2DWYA

Crystal structure analysis of gga1-gae
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
129
structure length
129
Chain Sequence
b'NILPVTVYDQHGFRILFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSGTELPAFNPIVHPSAITQVLLLANPQKEKVRLRYKLTFTMGDQTYNEMGDVDQFPPPETWGSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADP-RIBOSYLATION FACTOR BINDING PROTEIN GGA1
publication title Molecular Basis for Autoregulatory Interaction Between GAE Domain and Hinge Region of GGA1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 15
structure length 129
sequence length 129
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2dwyA00
4BCXA 2DWXA 1QTPA 1IU1A 1KY6A 1KYUA 1KYDA 3ZHFA 1GYUA 2VJ0A 1NA8A 1P4UA 1B9KA 3ZY7A 1KY7A 2DWYA 5CN2A 1GYVA 5CN1A 2E9GA 3HS8A 1W80A 2YMTA 1GYWA 3MNMA 1KYFA 1QTSA 1OM9A 2A7BA
chains in the Genus database with same CATH superfamily
1T6WA 3O2DL 5FO7B 3BEWA 3OGCA 5C7XH 1ZMYA 4PP1C 4FGMA 4BWUA 2HRGA 2WCPA 3K74B 4QHUA 4HZ1A 3ISWA 5EEYA 3S9DB 4X8CA 3KR3L 4N1EA 4P23C 2HPOA 3ARFD 4OAWB 4Z18A 1MLCB 5I8KL 4UIMB 2VDRH 1BVLA 1QAWA 3LNHA 3FDWA 4GI6A 1HI6B 2FSDA 1DSFL 5BMFH 3GKZA 1PZ5A 3DO7B 2ZX9A 2I26N 1ML0A 3LEXA 3BMVA 4Y9CA 5L2KD 3IU4L 1RIUH 1SY6A 1FO0H 2EXSA 1HQRB 1BZDA 4E68A 2W59A 3S48A 4AQ1A 1UD4A 4G6KH 5FUCE 2DKSA 3AVEA 4XRCA 5KS9E 3SE4A 3LS5H 3M45A 1D9KC 2IALB 1XF3B 3O9WB 2EE6A 2XWXA 2O72A 1XF2A 1GC1L 4KX7A 2LU4A 2G5UA 1G87A 3MACL 3WXVL 1I3RB 2JKNA 1TITA 4LCIL 3UZVB 1JD9A 5FAAA 4K15A 4K7PX 3ASWA 2B4CL 1ZHNA 4NN5B 1IAII 4XWGL 5C0GA 3N1GC 3DOSB 1MHEB 3OR7A 4YUEH 1EEQA 3MRFB 5AG8A 2NX5E 3CPLB 3GRWA 4D0CB 2Y2YA 2FWUA 3HTLX 4DPAX 2MCPH 2IVFC 2OKMA 3M1OA 2BS9A 2P8LA 4JJ5B 4MJIA 2IJ0C 3NIGE 5GRXG 5C2UB 4EI0A 3CZLA 5CN1A 3O4OB 3PWNB 4QEGA 4IKKA 1DFBL 3RWHA 1DQJA 1MCKA 1NAMA 4JKMA 1U41A 4CVZB 3CMOL 3EGSA 5ESVA 2IAND 5KANG 1WA2X 3DI2B 4OLYH 3BKJH 2AJUH 2YBGA 4HAFA 4XT1C 1KBGH 5D96B 2HJLB 2HRPH 3MAWA 4TTDC 1FFRA 3MODH 3TBSB 1TOXA 1UA6L 2I60L 4L4JA 3O3DA 2YEZA 4P9MH 1NBYA 2FQDA 5T3ZD 2R29H 2EEBA 2YEQA 2FHCA 2BERA 2ID5A 4UZGA 1XVSA 2G9HA 2LV4A 3OJDA 4X7DC 2MQ3A 3AREA 2WXKA 3GHBL 1EFXB 2P47B 5GHWL 3WHXB 5C0IA 3FBQA 4R96A 2CBMA 3MMEB 2ENSA 4U1IB 3VDBA 1T5WB 2NYKA 1T1WB 3UBXG 3AROA 1JZGA 4PWGA 4Z1PA 4MAUH 5DJXB 2F2HA 3QPQD 2WXQA 3B4NA 2XBZA 1EJOH 1JVKA 4KZ0A 4K94L 2NX5D 5GZOC 1OQXA 1W2KT 2IAAC 1NC4A 2KDYA 3GKWL 2CIKA 3T0VA 3CH1A 4Z6AT 1FE8L 1OT2A 3I6GB 4PRIA 4L1HA 1S5HB 2HFGH 1KIPB 2EICA 5HVFB 1FJ1A 1NH6A 4N0YH 1BF8A 3OKNB 1ITCA 3QUMB 2X70B 2OK0L 2Y6SD 3E80A 3REVA 1U95A 2X6CA 3V5DB 3PWLB 1DSWA 2DWXA 3CC5B 2IADB 3MBEA 3O41B 4KO5A 2I9TA 5D7LE 4ZPVA 3VH8B 2WXGA 1KJ2A 1MRFL 4I0PA 2UWEA 5CJXC 3WI9A 3CDCA 3B9DA 1GS8A 3N1FC 3FUMA 4XOBA 4JM4H 4MZRA 3P9LA 1YEHL 3DNKA 4BKTC 1PLBA 2ADGB 3QQDB 1CICC 3NZHL 3JWNH 4F2EA 3DX6A 2FZ3B 3KWUA 2DBLL 4G6AD 3IDYB 3RUGF 4JRLA 4XZUB 4GUOA 3RGVC 2OMZA 3QRFM 4KI5F 4LDLB 5DQDH 3RTQA 3SE9L 2QSQA 3S97C 3NCYS 5E9DE 4ERSH 2GJRA 4IKLA 1A6VH 2WTPA 4YXLH 4PB0L 1UB5A 4MBOA 3RB5A 3ZMNA 4CN4A 3JV4B 5I1EL 2GSMB 4EI5A 1FHGA 4LL1A 1M53A 1A9EB 5BUGA 1W16A 4F5CE 5AOIA 4L8BA 1ULVA 1OHQA 5GGUB 2XA8H 4LO9A 3RA7H 4NHUB 4B6ZA 2JE8A 2FIKA 4X9FA 3VWKB 2VDKL 3B1UA 3S8GB 1EQWA 2VDPL 2AJ3B 5GGTA 1SY6H 2H26B 2B9BA 2R2CA 1U93B 1YEDA 3OM3B 1TVHB 5IIEB 5J7CC 3H9HB 1YG9A 3NA9H 2ATPB 4JM2D 1AD9A 5SWQB 4QD2E 5JZ7D 4KNSA 1A14H 1UH2A 3FOLA 1DEDA 1A0QL 5FDWB 1WISA 2AQRA 3AMKA 3BAEL 1HCYA 1J9RA 3CN4A 2Y7LA 4N2NA 2CNYA 5DURB 5BW7A 1JTPA 5JIQA 3DVGB 3L4CA 3OJ2C 4DFHA 3QJTB 4UDTB 3ZT7A 1GC1C 5A2JH 3LRLA 2K9UA 4Y88A 5K1JA 4EDWL 4X83A 2QFPA 4X50A 3QPXH 3EJZD 4F9LC 1BDYA 2B4CC 5C7ZA 3GBNH 1FV1B 3EAKA 4NQXA 3QIWD 2FBOJ 4QXGL 5GGQL 1OP4A 3BDYH 1F97A 3K8LA 3JWOL 4NO2A 4WV1A 1UM6H 4IOFC 4QO1A 2ZTBA 5KSVB 5FCSH 1Q9WB 1WWAX 4JGUA 5AW9B 5CBEA 5M94B 1URZA 1QASA 1CC3A 1NKRA 4G7YL 5FYKD 1PZDA 3K7UA 3QZWG 1XGUA 4AGQA 2NY2B 3DV4A 5L9DL 1L7TH 1J1OH 4G9FB 1KELL 4GW5A 5HYJD 3GLZA 3C5JB 3RDTD 4MNQE 3PS6A 1HCFX 3SKMB 3VXSE 2UWEF 1FH5L 4JZJA 1BX2A 1X6LA 3HAEA 2YGOA 4RMUA 3BD4A 3VAEA 1CFNA 3UYPA 1TIUA 3CC1A 3JWNE 5INCA 4DERA 4PJ5B 1TUPA 4Z3TA 2DMKA 3V0AC 5T3XH 2E7LA 5AZ2H 4M93B 3LKQB 3AW5A 2VITA 3VMNA 2E6PA 4LSVL 5HJ3A 1WITA 3HE6D 1C16A 3VD2A 1IJ9A 4M7LT 3NBNA 4XHJC 1T04B 2OMYB 1KENL 4TNWK 1J9QA 5IB4B 1W15A 2PR9A 3KL3A 4KXCA 4XTRC 4XB8A 3GXTA 5C7XL 2H32A 2B1OA 1CDHA 1OGSA 3ILQD 3CSBA 3A24A 3EG9B 1TQWA 3QCVH 4TNWF 3TV3H 4BFFA 4DQOL 3HLAA 3MRDA 4K94C 2IH8A 1R1CA 3EYVB 3P30H 3P9MB 4WHCA 2P8PB 4G7VH 3MRNA 2VDRL 3TCTA 3K2MC 5I2IB 2K7QA 3OPUA 4GKSB 5BMFL 5GRVK 2LQRA 5J11C 2FLRT 1OE1A 3OJMB 4LPVA 5HD8D 1P5UB 1R19A 4QLWA 1RIUL 4S1SL 3U0WH 1FO0L 4L4TA 4G6KL 4PEEA 4RMVA 