 1I75A 3QCUL 3LH2L 3PDDA 3DVIA 2D8KA 3MCG1 2BOBA 2YGOA 3MUGB 1FVDA 5CEZD 5I6KA 1KEMH 2XTLA 2A6DB 3I75A 5AAMC 4BFFA 2P5EA 4WLCA 4D8PB 1MXGA 4XXWA 1RFDL 1DQDL 3SD2A 4UV4H 4HHAB 5C9JB 5GGTA 3OJVC 3IJEB 3QIWB 4K5OA 1N64L 1YY9D 1NCCH 3LY6A 4PH8A 3WKYA 2J1XA 1HT6A 1X7QA 2WLNA 1FYTE 1IFHH 3RPIB 2JI1A 2K0RA 1I8IB 4HCFA 2V2TA 3DROB 2V5YA 5HPMA 1TPXB 2XWJB 5EWIH 2Z91A 1KN2L 3EO0B 4PRIB 3VRIA 5AQ0A 4HUWB 5CWSA 2OMBA 4Y5XB 1I1AC 3DETD 1JNHB 4XNZB 5CEZL 3V5KA 3S34L 3F12B 5ES4B 4GW5A 4PJEA 5I8OH 1G9NH 1F11B 1HCVA 4GUCA 3HNTL 3C09C 4J6RL 4PY7A 5C09E 2GUOA 4P46B 3VRJA 2YRPA 3BPLC 4WJ5B 2H0FA 4KQ4L 5D8JH 5F7FA 1V8HA 4E41D 2PCXA 2F1BA 3CMOH 4N25A 5ALBL 2Y7MA 5EU6B 3T3PF 3VXUB 5K9OB 2M83A 3MOAH 1VKXA 3P30H 2CJUH 3GUTB 1YQ2A 1F2XK 3DIFA 4PRHD 4B50A 4UOW1 4WUUB 3Q06A 4XB8A 1UD3A 4S1QH 3VGAB 5CKGA 1NGZA 4GG8B 2PTTA 3HE6B 4XBMA 5GISL 3LKPA 1SGKA 5F0PB 2VLRB 1U30A 2FQDA 2H47C 1AGBB 1NIEA 3DOSB 3KPSE 2MJWA 2D0GA 1AS8A 5F6IB 2O6DA 4LXFA 2P5EE 1DBBH 3UCRA 1EXUA 4F93B 4FQXA 4GRLA 1ORSB 4RA3A 3MRIB 5TK4A 5KYXB 1NDMA 1YEWA 3SE3C 1T1ZA 4MJ4A 5EF0A 1EERB 1X9UA 2MQCA 2BIIA 5DMJB 4XVUD 1QFWH 4OD3L 4X6DE 3UPRB 2AEPL 4GINA 1NGPL 3NSCA 3MROA 3WFDH 1EH9A 4S10A 1GYWA 2V17L 1MWAH 5DHVA 4JRYA 3RWIB 3ECVA 3WUWA 2V9QA 2ZX7A 3K80A 3RDTB 3IE9A 3MV8A 2ZAIA 1RXLA 4P07A 2RA1A 5B8CA 1EAQA 4EUPB 1MFDL 3MLWH 4EIUA 1BZ7A 1MCCA 4S1RH 4PU2A 3QPQC 5GRZA 4AJWA 1AR1C 1PY9A 2WZ5A 2H1PL 1IBBA 4RRPM 4JFQB 3VI4B 3QK0A 4M1GL 2YAEA 1FNSH 2WXFA 3WTYA 5DHXB 1L5GA 3NJXA 2BSSB 3L4WA 4L3FA 4M4RB 3ZUNC 1GYVA 1O6VA 2F58H 3EFOA 1WK0A 4PJAB 5GGQL 3V7AE 5A3IC 4PM1A 2XN2A 1YAZA 3VAEA 3EH4B 3FO0H 1VHPA 3V8OA 4IOFD 5CLXA 3S2CA 1N0XH 4OLZH 4JHAH 4PB0L 5DRZB 3UBFA 1SJXA 2AEOA 1A3LL 4YXKH 2VQ1B 1Q9OA 2J5LC 4B6ZA 2VZVA 4S1SL 1TCRA 5KG9A 1MUJA 2G75B 3TEWA 2DIJA 4NZ8A 3RAJH 5DHEA 5DJZA 2ESVD 2D31A 4WW1B 3X3FL 2NY7H 5IQ7H 1CPUA 1KTBA 5C0FB 3W39A 1U2YA 3BRGC 2XWTA 5I9QB 1OGAB 4LPCA 3O6FA 3WJLA 1GZHC 2VXVL 5JNYB 4J3TA 5IG7B 3UZQB 5ABDE 5KBLA 3FO9A 5C07B 2C7FA 3LD8C 3V5DB 2FJUB 2K6YA 2VDQH 1PKQA 4GS7B 5FYKL 4WW2B 5JW4R 2XIDA 4UMGA 4KDTC 4R8WH 4JRYE 3Q5OA 1O6SA 5JW4Q 4GSDH 1U4EA 2FL5B 3C87A 1WIPA 3LKNB 4ZYKA 3BH8A 2HMIC 4NNXA 5FF6B 2W9EL 2CO4A 4BELD 2I7OA 3VFMB 4Z0BH 5E1HB 4JLRA 4R84A 2GTZB 3D9AH 3C8HA 4FL4C 2BVPB 1QKZH 1OAUL 1VZGA 3OKNA 2TRYA 4DK3A 1MCOH 1QHOA 3KZ8A 3BP6A 3LKRA 2X9WA 2UY7B 4HV8B 2F15A 2H1LM 4PY8I 4RZCB 3U79A 4EE2A 1M3JA 2EIBA 3EGXA 3SDCA 3IAQA 4YGAB 3VD2A 2HX9A 1XGQB 2BVQB 4PTUB 4AMKL 4X7EC 3EFDL 4GT0A 2XC8A 1DQLH 2K7QA 3OMNB 1PG7L 3ARVA 1JVKA 2W0PA 4KY1L 4MXQC 3ALWA 2GG1A 3DTDA 3RWHA 3L7EB 5E4AA 5FCSH 4DOHE 5JYLA 4IGBA 4S0TD 2EIZA 3LZOA 4KAQL 4TKWA 5BS0A 4X6FB 1AHWB 3O0RL 3WI9A 1RAMA 3ZKSD 1N2RB 1DHKA 3GTVA 5JUEL 6PAZA 5F7KC 3CH1A 1TZOA 3WDIA 1JS4A 5EF1A 1R3KA 4ELMA 2VZ1A 4V1DE 3OLEA 