2DWYA

Crystal structure analysis of gga1-gae
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
129
structure length
129
Chain Sequence
NILPVTVYDQHGFRILFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSGTELPAFNPIVHPSAITQVLLLANPQKEKVRLRYKLTFTMGDQTYNEMGDVDQFPPPETWGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Basis for Autoregulatory Interaction Between GAE Domain and Hinge Region of GGA1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords ADP-RIBOSYLATION FACTOR BINDING PROTEIN GGA1
total genus 15
structure length 129
sequence length 129
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2dwyA00
2A7BA 4BCXA 1NA8A 5CN2A 1P4UA 3MNMA 1B9KA 1IU1A 2VJ0A 5CN1A 2E9GA 1W80A 3ZY7A 3ZHFA 1QTSA 1OM9A 1KY7A 1QTPA 1GYUA 1GYVA 3HS8A 1GYWA 2DWYA 1KY6A 1KYFA 1KYUA 2YMTA 2DWXA 1KYDA
chains in the Genus database with same CATH superfamily
2YN5A 5B1CA 2UVFA 5CGYC 2RB8A 5MERB 2WSKA 2LAAA 3NPSC 1U93B 3W9EB 5IV2B 1E3XA 1CLOH 3OKNB 3TASA 2Y7NA 1RXLA 5FDWA 2OMVA 3VGBA 5TDOB 3QRFM 1AXSA 4N2CA 5IHHA 1BFTA 1J18A 1YEFL 3RVXC 4XMTA 2YBRA 3JWOC 2HX9A 2XN9A 5D1QE 2XIIA 5T3ZH 1ZLVH 4KAQL 1QHQA 4LQ1A 1QSVA 1GC1L 1VFUA 3INOA 3QDGD 3MJ9A 4AGOA 4F8NA 1LEIA 3POCA 3WKYA 3SBPA 1RZ7H 3KVDD 5F1NB 2NXZD 3TV3L 4KNSA 1LMIA 1CDYA 2P26A 4PRHD 5IHUH 4DPBX 1JFHA 4XHQA 1WWAX 3EYSL 4KRPC 3F84A 3VFGL 1LK2B 1O7VA 4H20L 5EA0H 5G4OA 4YQXH 3TT3L 3UZEC 4AJWA 4HWUA 3GZQA 1HXMB 5IVXB 1L4IA 5DUBA 1MQ8A 4KRPD 4NRXB 1M3JA 4JFOB 3JTTA 2Y2WA 4UT9L 3VQLA 4MMYB 2A74B 5FUOL 3GWJA 5FW8A 1YVLA 2ED6A 2IPUG 3WDJA 2P4AB 5HHOA 3HZMA 1AGBB 1DTUA 3OKOB 3RWCB 1LK3H 4NUJA 4Y2DD 1PDKA 2WJ7A 4IBQA 1KLGB 4KI1A 4AY0A 1KEMH 3L3DA 5TDPB 4PRHE 4L48A 1EUTA 1HHKA 1FH2A 2IG2H 4GLRI 4X7SL 2WXFA 5MEOA 3QUXD 1MWAB 2JH2A 1EX0A 5AUMA 3UGEA 3AXIA 1X7SA 2V9UA 4PWHA 1Z0MA 3TFBA 4XMPH 5F88B 1BYPA 2X42A 5SV3A 1AO7A 1MNUL 2FL5A 1E9QB 3EO0B 1XF5B 3B2MA 2IOMA 3SE9H 2F19H 2V3DA 3II1A 2Q7NA 1P53A 1ZMYA 5E2WH 1KLUB 4QHMB 1A7RL 1T2QL 4JFFB 3V0GA 1JN6B 3JWDL 3FCSB 2K6WA 5EZIL 5HY9B 1WFOA 5DHDA 1XXDC 1ZLVK 3TN0B 5FOBA 1LM8V 1IQDB 5MEND 1NGWB 4HYTB 4JFEA 1TJIL 5E23A 5DK0A 1NPJA 3MO1A 2QZQA 4IRSD 3I6GA 4HJUA 3T4AA 2EDYA 3UTTB 3B2XA 2BMKA 1A9BA 3O3DB 4PJIF 3D85A 1JK9B 3MRRA 1OCWL 3HS8A 5PAZA 2DLFH 3VXME 1OP3H 1IAKA 2WIIB 3OX8B 3S98A 5IROA 2VSDA 4TSBL 2A83A 5CGTA 5EFIB 3SQOH 3W39B 4NJAH 4CMHB 4A04A 5D72L 4K5LA 3DVIA 2BINA 3HNTL 4XXDA 3WXWL 1AGCB 4DCQA 3QT2A 3N6YA 4PQXA 3NK3A 1CS6A 1L3NA 2ZOTA 4W4OC 1LDPH 2CJTA 2E46A 4YHMH 1V27A 4HIIB 1UZ6E 4KFMA 2AC0A 3PWJA 4MAZA 5AW7B 2D7PA 1SNRA 3GZOA 4QYOB 1GYUA 3EJYC 3IS0X 4NRXA 4U0QB 5H8DA 2DWYA 4L4VB 5J4MA 4HCRL 3CVHL 2WXNA 4HQQH 3FQRA 4LEOB 4XNDA 3K80A 4LPTA 3RFRA 1YQ2A 5GGVL 2FAUA 3ESMA 3S3PA 3SO3C 5KBLA 5D7KE 4M56A 1T6VN 2HG0A 3QORD 4N28A 4ODUA 4XWGL 2WLJA 2X9XA 3OV6A 2CRMA 3L3GA 4JVUA 4X6CE 5CN1A 2OR9H 3WEBA 1TPXC 4ELME 4ZFGH 3LS4L 3OJDA 1M1XB 1MUJA 1H19A 1HNYA 1KXQE 1ZCRA 5HHNB 2JFCA 1QTSA 4MD0A 3QDJE 3PHQA 4DQOH 2G9KA 3L4ZA 4ZRGA 3PWLA 4P0DA 3VXPA 4X7DC 4RGMC 1QWNA 3K3QA 2YAMA 1ZLWK 1E9QA 2FX7H 1HI6A 4GSQA 3T3MB 2DM7A 3FZUC 1BAFL 2R27A 3QEQA 2WVVB 4NP9A 3MBEC 2O6DA 3FFOA 2YO3A 2CXGA 4X6CA 2B1OA 4B27A 1NAML 4JY4A 3L7FA 4UT6A 3W11C 4MX7B 1KXQA 3WHE1 1WZ1L 4JQIH 4TUKH 5FEBA 2ZUSA 2IPTH 5LBVA 1HHHB 3RHWF 1AGFA 4OLXH 3L4VA 4U0RB 2PWHA 4M43H 2EE3A 2Z1KA 4NYLB 2ED9A 2EH8H 3TC9A 3D3VA 2BNRD 4LLVA 1R0AL 4PJFA 4ABVA 5CHNA 3NA9H 4B95C 4QEGA 3STBA 1KB5A 3LTVA 3O0RL 2Y9RT 3D4YA 2V5YA 5EBGA 2RALA 3LZOA 1A7QL 1FBIH 2NY3C 4HKJB 4X6FB 4Q97A 2W5PA 1DE4A 3MGAA 4ZQKB 4B3VA 5F6IC 5D1XC 1TQBC 5AYUL 1XSJA 3GHBH 5FFLA 5KSBB 3VFOB 1G9ML 1FE8L 3SPIA 4UM9D 1PGRB 1J86A 1KN2L 2LR4A 3WNNA 5CFHA 5I1IL 4NQSB 3M1OA 4J8QA 4GKNB 1G7PB 1GJUA 1UURA 3II2A 2X89A 1NMCC 5KVEL 4D2NA 1N9PA 3HPJA 3BAIA 3I2CL 4YLCA 3ZOAA 1P7QB 3VE0A 3OKEB 2Y1AA 3L17A 4X0KB 5JW3H 1LDSA 3WNPA 2YXVA 2LTQB 4OJCA 4OD1L 1QUPA 3LNIA 2PP7A 2VL5A 1GC1C 3P2TA 4X80H 4K15A 1CLZH 1KWGA 4Z95L 4A63A 4ZUWB 4XRCB 4F33B 1WZAA 2A2QT 5TQ2H 4YXLL 3DX6B 4GI8A 2DZEA 1MCBA 1IUZA 3MR9A 4Z1PA 1Z9PA 2WWOA 3BP4B 2ZJSL 3HAEH 4PWJA 1KG0B 1UGKA 4PW3A 5BUGA 1LEGB 3F64A 3QDAA 4OJDH 1KYDA 2RCSL 4ODVH 1CFVL 4GG8B 4Y2DB 5AOKA 5D9SB 1W0VB 1X5YA 3VG0H 5T1LB 4QF1B 3IWVA 4WJG3 5F7YC 2YC1B 1JXDA 4LRIA 3U1SH 4P2QE 2BP0B 3W3BA 4JFHD 4TQPA 5AZ2L 3M46A 5LJYH 5AW0B 4Y8DC 1XX9C 1TMCB 4J3OH 2VDOL 2YXMA 4WTXA 1JZ7A 2FT6A 3ZIMA 3EBIA 5GS0C 4KNTA 2WTOA 2VXVH 1CT8B 1KZQA 1EWHA 3HB3C 5LVEA 1YRKA 4Z76A 2VXSH 4OV5A 4OIIL 3SJVD 3GIZL 2JMRA 4FQIL 1AACA 2R56H 3D69A 2BVQB 1NFDF 4MQSB 5DQDH 3ZX1A 2DH2A 3GO1H 5E6IA 1U8QA 1LK3L 2ODHA 2UYLA 3VB8A 4O58H 1RD6A 3IGUA 4PJIA 5A6IA 3FO1B 3VGDA 1VGEL 4ZPVA 2EEBA 1TTRA 4W9LC 3TBVB 5K9KB 1NBYB 2Y1ZA 3AWFA 1JGUH 5EO1A 2CBQA 1CE6B 4PVBA 1NMAH 3DX2A 5KSBA 3BI9X 2CR6A 3ORJA 1C08B 4K7FA 3H9SB 3EJTA 4M7ZC 4WKXA 5A2BA 4KO7A 1S9XB 3Q0HA 2IIJA 4E36A 4FOMA 1UWFA 3MRBB 3AUWB 4TRPL 4Z7NB 2D03H 2Y72A 1FSKC 2J8UB 1CDBA 3U0PA 4ANKA 2I7OA 4QRUB 3VVWA 3VCLA 2DM4A 3IDGB 2FH8A 3WL9B 3BPOC 1QSEE 1NJ9A 4J4PA 2ZPKH 2ISDA 3IJ7A 1ECZA 3REWA 1QR1B 1YEJL 2AF2A 3HC3L 4XH2B 3WV0A 3L4CA 5ICZA 5BNXD 