2VQTA 3QEGH 4MNQD 2HTLC 3VXSD 4P2QE 3LEVH 4ZUVB 3L2NA 4GP5B 1VEOA 3LS5L 2R7EB 3HS0B 3JV6B 4PG2A 1O9VA 3TU6A 4XWOD 4A7TA 5FKAB 3V6OE 3GMPB 3NQKA 3EGXB 2OZ4A 3D2TA 4K4KA 4IBYA 1E5AA 4G6ML 4KRNA 4MB1A 4ZTOH 1CGVA 3NN8A 5JPNA 2B2XH 4A6YB 1IILE 1PZ3A 3HOGA 4GQ9H 4RESB 3FT0A 4WW2B 1XMEB 2QVKA 4AH2A 4YUEL 5ABZA 5MEOB 1XSOA 2C9SA 4I4WA 4KTYA 2YA0A 4OFKA 5IWLC 3ZE1E 2VXVH 1RZ8A 2GW5A 5GGTH 3QFDB 43C9A 4F15C 2CO7A 3GHEL 4NDMA 3ZHLA 2CM5A 1AP2A 1HOEA 2O5NA 2BCKA 3CFQA 5IK3A 3UTTE 1D7CA 4LVOC 3RU8H 3OMIB 1JWUA 4YZWA 1JGIA 1E5YA 1DQMH 3IXTB 4OLYL 3BKJL 2AJUL 4PJEE 3V4UH 3EJTA 3MA9H 4URKA 1SN5A 1S7VB 4HJIA 1KBGL 1A6AA 4IBQA 3QBTB 4N2KA 4NM8L 1E9QA 2R4RL 1HQ4A 3G5XB 3QRGH 3VI3A 1CL7L 2OMWB 3NCEB 4FYQA 4YSDA 4G8GA 2YD7A 3U9UB 2XY2A 2B3IA 4PD4K 2ICCA 5T3XE 4P9ML 3UDWA 4YX2H 4FXGC 5IJDC 4U1GC 4Y4KD 5LQBH 4AEHH 1U36A 5FUCC 1YSOA 3GZPA 5IHZA 5LCVA 5D6DC 5F7YC 2VDOH 1LYQA 1I8KB 4J3XA 4XCYB 3TN0C 1E9OB 2K4AA 1HHKB 1TFPA 4M4RB 4PJDE 3C8KB 2OMUB 2IDCA 4YIQB 3TZVA 1LP9A 4FFVD 1A7OH 2X41A 1U8QA 2I9LA 3VFUA 3WHE1 3BHBB 3F7PC 4H5SA 4M1DH 3BZ4B 4U0QB 1I82A 3L08A 1TG8A 2GT9B 3NYKA 1EJOL 4LESA 1U8OB 3JWOC 1NDGA 2ZZUT 5FOBB 4G8AC 5J12C 1UXLA 4H8HA 4DH2A 5ISZE 2V3DA 1XCTB 2BFGA 2JI2A 4YHMH 4DGYH 1TJXA 1Y6KR 1AG6A 4U1NA 1WO2A 2P3YA 4N0YL 3AY4A 1PX4A 2PXYB 3T3MF 2HTKC 3ES6B 1Q94B 4TVPL 5FW8A 4JMNA 4YSRA 4YHLH 3LZQA 3ECQA 2TRHA 4OGXL 5D72H 1MREH 3S96A 2BSBA 2XWTB 3NRQA 5DS8B 3PABA 4ZPTA 5BXFB 1AI1L 1AGCA 2V37A 3G6AB 3BP5A 2CO6B 2OA9A 2VIRA 3MJ7A 3QZPA 2BW5A 4JM4L 3UTZB 3ARSA 3C6LD 3T0EA 4HJJH 5T3XD 3FNKA 3DETD 1FG2B 3ZHNA 2GIYA 3MR9A 2NW3B 1UD5A 2A6KB 3EF7A 1LEGB 4JREB 2ODHA 4RMRA 4XX1G 3T6XA 4TQHA 5HPMB 1R5IA 5DQDL 5AOKA 3QHZL 4ERSL 3I75A 3N42B 3SGKA 3WKNA 4M1CC 5I9QC 3NJIA 3C5ZA 3PWJA 1N59B 5G5DB 1L9PA 1DN0B 1WG3A 1E6JL 1K6QL 2XIIA 2XA8L 5JDJA 4PD4J 5DGRA 1A64A 2PW2A 5DTFA 1XSKA 5PAZA 2XPGB 4A2EA 2KZBA 2PO6D 3V4PB 4DP2X 2P42B 1JF1A 5FYKU 4AOFA 3BP6B 3GTTA 1YAIA 4QGTA 2FR4A 1SY6L 1C5BL 3GMRA 4X5QA 2AJYH 1RKRA 3FN0H 3JTBA 3FU7A 3TX4A 4EN3D 5IVXA 2IDQA 2JQMA 1QFPA 2XTJE 3NA4A 2IAMA 3NA9L 1QSEB 2F58H 3BQUA 3F04A 4P0DA 2QGDA 3E8VA 5SX5H 3UX9B 3VI3F 4PJXE 5DVMA 1WCQA 3RBSA 2LE9A 5FW7A 5D2LA 5FPIA 1HNFA 1A47A 3KWWA 4RRPM 1A14L 2R83A 2B1HL 4PY7B 2X4UB 3ZL4H 1J48A 4X4MA 5DD3H 3MYJB 1SOKA 4QGYA 3RJOA 2OZ4H 4NQEB 4QRRE 1X9QA 3A4DA 3B6SB 4F20A 4PJBF 4BELD 4PWKA 4Y16B 5I1DB 4UV4H 4P5TA 1OSPH 1LP9F 3VXUA 4NNPH 4LF3A 2Z8WC 3DHJA 3Q6FA 4RMTA 3BLKA 5J6HB 3IVKA 3B7YA 4W9DC 1DLFH 3BIKA 2E6JA 3LN5B 5CCHE 5LVEA 5C1MB 3A4FA 3GBNL 2DDQH 4WO4A 3KW7A 4RFNC 3BDYL 2VZSA 2GK0B 4POZD 1PZUB 1FL6B 4DT2A 4GG8B 2RCSH 5DJ8B 2VRAA 3KPTA 3D0VB 1EXUA 4AYFA 3QQ9D 4FNLH 5DRNB 4WI6A 4Z7WA 3NJVA 3KLAB 3CH8A 1U8KA 1GIGL 4KJWD 1RLWA 2JKXA 2X4SB 1FZMB 4WFHE 5FHAL 1L7TL 4FQCH 4XNQA 3QO1A 4LXFA 1UWXH 3LH9A 4J4PA 3DRQA 3LAFA 3O8XA 1UXWB 5C9JB 3MNZB 4JFVA 1OAJA 2BIPA 2DM7A 3PIQB 1KT2A 1EGJA 1JCKA 1WUZA 4OLUL 2EDQA 3TJHD 3ZUNC 3I6KB 4I1PA 3MRJB 5AZ2L 4X9YA 3WGVB 2XUWA 4EMZA 3FC8A 2ROXA 4QCIB 2VC2H 2VLJB 1BQHA 4KJQC 1UT9A 1SJXA 1ZIAA 3CDZB 1Y18A 3FHQA 3WIFB 3IE9A 5FA3A 1KJVA 4O2EA 3DGDA 2FYVA 2AK4A 1NBVH 2IPTH 4U1KA 4WIQA 5HI4D 4K3GA 2CJSA 1BGXH 2YQGA 1EIBA 5ID1A 5JMRA 3QUZA 2VUYA 3G04A 1PD1A 3P30L 3QDJD 3IFPA 2Q76B 5EB9A 2CA4A 2HRHA 4G7VL 4PG9A 5GS2H 3ALWA 4NCDA 1PKQA 2ZOKA 1NGYA 4TSCL 3RHWK 1KJ2L 1X3DA 5IVXF 4LSRL 3QPKA 2D4DA 3RVWC 3DIFA 3BPCA 2XRAL 2XVKA 2DWDA 4M6OL 3U0WL 2FT8A 1TDQA 3OKOB 5D2LF 1EDQA 2A9DA 3QEGL 1H6TA 1MI5B 3GLAA 1SEQH 1UM4H 3LEVL 1CK0L 3RWIB 5EUKB 5KAQG 4BXVA 1MNUL 1KCKA 1RXLA 1KCUH 1K2DA 5B8CC 5JDSA 4JDZB 4J27A 1A6TA 2A4ZA 2PNDA 4WI9A 2A3TA 3JWNC 1FPTL 4BINA 1JHTB 1OAZL 4HUWB 5MI0B 4H88H 2VM4A 5DRXB 2BSCA 1A1OB 4O4YH 2R23A 2B2XL 3QUXD 5CNHA 4GQ9L 2CE6A 2YAMA 4U1LA 1YQVL 2X1XR 4XI5D 1ZE3C 2CA3A 1I9JH 5E2UH 1BD2A 1A6PA 2V7HB 5GGTL 3TBYA 5EULV 3U7WH 3MO1B 4Z7WF 2M2DA 1MHHB 1KTDB 1YPZA 5FDYA 3BAXA 5AVRB 4FXLA 3RU8L 3L95A 4ZMZA 2XXCB 1FZOB 1DQML 3NPZB 1XD0A 3V4UL 4I0KA 1HL9A 5IV2B 2Z1KA 3Q05A 1GS7A 3ISRA 2WJ7A 2L8AA 3OWRA 3QRGL 1UWEH 4GBXD 4TPRH 1C08A 4CVUA 3NIFE 5JW3H 3VD9A 2AQNA 3NPSC 4X8XA 1IGIH 3MRQB 8FABA 1MFMA 1QFOA 2F19H 2UVFA 3C5SB 4ODXB 4AEHL 4JDEB 4YFLF 2VDOL 2Y69B 5HJDA 3UTSA 3JUYA 2NOYA 4QHKJ 2VR9A 2BNUB 2E86A 2JKLA 4ONFL 1ED3A 1J8RA 1WJ3A 2FATH 4ZMOA 5C2BH 1T1ZA 1AANA 4V1DE 1KPUB 3STLA 2LFEA 4KHTH 4Y5YB 2Q2EB 3ZDXB 1A7OL 2OP4H 4IEFB 1M7IA 4XNUH 3WLWD 1FBIL 1NJ9B 2QQQA 3X1BA 5BOPA 4AJVA 2CWRA 3B8YA 3KYNA 1DFXA 1G0DA 2VRKA 3CFDB 3MRIA 5TDPA 3QI9D 3GS0A 4R5VA 3VFVA 3JTSA 1D7FA 5B38G 2P5WE 1HE7A 1HC1A 3OGCB 3RVTC 1HKLL 1EZUA 5C08D 2VR6A 4MAYD 3F64A 4Z78B 5B1JA 4DGYL 2EZ0C 4YHML 5JNYA 4PI2A 