4PS3A 4LCWB 1BDYA 4FG0A 1A7QL 2ICWI 2KKQA 1U8JA 2NUPA 4PFEA 5GGRY 1C1EH 5DVMA 1OP5H 1JV5A 1ZT4A 2XETA 1INDL 2BCKB 5SWZD 4A04A 4NI3A 1M1SA 12E8H 2XQYA 2E75C 4OGXH 2OMVA 4FTVD 4KTDL 1OM3H 4ES8A 5KVGL 3ZKMC 1S9VA 3OB0K 1I1AB 2GY5A 3QS2A 4JFFD 5ALCL 1RZFH 4J4PC 1KLFB 5HDLA 2PTVA 3KJ4C 1LO5A 4QPEA 5IFJB 3C09B 2EILB 3EYFB 1RK0B 1CIUA 2NY1C 4FLQA 5E5MB 3GSOA 5CLTA 3VFRB 1WHPA 2EACA 4KXZH 2YBRA 3HG1B 4MJIA 3FN0H 3SY0B 2EDBA 5CZXD 2DN7A 4YBLB 1MFBL 3WHXB 3EZ8A 1HIML 1YJDH 4AQEA 5FYLH 4AGOA 2AJ3A 3W56A 2HSIA 4OLYL 2H45A 3E0GA 4TLTA 3BGMB 5CCKH 1VFAA 4JDEA 5E9AA 3SPIA 5HI5C 4TQHA 4NQXB 1D6EB 1QVOB 5BZDA 2HX7A 1UCTA 3QQXA 3OPZL 5ETUB 4AXWA 1Y18A 3NBNA 1NC4A 1RIVH 3AU1A 3BP5B 2IFGA 2VDMB 4KXDA 5EEVA 4OQ1A 3W38A 3I84A 2I25N 3CDGA 3VM7A 4LIQE 3GLAA 2O5YL 4J3OH 2A38A 3GMOA 3GSQB 1LNUB 1S4IA 4U3CA 4A2HA 4AOFA 4ELME 3Q2NA 3O3DB 1QHPA 1FZOB 5FYJD 3MRLA 3SE8H 1OPGH 4WWID 5DRWB 4ETQB 2XYCA 5IV2A 3HUJF 5KSBB 4BFKA 5A16A 3KYKH 1CGSH 3RIFF 3VFOB 3S97C 2APXA 3VG0H 3EOBB 4KK9C 4GIOA 5C3LD 1NBYB 3BQUA 3EOTH 2KZBA 4RQQA 3OM3B 5E6IC 1BXVA 1QA9A 3BXNA 1FNFA 2R2HA 2J43A 4QAMB 1E40A 3SBWC 3X3GL 3BAEH 1CBVH 1W91A 3OKDB 3EJZC 1MPAH 3V0FA 1RIUL 5HHNA 3V0HA 4HIXL 1O7SA 1MFEL 2X9XA 2YMXL 3ARGA 3D85A 3OKMA 3T2NL 2PXYB 4YDLC 3UYRH 5AD0A 1J5OL 1MG2C 4OGQC 2EUZA 4TNFA 4IBVA 2DWYA 3NESA 3BIAX 2R0ZH 4ABVA 1SVZA 4ERSH 2NX5B 3MNVA 1LO0L 4RGNE 1B9KA 1ZLVH 2ENSA 3QHFL 1T66D 3MFFA 3MRRB 5FYJL 5MEPB 4M61B 3FRPG 3MTRA 4MJIE 2P42B 3FB8B 1O9ZA 4DH2A 4AEEA 2EEXA 3PNWB 3QIBA 1BQUA 2HKFH 5C0BD 4M56A 1A3QA 1YEKH 3CVHH 3IAGC 1ZTMA 3R06B 3TEYA 1G7MA 3MRPB 4MJ6A 2GK0B 3HZKB 2L3BA 3DX1A 2H0JA 3Q8FA 2G30A 1U2HA 3IJ7A 4Q9CA 2J5LB 3HKFA 4HIHB 5KSVB 1KBGH 4NKIL 3WYRA 1EZSA 3JQOB 3C5ZA 2IXQB 3ZR5A 3V0GA 1A5FH 4PJCE 3VFTB 5IOPA 3HW7A 2XPYA 3WNNA 3TH2T 1YRKA 4EI0A 4DCQA 3FU9A 2JJUA 1Q0XH 2NXZB 4FULA 5K1NA 1HWHB 2MWCA 2N56A 1KY6A 3L3HB 3QQ4A 5C0AD 3RZCA 3TESA 2DWEB 5L8LB 4AG4L 3HI6H 3L7FB 1USZA 5J6GA 1FDLL 4NFBA 1U8LA 3LD8B 4QRFA 3QEUA 1E4XI 2AJSL 2XHNA 4DGIH 2FEDC 2COVD 4LSVH 5LB1A 3JWOH 1WYJA 4R2GC 3WL9A 2BOBB 5B1CA 4MVBD 3QA3A 4YSRA 4RX4A 4CSZA 4M6OL 4MX7B 1JFHA 1T1XA 5BXFB 1J1OL 3B2VH 3I75B 4GP4B 2DDQL 1XSIA 4JHZA 2NCMA 3QRGH 1ZXKA 4X8CA 5EBMB 4MCZA 4XPFL 5KW9L 2YGVA 3C6SA 3O41A 4HA1A 1X7QB 5KVEE 4A7QA 3KEDA 1F00I 4Y5YC 2V2TB 3I9GL 2FX9L 1SHMA 1S8DB 1ORQB 2J8UF 3N3EA 4JR9H 5HPMB 2F2HA 5I76B 2X6CA 3FUMA 4P2CG 2IGFH 4Q9BA 2Z91B 3AMLA 5E08H 1GGYA 4XMKL 2D73A 4KO6A 4DPAX 3ZRCC 3CFKB 4W9EC 5I5IA 4M7KL 3T2PA 4PJEB 2OJZL 3S4SA 3IT8D 2FWSA 3D7PA 1EXGA 4PJ5A 3S35H 3DC0A 4MJ2A 5I30L 2IPKB 4LCIL 4PY7B 1SN0A 5DYFA 3VRJB 2E4TA 4LZKA 1ITBB 4Q6IA 1TG8A 2DM3A 3MJ7A 2R29L 1I8MA 3Q9QA 1G0YR 5EBWB 4XI5C 1VKXB 2DOCA 4FA7B 2R4RH 1N6QH 4R9HA 3MGAA 2QQQA 4I77H 3RFZA 4XXCC 3L5JA 1TYEB 3QJHA 4YSOA 3U2SB 2DQUL 