1LEGA 2KZKA 2BVUA 5IVXE 1OOAA 5JHLA 3AREC 1E43A 1I7RA 1DDTA 1MLBA 1PPIA 5AKRA 2X1PA 4LZKA 4NQVB 4ZOAA 3UEQA 2VR6A 1QKZH 3TWCL 4I9WD 1TXKA 3S37H 1ET8A 1SHSA 1NOFA 1RUML 3PPSA 4OFIA 2OMBA 3ARBA 3O8XC 4IKNA 5C0CE 5L0QB 2C3VA 4HXBH 2JKRM 4JJ5A 1LD9B 2AVGA 4H1LH 1GR7A 1PVHA 2MPVA 4H26B 3V4VA 3CSPA 3EDFA 1J10A 4XC3L 2JJWA 4LNRA 3UBXG 2R23B 3VGEA 3US9A 3TYGH 2NY1C 3WYRA 3HR6A 3V0VA 1K6QL 2X6AA 5KSVB 1IBFA 4F15C 3DIVA 3CZNA 3IFNL 1YPZE 4HKZA 1JE6A 4XCNB 1C8QA 3OXSA 2B4CC 1IGTB 4ZMZA 4GSRA 3KCWA 4HJIA 4PJ8A 4EZMA 4Z7QB 1BZ9B 3K71B 3LB6C 3W5MA 5ISZB 3IVKA 2Z8WC 3CZKA 3ZW3A 5I28A 3NZHL 4FG2A 3PQYD 3QJTB 3KPQA 1BZEA 5B39B 2DWXA 3AREA 3NSCA 3LVTA 4JAMB 4KJQC 4KVNL 3PFUA 5DFWH 4F9PA 3C08L 1C5DB 1QVOB 5KANI 4YHIB 1XR9B 1K4CB 2DQCH 2YXFA 3BHBB 3PHSA 3NCCB 1FNGA 4OCLC 4E9XA 1FVDA 1V05A 1QUNA 1Z5HA 1GAFH 2MQGA 1YPZA 2BCKA 3RUGF 5I1EL 1HAUA 4NC2B 4XAKE 1OB1A 3QH3A 4MD5B 4UV4L 1TQVA 3PNWA 2CLVA 5T5NF 3RPIA 1H15A 1ZAGA 3MJ7A 1JZ2A 3TX4A 4E42B 3AS1A 2EYSB 4MJID 1O6SA 2X4NA 4N0FA 5I17B 2XACC 3DHJA 4HLZG 5E00A 1RHHA 3VFMB 2J55A 5GS0H 4AYFB 2WOBA 4NNPL 1HHGA 4DGIL 2PCPB 1XCQB 1BF5A 3RZWA 5J1AB 1ICTA 4JZJC 4NC0B 3RU8L 4QOKA 5EU6E 3QARA 5JPMA 3Q05A 3QWOA 4IRJB 2E7MA 4W6YB 4S1DD 3RY6C 3ZZLA 3TEWA 1YZZA 1B6UA 2JXMA 3KBPA 5DD0H 3MRDA 3QWRD 5KVDH 1B2WL 3BN9C 1CL7H 4GKZA 4CW1B 3GJEB 5TPWH 4JY5H 5AYUH 2YPLD 1XGQB 3VI3B 1RI8A 1ANUA 2KDGA 1URLA 5AOMA 2HFGL 3KMDA 5LAPA 1NOLA 2DH3A 3WIAA 2VC2B 5E4OA 1FG9C 3L4XA 4NQCD 4PGCA 2XTJB 4YE4L 4NHUB 1MXGA 4EF3A 3GJFA 4P06A 3IKCB 2MHAB 1UB5B 1XDTT 4FABL 1A6VL 4LIQL 3V0VB 2P7TB 1GW0A 5GS1C 1I85A 3LRHA 1XL6A 2MPAL 3PABB 3VXUE 1JGLL 4O2EA 4XNXL 1CG9B 2XZAH 3T4YA 4YZWA 1J9RA 1KJ2A 2WIMA 3FH5A 3QAQA 5ALBL 3UYOD 1OSPH 3T09A 3E0GA 1GY2A 1H8NA 1T3FB 4IMKA 5J06A 1MSPA 5I6LA 3FBKA 1RIUH 3SDYH 1MZZA 1HTYA 3QFJD 4OGYH 3MX0A 2V2XB 1ZHKA 1B9KA 2OK0L 3GM8A 5BZXA 2K7PA 3QA3B 2L7QA 4ZO9A 2IFFL 5F3HB 4TQIA 1JXJA 1KIQB 1DJIA 4J2QA 3RL1B 3V4PB 4YSAA 5IVXF 1G6RB 1HZKA 5IOPB 2Z31C 3NFSL 4HIXH 4YDNA 4Q9CA 1TOXA 2FWOB 1BMWA 4LCWB 3RFZC 3OKDA 2X38A 4P23C 4WFGD 5AOZA 1BVLB 4ZD3L 4QO1A 2KLRA 2JE8A 1O75A 1EJ6A 2PWEA 1JWSA 1T89A 2W88A 3OTTA 1U0QA 5BRZA 2A38A 1IGIL 1I82A 2ZX8A 4QRSA 3BIKA 4GIAA 1NEZB 5MEPA 3AQXA 3C6LA 5IVNA 3KHOA 3U4EA 1PZ5B 3CVCA 3Q2CA 1WE5A 4XOAA 3NT0A 3PAYA 4PJFF 2R0KL 3L54A 2DOCA 2YEZA 4YDLC 3V5HA 4OF6A 4IRZA 2EH7L 3SB3A 8PAZA 3KYNB 5DVOA 4YZFE 3H2QA 4Y9BA 3SDAB 4J2XA 2W65A 1QPPA 4NQDA 4EUPB 4FDWA 1OAXH 1J5CA 2QVKA 4JG5A 2ZQKA 4LU5H 2HLAA 1IBGL 4QRRD 2ZCKH 5DHVA 2UXTA 2P45B 3FQUB 4GBXC 4G42B 2EH7H 3FN0H 2XZCL 4ZZKA 5AG8A 1YMHB 1D5IL 3VYOA 3IDMB 1P4BH 5C6TL 2R0KH 3CSBA 5AW8B 5E1QA 4HWZA 4ODSL 5HVGB 1U3HA 2BP8A 2VZUA 3GLEA 3IEAA 2H7WA 4TNWF 5DRWB 5GIRA 3RDTD 4N26A 3CSFA 4FA8A 3NZUA 2WVTA 3MUUA 2TSAA 5E6YA 2ICEC 1AFVL 1TQBB 3OMNB 4ZMTA 3BP6B 2UWEF 2P8PA 3FRPG 3LIZH 3MOBL 4P4KC 2APVA 5EO0B 1T1YA 3H2PA 5IVOA 5DD3H 5KYNA 2DTML 4C83A 3B2DC 3QFGA 3ZE1B 1DJZA 5GJTH 1JXFA 2X4QA 2EIMB 1UASA 3L48A 1Q90A 2NQ3A 3KYOB 3M6DA 2Q8AH 2AS5M 3MRJA 3RVXD 4AXWA 2WN3A 5CZRA 4HOXA 5JHDB 1AZRA 1U9KA 4ANVA 3DX8A 2XXMB 3V4UH 4O00A 5E8OB 5EBMA 5AFAA 5EU6B 2AABL 2FX8L 1TQCC 5JZ7D 4X7TB 3Q2NA 5FKAA 2Z8RA 4RWYH 4U1IA 1JI2A 3Q9PA 2WUBH 2VSMB 3R06B 1M42A 2RCSH 1J5HA 1N5YL 4HSQA 4YEEA 1IU1A 1BMZA 4NM4L 4KK6C 1VPOH 3WCYA 5ALBH 3HFMH 4MJHA 2OV0A 5F7DB 3F58H 1CFBA 3KL5A 2V3FA 4HWBA 5C07D 4F7MA 1T21B 1QWHA 4QT5B 4AT6A 1WZLA 2MPAH 4H7VA 2XFXB 4XN5A 4H4NA 1JZGA 4HT1H 3E3QE 3HEIB 3AQDA 2XIBA 1JPSL 1NCHA 3UJTL 4IHOB 4DNLA 4YHNA 3DUHA 2ZYRA 1D7FA 5EBLA 5JNYB 1Z3RA 3V9CA 4JZNA 2PTUA 3BAWA 1SFHA 3IU4H 2EUZA 3QIWA 4G8IA 3T6QC 3NACH 4Q7DA 2C1PA 2ZUWA 2LV4A 1FZKB 2BHUA 3VFNA 1ID2A 3TO4C 1RJZB 2WINA 3WBDA 3SE9L 5IHZB 2DQJL 2P24A 2ZKHL 3KYKL 1B2WH 2F1AA 3DTDA 3KPTA 5CBAB 1MCHA 3B9DA 3C60A 5I73B 1MN4A 1UENA 3BWSA 3LPFA 5JR1H 4LHJB 1EAQA 2AQSA 3KGTA 1IRAY 3KPRA 4B9PA 4G6KL 1A6UL 3TIEA 3ULVD 4LGSB 4PMFA 4G3YH 4XZ4A 2ILLA 3OWRA 1FYTE 3PJSA 5BXFA 1U42A 2VERN 3K2UH 4Z7WA 1U8JA 1VSCA 4PJ5B 3RQ3A 4JPVL 2X5PA 3MGOA 3BP6A 4XPBL 3WS6C 2G2RA 4JPWL 1QLEB 2CUMA 4FXLA 4GT7A 3QCTH 2QVFB 1UKTA 3NZ8A 1L9OA 2OMUA 3ROLB 5I5JA 3QZWA 1JMXA 3S9DB 2WM0A 2DQGL 3KBEA 3QFJA 1LO4L 4WI2A 4LLQB 1A1NA 1MLCA 1FE8H 3PDGA 5BV7L 1E9OB 1CYWA 4EKXA 1NIEA 5G4MA 2PLTA 4NCC1 1IM9A 1BAFH 1OPOA 3H3BC 1Q9WA 5D6CB 4F7TB 2WZ6A 3CDCA 4R7DB 5JW4Q 2YMOA 4G6AC 2FX7L 3CUPA 5INCB 2JELH 1FFOA 4WIQA 5F7EH 3DYOA 1N2RA 3K1DA 3BSGA 2JQAA 3EBHA 4HOZA 4L0YA 2QPSA 2JK5A 1A14H 1UWEL 3LDBB 4YX2L 2QKIA 4JRYA 3RZCA 3O2DA 4M5SA 3P4MA 2BRRH 4FE9A 4PRNA 1KPRA 2XI9A 3WJJA 4JL1A 3AAZB 5LDSA 4JLRB 1J0JA 4Z9KB 1RURL 2VLKA 2DYPD 1S3KH 4I77H 4JO3H 5EPMA 5TE7H 2VXQL 4DEPC 1NCWH 1WT5A 2YUZA 3MROB 4C47A 2IANA 2ZKHH 5D7JB 3VWKC 5EBLB 5JNYA 2KPNA 4JO2H 1XAKA 1DVUA 3ATFA 3OD3A 3PUUA 5D5MB 2L3BA 1G7HA 4LDCA 2H45A 4EAEA 3QXUA 1G1YA 3EBAA 4Y4HD 1MDTA 5H94A 1F11A 4JHAH 3PIQA 4Q0XL 5F7FA 3FW6A 3QZWG 3DX7B 3P4NB 4JHZA 3ZYOA 1HQRA 4K8RC 4WLCA 3UZVB 3HI1A 1HL5A 1ND0A 4KOBA 3VU1A 1VADB 2Z65C 4BFNA 4XPBH 2W0PA 5DHXB 3IRPX 4TVUA 3U1PA 4CVZA 3V52L 4FQIH 5JXEA 5DUMH 4A55A 1VF5C 3QQDA 3MA9H 