1ADWA 3O3UN 3QSKB 5CHNB 1T7VA 3L1EA 4RLDA 2VZ1A 1IGMH 4JJHA 4KQ4L 4LPTA 1JIBA 4N68A 1MREL 1GZPA 1L0QA 4OLWH 4AENB 4F7TB 4LOEA 5KYWB 3PHSA 2I25N 4CNIB 2ZQKA 1RMFH 1RUAH 1PCSA 1SXAA 4LLYB 2YPKA 5ADOH 2UZXB 4AQ1B 2CUAA 4LSUL 1R4XA 3QNZA 4YHPB 4HJJL 1EMTH 1JF6A 2K6WA 3AREC 3WJMB 4OUOA 1DQQA 1IGYB 1I1AD 2BFVL 3IDIA 4JRXE 3CHSA 3A6OA 5FGCB 5EUOA 1CBVL 1RZFH 3T4AA 1GXEA 2Y7QB 4NP9A 4I77L 5TQ2H 4WEBH 2DYPB 2P5PA 3DTDA 3H2PA 4JDVA 2FO4A 4R7VA 4XPBH 3RUGB 2CXGA 3W0WB 5E2VH 1E42A 4OIIH 3NEOA 4X99A 3RP1A 1T4WA 4JHVA 4PMEA 4B5EA 1H5BB 3OR7B 4MA7L 5EO9B 5KSBF 4PY8J 1V3KA 3DMMD 1A5FL 1X44A 3LKOB 1KGYE 1UACL 1YPZF 4GUCA 4G7SB 5ITFA 3TONA 3KBPA 3MBEC 3K1DA 2QTEA 1WQVT 2AJYL 3FN0L 3HNVH 4BCZA 1ZEAL 3X11A 3MJ6A 2YMOA 4I0PC 4LE8A 3AAZB 4DP6X 4PYGA 1VB9A 3CX5K 3CZEA 5EZIH 2LVCA 2DI8A 2WWMC 1PIFA 1VDGA 2GAZA 3NZ8A 3R8BB 2OS7A 2EIEA 2E8YA 1KYAA 5JW4Q 5HGAB 1CU4L 2HT4C 1HOCB 2CCVA 3DX3A 4N0RA 2OZ4L 1KEGH 3TNMB 2C3WA 1WAPA 3H4FA 3UPAA 3L5XL 4JRXD 4UV4L 1CLZH 1OSPL 4RSVA 3RWCB 2N01B 4JFZL 3TVMA 1Q0XH 4NNPL 1ICTA 1H8LA 1G0XA 4NNYB 4F2MA 2WV3A 2ED7A 4FTDA 5EV7A 1DLFL 1RY7B 4BQCA 1YY9C 4NQVA 2M1KA 2W60B 2DDQL 2A2QT 2GI0A 2B1AH 2A6JB 3RNKA 1FWXA 1NC2A 5DYFA 5C0AB 1JYXA 4DCQA 3QUMH 5ADPH 4B5ZA 2FWLB 4ANVA 2XETA 3TGXA 1HIMH 4FLSA 1INDH 5I66B 3N50A 1O7SA 1NC4B 5GGRB 1FI8C 2CBPA 1FQ9C 4TL5A 3FB5B 2FRGP 4XO3A 1H19A 1UJ3A 2WN2A 5C9KA 3BWZA 3ML8A 1PLAA 2QSCH 4P2AA 1DJYA 4PBXA 3PJLA 4QRUA 5DQ9B 1U95B 4R7DB 3BPOC 5KEZA 5LCVL 2AJVL 2XTJC 2V9RA 3QNYA 2QZ5A 4L4VB 4OKVB 2I9TB 4TRPH 3AT8A 3BPNC 5BW7C 1I9EA 2HZHA 4JRWA 4AI7A 5D1QA 1KBWA 1BZ8A 3VFTA 5LXGL 1SN0A 4EPSA 1AO7A 2WW8A 5CP7A 1O5DT 5EUOF 1NAKL 4E42A 1AS6A 5A6MA 4FFZH 1UM5H 5CZKA 4EIGB 2VC2L 4ZAKB 1CURA 3ARRA 3DX6B 1RZKH 4NNXA 1UADC 1SJHA 5DJCA 1OGTA 1FSKC 3PWVB 2H2PD 3QIBA 3FFOA 3K72A 2E75C 4HDIA 4KKCD 3AG3B 1F1DA 1NBVL 3PPSA 3CX5J 4PS4H 5AAWA 3NSCA 4HBCL 5ABAA 5KVEH 2HYMA 5E5MB 2XWDA 5DZPA 2ZKYA 1UZ8B 43CAB 4HIXL 1F42A 5MERB 3KS0H 2BNRA 1EBPA 1YNLL 4KNQA 4OCWH 5E6RB 1ZLUH 5IVNA 1E4WL 2W80C 2MNJB 4EI6B 1A25A 4H1LG 3WEXB 5HDQL 4JZJC 4LEEA 5E1GA 2Y0SA 4RGOH 2YAOA 3O9WD 1YEDB 4X4YA 3CNKA 3PL6B 1NINA 1BZ7B 4MXVF 5FUZH 5DD6A 3ETBF 2IBZY 1SEQL 1UM4L 1L9MA 5BRPA 4YPGB 2NXYC 1AD9B 2ED6A 2R1WB 1HJCA 2FT6A 4XMXA 5LLIC 1O7DC 5L7XL 4JZOA 3JT2A 3HN5A 3IMRA 2AQPA 4J8QA 5EZPA 5C07B 4UUJA 1GRWA 3SYQA 5T1MB 3MJ9A 1MCWM 1JE6A 4HW6A 5IY5B 5EF3A 2BS71 4C56B 1YEJH 1IAKB 4H88L 3QZBA 4O4YL 2FECI 5F1OB 3WN6A 4X6DF 4C47A 3QXDB 2LAAA 4GO6B 4L5FH 4RGNB 2Z8VC 2AGJH 5E2UL 3WD5L 2QKIA 3JYCA 3NEEA 2M83A 2OTWA 4OV5B 1BMZA 1JPST 4O5LH 2GVYA 2WP3T 3IDMA 1FVEA 3LOWA 3PV7A 4NO2B 4OIAA 4TUJB 4WV1B 5IB5A 3TF7C 5IF0B 3HKZA 1J5IA 3IFNL 1NWPA 1BBDH 3DX2A 4EDXB 1Y0LB 3F6JA 4CMMB 3FTGA 1NFAA 1ET8A 2VR5A 3NABL 1IBHA 2WBJC 2WVSA 3GMQA 2FEDD 4EVNB 1AGEA 2H9GB 4GO9A 1VGKA 2Y2WA 2CD0A 2Z8SA 2KERA 1IEAA 1BMWA 2E47A 1SEBA 4H20H 2F7PA 4GMTH 1IIKA 3SDAD 3S8WA 2EYSB 2VERN 4X6EA 4YBLC 5JW3L 1EXGA 1T1YB 1EFXD 4PG2C 3KLLA 4N2EA 2EXYC 2C34A 3HMWH 1IGIL 3Q48A 4QIRA 5D9SA 2F19L 4N26A 1ZHBA 2VO5A 3C09B 5I1CL 1CFNB 2MEJB 4U6TA 5B21A 1B4JH 1LMIA 2X4TA 1S7QB 4LLUA 4U49A 5C2BL 5JPNC 3F6IA 4KHTL 2VITB 4BFJA 5J0BA 3TYFA 3ETBJ 2OR9H 1GGIH 4J23A 4QXTA 3AG2B 4JY5H 4WDIA 4HWBA 1BW8A 1GGBH 2ZUUA 4KGJA 1TQCB 2PCYA 4NGHH 3QFGA 4HJEA 1ZJBA 3D69A 1N6QH 1SQMA 1E40A 1OLLA 2QADD 5HGBA 1G5AA 3DV6A 1SUJA 4AIXA 4K5OA 3IKKA 5DJ6B 4I9WE 4KMTH 2AVGA 1BBJA 4Q6IA 2EC9T 5CGYC 4LZKA 3NZUA 4E9XA 3UPRA 1F0LA 2G60H 3F65A 1BVNT 1IGML 3FU0A 4NT6A 3T3MB 4PWEA 4QY8B 2A6IB 4WU5B 1GJIA 2VO8A 3UDWC 5MHSE 4MVBC 3IN0A 4NEHB 2AXFB 4LIQH 1RMFL 1RUAL 1GW0A 3BVNB 4Y9EA 5ADOL 5K69A 5E4AA 1TSHA 2X4QA 5I75B 1JOIA 3DUSA 8CGTA 3UACA 4J3BA 3HR6A 2VDNB 4N9GA 3FRUB 3TZVC 1RZ7H 4FNRA 4DW2L 3SDXA 4F9PC 2DEYX 2RBLA 3AU0A 3CX2A 4FNTA 2EILB 4MB4A 4FQJH 1ECZA 2YKLH 1IM3B 5B4MC 4XPBL 1N68A 4L5FE 4U1MB 4BCXA 3IMUA 1QMUA 4IMKC 2FLBT 1KFGA 1UB6A 2K78A 3UZQA 4WFEE 4AQEA 3I6SA 3LKNB 4P46C 3FH7A 3IGFA 4XMKL 1NEUA 5HHOD 1L5GA 1OAYH 4AH2B 4G9FE 3GFUA 1NZRA 2V33A 4YHNA 3R4DA 4Y2DB 5C0DA 2J71A 3S2AA 3AY4C 3GMNA 5I0ZA 1MWAA 1RZ8B 4DJMA 5J9PB 2QV4A 43C9B 4XMWA 1EPFA 4L3FA 5LGJB 4PJ5E 1QFWM 1QZNA 2VLLB 3MV7D 3L1OL 3PWPB 4KK5D 3RKPA 2IEPA 4FI7A 5EZIL 3FFDB 5F89B 1I7ZA 5DFVD 1VEPA 4GRWB 3HHMA 3BEVB 5J57B 5ELIA 1WCBA 1HQ4B 5D7IA 1TCMA 3MJ9H 4YFEA 4N25A 1KEGL 1MW0A 3RIAK 2ATAA 4AUJA 2YBRA 3SGKC 3KAAA 4P2RA 3N41F 3GF8A 4FERA 4A2MA 1KMGA 2X2YA 3L3JA 3HKFA 1MVYA 1TQVA 3L4ZA 5ENWB 1NGZA 2V8MA 4PJBB 3ZYZA 3C2AH 3DURA 1AS7A 3JVGA 5FS5A 3VYOA 3WJJA 1QX1A 3VMPA 3GSUB 3T8XA 4B60A 1UVQA 1K8IA 4PGDA 2I27N 5DHYB 5EEWA 1NCWH 4WJKB 3BSZA 3QUML 5ADPL 5K59F 1B0GB 