3UAEA 1M57B 3VJ6B 1HSBA 3Q1EA 2PTTB 5TH2A 1X4YA 3LKPB 1RZQA 3HG2A 4C47A 4JDTH 1PZCA 1KCKA 2YLHA 4DO5A 1HHHA 4M5YL 4IMKC 2XY1A 4BHUI 4UYPA 4NQQA 2VUOA 1H9VA 1KGIA 1SLUA 3KJ4B 4PJFA 1EXUB 4FQXB 4PWJA 4GRLB 4YS4A 4KOCA 4P0DA 2O72A 4N6RB 1NDMB 1JDDA 2I60H 4W9ZA 5FKPA 3SDDD 2VXQA 4XC3L 4BWUA 3LPPA 5GIRA 5IB4A 2ENQA 5FM5O 2B16A 4U1JA 4HCRL 3OB8A 5HGAA 3AADB 2B2XH 2CDEA 3FT4B 3F6IA 1KJ3L 4G5ZH 1VB9A 2OI9C 2WLIA 5DHVB 2CXGA 2VCOA 4JRYB 3TYFA 3WUWB 3DX0A 2JKJA 3MRBB 4DKFH 4GUPA 3MV8B 4CVXA 3RIFK 3WTVA 1NFAA 4JCLA 4PCYA 3V4LA 1SXNA 4HUKB 5B8CB 4GQ9L 3VG9C 2WCGA 5A6MA 2YD5A 1BZ7B 4LGSB 4DGYH 1PQZB 2UWEF 1NEZG 3SOBH 1GYAA 1GGBL 2EH7L 4PRDA 3E9UA 3E1F1 3OTTA 5LLIC 3NIDE 4AK2A 4Y1AD 3UZEC 1DBJH 2R15A 7PAZA 5CMAB 3VSUA 1L5GB 1Z9OA 5FXCH 5KBDA 3GF8A 3EFOB 4JL2A 1F58L 4RWYL 3DX6A 3WKPA 5HYFA 3GPSA 4LB8A 1TEFA 1H3TA 3FMGL 5I1LA 3V0VA 4KITB 3NK4A 5L2KD 4N1HB 2VW7A 3D5OF 3FQUA 4RFOL 1Q9OB 1I7TB 3VO0A 4K8RH 4QGTA 2VDRL 4XVJL 5KG9B 1BF2A 3EUDA 5AYQA 1MUJB 1LK3L 1UB5B 1LTXA 1NCJA 4FG6D 1FZMA 3FTXA 3K4DA 2ZF9A 3MODL 2A9ML 4FJYA 3PGDB 2D31B 4YDLB 4JM2A 4GUQA 3NSYA 3KR3L 5DEJA 1W8EA 1U95A 2IQAA 2B1OA 4WU5A 2XWTB 3HB3C 3BVDB 3THML 1E4HA 3O6FB 4ZNCD 3QYNA 1JIBA 1SM3L 2CD0A 3ZTJH 2ZG2A 2R8SH 2XTJB 3FO9B 4TUKH 3S96B 5B7FA 3NSDA 4XPTH 1PKQB 2WWMC 4QJ5B 5E5UB 5E8EB 3VFNA 4HGWA 1M3IA 1FF5A 1D2OA 3MLXH 2V8MA 3F58H 2QVKA 1O6SB 1EGJH 2VXSH 4MBRA 4PJGA 4C8XA 2O5ZH 1JGLH 3FQWA 3BH8B 2OZ4L 3NSFA 4MA1B 4NNXB 2Q20A 4JQXA 15C8H 4QRPA 3S5ZA 1AO7B 3MV9A 3UTSA 1FJ1A 5E7FA 4JLRB 3RVTD 3BT2L 3KYMA 3U6XA 3CVDA 2DTSA 2WTPA 5IHUH 4QY8A 5LN8A 1IGTB 3O9WC 1X5ZA 4GFXA 4JO3H 4WHCA 4GBXC 3TXAA 3BP6B 4K3EL 5JPMC 5F7LB 1OPOA 3EGXB 3SDCB 2XV0A 4Z7QE 1X4ZA 5IIEA 3SGDI 4MDRA 4MDJB 1U3ZA 4QOKD 3C2AL 3UBHA 4HWBL 2BWDA 1UD2A 2QSVA 1B2WL 4Y9GA 1R0AL 3LDBC 4YHKL 3A23A 4YHZH 3VTTA 4ZPVA 3RWHB 1M42A 3LQAC 1NFDA 4IGBB 1RUAL 3ZE1E 4Q9QL 5DSCA 1PS3A 5GS0D 2DWXA 5JHAA 3A4DA 5BS0B 3FO2A 4UI2A 1BW8A 3CH1B 3CZJA 1BWWA 3ZDYB 2JLPA 4DGUA 1GHFL 2AKRA 3T0XA 1B90A 3NA9H 4ZMYA 2FUQA 4U1IB 1CR9H 1UFUA 2Y7LA 2WJ5A 3FTVA 1PF3A 1U8JB 3VFUA 1WV7T 1OLZA 3F7VA 3D12B 2NYYC 5KSAA 4ANWA 1A7PL 1L6XA 3CXDL 2WGXA 2FX8H 5C92A 3IMSA 4UT9L 1V27A 3ML8A 3OG4B 5G4NA 3IF1A 5GS0L 1S9VB 4P8QA 1MQKL 3AT0A 1DBKH 2DYPA 4CN6A 4P2RD 1CFVH 2GKIA 2YARA 4WI3A 4FEMA 1EDYA 3NZHH 4HMEA 5CFHA 4NDMB 2GEEA 3GSOB 2X40A 5H4YA 2B59A 3F00A 3M45A 4GG6B 1QSEA 2F54E 1KFAH 1DVZA 4IS6A 2AJ3B 1WAAA 1FWXA 2EIKB 2C9AA 5HHPB 3VGHA 1OD7A 2DEXX 5AOIA 1L9TA 1XMEB 4J1UA 3ZSSA 1VFUA 5KSUA 1GYUA 2XZQL 1KEGL 3TPKA 2AXFA 1NFDE 3LNHA 2CJTA 4Y4FD 1X5XA 4GKNB 1Y18B 4J6IA 4AXWB 4ZNEE 3AU1B 2A6IA 3QORC 1R9FA 3S3SA 2UZIL 4ZSOA 3O4LE 1P4BL 3RTQD 3CDGB 2VDOB 3R8BB 4GKSA 2Y72A 1WWBX 3GMOB 4WNQA 3QUKA 4FFYL 3TOPA 4XBPA 4ZFOL 5CD5C 5IV2B 1U3HD 2OMWA 1SDAB 5A16B 