4Z7NF 1J1OL 1HH6A 3QNXA 4XOEA 1OTSC 3I9AA 2VL4A 4U3CA 2GK2A 4I5BB 4HPOL 3ARFB 1JF6A 4NWUH 3KYKH 5B3NA 4JVPA 2YSSB 4A6YH 2E0PA 1QPKA 3JT0A 2FUTA 1X5ZA 4GYBA 4FFZH 4WO4C 2FJSA 2Q8AL 4LLUA 1AKJA 4KKBD 5L2JA 1MWAH 2E59A 5GJTL 1CFVH 2X4TA 2GJZB 2OX5B 5I9QB 3PHAA 4L2YA 3DI3B 5DJ0B 5C0RL 3U36B 3KM2A 5D1XD 4MA1B 3KL0A 4Q6YA 2IQ9L 1UXMA 2DY2A 4R4FL 5DTFB 1G7LB 4ES8A 3MNVB 4RMQA 5I1LB 1R5IA 1IM9D 4L4VE 4LESA 1I9RL 4NUQA 4X5XB 4A7QA 4U1KB 4I8DA 1KC5L 5AB0A 2YBRB 1NBCA 1NC4A 3RPBA 5JW4R 5E56A 1MAML 2X1OA 5I6PA 1P4BL 2ZX5A 5C6TH 2B1AH 4PJ5D 2X28A 4MA7L 2FQGA 4KJPC 1BFSA 1AG6A 2OBGA 3QUKA 3JSSA 4UU9A 1M2VA 3Q06A 3C2AH 1D3CA 1FZOA 3S5LA 1FYTD 5IVZB 5JXED 4NM8L 3EBGA 2WZAA 1Z9OA 5JUEH 1CFSA 5DD1H 3OAWA 5ANHA 1BEYH 3MRNA 1SHXA 3LXAA 3MUY1 2FWSA 1BAWA 3ULSA 1HHIB 4PI2A 2XIDA 5ISZD 4HLEA 2BWQA 4LCYB 1P1ZA 4XMLH 4S2SB 1NCAL 1MHPH 4KK6D 4TF4A 2X4RA 3DV6A 3NJLA 3MCKB 2ZOWA 3HI1B 4KJWD 2I5YL 4JFXA 3HE6D 3C60D 1FNFA 1AGBA 3OKOA 2BDNH 4TSAH 1TYRA 5AOJA 2C3WA 2A77L 3RWCA 3ZYZA 1V55B 3S8WA 1F1DA 4RNRB 1OE1A 3EOTL 1LP9A 3ZUNC 5EBWA 2FZ3B 4DGVL 4R7NA 3GBMH 1LL1A 2YOCA 4GFXA 5E03A 2VR9A 2XJLA 4DOHB 4MS6A 3TBTA 1XB3A 2NUTB 2BNQA 4JY6B 4NUGL 4O4YH 4ODSH 3X13A 1YEFH 2MTPA 2OZ4L 3IXAB 2Y24A 3HS0C 3IF1B 2R51A 4AYBA 1KTKE 4DETA 4EN3A 5HYSG 1TZHB 1F1GA 4F24A 1MKFA 1GTFA 2L7UA 2ITDB 3VWJA 3PY9A 3CN4A 3HE7C 4JCWA 5HD8D 2WAQA 4PVNA 4DP6X 2WJ5A 5D7IB 3ZXAC 1HDMA 5HDOA 5BZZA 1VERA 3P1VA 4CN1A 2NXYD 2V17H 5D7LE 1WBXA 2EUWA 4OZ4A 4S1QL 4QNPE 1HILB 5DRZA 1FIEA 3SO5A 3EJPA 3GHBL 2BVEA 3HJEA 3L1FA 4KKRA 2R4RL 3HUJF 2OTUB 2LFEA 4KXZI 4KDWA 1K9TA 5C09A 4EDXA 2V4LA 1G7LA 3MV9E 4LKXB 4JRYD 1W8EA 3K6SB 5T33H 3HCVB 1CLYH 3QDJB 4B7IA 4JPKH 1CURA 4GS7C 4JRXE 2E7LC 4M8VA 5F7EL 2D31B 3FTVA 1AGEB 4P3DB 4AE0A 1FLTX 2JKSA 5BW7C 4X8JA 3VRJA 2H8PA 3DYPA 4Q4EA 4G6KH 2X70A 3QR1A 3W5NA 3W9DA 3QZNA 3KXFE 5J6HA 4OUUA 1BZ8A 2FEDD 3WXVH 1HHJB 5JQ6H 1BD2E 2DQEL 2KT6A 1WS7A 4GXVL 4WI5A 4PJGA 4XX1G 5B1KA 5AW6B 1NGPH 1LE9A 3Q13A 4M48L 4R84A 4WUKH 5E6ZA 2NY4D 3KE0A 1CXIA 1WAAF 1BZQK 4Y4FC 2XVGA 4MJJA 1H3GA 1B0RB 4CMMB 1UCBL 2OZ4H 1FGVL 4UT9A 8FABA 5HBBA 1RZIA 3KH3A 1S7QA 1RZKH 5BJTB 2QR0B 1E9PB 2N0KA 4UB0H 3FOMB 2ZOKB 1H0DB 1RMFL 5E99L 2DYRB 4BK4A 1U8IB 1A5FH 4MWFB 3VXRD 1S46A 2ZAHA 1ACYH 12E8H 1TJHL 3KCPA 1VGKB 4N85A 2WN2A 1T7VA 4OQTH 2B15A 3GC3A 4WU7B 4OZIA 1PKOA 3IF1A 2AXFA 4JFVA 4XNZC 1SJEB 1L9RA 5CN2A 4JDEA 2PW2B 3IDIB 3S2AA 2YKKA 4TKWA 5HYSA 4H5SA 1A4AA 3SY0B 5C8JA 1K4DB 2M1KA 3L2NA 4LP5A 5IP4A 3UJIH 3HPLB 2VDPH 2EJ1A 4N2LA 4GNKB 4G8EB 2BVPB 4QY8B 5DMYA 1DDHB 1MNUH 2DWTA 1F56A 2OTWB 3H9HB 4U7SA 4F7PA 2CLZB 1CFQB 2EKSB 4JO8A 1IFRA 5I0WA 5EC2B 1MH5A 1NEPA 4EN2A 2OTUA 1KDIA 3GSNL 4R3SA 4Y1AE 4OB5H 3WFDL 4HC1L 1J8HB 1OV8A 2EUXA 4KK9D 3QZOA 4D9QD 4YO0B 3AG3B 3UACA 3WUWG 5IMKB 4XC3H 5IKCB 3JXAA 3UABA 3L3OB 2GTQA 2MSPA 3RX5A 1KGCD 2OSXA 3QDMA 2YD6A 4LHQB 2GC7C 4P99A 5H37H 4HALA 1NAKH 4P2RD 2OMZA 4Y4KA 5M94B 4PGBA 1F90L 3WEMA 3BWAA 2XETA 3CDGA 3KPSE 2J72A 1SF5A 3MRGA 2E7BA 1DFBL 1RUAL 2VKWA 3S34L 3DIFB 2J5LB 3IBEA 1G0DA 4KH2A 4QTFA 4MNQE 4OD2A 4NT6A 5C0BA 2GUOA 5KN5B 3IRCA 2JLPA 2FO4B 4DEUA 5F89A 2B77A 2XPZA 3GMLB 3HG0A 3OF6D 4DP8X 4E2OA 3OPZH 2OYPA 4YJZL 1AIFA 2HFFA 3QHTC 3CGTA 3N42F 1CU4L 2XN9B 5AENA 1BQHA 4TQEH 4BGLA 4ALAL 1X6NA 3ECQA 3K6IA 2DIEA 4IMLB 2NNAB 4OSUL 3MV7B 4HS8L 2XVBA 3ALXA 1G7JA 1JF1B 4G9FB 3FQTB 5F2FA 1N6UA 2FVNA 2CXKA 4ZUWA 1JDAA 2GT9B 3O2WL 3J8F7 3ULUD 4KTEH 3HNSL 3CFMA 2ZE0A 4ZOEA 4PJAE 1A02N 1YYML 3MV9B 3UCQA 2GABA 1J1XH 4YVUA 2Q76A 3TCLA 2ZIDA 5A7EA 5FIEA 1R34A 2AXFB 4KDVA 2W9DH 1NTDA 1SVCP 1CGSL 1ZDQA 4C56D 2IBZY 4UT9H 2F1EA 3M7OA 1QLRA 5T1LA 5JXAL 3BAKA 3GSXA 5KSAB 4UCFA 4EI5B 2W9LA 1JWUB 4MQ7B 5IROD 3QJVB 1JZDC 2A4EA 1AANA 1TYJA 3ECVA 3U9UA 4AEEA 1CYXA 4E0RA 3FN3A 4H0IA 3UO1H 1ED3A 3QORB 2BH0A 4LOFA 3VFUB 1RZGB 2F8XC 4PJ7B 2AANA 3FQ4A 3KWWB 5CJQL 4IGBA 4FYSA 1N67A 3BSHA 4F7KA 1BVOA 3UBXI 2P44B 4E41A 2NCEA 4M61A 2HJFB 3FHAA 4BFIB 8CGTA 1XF1A 4JDVB 3NABL 3CXFA 1YNKL 5I74C 4G8FA 2WHVA 4OFVA 2D8KA 3F12A 4PGJA 3KPPA 1XIWD 4JREB 1EEYA 3QNZA 2VW6A 3NZSA 3BGMB 4R8WL 2K6ZA 4WDIA 3GSVB 3TTSA 3L3JB 1ZANL 3FT0A 1HL8A 3V0DA 4JKPL 1Y6KR 4Z7UB 1E4KA 3O4LB 5BUPA 5AB9A 3FUFA 5D1ZA 3F6LA 3LZFH 1L9MA 4YH6A 3CPUA 4MB4A 5DLMH 2BNQD 4RX4A 5B21A 2Z0UA 1YEHH 3BMVA 3DURA 3I6GB 3UTTA 4WCYL 4ZMPA 3KNBB 1HC1A 2BVOB 2UZYA 2CDFB 4RZCA 1JG9A 5SWQB 2EVJA 5I1DB 3VCLB 4J8RB 5AD0B 2F5AL 3CZUB 1UZGA 4OZGE 5HVFB 1VPOL 1AGCA 3MV9D 2Y36L 3CVIL 2A4ZA 4HUNB 5K9OB 3BKML 3REVA 1A6ZA 1EVTC 3MV9A 1HQ4A 4NQDD 1LNUA 1Z5LA 3QJHB 3RG1C 1Y1UA 5C0CB 2APXA 4HS3B 1RK1A 3MV8B 5E5MA 2EDNA 3UTZA 1JPTH 3CZSA 3EYVA 2VLJE 3STLA 3RUGA 2APSA 2RH0A 4Y4KC 1CDGA 1NCDH 4KGLA 1NSNH 5JA9A 3LSOA 1X6LA 4KH9A 2CLRA 4WK2B 2EDRA 1OIOA 2A6IB 1CDJA 3G5ZA 3R4RA 1H3PH 3QS2A 4X4KA 4Y5YA 1LO0L 4UBDC 1M1XA 1MUJB 3HB3D 3V8OA 2H4EA 1MIEL 3ZHLA 1ZXKA 2DMCA 3ROOB 2ENQA 1MF2L 2IWKA 4BELD 4Y4HA 2EDJA 5DHYB 3T1WA 3D87B 4HV8A 1T4KB 4WI6A 3MOAL 4YHOL 1BAGA 5JZ7C 3U9PL 5I76A 2YLHA 2Q2EB 5IEKA 5AVYB 3PJNA 3OLIA 3QXAB 5JO5A 3D06A 4Y19E 4UQ2A 5GRUL 4JQIL 1BZ9A 3K71A 2PTTA 4PR5A 3V2AR 1HIML 