3BN9C 1K5NB 2YQ3A 4EBQH 1HIML 1AMYA 2O6FA 4G9FD 1INDL 2WVVB 1J0HA 2WTOA 4GFXA 3W39B 7CGTA 5I5MA 1BWWA 3CLFH 5D7JC 1U58A 2BMKA 3QCUL 4UTAH 3HG1A 3BPLB 3QDMA 4PJ5D 2QSCL 1FL3A 3WNNA 1H9DA 1YCSA 4LIQE 2KKQA 3F5WA 3TV8A 3EDEA 5FYLH 3D34A 3BGMB 4KVCL 4LARH 3ZDYB 3CCHA 3S96B 5KJ7E 4TRPL 3HI1B 2X4RA 1AMXA 1T7ZA 1S3RA 2QV2A 2EYTA 2V0AA 3BP5B 4LLQA 4N8CH 4F7MA 3SDXF 2OFQA 3JQOB 3LRKA 1W0VA 1FGNH 4FFZL 2ZG1A 3T0EB 1NGWB 2Z31D 6PAZA 3KXFB 5GIRA 1OE3A 1P7QA 1PSKH 4HWBH 2YXVA 3DO3A 4U6YA 1RZKL 4A2FA 4NJAH 2ICWB 3JXAA 2NY5H 2H3NA 2O6CA 2WHVA 1B9ZA 2E7HA 2C3VA 1I3GH 4APQA 3V4PH 2AJZA 4PS4L 3BLPX 1KFAL 1PBYA 1QFWH 3QJRB 2DI9A 2UZYA 5B7FA 2ADJB 2EEAA 1EJ6A 3ASNB 1SVZA 2P7TA 3Q1SH 4JX0A 3COOA 3RZCB 5KVEL 3QGVA 1JWSB 4OF6A 4OZHF 3RWGA 4A2DA 1RHHB 3OKLB 1U4FA 1ZDSA 1AKJB 1E4XH 4HMDA 2EO7A 1A7NH 1KIQB 2F7QA 1VIWA 2V2TB 4KV5E 1JUFB 3ARBC 2NY4B 4HK3N 2NUTA 2BIMA 3FT3A 1IC4H 3LPWA 2AQ3A 1FYTD 2G75A 5BRZB 2FLMA 4YZFE 5IKCA 2FR4B 4R2GC 5A2FA 2LABA 3EOBA 1NIEA 5FUZL 5D7IF 2VLMD 1ZXKA 4KRPC 1CFQA 3VFNA 1E2WA 2PPCA 3P2TA 4OI9A 3UYOD 1KTKE 4AYEC 2XQ0A 5T1LB 3ARDA 3KPPB 1I3UA 5I6LA 5DEZA 4H8QA 3DROA 4UV7H 5E9NA 2WZPA 1MFUA 4PJ7A 2W0FA 3RGBA 4A39A 2WJ5A 3MV8A 4KK6D 4N1HB 4LEBA 2MTAA 2BVOA 3B7SA 4LEXH 4A63A 2R0LH 3RPKA 4L5FL 3C60A 1DBAL 4OGZA 4B7IA 3QUZC 1IC5L 3IF1B 3SGJA 1H0DB 3H9YA 5B3SB 3SO3B 2VW4A 5FV2A 3RWEA 1BG1A 4QRAA 4GQPH 4O5LL 4JHAH 1ACCA 5E8EA 1PLGH 3VWJB 3FUJA 4YS4A 2ZONA 5CCKH 1BBDL 1ZD6A 4O02B 4JFEB 4BUHA 4YLCA 1HHHA 1LWJA 4ZTPH 1I4FA 2YARA 2C7UB 2JJWA 5B1BB 4FQXA 5GS0D 1T0MB 3OG4B 3MBXH 5HYSA 1M2OA 4JG9A 1ECYA 4XPAH 4D8OA 4XNQB 4JFQB 2DMGA 5IESL 3T0WA 1AY1H 3O6LH 1XTMA 1TO5A 4RDQF 4UQ2B 3VJ6A 2NQCA 2DV6A 3O8XB 1ETZA 1FYHB 3VVVA 3SY6A 5F7NC 2AJXH 1BVKA 3R0NA 3L3OB 4LL4A 3O6MH 2GJZA 4HVBA 4TQPA 1B4JL 5DEFA 4YHZH 1RZGA 1G4MA 4WW1A 3D85D 4GKZA 3UJIL 5AYUH 1B2WH 2LFGA 2N4IA 2OR9L 1GGIL 4IIZA 3DXAA 3NRFA 4LT7A 2J1XA 3EFOA 1A2YA 1XGQA 4IMLA 4DQAA 4BSVA 3BZFB 4JGJA 4MSWB 4U1HA 1A6WH 4IJ3C 1N6QL 3RVVD 3VACA 3VFSA 2PXYD 4PJ6A 2X3CA 3L4VA 4NLAA 3IJSA 4HX1A 1UURA 1QSEE 5ID1B 4LLDB 5D5MA 5BV7B 2XX1A 3R7QA 2QEJA 1AQ8A 2OL3B 3RNQA 3WAJA 2CMRH 4JFXB 3FCBA 2G60L 3ZDZB 1XCQA 4Y4FA 5ERWB 4NQEE 1OP9A 4KI1A 4CW1B 1Z9NA 5I71C 3P2DA 4Y19D 5C6PB 2BP0A 3QUYA 2FYYA 2YZ8A 3HE7B 4L0PB 4MCYA 3KPRB 2OX5A 2SODB 2VTFA 3WL9B 1SYSA 2DWDB 3IDYC 1GMIA 5MEPA 2L3BA 3OAYK 5BQ7B 2DLTA 4C8XA 4F57H 5A16B 5CS7A 1ONQA 1RZ7L 3JZ7A 1MH5A 3FSVA 1HDMB 3WDIA 1S9WA 3ROLA 4O2CA 4ANXA 4UOQA 3M8OH 3D08A 5D7KD 4FQJL 2GJ6B 3TC9A 3T1FA 1WK0A 3EBIA 3ZKSD 1RZKC 3A0OA 1VADA 2VDQH 2J55A 1HCZA 2EC9U 3VWKC 2JWYA 2R23B 4DHLA 4N8VA 1XQ4A 4Z3FA 2XWEA 3JTTA 2E7CA 1AC6A 2WYZA 2ZUWA 4K2UL 5ICZB 1OAYL 3CTTA 5DC9B 3MNWB 3DX1A 3C8HA 4BFOA 4E2OA 4CU7A 5BVJA 3K4AA 4KFZC 1CFTB 4FL4B 2VXUH 1MJJB 2GIXA 3UAJA 2J6EH 3WY4A 3WTYA 5KSBB 4QRTB 5D8JH 5K93A 3G5YA 4DVBA 2LT9A 3ZUCA 4L8CB 4OF7A 4JLRA 1ZCRA 3NFSL 4MQSB 4NQED 5TF1H 2VLJE 4B9ZA 2IH1B 3VGBA 2OCJA 2EVGA 3MJ9L 4X6FB 1RZPA 3DYMA 1BAGA 3T4AC 1N70A 4JGMA 1H3GA 1NCDH 1NM4A 5SWSD 1DE4A 5GRZA 1O6SA 2VR8A 2WZ6A 4BFIA 5HGHB 3BCDA 3ESVF 4WWKA 5JORA 3S5ZA 4POUB 3ZRSA 3U46B 1AZZC 2HVKA 3LB6C 4PJ8B 5IEHB 4XHQA 3MJGX 1KWKA 2ZP9A 3T65A 3GS7A 2XSKA 2VGLM 4Z77A 5EU5A 5BRQA 3N2JA 4EBQL 1D3CA 3POHA 2NY2C 5HTSA 5FCUH 3FT2A 3P3UA 2CUMA 1QI5A 1I7TA 2P46B 4JY4A 3TA4D 5IB1A 3MTRA 3RWJB 4Q2ZA 2JKJA 3CLFL 3QAZB 4IIQB 1D5XB 1RVFH 5JNYB 1A7BA 4JFDB 4Q9RH 4FG6C 1JK8A 3MUZ1 1IQDB 3QXWA 3R1GL 3RLSA 3LXAA 4IKIA 2ADIB 2O5YH 2ZSWA 2EACA 4WRLA 5E6IB 5FYLL 4NQSA 4BFBD 2ZNXA 2RB8A 2KZ1B 4M93C 2XG5B 4LARL 5T5FA 4O2FB 4UILH 5CIPH 1GZPB 2JH2A 4HUUA 4CSTA 3WTSA 5FYJH 1JGUH 2VXTL 3IXAB 3EYQC 3R8QA 1DCEA 4B9GA 3DTXB 5HHQB 5KSUA 2Z92B 2ERJC 3VSTA 3TVMC 4I9XA 5I73B 5F9WB 1YUKB 2J7LA 3N1QC 1G1OA 3GSNB 4H8UA 5IFJA 3MFFB 4KAQH 1PSKL 3B2VH 4HWBL 5D1ZC 2EUZA 4NJAL 4A2GA 3GXMA 4OCRH 4DP8X 4B50A 1MCQA 2NY5L 2FX7H 4DEUA 4KBPA 1J0YA 1P5VA 1UQSA 1I3GL 4PW3A 4R7XA 3V4PL 2ZT9C 4Q9CA 3I2CH 12E8H 1QFWL 3U83A 5DD0L 1IAMA 3VU2A 2E7BA 2WO2B 1JZIA 1SF5A 3Q1SL 1L3WA 3DO4A 4LQFL 3MLRH 2J57A 3QQ3B 5AOMA 4HZLB 4KK8C 5I0YA 3VUAA 1OW0A 2YC1A 1UZGA 3LQAH 1WIOA 4MDIB 1QLEB 1INQA 3ZR6A 4AWJC 3NUKA 3WTUA 1A7NL 3PQYA 2G2PA 1FZKB 1I7RA 3QRLA 2R69H 3AS3A 5CLZA 1MI5D 1UD2A 4Z23A 3X1NA 5EZJB 2EE0A 4UBDC 4UQAA 2Q6WB 2IDUA 3WFHA 2PTTB 1G9NH 2YD2A 3GPEA 4WGVB 2W38A 3VXRA 1CN4A 3HS0C 4AK2A 3VTAA 1F86A 2VJ0A 3FRPB 3VD0A 4I85A 5D1QC 2I85A 3ZDXE 4D3CH 4TVSa 2UY7B 1IGTB 5I74C 2GAZB 4JVUA 3KPLA 1KOAA 2F7IA 3OJVC 3MLTA 4OTXH 4K7PH 1TCRA 4L8DB 4OLZL 1R3KA 4MMYB 2YAPA 4UV7L 1FFOA 4WW2C 3QIBC 1CDBA 4JRYB 1DANT 4IRJA 1X4XA 4OD3L 3OC8A 1JXDA 4FQIH 4HHAB 1V7NH 