4JFZL 3S36L 3L5HA 4IK6A 2H3NA 3NFNB 2D7QA 4RQQB 3BQUB 2DM4A 5EEYA 5D1QA 3QUML 1A6TA 1B0GB 3BXNB 2FECL 4FQCL 3DO7B 2C9VA 2AJVL 4M29A 3TJHC 2ADYA 3OKMB 3D85B 4KRMB 5AD0B 3VG9B 2UYLA 4BA8A 1WFOA 2KYIA 3RU8H 1T2JA 3CX5J 3MNVB 5I6PA 4N86A 3UTTD 3V52H 2CALA 3GS0A 3MFFB 4H1LB 2PPCA 1QPPA 4QLWA 4O2FA 3FHQA 3QIBB 1AP2A 1ZSHA 4RMSA 2JKWA 1ZLSH 3SZ6A 4OFKA 1WAAE 5DFAA 2PNDA 1HJBC 2G2RA 5EEUA 4W6YB 1MCWW 2FH6A 4D9RD 4OT1L 1NDGA 1CFMA 1FO0H 5E0FA 1G7QA 1G7MB 3DX7A 1ACYL 3B9EA 5FYLE 4MJ6B 1U58A 3DX2A 5B38G 4DGVH 1DJGA 3JVGA 5AB9A 5L7XH 1CLCA 3RLSA 4BH7A 3QPKA 3IMVA 4KNUA 5CS7A 3C5ZB 4ZAKA 3LMJH 3QIWD 2H32H 1LILA 4JBSA 3E8UL 4X4ME 4ZW5A 1Q9KA 4DCQB 1P2CA 4P23A 3MRHA 3SE9H 3QQ4B 3QXAA 4XOCA 3HB3B 3EADA 4K3DH 1E5YA 2N1TE 2XX1A 1JYNA 1NSNH 2F19H 1LMIA 2Z92A 4LHQB 5HHXL 1U8LB 1FGNH 4W9HC 2HPOA 1C5CH 5JIMA 2WLJA 3QEUB 4U6HB 4XPGL 2AJYH 3RRQA 1I1RA 1OAYL 3VWJA 3S7GA 4NQSB 3WL9B 4Y4KA 1CXKA 4IRZL 4ONHA 4PJHA 2X42A 4YDMA 2MPAL 1HINH 3EIFA 5AW2B 1D5IL 1MF2H 1JV2A 3FCSA 3K91A 1CLVA 5B3SB 1FRGH 4P2OA 2L7JA 5T33L 4OZHB 1N6VA 3BO8B 1JZ7A 2C9PA 1NBVH 3WO4C 3U4AA 2H2PD 2ZCLH 2RHEA 4OFPA 5EU6D 4MCZB 1INQA 3C6SB 2BP5M 3O41B 4MAYA 3WIHH 2Q2EB 2UX6A 2BRRH 3REWA 4BSJA 4QRQA 4WUUD 2CO6B 1LXMA 4RDQF 4DK5A 1NCBL 2NZ9C 3SKMA 3D4ZA 3HE6D 2IDFA 1KSRA 1TNMA 4RH4A 2GIMA 3KPRE 4OCRH 3DX8A 2R2BA 3IDGA 3EBAA 4FN0A 3S4SB 4PJ5B 2AJXL 1JF6A 3X1GA 2QKIC 1OF0A 4I9XA 1XGYL 3QFJA 1SF3A 3OKYA 3ZTEA 2X09A 4MQ7B 3MJ7B 4HPYL 3STLA 4JFED 2GHZA 4IEFA 1J5HA 4PSRA 4A55A 1YYCA 2R0KH 1XZ0A 2NW2A 4OAWA 3ZO0A 3K0YA 3LS4L 1G4RA 3A4FA 1L9PA 2E7MA 3RDTD 3TYGL 1NLBL 4ZMNA 2WO2B 3NAAL 3QJHB 1CK0L 4PSPA 1A1MB 2BDNL 1KCWA 3X1BA 3LPOA 5AZEH 4D94A 2QZ5A 1C8PA 1HSBB 5TH2B 1DVFA 3RY6C 4WO4D 2IV8A 3VB9A 1FFOA 3II3A 1GA2A 4RMWA 4OI9A 2WO4A 5IZ7A 1BMWA 5TQ0L 4PJFB 2FBOJ 1CLOH 2YOCA 4FX5A 3UAJA 3D33A 3PYCA 3HJEA 1WISA 1CFQB 2GVYA 5FKPB 4HZ1A 1T0PB 5FCUH 1XEDA 5IBTH 5GIRB 3CX2A 3CHSA 2NT0A 4FNTA 1T03H 3HBPA 4EAEA 5IF0A 2P5WE 4XHJD 4BKSC 2NPLX 5HGAB 2CDEB 3MCLH 4G71B 4IBWA 3G3LA 2WLIB 1FGVL 3GSRB 4MS6A 4HXBH 5F9OL 3TYFB 5I19L 4GUPB 1K2DA 2F7RA 4ZMTA 1R34A 5DZNA 3FFOA 4PVBA 3PWNB 3W1ZA 4TS6A 2G4EA 3DJTA 4DN3H 4YVUA 4A2LA 4OIFA 2QTEA 4PRDB 2HTKC 5F7YC 4RMTA 3FUDA 4R0LA 2OR9H 5E5RB 1AXIB 4ODXA 2Y7SA 3LNGA 3L3JA 1JK9A 1GSMA 1ZVSA 2WVVA 3FU3A 5C07D 4PHZA 1PPIA 5DJ0A 1EAPA 1CFNB 1G1KA 3S9DB 5DU7A 2A9CA 4LMQI 1KYFA 3DX6B 2BSDA 1T7VA 1H8NA 2FATH 4GRWF 4ZRGA 4KTEH 3V0VB 3VXNB 3L3KA 2PCFA 4L3AA 4ALAL 1KLGA 1E28A 3FQUB 4Z95H 5I6OA 4X6EB 4IDJL 3H9SA 3AS3A 1T7XA 4FFVC 3ZKND 2C7UB 1RKRA 4MA3A 3N40F 3US9A 3V0EA 4G8FA 1O5PA 4JM2B 1EZLA 1YY8A 3ES6A 4ODUA 3N1PC 5D5MA 1E6JH 3DGCR 1FFPA 5AYUL 2FIKA 5DHYB 4OF7A 2YEVB 1U95B 2IQAB 3IFPA 4N2DA 4WU5B 1WTGT 5DC9B 3QAZB 2VXUL 1VGEH 3CDYA 4WGWB 2VQTA 4NSKB 3UCQA 3LV3A 3FU5A 4XP4L 