3BKYH 4ZFOL 1UCTA 4WW2C 4U31A 3RJDA 1RH8A 3VRLE 1BFOA 1FIGH 4LSUH 4ZTEA 3N41B 3FU3A 1SOQA 15C8L 3QEHB 1UVQA 2AV1B 3AWEA 4XP1L 5EU7C 5C0GB 3RFZA 2O1AA 4KKCD 1LHZA 4PHZA 1CTOA 3BKJH 4NZTH 1DCLA 3OF6A 1WAAE 1UOKA 3VNZA 4X9HA 1HX0A 3QWNA 4Z7IA 4FEMA 3JTSB 5C2UB 4GPVA 4M9PA 1L5GA 4PTUA 2G3XA 3SPJA 2CNZA 3KNBA 4OZHB 5I8EA 5CJQH 3V5DB 2H1LM 1LO5A 4P48A 4Y16A 3MJ7B 3SPHA 4XVOA 3N1QC 3H1ZA 2YA0A 3MRLB 3T77A 5C08B 2EYTA 5HDWA 3HUJA 3BD5A 4ONHA 4DN3H 4HC1A 3W2DH 4KXDA 2VABA 3DLQR 1KIPA 1V54B 1HE8A 5EHFA 4X4YA 5AAPA 2HAZA 4KKAC 3I75B 1D5IH 1ZT7A 3FUIA 2NTSP 4WWNA 4LLDA 1KGCE 2QHRH 1PCSA 2DPKA 2GY5A 3F7YA 3STLB 5IESL 1CICB 2R9HD 3HPJB 2GSGA 2YAQA 3LB6D 5ID1B 4TUOB 3WI9A 2QGEA 4YZFF 3VXSA 3R4DA 2B08A 1SLUA 3EFFB 1IE5A 1TVHA 3WD5H 5IHBA 1AHWB 4N8UA 5JMRA 2R8SH 3O6FA 2JJSC 4LEEA 5IROC 4KJQD 3IJEB 5C0DA 1JGUL 1HIMH 3BKYL 3HVDA 3VXUB 5I0YA 5IQ9A 4XRCA 5DC9B 4PJEA 1W72B 2W0KA 2YPVA 1W8OA 2FIKA 3CIQA 6TAAA 4UTBL 4HJSA 3HBPA 3SDAC 1N64L 2ZTBA 3DETC 4KY2A 1FL5B 2VDQB 3FB5B 3QYCA 4UZGA 5T5FL 4JE4B 5CCGE 5IMMA 4PJ9A 1TLKA 4FQLH 1NWOA 1USQA 5I82A 4FKEA 2V6HA 4OGAC 1HH9B 3RTQA 5K5YA 5ESQB 4F37K 1WFUA 1WAAA 2C9XA 1ZY9A 4IHBA 2R4SL 1CK0L 1UXWB 3T4YB 3TNNA 2VT0A 5J3HD 2ZICA 4MCNA 4RWHA 3TA3D 1HSBA 5B7EA 3QEUB 4RMVA 4ONFH 1SXSA 3MZTA 2B9AA 2E9GA 5HHOE 5ECGA 5C7ZA 1EHAA 4L37A 4K5MA 4LCWE 4OF0A 1CT8A 3B9AA 3LKNA 3DUUB 2W0FB 3FO2B 1E90A 3Q8BA 4DKTA 4ZBJA 4M9OA 5ICUA 1YYCA 3HNVL 4OV5B 5FO7B 1IEAA 4PJCF 3L5XH 1XGUA 4IOFC 2IANE 4EOWH 3MRQB 3TH4T 2YGOA 2W94A 1CICD 2P43B 5F7WC 2PUQT 5E6IB 2Y5EA 1PU0A 1FG2B 4W93A 5FYLL 2FWLB 4AYID 1T7YA 1Q0YH 5C08A 1E65A 3HS0A 2FT7A 5TQ2L 1SZNA 4XMKL 1HJBC 2OW7A 4L3ED 1KUMA 3ARBC 3O8XA 4L8DB 1SFDA 3BRFA 1EEZA 2R29H 3FPXA 3NH7L 3MV11 4QXWA 3U1QA 4QJ5B 5JPNC 3GFUA 4FP8H 4Q2ZB 1GYVA 5AEAA 3UZEA 3KL3A 4NIYE 5GS3A 4D9RE 3VSTA 2EO1A 3TYFB 2P52A 2ZCLH 2J1KA 3FMGL 3LD8B 4IJTA 2MIZA 4WJ5B 1ZGLA 4KJPD 5BCAA 3FTGB 4TUOA 2W9EH 2P5EB 2OJEB 2YPLA 3MFGB 1CL7L 2X4PA 1KN2H 3MMEA 4QAMB 4X9GA 3RVWC 1F3DH 1NCWL 1S5HB 4XE5B 1IC1A 2OXHB 3HZYB 2A5UA 2XNAA 3KGRA 4K23L 5GISL 4C4BA 3Q1EA 3EO1B 3L3IA 1L7IH 3A6OA 3NCYP 3TOPA 1YNTF 2D0HA 2DQTH 1J12A 4AK2A 2EZ0C 3AY4A 2VQ1B 1AR1C 2XBZA 3ASNB 2FK9A 1MCWW 3EZJB 1MREH 4WI4A 2B2XL 3H7LA 4JFYB 4MJ5A 4GSDH 2RBLA 4M62H 4WWKA 5DJZB 2GBAA 1PW3A 3BSZH 4JN1L 5IUSA 3TM6A 2F8IA 4OBSA 1TJXA 1GCYA 1NKOA 4ELKA 1IX2A 4B53A 1IV8A 1NWPA 5GSVA 4L3CB 1AXTH 4LPVA 3FSOA 4N0YH 3HNVH 1ZRUA 2HH0H 4G8GB 4FQJH 4H25B 2IDSA 1Q9OA 1RFDH 1FORL 1XBRA 2YN3A 2Y3AA 3DUUA 2VXUL 5C71A 2MNUA 4J27A 5J9PB 2R0ZL 5D4QA 1T0MA 4UF7C 3P2DA 1YY9D 3D33A 2WZ0A 3EUDA 3OX8A 4MNHA 1WEJL 5I1AB 1A6WH 1KTRL 5J6GA 2J6EA 4N8VB 4HKZB 5DQ9B 3L3KB 2BOLA 4KRLB 5HJDA 3TO4D 3AY4C 1IGTA 1GC1H 3LKQB 3UMNA 1XGRA 1C8PA 2DLIA 4PRPE 1R46A 4DIXA 1JVLA 1N6QL 1J0YA 4M43L 4W9GC 5B22A 4YK4B 5HHPB 4ERSL 2HCZX 3MNWB 2XFXA 1Q1PA 1EHNA 5LN4A 4YEFA 4NN7B 1AHKA 2O5YL 1QVOA 3CZGA 2O6CA 4AL8L 4G59C 4HMCA 2GJRA 3HE7A 4JFSA 4CADA 1LWHA 2XN2A 4KMQA 2PWGA 4NO2A 5AL8A 2ZXDA 3MDJA 3SE4C 1E7UA 5MHSD 4RBPH 1XO8A 3RPIB 5GGRB 2H32B 3VMNA 4WZ9A 2ZZUT 5L8KB 1E30A 1T1WB 4DPRA 5BQ7A 2Z4QA 5EZOL 5E1AA 4N86A 3HHSA 1MVYA 3TH2T 2OPCA 4G6MH 1FAIH 3SN6N 3S35L 1F6FB 3FQNB 3CX5J 1GZQA 3A6BH 5JW4M 1CBVH 3QISA 3D51A 5DQJB 1SUJA 2XPGB 4WTWA 4IEFB 1G9NL 4P2RB 4OGAD 4TLKA 4K2UH 4QHLB 5AALA 1O7DC 1R3LB 3KM1A 3NQIA 2HFEB 2X09A 4PREA 3TA3C 5E8DL 1H6EA 1E67A 3FU9A 3KWTA 2TRYA 5DWPA 4G83A 1E4WL 1T2QH 4O2CB 2EACA 3ZT6A 5DFVC 3T6WA 4Q14A 5AW4B 3UGUA 5FF6B 4J5VA 4KK8C 1FFNA 2OW6A 3EGSA 2W91A 3O3UN 3LPWA 3EJYD 1Y6MR 3KR3L 3EXJA 1ZA3B 2VE6A 4UT6H 1ZLEA 3H8NA 4JO1H 5FX3A 2AXGB 1CICC 5KZCD 2Z3FA 4EN3D 4OCSL 1NCGA 3WEAA 1OARL 2Z35A 4OJFL 4JFDB 1YUKB 1S9WB 2JJVA 2HVJB 2XZCH 3K8LA 3DOSA 3CD4A 1QHOA 2KH2B 4X4MA 3AU0A 3VRIA 2Y6TE 1WC7A 4I0PC 1DLFL 4NRYB 3VTMA 5L8LB 5M95B 4P2OC 4G9FD 3BGAA 2IDUA 4HIEB 4XVUC 3RWGB 4OCNC 3ARTA 2WLZA 1I9JH 5DJCA 1WVZA 4UIMB 5F1OB 5D71H 3RAJH 1NC2B 4BBWA 3MXWH 1EFQA 1E4HA 3EJQA 4D94A 5DHVH 1JHLH 1XSKA 2H32A 4OZIE 3CC5A 1T1WA 2BVYA 1FFPA 4CC0A 2I25N 1WYJA 4Y9EA 1JV5A 1D5BB 2CSPA 4QAWA 3UBGA 4JRWA 1KG0A 3RWIA 1GL4B 4LCIH 3GBNL 3TO4B 1TNNA 2ADJB 3G08B 1KEML 3V7AG 4Z7VB 4XP9H 2ZUUA 3ARBD 4EQ3A 4NQCB 2J1YA 3BE1H 3GEWB 4G7YH 3SJVE 2WQSA 2XPGA 2B1HL 1N26A 2IGFH 5F7LB 4JUTA 1YN6B 4I1RA 1E2WA 1MFBH 4P2RA 1B0GA 3N91A 1IBHA 1I1FA 2WLNA 2BP0A 3DOHA 5T1DL 2R9HC 2DQFA 2FX9H 3MUJA 4WFHE 5EH1A 2ZYHA 4NENA 3SKNA 1INQA 2X12A 4MCYB 1NFDA 1BZ7A 2V9RA 3ZTNL 3S8GB 3HMXA 3EYSH 2BC4A 3VFGH 2BZCA 4LAJH 4R8WH 3FQWA 4NB7A 1RUPL 4MGXA 4C4KT 5E8PB 4ZTPL 2PTVA 3CX2A 3WNLA 4URKA 5C07A 5B38B 3ULUH 4WO0A 4WW1B 1C7SA 3ARDB 4NKOA 1VZHA 4J12A 3SOBL 5B8CB 4H1LB 2C3HA 4Y4HC 1NPNA 2AXGA 3ARUA 1DQVA 3P0YH 2CK2A 4Q9QH 3WTUA 1D5MB 4XXCA 2V37A 2MCMA 1TKWA 4RCAA 1A6AB 1MFAH 3PGFL 5HDBE 3MBED 3UFIA 3ARPA 1DBJL 5G2NA 1QRNE 3DJTA 4MJIE 5E00B 2AGJL 4FFVD 2UXFA 2DMBA 1NPUA 4ZPTA 4PRHB 5AVZB 1XIWB 3JWNC 1JHLL 4X5QA 5KZCB 3UDWA 4M7JL 3WKNA 4HDIB 3UDWC 4JMNA 4NO0D 1NC2A 1VAHA 1RZJL 2C8NA 4Q6KA 5E94B 1W9XA 4N0YL 4APXA 1F3DJ 5CKAA 2CUHA 1COBA 2WP3O 3OJVC 1IAIL 2J20A 3RY5A 5I6OA 