4AZ8B 1U8CA 2DQJH 2H8PA 1CE6A 1I8LA 1VFAA 2R0LL 4XNAA 1T7WA 5ITBH 4F2MB 2LR4A 3SEPA 1CLOH 3HR5B 3HPJA 3W9EA 1QACA 5EU4B 2IO5A 3EGDA 2R4SH 3FQUA 4MNGA 4X6DB 3RNKB 2W9LA 4KROD 4FI8A 5GRYA 3MOQA 4MZ3A 4JHAL 1HS6A 4Z7VA 2XWBA 3QE5A 1UKSA 5ID0A 5CCKL 2HN7A 5E8DH 3DC0A 3FFCA 1FNLA 2ISDA 3RILA 4B0MB 3MOBL 1BLIA 2OSXA 2YD0A 4AY0A 2XLLA 4P49A 1MZYA 5C0EA 1ZGLM 1XH2A 4FHKA 3D25A 4LBAA 4TVPD 4P5KB 3MBXL 4BK4A 2BNQA 4PLJC 3VFWA 3CSTA 2E27H 4KU1A 4LPYA 4XPAL 2L0DA 1FCGA 5FYJE 2OMTA 3F7LA 4OZ4B 4XVUC 1DJGA 2XDHA 1AY1L 3O6LL 3KYOA 3RUGE 2EO1A 3W0WE 2WD0A 4KI5E 4KUCF 1TEFA 4AJ0A 4I1RA 2AJXL 2R0WH 2BDNH 1YYMH 2ZXEB 4ONHA 4MA3A 1N7MH 3EJSA 1X5MA 1GGCH 3CFCH 3U30C 1JNLL 4YHZL 1E27A 2B7DT 1BQSA 4UI2A 1JZFA 3H9SB 4BQ6A 2PCPB 1ZAGA 3BC9A 5AYUL 1B2WL 2UYLB 4MA8L 2NY3B 4WTWA 2AKRB 3BSZL 3UBXB 3QORB 3OG6B 4RRPG 4YH6A 3MU3A 1OGTB 4BRVA 1ZLVK 2B39A 1GZHA 4IDLA 1GZQB 1JVLA 2HG0A 3JBG7 4PTUB 4RCAA 5JPMC 2DY2A 3OD3A 3RVUC 4J6IA 4XCEA 4E9LA 1I8UA 2OTUB 4HXAH 1UH4A 5FFLA 2HX8A 2WCSA 3NH7H 3K2UL 3VXQA 5A3ID 3KWTA 4Y89A 3UCRA 4XPGH 2CMRL 2FJFA 1O9ZA 3H7BB 2WYIA 3K1KC 3QQ4A 1I1FB 1PJ9A 2UXFA 2WLIB 1T3FB 3MNVB 1J8HB 4MQ7A 2DLGA 1ZTMA 4ODWB 4D9RD 4E0RA 4AGOA 4KRMB 5KBDA 5EOTA 2QR0A 1DUZB 3INUH 3LRSB 3S34H 1NICA 5HDRA 4JPSA 2VN4A 4UU9A 3TPUA 3TJEH 3N5AA 4ONGH 1U8LB 3VSVA 1NFIA 3P0YH 4F1SA 1RUML 3CXHK 4F57L 3SZ6A 1BXAA 4KI5D 4XMZA 5C0AE 4QXVA 4H25B 3IPBA 1J18A 1X7QB 1FORH 5LDSA 3M8OL 2HFFA 5IQ7H 3GBML 4E5XA 1MCNA 2AK1H 4W1TA 4EE2A 5EO1B 2C1PA 3QWQB 1LQBC 3LZFL 1ZPUA 2VDQL 3GMLA 5AAPA 2NY5C 4G82A 1JXJA 3P4OB 3H3PH 4XNYH 4QHLB 4Z7UE 4XP5H 1NA8A 5DMJB 3IDGB 4HKJA 4L3CA 4QXUH 5AW8B 4N3TA 5A2IH 4TM9A 3MFGB 1IKNA 1EDHA 4Q6IC 3S36X 4YDLB 4F8PA 4Z7VF 3QJFB 4W9JC 2QQKL 1BYNA 3MUGB 3SYPA 2BWIA 2OTWB 3D30A 2J6EL 4TQEL 5DVOA 4L4VE 1HSBA 2A0LC 1UCBH 1I9IH 4NO0A 1SN2A 3OAZK 3WUWB 4QT5B 1S8DB 3OXRB 4XP4H 1U9KA 5KYXB 2CHXA 3MRPA 4TNEA 3E1F1 3FTGB 4PLNC 4UAHA 1Z2KA 1WE5A 1QTPA 2W92A 3SBQA 4ZFZB 3SDDA 3AZUA 3SBPA 1OWWA 1X5KA 4PJFF 1KEMH 3SDCB 1F3JA 1OP5K 1A4KB 3CVBA 1QBLH 1QATA 4Y16C 3SCMA 5CD5D 2J20A 2W07B 1DZ0A 2KT6A 4G8IB 5D70L 3ZZQA 2Q1EA 1MHCA 3DDFA 3I02B 4KTEH 1NCDL 3UIYA 3ATBA 3FAXA 4G43A 1XIWB 2C5DC 2F1AA 2OTPA 3D50A 5DK0B 5G4OA 5IW1B 5C0AD 3EHBC 5ACZB 4FZEH 4AVKA 2AV7B 2PWDA 4EQ2A 3OHXA 5I1JL 3FN3A 1H15B 4K9JA 1QSVA 2EDOA 2X3BA 1BZ9A 1QG3A 2IG2H 3ZTEA 1IAOA 5AAMC 1FIEA 1NC4D 1OOWA 2WVTA 4ZO7A 4PCKA 5KN5B 3NACH 3CFEA 1W91A 3EJYC 4IU2A 5FWRA 2FQFA 5AD0A 3F3HA 3R4RA 1MVUA 1L0PA 4GSUA 2BJMH 3S4SB 2EIKB 4MCZB 4NPJA 3CXHJ 3TTSA 3Q43A 1PGRB 1XGYH 2IFFH 2YJQA 2NTSP 3QZWB 3SY0B 1FDLH 1LK2A 3DV6B 3G9AB 3R06A 5D1ZI 2MOQA 4L4VD 1RVFL 4J28A 4UYPA 3KPOA 4DO6A 3L6FB 2Q7NA 3UPRB 3EADA 3QG6A 1OD7A 5C07E 2WTRB 4PCYA 1PQZA 2O5YL 2VDNH 3P0VH 1DQTA 1JNNH 1B0IA 1YDPA 4PV8A 3HC3H 4C56E 4FFWC 1F4WH 4UILL 4ZAKD 4PJCA 1CFMA 4V33A 4AM0Q 5EF2A 4ZOAA 5IHUH 5FYJL 1QRNA 2X6AA 4WUUB 1BA9A 2XQYG 2KC0A 5EU6A 1JNHB 5JIMA 4UNIA 3RTQD 4RGNE 4IJTA 3UJTL 3ECBB 3I85A 4WWNA 3GSQA 4X6CA 1CG9A 1PL3A 2N56A 3MRMA 3VM5A 1NLDH 4KAQL 3IETB 4N9GB 4IRSA 4TMPA 5EU3B 3DVNB 2D8KA 3VD3A 5GSVA 1ZPLA 4AYDC 4EI5D 3IMVA 3SDXB 5J4MA 2C3GA 4MGXA 2FX7L 4YXKH 5CLWA 4CILA 1G7QB 1K8DA 5KYYA 2SEBA 1M1XA 4N85A 3PAUA 5T5NG 12E8L 5DJDB 3AB0C 4AUUA 3GK8H 1DQVA 1UB6B 1P7BA 3MLRL 2JKTM 2CO2A 3TIEA 1KGWA 4A7QA 1LK3H 2ZUQB 1BM7A 3L9RB 2WY3B 1R3LA 3LQAL 4KRLB 3P69A 4DWHA 3PL6D 3Q2LA 4GRWH 4OZHB 2MKLC 3TIDA 2QLYA 3S88L 1MWAB 5CZXC 2VL5B 2DIEA 5C0CB 3LNDA 1G9NL 4J8RB 3FT4B 2CQVA 4BZ2A 1KLGB 2OV0A 1AXSB 3VD7A 4JHWH 5F7WC 5FF6A 2XN2A 3OKEA 1P2CA 2VT0A 3WFDH 3CIQA 4K7PL 1WCBB 4PYHA 5D7IB 1YAZA 3TP4A 1W72A 4BM7A 4RGND 4N1CA 4OJEH 4Y7MA 1CFVH 4FQIL 1QRKA 1S9XA 2DQJL 4HG4K 4ZYKB 3S0PA 1I8IB 3AU1B 4YGVB 4EUPH 3RYMA 1CLYL 4N0CC 3RX5A 5GS1A 2YKKA 4JFPA 3VH8G 2FJHA 3QVAA 4OVVA 3DURB 1CLOL 4GI8A 4AL8H 4NQCA 4G5ZH 4NP4L 2K8MA 4R5XA 5CU9A 2R4SL 1WZLA 3HI6H 3S3JA 1F4YH 1RZIA 2P1YA 3T8XB 2MHAA 4WU7A 3D39A 3MREB 5GZNC 4FLRA 4NQUA 3O4LA 3T3ME 4G6JL 4KKZA 2FO1A 3QB7C 5IM7B 3ZHDA 5DF0A 4HC1A 4BH8A 1KIRA 4M5SA 5E8DL 5CSZA 2DYSB 1MG2C 2Z91B 3FZUC 4ZW8A 1W8NA 2DQIH 3WY2A 2NLJA 4XBGB 3SZKC 1U8PA 3QCTH 1SDAB 1SVBA 2E6QA 1I3VA 4LCWB 5DRWA 4PJCF 1DANU 4NXSA 1AE6L 2F5AH 3G5ZB 2BOCA 2ZJSL 1JK9B 4LKXA 1OD9A 3ARDC 5BZDA 5JXAL 4BYHA 2GTZB 4Y7OC 1OZUA 3QIUA 2BDNL 3D07A 1YYML 3NSYA 1QNZH 3DSNA 4L37A 3QXVA 2NPLX 2VM9A 4P06A 1N7ML 5DT1L 3CFCL 4JPIA 4HUCA 1W0VB 2QHRH 3K2KA 2I07A 2KDGA 1LILA 1YNKH 4Z3JA 2Q5BA 1P7QB 3HFFA 3SGJC 3KPSA 4ODHL 1LO2H 3VFOA 1P6WA 1DBKL 2X44D 3KCWA 1ZWIB 1R24B 4DGVL 2H3NB 2G9KA 1DUYA 1FNGB 4L48A 3QULA 3PWPE 4APQB 2AJZB 4C4UA 2ICEB 3VI4A 1IC7H 4HXAL 1TKWA 1M7UA 1IT9L 