3VXTA 3BPOC 4C54A 1CVSC 2JIXA 1WUZA 3S3JA 1ZJBA 3VFNB 4HGWB 4PG2C 2YZ1A 4I4WA 5EOQH 4BK5C 1F86A 4O9HH 3ZL4L 5E2UH 3PU7A 3QQ3A 4PJGB 4Z7VB 3WIFA 1K8DA 3CN3A 2ITEA 1G1YA 1IFRA 2VZTA 5E03A 5IUSA 2DL9A 3LQZA 4FP8L 4QRPB 5E2WH 5AB0A 2BK8A 1K5NA 3MV9B 3UTSB 1FJ1B 1G9MC 3MRKB 1H8SA 3KYMB 3IJ9A 4HAKA 4LCWD 4PJXB 3BAWA 5CJBA 1PGRB 2CZNA 4GXVL 5E8NA 2F8IA 3SJVE 2J57A 3L5WA 5F6HI 1UURA 2WUBH 1GJUA 4Y16A 1AYRA 1HHJA 3GQFA 3TWYA 2Z4QA 5DZVA 2OCFD 1AG0A 5IIEB 3EDEA 3CQPA 3LZLA 5KBMA 2EO7A 3DV4A 4ZQKA 2BHFA 1S78D 1P0SE 1I1AD 1HXMA 1QNIA 2HUHA 4ZPVB 1KJ2H 4GO8A 4XPBL 1UM4L 4XNMA 4TLKA 5IFHL 4RVBA 4DPBX 2ATAA 2VRKA 4I0CC 2AQSA 1WZMA 4ONGL 3RZWA 1OF2A 3ZZQA 1MW3A 3SE6A 3X13A 4N3UA 2AKRB 4NQTA 5I0ZA 3WO4B 4G8IA 1UWXH 5J11C 4XXDB 3OQ3B 3DIDA 2FQEA 2B8OT 3PREA 3RGVA 4X99A 3VFUB 1A6AA 2VR5A 4FXKA 3S3DB 3F7VB 4JKMA 3NACH 5IB1B 4HVBA 2CLRB 1V7NL 3HC4H 3VI4F 3WELA 1UENA 2DMGA 3HG5A 4K9JA 1NC2A 4NM4H 3CSYB 4ZMQA 3IF1B 3NJHA 4UQ2B 1UGNA 5I5JA 2VR4A 2R0WH 4PJAF 2DYPB 1J1PL 2OM5A 2N0KA 3UADA 1Z2KA 5DUPL 2FBJL 4HKJA 3SDAA 4RMUA 2AXGA 1MRCL 1SOKA 4NZJA 2B59B 1OZTG 2WYIA 4ZI8A 1QSEB 3GMLA 2KL6A 2DQGL 2DF3A 2GY7B 4IS6B 4OJFL 1E9OA 1IE5A 2GFBA 3QXDA 4J1UB 4LSUH 1JPSL 3TASA 1Z9PA 1QYGH 4G3YL 5CILL 5KSUB 2WKLA 2VDML 1NAMH 2PXYD 1II4E 4K9EH 1RIHH 2YAQA 1IKOP 1A47A 3LOWA 3PGFH 4XNAA 2A6IB 1GOGA 5JIHA 1ZHNA 4OLXH 4ZSOB 1UXMA 4IU3A 3S6CA 4YDIL 2BSBA 5LNGA 4FMKA 3KDMA 4GKSB 1FYTD 2PCPA 3CZKA 4WNQB 1BM3H 4BQ6A 2HFEA 5T1MA 2MOGA 4F2MA 2HVBA 2QFRA 2B3IA 2O26U 5DJXA 1HCYA 4J3WA 3KLKA 1LDSA 2OMWB 4A7GA 2MSPA 4OM0L 4PB9H 4HFWB 5TF0A 4H20H 2AZAA 2VDKB 3L95A 3EJUA 1UWGL 1VJSA 1RZJC 1KACB 5D1QB 4KJQC 2HJFB 4AITA 3I6LD 2V9UA 1MJUL 5C2UB 1J10A 3B3IA 4KX7A 4PP1C 5CINL 4LLUB 4HUMB 5DQDH 5GSVB 1QACA 2I27N 2VL4A 2UYLB 3SQOH 1CG9A 2NXZD 2LLLA 5D2LA 3TZVC 4NC0B 4WI8A 4R90L 1P9MC 3B9VA 3LCYA 3P0VL 4LPTA 3EXJA 1HESA 5HDRA 3EH1A 3IXAA 5HYJE 1MCJA 2J8OA 3KPPA 3EYSH 4HWUA 3TPUA 2BNQE 1RU9H 1CTMA 2FGZA 1B2YA 4CU8A 4O2FB 1ZEAH 4YNYA 1QTPA 2G2RB 4DW2L 1FVEA 1G7QB 4KV5F 3DX7B 1B6DA 3T2QA 4YDNA 1SUHA 3DPDA 2P5ED 4BH7B 3OZLA 1UXSA 2Y7OA 3F01A 1FO0A 3RIAF 4FLOA 4OIAA 4A6YA 1KENH 1T5XA 3C6LA 3BKML 5GGSB 1NGWA 3G5XA 2YQGA 5D2NE 2WOBA 3B43A 3PWLA 2ZOOA 3HC3L 3QQDA 1Q9KB 1F56A 4HF5L 1P2CB 2HRLA 2D3LA 3H53A 1TDQA 3MRHB 4ODHL 5HJBA 3UC0H 5M95B 3BEVA 2NQ3A 3QXAB 1HNFA 4YN3A 2PUQT 2Z92B 2GJRA 4OF8A 3BRDA 4EKJA 3RWJA 5G5DA 3BPOB 3GKZA 2XKNA 1H3VA 4ODSH 3AU0A 1HH6A 2YUWA 3OMAB 3TFBA 3FTGA 1M7XA 3UBXI 4L8CA 5J3HC 1JXFA 4FABL 3UPAA 1P84J 1FVCB 3AY4A 4A38A 1ZDSA 2P3YA 3V0IA 1M2OA 4Y4KB 1H3PH 1MCFA 4PJHB 1ZLUH 3FSVA 5GGTL 1JV2B 3FCSB 4L5FL 5IEKA 3RX7A 3ZRSA 4P2OB 4ADJA 3BP4A 3RJDA 3X1FA 3QNXA 3SYQA 4AV5A 5JHMA 3U0PA 1RP8A 2ICEA 2YAOA 1MREH 1INQB 1P5UA 1R5WA 2DBLH 2JK5B 4MAYB 3ZUCA 2J5WA 1FZJA 9PCYA 