4IBLT 1QNIA 3ILPB 2BNQE 3V55A 1ZE3H 5DZ9A 4Y0GA 1P7KA 4AC2A 1MRFL 2CJUH 4ONGH 4WK0B 5T1KD 4A1RA 2BXYA 3VI3F 3EO9L 5PCYA 2OA9A 4OT1H 3V6OA 5K9JH 3KJ6H 3MFFA 2X6BA 1KULA 1G4RA 1B4LA 2NUTA 2OMNA 2ZWYA 1AZNA 4XBPB 1NIFA 1MZYA 1JZFA 2Z6FA 3PDOB 4HP5A 3IXAA 1KJ3H 5DSCA 1TPXB 3IJSB 1XCXA 1BZ7B 4M4RA 2XQBL 3RNQA 3NEXA 1HWWA 2QGCA 2QVMA 2X9WA 3CBRA 3SGKC 4YFEA 5I6KA 3FB6B 4HPOH 5D2LE 3V5KA 4YHML 3NJHA 1VFAB 3TIEB 2DI7A 4PU2A 2X4OB 5JUEL 3U0WH 5AAWC 5CEZL 3QQ4B 1CPUA 3E6HB 1YA5A 4PH8A 4UIKH 5JHMA 5B8CA 5MHSE 1MFDL 2XWJA 3QVAA 2IWEA 1KCRL 3MQIA 4PJ8B 3V4PL 4HUXB 3B7UX 3MYJB 3IE4A 3UAJD 4BXVA 5E2TL 5TH2B 2Z34A 5SWZE 2WVVA 1OHQA 4XHJD 4ZS7L 3RVTC 5EO9B 5KS9E 4TUJA 2P80A 1U58A 3PLYA 2ZOLB 4XP6H 4RQQA 4UOW0 2ERJC 5EOQH 1VFOA 5DT1H 3S4SG 3LKOB 3VJ6A 4AQ8A 1E5ZA 1A3QA 2JCWA 4K7PL 4UIKL 4XCFL 3Q5OA 1S7SA 3FN9A 2V7HB 5EMYA 4NSKA 5E9DB 1IVTA 2WD0A 1P5VA 4X6DE 5J6HB 3APCA 3G6JB 4PRBB 1W72L 3CWGA 3PGDA 2Q3ZA 1BDYA 5F1IB 2NY2D 3AJ7A 1I8MA 3IRZA 4UQ3A 1FN4B 2W65B 4YBLB 4XN1A 2VR5A 3UPAA 2BIIA 4GKSB 1OGAD 3KLQA 4AL8H 4ODXB 5I1JH 1OT2A 3BEWA 4CSTA 3UAEA 2Z8VC 4LF3A 4NGHH 4NIKB 2R29L 3NH7H 3EYFA 4HEMA 4NBYB 4LOVA 3Q6FB 5KBKA 3QUZC 4LQFH 4KXZH 3ZE2F 1RZIB 1S7XA 1CLZL 5J7CC 1E9PA 2WCGA 4MLSA 4BSVA 1I75A 2BY0A 3VXUD 4U7MA 1G7IA 4MWFA 2MEJB 3VW3L 1TZIA 1BG9A 1NL0L 4PJBB 3X2QB 1D6EA 2IADA 1S3RA 4OZGB 5IBUG 4Y16C 3L95B 2UZIL 4KZDH 1MQKH 3S4SA 4A6YA 5DZLA 2D9CA 2K4WA 2Y7QB 4AM0B 5CM1A 3WDIA 4JFTA 3FT2A 2AEQL 3CXDL 3DPBA 3FT9A 1ESOA 3KHQA 1R3IH 3LRSA 4U0RC 3BZ4A 3UC2A 4I3RH 4NUJB 1JZ8A 1YYLH 4KVCL 1FNEA 4OI9A 3SCMA 1NL0H 4JFWA 4K4KA 5IBLC 2I07A 4UQ9A 4Y5VA 5BPPA 5FPIA 3CSGA 2R56L 3NPZB 1OTTD 4JPQA 2QFPA 1RURH 4P23A 5EO9A 1WWWX 3CSYB 1DUYB 2F0CA 3S88H 2HJLB 2ZOLA 4FI6A 4OCMC 3WMSA 4L4VD 3QA3A 1YY8B 1BZOA 4HJ1A 5CAYB 5BZDA 1UC6A 2KDYA 4KI5E 3T8XA 3EJJX 4ZDHB 4DGWC 2OMZB 2UXGA 1ECYA 2OI9C 5EIIG 1P7HL 6FABH 4U1HB 4W9JC 1HEZB 3QIBA 3ZT5A 3S36X 4JZNB 4OCRL 2HYMA 2PPAA 2O61B 4NI3A 5HY9A 5ABAA 3OSVA 2NY1B 3HOGA 3X1BA 4PLOB 4OZHF 4F5CA 2BHYA 1DVFB 1E3ZA 4OLWH 3HVNA 1B88A 4K5PA 1INDH 2F6AA 4NX0A 1VCBC 4U1KA 1B4RA 2O5XH 3WDHA 2QQLL 4J7RA 2XZAL 4QRPE 3GI8L 1JTOA 2MKWA 1TEGA 2QVTA 3MRFB 3N3EA 1UTDA 2TRHA 1TCRA 3FL7A 1YUHB 4YDJB 3C5ZD 5FYJH 4GQZA 1L7TH 2MOVA 5T1KA 3RWDB 1NCNA 3VFVB 3F7VA 5DQDL 1OPGH 5GXBB 1IT9L 2B59A 4XGZA 5IWLA 2CNYA 4AQEA 3D2UB 1MY7A 1OSZB 2DQHL 2NXYB 4CDHA 3P30H 5BO0D 3KYAA 5E5LA 3PFQA 2R0LL 4PI0A 4BKLA 1KENL 5IBTL 4G11A 4GRLB 5A2KH 1MCJA 3GBEA 1PKQB 1FL3B 3HC0B 4ZSOA 4YXKL 4F8TA 3I50H 1SF3A 5KVDL 1ZV9A 4IRZH 3ZR5A 1G1KA 1JD9A 1IGFL 1ADQH 4P5RA 5ILTH 4YHYB 4N2AA 1KJ2H 1NZRA 4LLQA 3ABGA 2VNCA 3PP3K 4K5NA 2FECL 1QA9A 3QZMA 4ELMB 2XHNA 3SBWA 1JDCA 3RA7H 4Z3HA 2BZ7A 3VX1A 4JQXC 4A2LA 5ESVB 4E9SA 2Z31B 3AT9A 4OH2A 1BW8A 1P9MA 5ID0A 1BV8A 1V7MH 3U7WH 4W9CC 3T0WA 1PY4A 4NRZA 2VLJA 3MLRH 3SBRA 3S36H 2FB4H 3C5JA 3H9ZA 4Y9GA 4LCCB 4ABUA 2R0WL 4WENB 2ITDA 5LUMA 4E41B 5AW2B 3WUWB 1OGTA 3KR3H 1XCWA 2YLKA 3QPQD 1HDMB 4NQEE 4QRPA 1AHMA 1PZUB 3IGAA 2FO8A 5D7JA 5GS0D 1QBAA 1XQ4A 2YAOA 2OYKA 1BG1A 4M29A 1HKFA 2ATPA 3K72B 1FYTA 5AVQB 4ODHH 3CDFA 2WV3A 1U3HD 2YRLA 3NQKA 4OD3H 4BZ2H 1C5CH 4L1DA 3ARSA 5FYJD 2F68X 4X9BA 4KJWC 4KNQA 2W8CA 2NMSA 3EJSA 4Q6IB 3PL6B 7FABH 4XXWA 1CL7I 1V7NH 4QMEA 4DGUA 3JQOB 5GGQL 2FD6L 5CILH 1HSAB 1KN4H 1RZPA 4AW4A 3SBQA 1S5IH 1G6RL 2ZX6A 3PWPB 4K73A 1DJGA 4F58H 4YR6B 1OGAB 1TETH 1JZEA 2GK0B 2LVCA 1KSRA 4RFEA 1FA4A 2PW1A 4AL8C 2NY0C 4L5FL 5EIIB 4XNAA 5AUMB 1JK8A 3VXRE 2OCFD 4I18A 5D1XA 2V17L 4KO5A 3RYMA 1QNZL 4P3WA 2L04A 15C8H 4P2AA 2BP3A 1OAXL 3OKEA 4MXQC 3AW5A 2DWEB 5L6YL 1ZPLA 2W9DL 1MRDH 1KYOJ 2PN5A 2WCSA 4BDVB 1MCDA 1X5JA 2EEXA 3MODH 4HMEA 3HG1B 1A0QL 4QHMA 1YC7A 3QJXA 5EB9A 4QRRA 2X6VA 5F0MB 1F97A 1KJMA 2UZXB 2PF6A 2ADYA 3L6FA 4AQ1A 2ITFA 4H8QA 1S6NA 3OZ9H 5DJ6A 5T3XL 4JPIB 4URTB 4J1UB 3PV6B 5ACMA 4ICWA 5C3IA 2UWEE 1IEBA 2QQKH 4G1MB 3GHPA 1AHWC 2I32A 3O3DA 2Y2YA 1J5IA 4WTQA 1E8YA 4FQ1H 3FZUD 1S7UB 3O6FC 3QXAA 4HAGA 1P5UC 4XT1C 1UD2A 4H44C 2AQRA 5IUCA 1PQZA 3T8VA 2KL6A 1X9RA 4OZFB 1A7RH 3NOIA 3U25A 4DKDC 5FC9A 5G55A 1T89C 3OMAB 1YEDB 5SX5H 5DS8A 1XD1A 2ZP0T 4TNWK 4MAYA 4DO6A 4H1LG 1CB4A 1JI1A 2J8HA 1N2RB 3T2NH 3QEHA 1H8OA 1CFQA 2LQRA 3CMGA 4O2FA 4RRPA 5C0GA 3BKJL 1AXSB 4NZTL 5FM4A 1GGYA 3U7AA 2EDDA 4C57C 2HH0L 2XBDA 2BOCB 2X10A 3ISWA 4H8VA 5D1ZC 2VQ4A 4E9RA 5KVDE 1JCKA 2KLSA 1HXYB 5I16A 3FTSA 1GZHC 1OTUD 2IEPA 3R19A 2CCLA 3SDXE 2AJYH 4B6ZA 2VLKB 2Z7ZA 4XVJL 4M8QA 5G5DA 4BKTC 3F3HA 4OZHA 2CBMA 5D72H 4L1SA 2UY7B 2ZUQC 1F2XK 2A0LC 3BUTA 5KSUA 1OTUC 3AFLA 3UYRL 3VH8B 3VI3E 2WXHA 3T0ED 4WHTA 2Y3NA 3JVGA 3QUMB 3WLWD 1K5WA 1QLFA 4V33A 4ZAKC 3AGVA 3GHEH 1ILSA 1X5GA 3WHXB 3BUPA 5IJVA 2VIRB 3NA4A 4FQPA 3P0VL 4NUPA 5FAAA 3IPFA 3OKDB 1UWXH 4YHKH 3ZMNA 3NJGA 2CGZA 3FTZA 2GVYA 1ZT7B 4GY4A 4Z7OB 1GYAA 2OZNA 3U4BH 2VRAA 2NR6A 3FTXA 4BE6A 4YPJA 1WS8A 3FPYA 3IDNB 3T0EC 5JIHA 1Y0LB 4FN0A 3DUSB 2I60L 3OLGA 3QORC 3O3BA 4JO4H 4UQCA 3D12B 2CIKB 4L4TA 5AG9A 3TF7C 1QMUA 1YMME 2OCCB 5F9WC 3WOVA 2C34A 4BXSV 5DS1A 3W37A 3RZCD 3SDDB 3N0AA 3CLFH 1KCLA 1F4HA 1RUKL 5E7BA 3HBGA 4GJTB 2Y25A 2YFOA 3ZDWA 