2Y36L 4UAOB 4M1GL 3NH7L 2BRQA 2P7TB 3CFBA 3GLDA 4GRWE 5LJYH 4ATWA 1AXTH 1MRCH 1KXQA 2WCGA 4FQXC 4NUGH 4XPGL 1PY9A 4TNFA 1AHKA 5ECJE 4HU8A 1EV2E 5T5FL 5ESAA 4L4TD 4NRXA 5HI5D 5A2KH 3W38A 4HG4J 1GKEA 1LEIB 5F71A 4PRNB 2JJVA 2CRMA 1KYDA 4MJHA 4MMZB 3S34L 5J1SC 1QFWI 2ZX7A 5K39A 4PJBE 1Z1WA 4ONGL 5E0FA 2KL6A 1IM3D 3P0YL 2VAAA 1F56A 1GYVA 5DJ0A 1N2RA 3QWNA 1JZ7A 1P7KB 1UFUA 1FORL 3UC2A 1E4XI 5IQ7L 1XCXA 2VW7A 4ZFOB 2YWYA 2AK1L 3TM6A 3CVHB 4ELKA 4XP1L 1YY8B 4HXBH 4AXWB 1OTTD 2BVTA 5EFIB 4OZIA 4YBHA 2NY1B 2VMDA 1KGCE 3H3PL 5HHMB 5J3HD 5DWUH 2XZAH 2Z35A 4G6FB 5B39B 4XP5L 4JQXA 2X4OB 1HXMA 3NCYP 4O02H 2YJLA 4QXUL 1CD1B 4FEMA 3RI5K 1ASOA 3C60B 2BOBA 5E2JA 4TLSA 1IMHC 1DJWA 1PYWB 4R5TA 2DIBA 2P48B 4HMCA 3S5LB 4LQ1A 2RAMA 1HAUA 3ZDYE 1PD6A 3LQAC 1KPRA 3QZMA 2W65B 2GUOB 4YXHH 1NBCA 4XP4L 4BFRA 3VFPA 1Z9SB 3FB8A 5IMKA 4G8GD 4Y4HB 2XYBA 5IG7A 4HOZA 3KXFE 4JO3H 2OXHA 1G9NC 1IKFH 1JL8A 1NFDA 1WZAA 2GIMA 4LLWA 3WGUB 1CXHA 1KEML 2QPFA 4R0LB 5HYSB 4BXSV 1G7MB 1QBLL 1OSYA 3UXFA 2COVD 1IEBA 2HKFL 4XNZC 5E94A 1NM9A 3P4LA 4NN7B 4Z9KB 4KTEL 5IQ9B 4TVUA 3S3CB 4YBQD 4S1RH 3VYPA 4BZ1A 4KKBD 3Q2WA 1KWGA 2EKSB 3LIZA 2GJZB 4FZEL 4PV9B 1YMHA 1G0YR 2NW2B 2F74A 4PAZA 3L3HB 3SQOH 4KTGA 5KBLA 3LD8B 2Y1AA 5BV7H 2DLHA 1O7VA 2IG2L 2Y7SA 4R83A 2OJEB 1KGCD 3BVXA 3NACL 5EORH 5BRZE 1XGQB 3VI4F 5DHVB 2YN5A 4N90E 3KDMA 4R90H 1Z5YD 3KE0A 4JJOA 3EFFB 3HNSH 1EVUA 3QWRD 1FFNA 4X7SL 1FVDA 2CLRA 2BP8B 1FDLL 1XR9A 2QGBA 2R56H 3KPMA 2VQ1B 2XWCA 1D6EA 4JFFA 3OAUH 4GYBA 4DUWA 3DK2A 1IVLA 4NERA 1ZS8A 1JV5A 2B5IB 2VDNL 3QR2A 4Y4FB 5CLXA 1TTAA 1JNNL 1QEWB 2GI7A 3HC3L 2DQTL 3T0ED 1F4WL 3ZTCC 3V55A 1E28B 2BP0B 5IHUL 4MCYB 2JQZA 4MS8D 2FX8H 3L5HA 5LGHL 4JANA 2ITDB 4NFCA 5MEPB 3MRBA 4PGEB 5C3IA 4LCCB 1F3RB 4PS8A 3PV6A 1DVXA 3M46A 5DO8A 2HJFB 1BIIA 4P4KA 1GYWA 4WWKC 4XXCC 1OF2B 2WSPA 1S9WB 3V0HA 3C5ZD 5JHMA 3RZCD 4OZIF 1G7JA 2Z0BA 2FJGB 3IB4A 3CHXA 5LAPA 1I75A 3KPQB 1BZEA 3LZLA 3L8QA 4JFEE 1KY6A 4W6YB 1DLHA 3VGHA 4H0IA 2V4LA 1AHWB 4S10A 3GK8L 1P4UA 4U6HA 1C8QA 3QG7H 4LRIA 4OZGF 4K5NA 4DKAA 4X9GA 4ICWA 1LK3L 5CD3B 3EH5B 4N90D 1ZGLA 2UY6B 3F00A 4NKMB 1UG9A 3BH8B 4AE1A 1G7IB 5DC0A 1KB9K 2IAMD 3IGAA 3BQUD 2F1EA 2WLNA 3DECA 3H0TA 5EN2A 2DAVA 2W5PA 5T1LD 4D9LH 1AQDB 4HH9B 5I18L 5KVDE 2BIOA 1YYLL 4OCNC 4ZG1A 4S2SA 4JK0D 2VDLB 4JHWL 2DJ4A 2VZTA 5DC4B 3WNJA 2DMHA 3EFDL 5ACMA 3FONA 4OD2A 3RY4A 2R2BB 4APXB 3MCKB 4P5TD 4ZOBA 1PDKB 3HZKB 1MLBB 3VXUD 3ILEA 4XZ4A 4HJ1A 2AS5M 4L1BA 2XWRA 5AVYB 3VX1A 1WT5A 1QSFA 2AANA 4ZD3H 2Q9OA 1A7PH 1E8YA 4WO4D 2D31A 1W0YT 4GEJA 4NUPA 2J8HA 3ML9A 5C0BB 3PGCB 1COBA 3QEQA 5F93C 3ZGHA 3ZDZE 4UCFA 3QDGB 4CADB 2JV6A 4G5ZL 3E8UH 4JFED 4KKPA 2JJSA 3HI6L 2ZAIA 1OW0C 1THCA 2ZNWA 3SN6N 1SOSA 5L2JA 3WV0A 2JKRM 2X9WA 3KPRE 4Z77B 3EO1B 4JBSA 1HEJC 2C26A 2G3ZA 4JFHE 4M03A 4ZX6A 2HSIA 4J4PD 1IO4C 2DQIL 1QTSA 3O8XD 3V0VA 3U6RA 3PF2A 3QCTL 3VGGA 4HEME 2IPKB 1J5OH 4QF1A 5F96H 1M1SA 2Z65C 1G7HA 1T22B 2D9QB 3C09C 3ILPA 4PJIF 1KXVC 2FL5A 2GJ6E 3GSNH 3HZMA 2RQ8A 1GSKA 3RY6A 2XFXB 4LSPH 2NZ9C 4AGPA 5EBLA 4BZ1H 4AQ8C 1PZAA 2AQ1A 1GL4B 4XN4A 4YWGL 1RIVL 1JPFB 2DQ6A 5DZVA 1O75A 4QAWA 3MOAH 4PRPB 1A6ZA 3BVDB 1L9RA 5KSUB 1QBMH 1FRGH 1I8LC 1DVFA 3BKMH 4Z7IA 1KB9J 1TQCC 1TZHB 2QHRL 3GSOB 3UAFA 1ZDQA 1EX0A 1YNKL 3P0GB 2YD6A 4LCUB 1LO2L 5KSBE 2PMZA 3ULUF 4XBPB 3P3TA 2NYYC 4XCNA 1QLEH 1MFBL 3BH9A 3LXBA 1P5VB 4IBZA 3TCLB 1TXKA 2RALA 5F72S 4XBEL 5KSAC 1IC7L 5SX4H 3FQWA 5JXEA 3SE3A 3K46A 2VN6A 2TAAA 1IFRA 1T2JA 1DVYA 3HE7D 3ZKNC 3NGBB 1RI8A 4QR7A 1XEDA 4OQTA 4X5PA 5C09B 3T2NH 3U9PL 1INQB 4JFHD 1U91B 4G8EA 5LWYH 1I7RB 4DEPB 5I75C 2XPYA 2YAHA 4ZW6A 1QVOA 3UIZA 3MN8A 4FXKB 1QR1B 3EH1A 5EBMA 5K9JL 3VYNA 5ICYB 2J3SA 2GJ6D 2X0VA 1ORSB 4XO8A 3WYRA 2ED8A 5HHVH 4HP5A 5B3JF 5GSRA 4YE4L 4PVBA 1N67A 4PRDA 4Q8BA 4ZXBB 1AYOA 4Y5VA 1F4AA 3A22A 3QWOB 1JWMB 3SPJA 3R7RA 4WWID 4OV6F 1GZHC 4IS6A 5IROD 2GSIA 3D7PA 3QR1A 4K7PY 2FIRT 1GPOL 1BD2D 4Y2DC 1PTZA 3TO4C 1JDDA 1WHPA 2XZAL 4G42A 2HB0A 4CGTA 1SJVA 2H8PB 3SKUD 2RMNA 1VFAB 2FD6H 2R1XB 2ZKMX 4MJ5A 4O02L 2DTMH 4JFDE 3N44B 1U8MB 3ESPA 2MMXA 3CXDH 3UBHA 4FQHA 3BESR 1NMAH 4P3DA 4M02A 4JB9H 1U3JA 3WKYA 5GGRY 5IR1B 4KX8A 1V05A 3CZKA 3G6JA 4YXHL 4BZ2L 5E24E 3KH3A 3CK0L 1M2VA 2EDHA 4XAWL 3P4NA 3SPGA 2LU7A 1IC0A 3I9GH 1TTBA 4JO3L 5FM5O 5C0EB 1P1VA 1IKFL 2AEWA 3D25B 3PHQA 5CM1A 5F7AA 1GYUA 1IUZA 2CHDA 1L3NA 3L4XA 32C2A 2VLRA 4P2OB 1F90H 4ZUWB 3UTSD 4M6MH 3Q8EA 5F2FA 4WEMB 4MWFA 1KIUB 5DO2D 5BVPH 4PJFB 3WIAA 3NJFA 3BWUF 4JL2A 4JQIA 3LY6A 1ZSHA 3MTXA 4S1RL 4PJ8D 3PFUA 2YSTA 3CPUA 1IJNA 4ZW7A 3KPNA 1V7MH 3SQOL 2J5WA 3ARFB 1OTSD 3RL2B 3ZT6A 1P53A 5BV7L 5E8OA 2OQJB 4HIQA 5EA0H 5AVXB 3K5RA 