1H3UA 1DDTA 3DK2A 2GI7A 1BZ9A 3FSWA 4QRQB 3OKEB 1KCRL 1J0KA 3WIHA 1DTUA 2NNFA 3SKMB 5I2IA 1RCYA 4PJ7E 3TT3L 2QLYA 3NJGA 4DQOH 3QUZC 4DF9A 5AG8A 3DGDA 3QNFA 4RFEA 1BFVL 1W0WA 3DX8B 1O5DT 2R2BB 3IDGB 4M93B 3CWGA 5BO1L 4PGEA 4TOYH 5KSBF 1CT8B 4FQXD 4GRLD 3HE7C 4MB1A 4X7DC 1A1NA 5DMGD 3ULUH 3QFJB 5J13C 1SEQL 3APFA 1JGUL 1I1CA 1U8OA 2NSQA 2C34A 5CNHA 4IHOA 4NO2B 1XZ0B 2NW2B 4MCYA 4OAWB 4QXUH 2ZT9C 2ZX6A 1JPFA 4JRYD 3HI1B 1MNUL 4JPIA 4MJ5A 3PAUA 4FQQA 4M5TA 5CZVH 3ZZLA 1OTUD 1XAKA 3CBJB 3MV8D 4QLRA 2W0FA 5BVJB 1F1AA 3JTSA 5AZ2H 3MOBL 5IROA 1QBML 3CFEA 3QDJE 1TO4A 1DVFB 4FQ2L 1J9TA 3RPBA 2E8ZA 4P06A 5DTFB 1FFOB 4P2QE 1XHHA 2Y2WA 3RPKA 2IAMA 3HS8A 1H3WM 4GQQA 1ZHBB 5CGYD 1KNOA 3VMNA 5C97A 3SGEI 2CH8A 2R7EA 1JUFA 1UD5A 2VLKE 2ZKHL 3GXIA 1W80A 4QYOB 2UZXB 4ZXBC 5J6HA 4EKXA 1Y6NR 3BDYL 2IC2A 1N5YL 1F8TH 5IF0B 3VX1A 4UQBA 4XT1C 1FG2A 2W38A 2XBDA 1OTTC 1TTBA 2F7OA 3DI2B 3HHMA 3V95A 4HQQL 2KLSA 1K2DB 5EZOH 2HT3C 5EO9A 2E6QA 4UNVA 1SQ2N 1HI6A 3A24A 3F5WA 2B9AA 5C7XL 3QJRB 1XR9A 1QFUL 4WI2A 2PP9A 2A6JA 5CEYB 1A66A 1PLAA 2Z8RA 1AS6A 1AFVL 1C8QA 4ATWA 3ZQXA 4ODXB 5GRJL 2X0WA 3O6FD 4M43L 3L3JB 4W93A 3HMXL 1ZVSB 5IBLD 1BQKA 2XTJD 3EG9A 4YSAA 5DJ0B 2CPUA 1HHIA 5TDNB 4KKBD 3VMPA 4AGQA 5DJ2A 3VUAA 5MERA 5DZOA 1ZLEA 2NXYC 2BX5A 3L3KB 3B5HA 4K3JH 1KLGB 1E28B 1MG3C 1TTAA 3MBXH 4WWPA 1JG9A 3H9SB 4FYTA 3FTWA 4A7TA 3CN2A 1CLZL 2IWFA 4ZOBA 4MA8H 4MA3B 4X6DF 2JKXA 3AREA 4G8FB 1YY8B 3ES6B 4ODUB 5CJOH 5D5MB 2HFGH 2WPGA 1FFPB 3ZRFC 4WTQA 2FIKB 5C0CB 1HEZA 1THAA 2EDKA 3IFPB 3Q8EA 3SDCD 5TD4A 1BOGA 1WC7A 5HYQA 3FO1A 3NCEB 4YSCA 1GC1C 3ZY7A 4X80L 3LV3B 3S2AA 4AW4A 1MCLA 2ZF8A 1KIQB 2G60H 4PMFA 3VXTB 2JLLA 3FFCA 4MQXC 2JIXB 4ZS7H 4JFYA 1R3JA 4OCXH 1IEHA 3OHXA 4OIIH 4FZEH 5CJ8A 4ZX3A 4IGBD 4BFIB 1OHQA 4MLIA 4A37A 3G6AA 1RZ7H 3QQ3B 3WIFB 1JXGA 5F93C 1K8DB 1XD0A 5BS0D 4OCMC 4APQA 3LQZB 4JJOA 1OANA 2WXQA 1MNNA 5MENB 4RNRA 4U1GC 5EZIL 1FL5A 3GTNA 4WF7A 3CUPA 1UT9A 2HLEB 4P5MB 3MCYA 5E8NB 3RKDC 3QUXA 1M2VA 4XBGA 3PWPE 4GSXA 4Y16B 1MHPH 1HHJB 2WNWA 4LCYA 3KLQA 4NLAA 2VISA 1D7DA 3D0LA 3CK0H 4L4TB 3DV4B 1IT9H 3I2CH 4XB3A 3IRZA 1HXMB 3UTPE 4P4KC 2ZXAA 1F4YH 4WHYG 4AQ8A 2LLNA 5I71C 4XMVA 4LIQL 1QFWM 3UEQA 3P40A 5FV1L 1SY6H 4G6JL 4AH2A 1LO2L 4PBVC 3M8OL 4QTHB 4R26H 1KJ2A 2ZX9A 5F9WB 4TUJA 1UACL 5G55A 3AQDA 1OF2B 1QPXA 1YEEL 1DLFH 1GGCH 4MJID 5I18L 2B1AL 4ANXA 4G8IB 4I89A 2HKHL 1F0LA 3P2DA 3QEQA 4GKZB 4XNYH 1JVLA 3UP1A 2EIJB 4X99B 3BFWA 4HMCA 2WXOA 3IEAA 5F3HA 5ACMA 2O61A 4KK5C 1A6AB 4BEIA 1WICA 3CV5A 4HOMA 3OPUA 3PV6A 1A6VH 1YN7A 2YPVH 2CBOA 5CEZE 4Y2DA 2APWA 1NC2B 2P46B 4LCVA 5E99H 2I69A 3MLZH 5FUZH 5I26A 4YXLL 5D1XC 3HZ3A 4HD5A 5DFVC 3DVFA 4ZO8A 4DAGH 2X44D 3MXWL 1ZE3C 3L4CA 5D72H 4YX2L 2X2UA 3GXNA 4YR6A 1NINA 2D03L 3SDAB 4AMWA 2AXGB 3KVPA 5J13B 2G0LA 3KM1A 3US1A 1UYWL 