2F2HA 3TZVA 4LPCA 2YARA 5CHNB 1UCBH 4XBGA 4KI5C 3ARDD 2AJUL 4AGQA 3RTQB 3M17A 3CFCH 1FH5H 3NIDF 1R24A 3QJOA 4JW3A 2YD3A 5E8EA 1CYGA 2B4CH 2EIKB 4QI3A 2W60B 4M3KB 2D31A 4N9OB 5L2JB 4AMKL 1MHCA 2A73A 2IWFA 4WAFA 3H4HA 3PHOA 3UYPA 3X1GA 5CGMA 5DYFA 4OF8A 4JDZB 4JHAL 1GAFL 3TIDA 1EJFA 2L8AA 4HCGA 4JRLA 5ITBH 2DLGA 3BDYH 5E0QA 1S9YB 2G9HB 1MHHA 1UWYA 4AYMC 1AR2A 1UJ3A 4UUJB 3FAXA 5EU5A 3KYOA 1H5BA 2R1XA 1OY3B 3BESR 3KWWA 4X0KA 3THML 1M7DB 2YQ2A 2H1PH 2C1OB 1KIRA 5T33L 5F6HJ 5T3XH 1U6AH 1WA0X 3NCBB 1BLNB 2WOYA 2B7DT 3ZHKA 3U46B 2NY6D 2Z93B 4L8DA 4WHYG 4HG4K 1DQIA 3CCHA 4TOYH 4LASL 4YHLH 2XV3A 2GBUA 5DHMC 2P5EE 2VAJA 1I3GL 5J56B 5JIDA 5FYKD 4NO5B 4NXSA 5HGBB 4DSYA 4ICXA 1ZEAL 1N8ZA 2EEAA 2NX5A 4JFXB 4PJHB 1IL1B 1AS7A 2DEWX 1W0VA 4M7LL 3L4UA 2VZTA 1I7ZA 2M83A 5IESH 1JHKH 2ENYA 2P5EA 1G84A 2A74A 2P9RA 2VLJD 3F7QA 3ZYJA 4YSSA 3FUNA 3S96A 1CFNB 4FXTA 1A6PA 3LJ3A 5I1DA 1NAMB 1PNCA 4I9XA 1VENA 4RIRA 2WXQA 3RDTB 4ZW5A 3D48R 3G6DL 3X13B 1GKOA 1HZHH 2OQJB 3GS0A 4NKQB 2W81C 3IXTB 2A3TA 3P3YA 1G4MA 3C09C 4CVXB 1YSOA 5MEOB 2WINB 5IHZA 3HR5B 1LNUB 1Z5LB 2B2XH 3QJHA 3SDXB 4Q9QL 3LH9A 4UTBA 3M17B 3VSUA 4AW7A 1GPOL 3RDJA 3TPUB 4UQAA 3TZVD 4D0BA 3US1A 4XB7A 3TBWB 4N68A 5D7HA 5JIKA 2X05A 4N3TA 3FO1A 5CLTA 2PYFB 1LTXA 3A4EA 3N1MC 5JW4N 1LP9E 1GXEA 5DD5L 1IGCH 1ETJA 1F6LL 1I1CA 1YJDL 2OL3B 4X2UA 4XPAL 2LABA 1YO4A 1J88A 1ZIAA 2BIPA 5E2JA 1S9XA 4G5ZH 1IQDA 3MCG1 1F3JA 3KVQA 3DRTB 4GEJA 1MW1A 3T4AB 1FSKB 5DGQA 5CP7B 1BM3L 3BDXA 3H3PL 1BQHB 4JEGB 1NLDL 2A6KB 4KQ3H 1KC5H 5FV2A 2DF3A 2ITCB 3EOBB 4N2NA 4ZO7A 4LL9A 5DDHA 5H2BA 1X44A 4YSEA 1NCOA 5FB8B 3WL9A 4R7DA 3MNWA 4G72B 3FAWA 1T04A 1LQBC 3QQXA 2IQAA 4E9TA 1TTCA 2NY1D 3KWXA 4FC3E 1KV7A 5GSRB 2VLME 4FTDA 1BXVA 4F7CA 2EADA 2N56A 1JJUA 3BAJA 4OLVH 1TT6A 3RZCB 2J44A 2CO7A 2VXVL 1PS3A 2YPKB 3GB7B 4MJ6A 2LT9A 5FGCE 3ZRFC 3MLWL 4L8BB 1SJHA 3P77A 4NQVA 5DO2C 4PJXB 1I7TA 1M1SA 4L4VA 4OZIF 3P4OB 5F1KC 2OR7A 1IKFL 4LP4A 3B34A 4M5YL 4OJEH 1SM3H 4HKXB 3BIAX 2R0LH 3K7UA 3T1FA 5BRZB 3NSFA 5EZLB 1U8PA 2FR4B 3NJKA 1SXNA 4JFDE 2DQHH 4MHHG 5D5MA 1FLRL 4G6JL 5CR1A 3B2VL 5C0JA 2H26B 4MA7H 2F5AH 4OY9A 1OAUH 5D9SA 2KI6A 3VXRB 4OJFH 3SDXA 1U8NB 3OHXB 1FNSL 5IB5A 1S7TB 1ITBB 4XNBA 4OCXH 2WSDA 3IFOB 2N59A 4U6YA 4Z23A 2IALA 3SD5A 1DQQA 4M93C 4HOMA 4BFGA 1F4AA 4GRWB 3GXDA 4PWFA 3T08A 4JS7A 2EIBA 2WWMD 2VITB 1MHEA 4BQ6A 5KVEH 2VM4A 4NHCL 2V2WB 1XZ0B 1JP5A 3LN9A 5DZOA 3BPNB 2Q86B 2JWYA 3KLHD 1WFMA 4JHWL 4XNQA 1OWRM 4HK3N 4N6RB 1E8ZA 1E4WH 4W9HC 1ODUA 1G1OA 5E5RB 2L7EA 2JB5H 1BVKA 4R2GD 2NLJB 1UYWL 1DEEA 1T80A 2XZQL 3OG6B 5DMJB 2QTVA 4R90L 3LS5H 1XF5A 2ZOOA 5CD3B 5I1KH 4JHVA 4CC4C 4JANA 5CINH 3SGDH 4R2GC 4LCUB 1AQDA 3VDAA 5J11B 2V7NA 2JLLA 1FFRA 2OR9L 2DQUH 5B3JF 1FBIL 3VGHA 5EUKB 1ASPA 3THMH 4ZQKA 2X4TB 2X4NB 3CFJB 4FQXB 1KXTB 2G2PA 5JQIB 1UM4L 3BEVB 5DD6A 2ZF8A 2FLMA 2DEYX 4IDJL 2PWFA 5FKPB 4R0LA 2ARJA 2YRZA 1SVBA 2H32H 3EHBD 4L0PB 2W59A 3GUTA 4XNYH 4PRPA 1MJJB 2WLYA 1CGXA 1UYWH 4KMTH 2PNDA 4B0MM 3SDCA 3M7FB 3UEZA 3V0WH 1Q38A 5I0XA 2K4AA 4J3OF 6PAZA 1Y7VA 3UAJA 5EOCJ 1I7TB 1LWJA 1RLBA 2QDVA 3VSQA 2GAZB 1CDIA 1ZEAH 1AZBA 1J05B 1SN5A 3DO7A 3S5LB 3IPBA 4Y1AD 4JPVH 1U91A 4HIIA 4RMRA 3QJZA 1O7SA 3SDDC 3NIDE 3OPUA 1QFWH 2IDFA 2VLRE 3WFHA 4KRMB 4PJ8D 4QYOA 4YHOH 4P46C 5IMOA 3GK8L 3H54A 3QDGA 3U7WL 4F20A 4PG9B 2WWKO 3EZ8A 4RDQG 3RGVD 1T7WA 1GS8A 1UXSA 4PD4J 1SEQL 4QD2E 2F54E 3IDUA 4O2EB 5ESAB 1KNOB 4YE4H 2CDEA 1P4LA 4HWEH 3HG5A 2F15A 2OYLA 4HAFA 1HINH 4U1NA 1A1OA 5CJBA 2BOBA 2DD8L 1J8RA 4MCMA 1ZHNB 4FXKB 1MCRA 3WFZA 1IO4C 1AZVA 3LAFA 3VDBA 1SM3L 2ZUQB 2F7OA 5L88L 4HIHB 1BQHG 2P8LB 2BNQB 4JY6A 4YSCA 3J7HA 3OHXC 1XF3A 1RKRA 3O4LD 3CQFA 4ZAKB 2E75C 1FC1A 4P2YA 1YEKH 5FLUA 4XCNA 1GCFA 1PEWA 3P0VH 4XMPL 4PJXE 4O9HH 1J8KA 4ZOCA 4DGIH 3VXSE 3F58L 5KVGL 1CO1A 1JWMA 5IHWA 2AJ3A 4HGMA 3KLAA 1UQSA 2DICA 1MFEL 1ZHLA 3EF7A 1N7ML 5CZVL 2FSDA 5GRWA 4FS0A 3CVHA 4OCSH 5IFJA 1Q9KB 1BM3H 4PJHE 1A1NB 1MLCB 3H6AA 1XIWC 4I1NB 2XSKA 1HN1A 3DV4A 3G6AA 1DVZA 3JV0A 5EN2B 1M7XA 1NUNB 2IO5A 3N9GL 3P9LB 4ALAC 5BS0B 4FQHA 1MCFA 4A67A 3ZQWA 4KK9C 3EOAA 3CC1A 2VDML 3ILQD 3SPVB 1D9KA 3OB0K 3EHBB 5K39A 2OP4H 2O26U 3HZKB 5FO9A 1ZOXA 1EO7A 3DVNA 4PP1D 1NIAA 1UZ6F 3QFDB 4BHUA 4D7PA 3QXWA 4N24A 3U0PB 2XFGB 3ARFD 4MMXC 4M7ZB 5B3SB 4K07A 4JLRA 2HKFH 1U91B 2VR7A 4I87A 3HRZB 4FQLL 2FIKB 4CAGA 4LK4A 3VXQB 4L1LA 1OAZL 1AO7B 4Y7MA 3GTNA 1RLWA 4X0NA 2XV2A 3HE7B 2ZF9A 1U8LB 4Y19D 3KPLA 4P5KB 2EECA 1KNOA 1MLBB 3QRGL 1KBGH 3K0YA 1JYWA 3JVFC 3B7TA 3ZDYE 1ASQA 5H94B 2IAMD 4M1CC 3ATBA 1BVZA 3FHQA 5ISZE 3RNQB 1QYGH 3SIKA 3L08A 4U1LB 1UB5A 5J13B 1VB9A 3QK0A 1U95A 1XF3B 4AOFA 3BUBA 4WNSA 4YOKA 4ZAKA 5IW6A 1E5CA 4JX0A 3N1PC 3G5XB 4WVRA 1L0QA 3MRRB 3WY1A 3JVGC 1MCEA 4POUB 2D4DA 1AYRA 2DTMH 5B39G 4KZEL 3W39A 3AXLA 1K4DA 4FQ2H 5TF0A 2FCBA 3AZUA 1NDTA 1QEWB 3HPLA 1KDJA 2GHWB 4JFFD 3O3EB 5TE4L 1IAIM 4BFJA 3FQXB 1XR8A 1F41A 1N64H 1Q0XL 2HN7B 2LHAA 4R90H 4N22A 3EO9H 2ITEA 3FH7A 3S3CB 3NRQA 4G9DB 1EFXB 1P1VA 2Y23A 4LLMB 3FN0L 4P2OB 2GSMB 4JGMA 4F2EA 5IG7B 3RY4A 4LEXH 1PZBA 2BSDA 4PTTA 5BS0A 5SX5K 4DP0X 4CRPA 2BVQA 4CKQA 2QKSA 