1IKNC 1KG0B 1UWGL 3CIAA 4PJ9A 4JAMA 3TNNB 2ARJB 3ARXA 2BWQA 4AL8C 2CM6A 4HC1L 1WC7B 2ZAGA 5CXPA 4R90L 4JFDD 4CKVX 1M42A 2YS4A 3HNSL 4XN8A 3SJVA 3BPLC 4UMGA 2HLAA 4C83B 2R56L 4O51A 4N2MA 3RL1A 2OMVB 1OF0A 1XWVA 2KLRA 2J8UA 2QQLH 4UOW1 3SDDC 3FH5A 3ZSSA 4PVLA 4NZDA 5F44A 2PCFB 3GYRA 1WZ1H 4YSAA 4Q9QH 2WXJA 1FNEA 1EHAA 2V2XB 2XZQL 4KZDL 2HVBA 4JRYE 3CFNA 5HDBB 5TD4A 4E0RB 3MHZA 4GQZA 5CJ8A 2G5BA 4UM8A 3V4VA 1J05A 4D94A 2X4PA 4A04A 1G1CA 4GXVL 4NENB 5JLZA 3QEHA 3JSSA 3JWDH 5IB2B 2YPVA 4X6DE 5FKPA 3KCPA 3V5HA 3GRBA 2TSAA 5EG6C 4L1SA 4AQAA 1NMBL 5IHHA 2AEPL 5IVZB 1Q9KB 2FE0A 2WM0A 2AXHA 2C1PB 4I3GA 5F6HI 3ATEA 4B9IA 1USQA 3BW9B 3AADB 4JPQA 1UEYA 1N0XH 1ZS2A 3QG7L 3NIDF 1R3HB 5IW3A 4H26A 5D71H 4IU3B 5EIIA 1PY4A 3B9KC 3FB7A 4MBRA 5E51A 3DBXA 4L2YA 3RAJH 3IJHB 1U30A 3IRCA 4CC4C 2BRRH 3CZGA 4MQTB 4JUTA 4XAKE 3G6JF 5D1XB 1TYRA 5CSBA 5HGDA 1J11A 5DMGD 5F1NB 3VCLB 4H1LB 3CN1A 1HSBB 1IM9A 3CDYA 1B6DA 4GRLB 1T03L 1QQDB 2CIIB 4C58B 1RJLA 3H6JA 3V0GA 3ATFA 2HMID 1ESOA 3CFJB 5ALBH 4LEOB 3W56A 4B96A 3MQIA 4HIJA 3FCTB 1L6PA 3H9SE 3OKDB 5DFTA 2ZSVA 2E4TA 2VABB 4NUMA 1DEEA 4CDGC 5BS0A 5DUBB 4I88A 5C6TH 1JRHH 4ETQA 1YEEH 2JCCB 4Y1AA 3W82A 3TBTA 1IGJB 1C9SA 3SCMB 4CVXA 3C6SB 3MBWB 4M8VA 3G7TA 4Z0XB 1ES0A 4UDUA 1A7PL 4W6XB 4JKPH 1AR1C 3CV5A 2XFGB 3WS6C 2DWSA 3SO3C 1S9VA 1QLFB 1TMCB 3CJJA 3ZN6A 1TJHH 2YXWA 1CZ8H 1HKFA 3VWJC 3E8UL 5C8JB 4RAHA 5E99L 3LHPH 2I7OA 1BZ9B 1J8HE 3L2MA 4OUUA 4U1SA 1IAOB 1HHGA 3UABA 4ZW5A 2Z3FA 2JB5L 1D7BA 3CFEB 3WO4B 3NCXA 5AYTA 1PCXA 4AMXA 4PRAA 3OB0H 4EAEA 1ROWA 3G08A 3BD5A 1JYVA 4EIZC 3N6YA 4XAKD 3ZYIA 4ZNEE 2PUQT 1R3JB 4K0OA 1J5OL 1MW1A 3OKYA 1EEYA 5F96L 4ZS7H 1HINH 4R4BA 3KPOB 1N0LA 2PF6A 5I26A 4LSQH 3GSNL 1PAMA 4JQIH 4LSPL 1AO7D 1H3PH 3TFKD 1YDPB 3H9SD 5CEYB 4BZ1L 1A9BB 1CIDA 4NKDA 4ZS6C 4Y5XA 5F21B 3VXNB 5BUPA 2NY3D 3NP4A 4PJCB 3NJJA 2ATKA 3DX8A 4DZ8A 4AKQA 4B9KC 3VE0B 3BWAB 2I69A 1FRGL 4TNVK 1HH9B 2DD8H 3HNTH 1EEZB 3GSQB 3BDXA 5GS1C 1OM3H 5I1LA 2DOCA 3KLKA 1DP0A 2KLSA 3P4MB 4H2AA 1XFPA 4ELMB 3ZOAA 3B5GA 2HFEB 3WLBA 3HRZA 4TNVF 3HBGA 4GEIA 5ALCH 5BV7C 2WVUA 1K8DB 1WBXB 3MA7A 2SEBB 3QEUA 1MUJB 3UYRL 2A99A 4JPKH 3UBFA 4HIEB 1J8HD 2V3EA 4JM2B 4B41A 1ZV5A 4YDVB 3AXHA 2VSKB 2NY7L 1Y7VA 3BZEA 2X0WA 1FF5A 4AKOA 3K0YA 3MV9A 1U8JB 1A3QA 1R3LB 1JGLL 2G2NA 3DIDA 4ZSOB 3T2NL 2J43A 4J3OF 4MMXA 1FLTX 2F53A 5C70A 3QJXA 1VLXA 3IDXL 5F1IA 3JZYA 4W93A 4NQDA 3WFBH 4CBPA 4JGNA 3QIUC 4R7NA 1OKEA 3A4EA 3LCYA 4RAUA 5HHPB 2YPVH 2CR0A 3TOPA 1IGFH 4HH8A 3FO9A 3BSGA 3NSFA 4OCMC 5E95B 3QIWB 4PW4A 4N0UB 1N64H 3JT0A 4PGCA 3QYNA 4LLMB 4P23A 5AW3B 3PCYA 2EH7H 3VRJB 3ULUL 2VLKA 3GSVA 1X5AA 1SM3H 2VR3A 1DDTA 2NUPB 4JFYA 4GG6B 3QXAA 4IK7A 3VQ1C 2JTYA 1Z5LB 4TF4A 5LGYA 2FD6L 4FL4C 1OVZA 2DTML 3M07A 5HYJB 3CXDL 3EYOA 1ZLWH 4AEIH 2B20A 1U3HB 1RPUA 1NMAL 2HG5A 1CYGA 1ZV2A 2NDFA 4JQVA 4KNTA 3L5WB 1D9KA 1RFDH 3U6XA 4XXWC 1W8EA 4OJDH 3LSOB 1N9PA 4WUUE 5EU7E 3SDCD 1XB6A 2JKIS 4G8FA 4UQ3A 4FTVB 4MRCA 3I9GL 3X17A 2YLKA 3KBFA 2FQEA 5JW4M 1EFQA 2FH8A 4FFYA 3C08H 4KDVA 2Z0UA 1F90L 1JDCA 3DK0A 4GSXA 2KS0A 2QLVB 3O3BA 3E2HC 3QJSB 4QDGA 5BVPL 5CINL 5E4IA 3W81A 2DJMA 1KTLA 5SWZA 5HYQA 1QWHA 5PCYA 1ORQA 2EYRB 4TLKA 1MCBA 4L37B 1TVBA 4RMWA 3P3YA 4R4NC 1VF5C 3GJFB 1V7ML 1XEUA 1HK6A 4YR6A 3BFQG 5HYEA 1A1NA 2VDMH 5EA0L 5KOVC 3V0DA 3LIUA 4OZHE 1VZIA 5MENA 1N26A 2HH0L 1J0ZA 2HT2D 4HS8H 2NY0C 5C0CE 2H6PA 3QAZC 2P24B 3TBVB 1BJMA 2MPAH 3APNA 2ICWI 2NR6D 1KB5A 3CFKA 1QA9B 4Z7OF 5HY9A 5L0QB 3Q7JA 3LDBB 5E6IC 2QQLL 1S7TB 3CFBB 5AKTA 2ESVA 5JW4N 5EHFA 2D2CC 5HI3C 2WXLA 1I8MB 2VCOA 1WZ1L 2ZUSA 4DGWC 4XVJH 3FQ2A 3BIAX 5C0RH 2FSEA 3IAQA 1K4CA 3F01A 5C86A 1AZRA 1BVNP 4DN3L 1Q9OA 3HG2A 5E1AA 4PVNA 4GAGH 5GZOA 5I6PA 3JWDL 3X2QB 4AGMA 2PLTA 1AGBB 3E6HB 1P4IL 1S7RB 4DGUA 3KVDD 4L29A 5DMYA 2R59A 8PAZA 3R19A 3RY5A 4GW1A 4HT1H 1ZT1B 2Q0ZX 5ETUA 3QJZA 1PNCA 4OZIB 4Q89A 2FX9H 3GSRB 2DMCA 4YC2C 4MNHA 4ZFGH 4XXDA 3ULVH 3O45A 2GTWB 3MV01 3FUKA 2ZIDA 4XMLH 5IHBA 2MKWA 3GIVA 4V2CB 4OF8A 5CJXA 3KNBB 3V6ZA 5C0CD 1J0JA 3HAEG 1IKOP 4LCWE 2DRUA 3IDJA 5F88A 3RAJL 4PB9H 5D2NB 1CICA 2BRRL 4OZGB 4DIXA 1CF8L 2CPUA 3H7LA 5K9OB 5KSAB 2CDEB 4W9IC 4R6UA 1QSZA 2YD1A 3RGVA 4B9YA 3IJEA 3CSFA 2V8LA 1G9MH 3W11C 4IHBA 1BJ1H 4IM8A 2BVPA 5ALBL 3MCLH 1RD6A 1D5MB 1NBZB 4FQPA 2EE2A 1ZJAA 2HX9A 3L3GA 2P28B 3SYCA 2MJWA 4OGAC 2NTFB 5IMKB 4QJ3B 1TJIH 4TUKH 5JHDA 5JR1H 1JRHL 4K71C 4P4KC 1A4AA 4Q52A 5E8PA 4F7CA 1MPAH 3LV3B 3FTXA 2EDKA 3VGDA 2H2SD 2XX0A 4XPFH 3I84A 3MRCA 3AT0A 3SD5A 1J0IA 4YHIB 2Y72A 1KXTB 1UC6A 1G6RA 4PSPA 5DHVH 1BJ1J 2V5TA 1A1MA 2ITCA 2XIBA 2CDGA 2J88L 2OXGA 3HZYB 4M8QA 2B8OT 1TJHL 4RQQB 3VQMA 3MRGB 5B38A 3PDOA 1WBZA 