2EH8L 4LSQL 3QBTB 4MNQB 4OQTA 1I85C 3GMLB 4NFDA 1EPFA 4JG0L 4Z3EA 3BQUD 1MCHA 1RUMH 4XNBA 1QTYT 1XF4A 4LSSH 5TPWH 2FECI 4W70A 4B9IA 1S7QA 3N41F 3AWEA 2GFBB 4N5UA 2NMSA 4R4ND 5HVHC 5DYOA 2VH5H 3UGUA 3ARGD 3D85D 3RE0A 3ZL1A 4DERA 5CN3A 1ZT1B 2VKWA 2VDOL 1UTDA 2VDNB 4HS3A 2ORBH 3D34A 4KHTH 4WFHE 4F9LA 2IH9A 1NAMA 3B1UA 3PQYA 4IU3B 3EOYG 3BESR 1NKOA 4OB5H 1RUKH 3KDMB 2YFOA 1OAXL 1Z9MA 4D2NA 1CLYH 4ODTH 1VERA 2HFEB 3RI5F 4F2MB 1F2QA 5CSBA 3QIBD 2WUCH 4JFXB 4LDLB 4KO5A 2PR4L 2X2YA 4NRYB 2BVYA 3IDXL 4AT6A 2QPSA 1KBBA 1HL4A 3SOTA 5J57B 1DQIA 5F21B 1KXTA 3L95B 1UKTA 1JNLH 1N8ZA 2QHRH 3L3IA 4ZTOL 5E6SB 2C9QA 3A6CH 1U42A 1TCMA 1YUHA 5T1DL 3NPSB 1D2PA 3GXPA 1P4UA 2BNRB 3QUYC 2AK1H 1YN6B 3C5ZD 4GY4A 4JZJA 3L5XH 4Y9EA 4GAJL 3MLSL 5IR1B 2ZOLA 3RX9A 35C8H 3G5VA 1CG9B 2P8PA 3K1DA 3TV3H 3ARTA 1IVLA 1N3NA 2Z3FA 3CLFL 4IKIA 2Q8BL 2YQ3A 3OL2A 4FNSA 5D2LB 2CJ3A 3SDXA 2K6ZA 5IP4A 1DE4A 3QCUH 3LH2H 5B1AB 3RZCD 1PG7W 1HVXA 5AOJA 4ADIA 1ID2A 2XZCL 3EO1A 2VJXA 2YAPA 1J12A 3INUL 2ZXWB 3UMTA 5KYWA 3BEWB 2YA2A 1PLCA 5EMYA 2AJZA 4Y1SA 1RFDH 1DQDH 1ZS8A 2Q10A 5L88L 2KS0A 1NM4A 3EAKA 1N64H 3Q43A 2NXYB 4RX4D 4ELMF 5DQ9A 3FB7A 3QZWA 5TF1L 5BPPA 4WSKA 4A6YB 4NQCA 4K71C 3GLZA 1A4JA 1NGWB 3G5XB 4MKMA 1GZQA 1JZ4A 2E7CA 1OSZA 3QIUA 3VD4A 3ILQD 2UXTA 4NC1C 3IFNL 4I7ZC 1KN2H 5FUCE 1VGKA 4KMLB 4F7TB 3BEVB 3L2MA 2A3TA 5CEZH 3S34H 1FFNA 1K4CA 1IBFA 4V33A 1W0VA 2MIZA 3VVWA 3RWJB 2DLFH 3EDKA 3HNTH 5G5DB 4A7UA 5DC2A 2R1WA 4J6RH 4JREC 5HI4C 1HH6B 2M8XA 5IT2H 3FTGB 4L8CB 3AM8A 3IJSB 2EEFA 1UOKA 2BOCA 3TNMA 4KQ4H 3PABA 4PJ5D 3RUGA 5ALBH 1U8KB 5GSRA 1KEML 1FN4A 5IEKB 3GHPA 4IJ3B 3TO4C 3CXHK 4L1TA 3K1KC 4WFGE 3BP4B 4UV4L 4U1GB 2WN3A 1IJNA 3IS1X 3O2DA 3QNXB 4H25B 3SDXE 3U0PB 2APFA 2ICEB 3BISA 1NCCL 1ZJAA 1R5WB 1P5UB 1S46A 3MLTA 5HI3C 1NCIA 1QQDA 1FZJB 2DQMA 5GISH 3H7BA 3ZE2B 4TQEH 3IDJB 3IDUA 1BZ9B 4I2XA 2NYYD 4MMZA 4B9ZA 1JMZA 4C59B 4D0CA 5I2IB 4R7NB 3ESOA 1Q0YL 1OAJA 1B0RA 1J0IA 5FA4A 4AYMC 3TVMC 4RFEB 2WXIA 1YNTA 1I53A 2ZICA 3D39A 4V2CB 5A6IA 4X8XA 4DN4L 4OD3H 4C56A 5I8OL 4O02B 2A74A 4QHKI 3MVSA 1IBGL 2AEPH 2XIBA 4LESA 4U2YA 1NGPH 2V5TA 3U30B 1KDIA 3VQLA 2MCG1 1E5BA 3QH3A 2WBJC 4L3EB 4P5SA 2V17H 2FAUA 5IGXL 1U8OB 2OXGB 4IQHA 4LHUG 5BOJA 2WNXA 3DRQA 4ZOCA 4IHOB 4NQEA 3MOAL 4MCYB 5AEAA 1MFDH 3P30L 3UYOD 1JPFB 2C9SA 4ZMWA 4JPIB 3P77A 4FQQB 1NLDL 5D7JA 4Z7NE 1DLHA 4HX1A 2W0FB 2H1PH 2YEQA 3O4OC 1CGTA 3JTSB 4S1QL 1A3ZA 1CTOA 1IGCH 4LNRA 4M1GH 4PYGA 4LOEA 3G08A 1SJHA 3O3BA 4HGKC 2EVHA 4HJ1A 3DHJA 3RUGE 3SD5A 2XWBA 3SQBA 5GGQH 1L9NA 1MRDL 2EUXA 2YWYA 2VXQL 4BZYA 5D1XB 4NQVA 1XCQA 3NIGB 4RGNC 4WI4A 1FG9C 3WN5C 2BW5A 2R7EB 1JUFB 4WTXA 3WS6C 4PB0H 2V2WA 5J6HB 3FU8A 4H13C 5A7EA 1A3LH 2QQLL 2CIIA 3KDPB 3IVKA 3GM0A 1DJHA 3CZLA 1ZVYA 3ZW3A 1FG2B 3VE0B 2I9LA 4DKTA 3SO3B 4Y19E 3RI5K 