2IMNA 2B9BA 3KLDA 3ZDZE 3MREB 1E7VA 2X2YA 5T1MA 3W0WA 4N20A 4G8IB 1ETZB 1XAUA 3NN8A 4NO0A 1FVEB 3ZTNH 2C1PB 3DROB 4QJ3B 3NPSB 1KWKA 1SGKA 2PP8A 3BISA 4GW4B 2ID5A 2CHWA 3IMRA 5FHBL 4CL7A 1XEUA 1AG0A 1IARB 1XH2A 2UY6B 2E27H 1M05A 4M7JH 1I53A 5MEPB 5EUOF 3ZL1A 1E6JH 4EXKA 2XNAB 4ZX5A 2ZXAA 3BUYB 3QHZL 4S1SL 4TNFA 1F6AA 2OSLB 1MCPH 4FTVE 1IZKA 1BVNT 2AEPH 3CZFA 3Q5TA 4MJ4A 3QUXC 2C7UA 5F9JA 1XCQA 1ZTXH 3GMLA 3DHMA 4LSVH 2FGWL 3WIFA 1T5XB 3MA7B 3WJMA 2BY1A 2O5ZL 2DLTA 1P5UA 2VH5L 3II3A 3HMXL 1DVXA 2Q1EA 2WGNB 4FKHA 3WEXA 4S0TD 4I89A 1N4XL 4KY1H 1CGWA 3DSFH 3BZEA 2EO9A 1IFHH 5CFAA 3TEXA 1YQVH 1SLVA 2NY3D 3NFPA 5FGBC 4AMXA 4DP7X 5J11C 3NCXA 2F54B 3FUKA 5GHWL 2OMUB 4KX7A 3ROLA 3VXUA 3QZWB 2FIRT 4XI5D 3IBOA 5IQOA 3OJMB 5D7SL 4LBEA 1KACB 5B1JC 5JOFB 2W9EL 3OKMB 4PB0H 1U95B 4RMUA 1EAPA 4X6DF 4EEEA 5BMFH 1HH9A 2YGNA 2BWDA 2VH5H 4ODVL 3KDMA 3RLSA 4G7VL 4M7LT 5AW3B 1ZSDB 5JQHC 2P7TA 5EO0A 1U3JA 5I15L 4GAGH 1OANA 3ZYIA 2G60H 1A6TB 2X40A 4C83B 2EVIA 3DDFA 4GG6A 3L3KA 2XUWA 5I66B 1JGLH 1SDAB 4X9YA 3R1GH 4NZFA 2H3XC 3LKQA 5HJ3B 3BH4A 1AGDB 2BERA 4JG9A 4KVPA 1CDHA 4X9IA 1SYSA 1T03L 1KTCA 1HOEA 1TJIH 5D5MF 1XGTB 1ROWA 4DTGL 4Z3EA 3Q01A 4ZXBA 3PNRB 4U6HA 2NR6D 1ACCA 2BC4B 1ZA6A 1EFXA 2HT4D 4FFYL 2XPYA 4HSCX 3T6ZA 5LQBH 4RMWA 5IG7A 4S11A 2OMWA 1DVTA 2H6PA 5KSVA 2WQXA 3UTOA 2DJ4A 3ZR6A 3BUQA 4UINL 2ZYIA 1JZ3A 1DANU 1XFPA 1IGFH 3IJ8A 4ZFQA 1D5XB 3RIFF 4JB9L 4DZBB 2HT3C 2HRLA 4F7EA 1WPCA 4U6XA 2GJ6E 2ZAGA 4F7MB 3IN2A 3IK2A 2K3HA 3UG3A 3KPQB 2BW5A 1K2DA 2DN7A 4MZ3A 2A9MH 5SWSE 2W95A 4Q2ZA 3ZE0E 4GP8B 3L3JA 2F53B 4G6FD 1UJTA 5IK3A 1IT9H 2XTJD 1XV8A 2NRDA 3F7VB 4XC1H 5IB1B 4HBCL 4G82A 2VN3A 2YKLH 3MA7A 3QULB 1GOFA 2AQ1A 4OBRA 2YPLB 3KBHE 2YPVH 2EVHA 1HH6B 4ZODA 4MS8D 4ORGB 5E94A 3QG7H 1CVRA 5AKSA 5HGHA 5DEFA 2DMGA 4D3CL 3CMOL 2Y5QA 1XF4B 3T0EB 3TEZA 4PBVC 3ZQ9A 3ULUL 4D9QE 5GRJL 4LU5L 4GXUN 4HK3J 5LG6A 3RJQB 1YJDH 2VR4A 3DIDA 3FT4B 4FZEH 4JKWA 4IS6B 2VJ8A 2YAFA 3B2UC 2AXJA 3H6JA 5C3TA 3LQZA 4GW5B 2EZ0D 1J1XL 3W38A 1U8JB 4HETA 4PJ5A 1D2PA 3S3SA 3ZDZB 1U3HB 4F8LA 5L2KA 1ETB1 1BBDH 2ATKA 4KTEL 2VE6B 2I9TB 1RJYA 4BEIA 2QVIA 2K1MA 5AVUB 2J4WH 1NBYA 4P07A 4EI5D 4LSRH 2ZG3A 4JFFA 4PWGA 2DQDH 2X4QB 4J3BA 4A2HA 1S78D 4ZXBB 3GJFB 3D05A 3NJJA 4P8QA 3ZKQD 4C56B 5KBPA 5CWSB 3ZGIA 5T1LD 2NOYA 1A7BA 3MJ8A 1F4YH 3X1FA 1WC7B 4NRYA 3EUUA 3QO1A 1U3ZA 4G2AA 3MRBA 4YWGL 1H6TA 1UFGA 5DHYA 5HSFA 4ZMQA 4LGRB 1IC4L 3UG4A 5IEKB 2PR9A 2VDKH 3K72A 1GSMA 3U48A 4YFLF 5LNGA 3IJHB 4N6QA 5FYLD 1J8HA 3P3TA 1VEPA 3WKML 2R2HB 2HPTA 2APTA 2BSTA 5CZXD 4BJLA 3B9KA 3IDXH 4V1DA 3WFEH 4M8UA 2COVD 3B6SA 4MKTA 1QEXA 1FJ1B 3W81A 3K2UL 5E9AA 3ZGHA 3KPSA 1ML0A 2ICWA 4QRTA 3K4ZA 3KS0H 2WY3B 2NY7H 1V7NL 1TVBA 3FYEB 2KQMA 1G6RA 3EF4A 1KCSL 1L0PA 3MOAH 2D3JA 3D39A 3O4OC 4IOIA 2B8OT 1A3RH 1FVCA 3A24A 3DSNB 4OGXL 1YN6A 4W68A 4NO2B 4PY8I 5DCCA 1QQDA 2PW1B 1WQVT 3WE6A 1RAMA 5F1IA 1LO5B 1JK8B 2VDOB 3DTXA 5E9DD 5HGHB 1JHTA 1SBSH 4BK5C 1CDUA 2R83A 3RVTD 1A3LH 3SPGA 5EZJB 3C6LB 2J1WA 3U4EB 3OM3B 5TE6H 1INEL 4FHBD 3D0AA 5GZNC 1KCBA 5AOIA 4MD0B 2QZ5A 3KPRB 2NY2C 4M6NH 5IF0A 1GSKA 1TITA 3QDJD 4PN6A 2X7LB 3WMQA 5AB2A 4JGJA 2XG5A 3MRPA 3PWVB 4PLKC 4A7UA 4CVUA 5DO2D 4TS6A 1X4ZA 5KYYA 4FLQA 4ELDA 2Y6SD 3F2LA 4KI5F 5F9DC 3T9WA 4ZNEA 5M7QA 3K6SA 2BW4A 4HS6A 2G60L 5H37G 2J57A 3QAZB 1AJ7L 2CG9X 4JZOB 1N5YH 4G7VH 4TXVB 2X0UA 4PGDA 3O45B 2NYYC 2JV6A 2X1XR 3T2LA 3PF2A 4CMHC 3FS9A 5J1TC 4AZ8A 4K71C 4CSSA 3BHBA 1RERA 2V9TA 1OF0A 4YGVB 4HHAB 3D3VB 2BCKB 2AVFA 4OUUB 5GS2D 4ZFFA 5D6CA 5DTFA 4B41A 2R39A 4K0OA 4M5TA 1S7WA 5D4HA 2BVTA 4U1GB 3CFTA 2I60H 2KS0A 2FLRT 3O2VH 1Z2KA 5IWLC 2EXTA 3TCXA 1RZKC 1H6FA 2NYYD 5TDOA 4N0FB 1FF5A 5DD3L 1AR1B 4HA1A 4DW2L 4UV7H 1QFWM 1CR9H 1DUYA 4HJJH 1ZK5A 1NC2D 4MQTB 4UU9B 1S3KL 3MRCB 4JO3L 4LSRL 2ROYA 4R9HA 4UTCA 5E8OA 5EBMB 1JVKA 3ETTA 4JDVA 5KANG 1LEIB 2VKXA 3CAFA 4MSWB 1QWUA 1J11A 2WWMC 4QGYA 3NCYS 1H0DA 4TUKL 4X80L 2XKNB 2YBGA 4CKVX 4LVHC 1L9QA 3C87A 1HHIA 4FQCH 4R4BB 1NAMH 3LEYL 3Q1SH 3QIUC 5EIVA 4EIUA 4TN9A 2ZCKL 3INUH 4EO5A 3N55A 3KPMB 1NDMA 4I13B 3DYMA 4YBQD 1N8OE 4DEPB 1ZT1B 4HXAL 1NBZB 4Z7UA 2YEQA 1X4XA 2PW2A 4GEIA 4ZK8A 1JV2B 2Z0BA 3ESNA 4I4WA 3O3BB 3VTTA 3WAJA 1EEZB 4XO3A 1CXLA 2Y7LA 4LDLB 1A9EA 1U8CB 3U4AA 4F92B 4GP4B 1N0XL 4XWOD 3FO9A 1NICA 5KVFL 1TJGH 5GPRA 4LARL 5LO7A 1U4EA 2TAAA 1R3JB 5DK2B 3DJZA 3IKKA 3HBQA 4NENB 4QF1A 4ZS6C 3QEQE 4QHPA 5C86A 5HYJD 1YEEL 4MDIA 2CR3A 5FYKH 2KUTA 1FLRH 1JTTA 4TUJB 1RPKA 5F7AA 5D7IA 5F88A 2WLIA 3MUGA 5F3BA 5KSBE 2E6PA 4J4PD 1UH3A 1ILUA 4M4PA 1H3UA 4APQA 4WV1A 4XMLL 5HYQA 3PAUA 1QSFE 2EDFA 2VQ1A 1QRKA 3ARDA 2ZSVA 2IPUK 4NN6B 3MN8A 4KOCA 4PJBE 4W9FC 5A3IC 4ELMA 1KGJA 4OM0H 5AWNH 1LDPL 1A9VA 1MQKL 3VQMA 5HPOA 4QO1B 2IDQA 5F1SA 2ICCA 4GIOA 3NAAL 3VI4F 4ZZFA 1XMEB 3OXRA 1QNZH 4OKDA 4DP4X 5E1GA 4HUUA 1IBBA 1R5IB 4FL4C 4ZPVB 1FZMA 4G8GA 2ZJSH 4R5VA 2B1AL 1NCUA 1DJWA 3IE9A 3LNHA 2GHZA 3LQAL 4I3SL 1RJLB 3MRCA 2ZUTA 3AS2A 4WFFE 1JPGB 5C0IB 3UTTD 4JHBA 3SSGA 1K8DB 1VJSA 4DJMA 3W2DL 2A83B 4BRJA 2C9SA 2YEZB 4DPCX 4EI6B 1JF1A 5FYLE 1AQ8A 4XP6L 3TA3B 4QRPB 3NJFA 5HDQL 4I0PD 4HKBB 3GKWH 