3VYPA 3TH3T 1AXSA 3X3FH 4X7FC 4APXB 4LSPL 5AW8B 1TTCA 4HLZH 4E9QA 5HVHB 3GDCA 3JWNE 5ERWA 3F5WB 1UWFA 4PJIA 3O8XC 43C9A 2RFXA 1RJZA 2VXVH 3A3YB 3D39E 3GC3A 3OG6B 4JM2D 4QYAA 2A6JB 4IMLA 2QPDB 3U1PA 1EBAA 2C4FU 4XH2A 1PG7X 3SGJC 1XT5A 2DYRB 3IM1A 5FYKH 1M7IA 5GPRA 1BEXA 2JKIS 5C0GA 3VD1A 1FNSL 4BFGA 5F7DA 3T8XA 4ZFGL 3CSPA 4P5KA 1E0OB 3EG9B 4QF1A 4ZUUA 5FEBA 2CHXA 3ULUE 1PNCA 1LO3L 5JPNA 4NQEE 1SMOA 2H6PA 2W9EH 5DJ2B 3T2LA 1UJ3C 5MERB 3PUUA 4PW3A 2XLLA 3L17A 2BP8A 4JHAL 3H3PL 4DSYA 2BJML 4JRWA 1OAUH 2X6MA 2J3SA 4MBOA 4YXKL 3FUKA 4QRPD 5I73C 3F05A 2J88L 3P4OA 3MV9D 4FNQA 3TBBA 3VTMA 3UTSD 3BIKB 4N24A 4MD0A 4AMKH 3EFDH 4JKLA 1HEZB 1Z0NA 2WIIA 1PG7H 5CJXC 2JCCE 3WE6B 1BOGB 5HYQB 4HISA 1CGVA 3CFNA 3MRFA 1GRWA 4XWOC 2JXMA 4BGDA 1V55B 3UFIA 5ITFA 2Q9OA 3ME0A 4KAQH 3EBHA 1J18A 3QJFB 3FFCB 4NCC1 4ONFL 3QWOA 4UAOC 3MBEA 4MSWB 3TCXA 4JFYB 3O0RH 1R3JB 5LXGH 2MQGA 1FZKB 3B34A 3OHXB 4PRBA 5JUEH 4R8WL 3PIQA 1NPJA 4G6MH 3NIDF 3JWDH 1BHGA 2ZONA 3G6AB 3NGBB 4U6VL 4N87A 4NN7B 3GMQA 4APQB 4L2YA 2AAAA 3KGRA 1KYDA 4TSCL 1A7QH 4ZW3A 4PLNC 2FB4H 2OMUA 1FL5B 2YQ2A 3TBYA 1INDH 1QKZL 1A4CA 3L2LA 3WNJA 2H6OA 3QUXB 1M2VB 4EIZC 4KTDH 5DHDA 4HJSA 2G5BA 2IFFL 1JF1A 3ARRA 5KVGH 2F18A 4PGBA 2CPCA 4LCYB 5ALCH 5KSAD 4HG4J 2NZ9D 2VISB 2I7SA 2AQ3A 5DT1L 1HAUA 4PJFF 1O7DE 5CP3H 4JREB 5KVDH 1NPNA 3CDZA 3K6IA 1H0DB 1U21A 5KJ7E 2EKSA 2DYPD 3FHAA 4LVHC 1G7JA 4AH2B 3NCYS 3UJJL 1HIMH 3BZ4A 4TUJB 4G9FA 2LVEA 4FGMA 3TO4B 1NOLA 1CMOA 2OKMA 3FCTA 4OLYH 2ADFL 1QSED 2ZOTA 4GH7B 4JN2A 3B37A 5IJBC 4FYRA 1OAZL 2RIKA 3QEQB 1BAGA 4O2CA 1JXKA 3K3QA 3OPZH 3PCYA 5F3HB 1HDMA 1IFGA 2CXKA 4KXBA 2O61B 2WXGA 3NFPA 5AVSB 4PW4A 4Y2LA 4MB4A 1EEZB 1PD1A 3PV6B 1YN7B 5D6DC 4FLSA 3BGFB 4KJPD 5LBGA 2O5YH 2X1OA 1KCSL 4L29A 4Y2DB 3VVVA 1E3XA 5EU5B 5F7UA 2EUWA 5EC1B 2Z6FA 2G5RA 4FC3E 1BIIA 4G1EA 5E1QA 4DVRL 3HAEG 1ADQA 3BCFA 3WKQA 2WXMA 4EN3A 1JP5A 1WWCA 1RZKL 3GB7B 3RVUC 4OV5A 4S11A 4KJWC 4B9PA 4YR6B 2E27L 1G9NC 1I1YA 2DMCA 5BW7A 3H54A 3Q2WA 5GJSL 3EJTA 3UC2A 2XIIA 4J3OD 2CRIA 4U33A 3X3GH 5B21A 5B1JA 3FN0L 2CRMA 3BCDA 3ZE1F 3KXFA 1PVHA 3IYLW 3NIFE 4HIXH 1U92A 1MFEH 2YMXH 4LAQH 5T1JA 1BJMA 5D1QD 3T2NH 1I8KA 1J5OH 4XB7A 1S7QB 5FFLA 4B0MM 2Z35A 1HAWA 1LO0H 4KZDL 1GS7A 1EJ6A 1A1OA 1NCAL 1NL0L 3KNBA 2F0CA 3O4OB 2CQVA 5DYOB 5J1TC 3QHFH 2YSTA 1YECL 2EECA 4HC1H 4AV0A 2I9TA 4CL7A 4H1LG 5CR1A 4HS3B 4XTRD 1IAOA 3PQYB 1USQA 4AVJA 3UEZA 4LAJH 1ZWIA 2WLZA 5INCA 1FH2A 1ACCA 1LEIA 4GB9A 2V7NB 3SHSA 3VXOB 1GL4B 2FSEA 2FH8A 2VDKL 4PJGF 1OPGL 4IKKA 5F3BB 2Y07L 5J12B 1TVBA 4AT6B 1CXIA 2JF1A 3DYMA 2EVFA 1OO2A 1BVNP 1KXTB 5JXEC 3L3IB 3N6YA 5F3FA 2PYEA 1FQ9C 1H6FA 3CVIL 2EYTB 4Y8AA 4IM8A 4JZJB 2XWEA 2QADC 3T3ME 2ZOLB 5FFGA 5EIIB 4B9CA 4F3FB 4ENZA 1XAUA 1XSJA 4KZCA 2P8PB 1B4TA 2ZG3A 1TETL 2XFXA 4Y7OC 3WMSA 2VWEE 4ERSL