4F5CE 1EHLL 3WUZA 2IGTA 4ZS7H 2FQEA 5IVZA 4OFPA 2V33A 4KUCD 5DVPA 4NN5C 4FMFA 4QKXB 1ZVSB 5D2LF 2C9RA 4YNYB 1IGCL 5E6UB 3K2IA 4PJHA 1WBYA 3D9AH 5HPMB 3BT0A 3QR2A 5I0DA 5ICXA 1I8UA 4GRWE 1BQ5A 2CPCA 3V5DA 4OV6F 3DGGA 3LN5A 4N90E 4OF3A 3T77B 3GSOB 4NBXB 4B9YA 1DQJA 1H8LA 3F05A 3DC0A 5AW5B 3HMXH 1JGDB 2V3EA 1RZQA 3IETA 2OQJA 1FL6A 2P8PB 3Q8EA 5GRUH 2GK0A 12E8L 1OPGL 1TLMA 4RFEB 1EMTH 4JDEB 5JORB 4PGZA 4IDLA 3BLBA 3VACA 5CS7A 3CN0A 3KD4A 1DN0B 2AK4A 5GGSB 1JPFB 2G2NA 4PJDE 5GRXG 2HP4A 3TPUA 3BWUC 1VZGA 1BJ1J 4KZ0A 4FQXD 3E8UH 4UV4H 4D0BB 5I15H 2F61A 2HKAA 1UATA 1HWGB 2EKSA 3B3IA 2ZSVB 1KCKA 2ESVB 4MBRA 3O9WC 3RURA 1F1AA 3QPKA 4Y4FB 3VWJD 1AZUA 4MX7A 2H3NA 4V2CB 4AX3A 1UOVA 4HWEL 4RAUB 3FC8A 2VXQH 3GXIA 3LNEA 2WZPD 1KLFA 2VLRA 1PD6A 1JVOA 3T4AC 1NCBH 3L3OA 3FRUB 4YE0A 5ABDE 1C9SA 4Z0XB 4X6EB 4MAYC 1ZWIA 1C5DA 4ZMXA 4IHOA 3FBQA 5K93A 1YEEH 5LLIC 3C5SA 3GI9L 5FB8A 3RILA 5DJXA 4L8CA 4LSDA 3CNKA 3TS8A 1ZV5A 3W9DB 4Q74A 2PYED 2NY6C 2X0VA 5F21B 3KYMA 2BWIA 4IJ3C 4BSWA 3D2UA 4ZD3H 3VFOA 1PSKH 1RJZA 3DKHA 4GAYB 5FUOH 2WW8A 5HDRA 4K7PX 3VYNA 4NUMA 3PRZA 4HS3A 4E42A 3GLZA 4GAFB 1TQSA 3TVMA 5IB3A 4D8OA 3DRQA 4NZUL 2NW3A 4M7LH 4XCYA 2H9GB 5DUJA 2LOEA 3D30A 1BIHA 3T2OA 2YZ1A 3RUGE 3A4FA 4JM2F 2IC2A 1A21A 2XV6B 5EZLA 3M88A 2LU5A 1I1YA 3OAZH 3QQ9C 1MFAL 1V3LA 3CU1A 3QC5X 1MJ8L 3HNSH 2EILB 4WHYH 1HESA 2CE6A 4K9EL 5T3ZL 2HVKB 1QASA 1QFOA 2EDOA 3HG1E 3W57A 3S4SB 4A6YB 4YSQA 3WE1A 3BGFB 3VDCA 1FFPB 4FI7A 5ADPL 1PKQE 2DLHA 1NBVL 3MUZ1 5GRVK 2FNWA 1ITCA 5IB5B 4XWGH 4K94L 2BDNL 4PV1C 4TSAL 4WFFD 5CLZA 3UTTE 3TJPA 4WW2B 2IH3B 2JELL 4AE1A 3QDGE 2OM5A 4RNRA 2YUVA 1G6VK 1GGIL 2FZ3A 2N1TE 3WGUB 4KKLC 4NHCH 4NXKA 2NZ1A 1XGZA 1PLBA 4HHWA 2V2WA 2I07B 1B0GB 2XG4B 4Y5VB 2E4TA 5DXWA 4Z3GA 4B0MB 3G5YA 1VLXA 2N1KA 3N9GH 3RAJL 1A8JH 4PJ7A 3JWNG 1DBBL 2WQWA 1M57B 1OP5H 4JDTL 4Y4FD 4QGTA 1HEHC 3VWJB 3WIHA 2A9CA 4JHUA 1BIIB 2O5NA 4U1JB 4A7GA 3VFRB 3MNZA 2YA1A 2I27N 3FQWB 3MC0A 3BE1L 4RAVA 1AQDB 2DQMA 3Q7JA 2ENSA 2LU4A 2XQYG 4I0PB 5FM5O 5C0AE 4Q8BA 3UXFA 5HVHC 4TPRL 1J1PL 3EGDB 3APMA 3TBVA 4YBHA 5LAXB 3LMJH 5FYKU 2IAAC 4M5ZH 2FWOA 1IC0A 1Q9OB 5HHQB 1ACXA 1UD5A 3VQ2C 1DVFA 4JM4L 4XB8A 5CSZB 1RU9H 4M1DL 4NT6B 1BQLL 5I1EH 5EZIH 3BW9B 2VC2H 1M6OA 1TTFA 3OKLA 4ZNEE 5I1JL 1U8KA 2OFQA 5IW1A 5FUCE 4ONOA 2P46B 1AZZC 4AEHL 4B9ZA 1KJVB 5I1HH 3LQAC 3PREA 4PWIA 3V9FA 2XTJC 1PL3A 4E9LA 4KUZL 1AHWA 3R8BB 1U3YA 1T66C 1RU9L 1OSYA 3WN5B 4ZFOA 4EVNB 3FQTA 5CBEB 2MFNA 1WICA 5I5RA 1KJMB 2UZXA 4X5WA 2HT2D 3MV7D 4XH2A 2PWDA 1CXEA 2A9DA 4N0UA 1Q0YL 2H5UA 4I5BA 4OT1L 5IMMB 4Z3IA 5IMLA 4DKFL 2RA1A 4B9FA 3EO0A 4AV0A 5B38G 2WTPA 3TYGL 3O9WB 2YD1A 3NIGF 3HZVA 3US0A 3ULVF 1PQZB 2WK2A 3CHSA 1NCCH 2QSCL 4F9PC 5D8JL 4ZI8A 4OZFA 5CEZD 2EXYD 3KLSA 2IPKB 1DBKL 1T2XA 2WQAA 2C3VB 3MKKA 3RWEA 4S1RH 1ZLUK 4GRWH 5ANME 3JZYA 2R2EB 3QRLA 3RDTA 3ROOA 2XN9E 2CKBL 1KXHA 4JFEB 3E2HB 4Y4HB 1DFXA 4KMTL 5EU3A 3MV7E 3OSKA 2X4SA 1IFHL 3U79A 1T6BX 1FRGL 2Y07L 1O6TA 5DQJA 1VEMA 3BVTA 5C09D 3LN4B 1QR4A 5CSBA 5GGUA 5T3XE 1RZGA 5HXMA 2HTKC 3VD4A 4FA7B 2YD9A 3GIVA 3LOWA 3U2IA 1GS7A 4WHDA 4L3AA 4LKCB 4YAQB 3SCMC 3ZDXF 4R7LA 4YUEH 5EN3A 1RIHL 1J8HD 4M61B 3X3GH 4BSJA 3QIUB 5IGXH 1PJWA 2G5RA 1E40A 3DMMA 2JKTM 1QLFB 2GITA 4WI9A 1G1CA 3ZKSD 1JZ6A 3VM5A 3VD2A 4OW6A 4RFNB 5DJYA 4BH7B 4TRPH 3SDAD 2AAVA 5JMOC 1W15A 5HDBF 4X98B 1EEYB 4E5XG 1NC4D 4MJIB 1K4CA 4U6TA 3X1NA 5IMKA 4ADIA 4ZUVA 1N3NB 4J3UA 1AS6A 1YAZA 5FUCC 1MCLA 2DJUA 1IEHA 3NCJL 4R97C 2Z64C 3GJFK 1HSAA 1R5WB 2FJGB 3HZKA 4J39A 5DMKB 2BVOA 4J4PC 4PJAA 3HUJB 3E8UL 4ONHB 3S5YA 2NZ9D 4L4TB 2W38A 3BUIA 4JMXA 4PV9A 2V8LA 4N2OA 3WLBA 2PCFA 2QL1A 1UH4A 4L3EE 5T1DH 3MLSL 4X4YB 3QGVA 3GMOB 5TE4H 1BREA 1PZDA 3G6JF 3MLXL 4Z0BH 3TL5A 4FABH 5IT2H 3JT2A 4RAHA 3D08A 4ODXA 2BNRE 5FYJU 3BSZA 4GW1B 4CJ0A 1VZIA 4QRBA 3CXHK 1MEXH 5BMFL 1QFHA 5I1KL 1FRGH 2Y07H 3H55A 4GMTH 1EANA 3MV7A 5I0ZA 2FYVA 3V7MA 4IKKA 5GISH 1IKFH 1RQ5A 3OC5A 1A4KA 1Q8MA 1NCDL 4Z78A 4YSTA 1KYAA 3F85A 2F54D 1AGFB 3T1FB 2WYIA 4HIJA 1R1CA 2BX5A 2R2EA 2NY3B 1MW2A 3EW3B 2JB6A 4FNUA 4UQDA 1CF1A 2JJSA 4LKXA 4M1GH 4PJFB 4AIZB 3KXFA 2QGDA 2TSBA 2VO5A 3PGCB 3IKCA 5D1ZD 1QRND 3BVVA 4P2QB 3L95A 4PJHF 4FFYH 3OKKB 1A4CA 3TNNB 2J6EH 1IGML 4H8PA 2AKRA 4HKJA 4X6FA 2UX7A 1JPSH 5J6GB 1O6VA 4DKFH 2MQ3A 4FLHA 3UIZA 5CD5D 5A2IH 3D39D 2R0WH 3HHRB 4W1TA 3GSXB 5EF0A 1XB8A 5AB1A 4YXLH 4J3TA 1SBBA 4I9WE 1DBMH 3ARFC 3ZVVA 2YAHA 1A6VH 4LIQH 3WLWC 2HN7A 3O9WD 3G5VA 4AYEC 3FU7B 2F58L 4G9DA 4BH7A 1RIVL 1FWXA 5C09E 1QSED 3ZQXA 3RWFA 2A99A 5HTSA 4WUKL 2Z91A 2ADIA 5HHXH 5G5DB 4LSQH 5LNDA 2GW5A 3MREA 1FNAA 1NSNL 5KSUB 1YY8A 1ETZA 2DLEA 2VC2L 3NN8B 5AZEL 3ULVE 4RMSA 1FVEA 5IM7B 3EFOB 2WQRA 1LP9F 3PS6A 3BN3B 4OF7A 4LCUA 4MD4A 3GGWA 5GGTA 1K85A 2ZOKA 2IBBA 3CH1A 2PCFB 3F12B 2O30A 3I6KA 4R26H 2FHFA 3C8KB 4ILDA 1UM5H 4Y5VC 3QNYB 1XGYL 3Q3GA 4R0LB 2EC8A 4CVXA 2YD7A 1FI8C 5D1ZB 1TZ8A 3MHZA 4JG0L 1QW8A 1R0AH 3CFKA 1K8IA 5D93C 2IQ9H 1VACB 1I8IA 4C59B 3F65A 1OP9A 4TULL 1QW9A 2WXOA 1TVHB 1F00I 3L1EA 4V2BA 1KYUA 4PG2A 2WXKA 2Y7OA 3WD5L 3RWHA 2HRHA 3ULUC 5E08H 1JFQL 2IDCA 4XODA 2Z92A 4ZMWA 3HTLX 1BPLB