2EDWA 3FUIA 4LRIC 4UINH 3ZBMA 2APBA 3NOIA 3LEYH 3LHPL 1B4TA 2KLTA 1OGPA 4QHNB 4M62L 2DWYA 2WAHA 4FYTA 4XB3A 3D0LA 2IGFH 3KM1A 1MG3C 1URIA 2H0JA 4N2BA 1LM8V 3LZNA 1YMMA 3QDMD 3LJ3A 3U2SB 5DJAB 3DI3B 3PHOB 2WWOA 4WLCA 3ULSA 2F54E 4FFYH 2Y1YA 2ZX5A 4M6AA 3MLYH 3M86A 4YK4B 2LLLA 3RFZB 1T80A 2OI9B 1A4JB 4IRZA 3VSUA 4M5TA 4PJHA 3HCVA 1G5GA 4FQLL 1HINL 4M9PA 5KYNA 4F9LA 2ORBH 5EC2B 4JQIL 1WT5C 4JO4H 5JOPE 1Y07A 4N22A 3ECWA 4PJIB 1P7QD 2XVBA 4YHOH 2BSED 1DCLA 3AXLB 4XOCA 3QORC 1YO4A 4NRYB 3V0EA 1IBDA 4JANB 4LLVB 3RKDD 2DD8L 1MCOH 1MEXH 1DDHB 3RDJA 2PPFA 4WTXA 3NTCH 3PV6B 4HWEL 1OM3L 4APQD 4C55A 1BIIB 4ZUTA 5JOFA 4A38A 2JJSC 2N7SA 2WNGA 4C59B 5L4JA 4LRNH 5ALCL 4J6RL 4AQOA 1TQBB 3FQNB 3VXMA 3E9UA 4YVUA 1Q72H 4JPKL 1XGPB 3TLRA 4W81A 3VFRA 3VU1A 1MWOA 1KN2H 2HP4A 5JQ6H 2BSTB 1GY1A 1JXKA 4ZJ9A 3FOMB 2VDLH 3FZUD 4OJYA 4BDVA 2XI9A 5I76A 4LOUD 3WENA 1OANA 5IMMA 3HLKA 5HDLA 4QTIH 1P1ZB 1WP6A 3L1GA 4JN2B 1YJDH 4KH9A 1MCFA 1UOLA 1SJEB 4HWZA 2YPVL 2PWHA 3A21A 4DKDC 3GTNA 3LS4H 3RG1C 3OZLA 2XG4A 2WZPD 4C4KO 1RK1A 2NY1D 5JOPD 2J8OA 4NYLA 1H6UA 3MV8D 4FKKA 1F4XH 1LD9B 5HHMD 3IJ7A 1YNTB 4G6FD 3OXSB 2YPLA 3JWDC 1JYWA 1LDPH 2A73A 5DQJA 3ZMRA 1S7UA 3C60D 4OLVH 4P5MB 2UUDK 2FJUB 2XQBH 4XB7A 2GFBB 4K3JH 5DZOA 4YDLC 4I48A 4PRBB 1NOAA 3QEQB 5K9KA 5L2KA 1FN4B 1F1AA 3AG1B 2ED9A 4XVOA 4G9DB 3OGOE 2YAFA 4L8SA 3MYZA 1JGEB 4KXAA 4AEIL 1HZKA 5GGSA 3TTYA 3DARA 3GI8H 2P45B 1QUNB 2EEXA 2Z93B 3VRIB 4Y4HD 2ZX6A 2V5SA 4JG0H 1RFDL 3FQ4A 2YGPA 2C1OA 2CDFA 4QOKE 4LBEB 2ZOLB 3Q0HA 2WINA 2XICA 4YDIH 1IQWH 2B14A 4RFEA 4BSJA 2WIIA 2EC8A 3MLSH 3NFPA 3BP4A 1WLHA 3VRLE 3E6FA 4HQQH 2R2EB 4JZNB 1BOYA 3WE6B 3W1ZA 3T2QA 4KHXH 1XIWC 4OM0H 1MQKH 4P9HH 4JS7A 4Y5VC 5GQBA 5LBSA 2N0MA 5EBLB 2BVEA 2NXZB 1SDDB 4HIHA 2Q86A 3LMJH 5CO1A 4OZFA 5H4YA 4F37K 2IQ9H 1ZLEA 2RIKA 4J1UB 4Q0XL 2VDML 3DVIA 2W0PA 3BKCH 5T33H 3JV0A 4JR9H 3D87B 2Y5TA 1XZ0B 3F7YB 3KJ4B 5DJ2A 4HS8L 3GM0A 3T09A 3V5KB 3VG0H 5JIPA 2FBJH 1QYGH 3QXTA 4F37F 5INDB 4KY2A 3QYCA 4DVRL 1IX2A 2MPAL 2JVUA 4Y4FD 4IRZH 5D6DA 3N43F 1JGDB 1BAFL 3TN0A 1TENA 3QYMA 2P43B 5KS9A 3QUYD 4YSTA 1ZLDA 2P8MA 5AVVB 4LCYB 5DMIH 3K6SA 5EU7C 4L3EB 4XVJL 1ZHKB 1CTOA 2JQAA 3L16A 2AV1A 3T4YB 5C0RL 5CFHA 4MA1B 2JJUA 3ZSTA 2E46A 3EH3B 1QVOB 5C0BE 3QUXB 2G0LA 4M7JH 4UT7L 4MX7B 4ISVA 2AXGA 2A77H 5SX4I 1MFAH 2F08A 3FAWA 4M3HA 1G7PB 3FTZA 1HYSD 1NEZB 3QDGE 3RPIA 2N59A 2NX5A 2UX6A 1Z3RA 4RIRA 1ND0A 4YDZA 4YL4A 1HXYB 1MJ8L 2MSPA 5I6XC 5I8EA 1ZOXA 1TU2B 3HZVB 3QUKB 3I3EA 4M56A 1Q9LB 2BK8A 1OAQL 4HT1L 1JZ4A 3B1TA 4AIZB 2W81C 3PWUA 4MJ6B 3II2A 2ZUQC 4X8JB 1S3KH 2FX9L 2IPUK 4LP4A 4N6RA 4ZFGL 5E00B 3DX0A 4KNUA 3ULVL 1N5YH 3GRGA 5H37H 4NWTL 4XMLL 4GLRH 1O5PA 3UAJD 3ORJA 1EO5A 3AC0A 1GJUA 4WJG3 4YHYB 4GBXB 2VN3A 4AIEA 2WQSA 4PB9L 5D4HA 4QKXB 2EQDA 3BXNB 3PNWA 3NIDB 5FC9A 3AJ7A 4JFSA 5TDOA 1B2YA 1G9ML 5I1KL 1EAPB 5FM8A 5EIVA 1WV7T 4JKKA 5E70A 2O26U 4PRPE 4IYKA 1RU9H 1SRDA 1LEKB 4FX5A 3EDKA 4UT9H 4XGZA 1RULH 3SPVB 2D7NA 1OB1A 2V9UA 2FK9A 4TUKL 3FSWA 5JR1L 5KANI 3PHQB 1M3IA 5C0BD 1RCYA 5DUMH 2XPZA 2HLFC 4B9CA 3UO1H 5FV1L 4DKFL 3MGTA 1MPAL 4RGMB 2XNAA 2PP7A 1BQ5A 1IBFA 4LPXA 2YK1H 4MWFB 4R97B 2C9RA 4XPFL 5HVHB 3U0TB 1KLUB 3QDGD 4WWKD 1MHPH 4ENED 5FHBH 5CLYA 4D0BB 4TKWA 5L8JB 4WFGD 5HYIA 1A02N 1T7XA 1LDSA 4MAYB 1L4IA 3UOAB 4Q4EA 1QLRB 2N0KA 1BP3B 2DQFA 2FAUA 3Q44A 2Q7AA 1C5CL 4MQXD 4OT1L 4ZMNA 4NZFA 1K4DB 4NKOA 5C09E 1CDYA 4HWNA 1NFKA 5AL8A 4CN6A 1MCWW 5DEGA 5D7LA 2VR7A 5IEKB 1XL6A 3U1QA 3F7QA 1J87A 4U3SA 4ODBD 4OH2A 4XNMB 3UBXI 4BKLA 3H54A 1YZZA 2WOYA 5TFSH 3RURA 4FFYL 2B77A 4QTHB 5A43C 1AD0B 1QPPA 3MLYL 4MHHG 3FYIB 4ZO8A 1I1AB 3S7GA 3UAEA 4N5EC 2DWEA 4G59C 1BFVL 3X14A 3FCSB 5CEZD 5FFOA 4PRPD 1UXSB 2ORBL 4YNYA 5LBSH 2OSLB 5E9DA 4KUCD 4I2XB 1VGEH 4UT6A 1ZHLA 4IGBB 3VQ2C 1A7QL 1EHNA 4DZBA 3EDJA 3F12A 4PJGF 3UGEA 2WQWA 3ABZA 4N9OB 1G7LB 4ZDHB 3RVXC 2GTQA 4OJFH 1U8HA 5FLVA 2GKIA 1T89C 4DP4X 4F5CA 4ZK8A 1J1XL 2YLHA 4FOMA 3AQDA 4WKZA 1MCOL 1MEXL 1YUHB 3NIGF 1MIEH 3K80A 4UB0H 2ADFH 2WYTA 3KMDA 3NTCL 3GUTB 3DMMB 4I8DA 2DIAA 2J2ZA 4NN6C 1PF3A 3V5HB 5IBTH 1MAMH 1OTUD 2DQGL 1XB3A 2ICEC 3VQLA 2O61B 1PG7H 4NPKA 2JIXB 4FDWA 3SKNB 5H2BA 1KYOK 4LRNL 4UAOC 1FL5B 1B88A 3MDJA 4F7EB 2CLZA 1CDCA 3RDTA 4WJ5B 3RTLA 5C09D 1Q72L 4HJGA 5DJYB 5DXWA 4H1LH 5T3ZH 4TUOB 3B5TA 3PQYD 4M61A 3O11A 2DEWX 1KN2L 5JQ6L 4WK0B 3OVUB 4EZMA 1FIGH 3IFOB 2MCMA 3ISYA 4HKZA 5DYOB 4FQ1L 5EIIB 2R29A 4M7ZC 5JHBA 4DFIA 1AZCA 2MOGA 3VD5A 2WXRA 1ADQH 1C5DA 3L1FA 4P57B 1T66C 4PJFE 3VXRD 1OT1A 1U3NA 3KGTA 5KW9L 4Y8DC 1G84A 4HPHA 4Y5XC 5DJZB 3MLUL 1D5ZA 4JY6A 5FYJU 1VESA 5TDNA 3LS4L 4EZJA 5TE4L 2WWNA 4KUZH 1WA1X 1CQYA 1HHIB 1VFBA 4JCMA 1BFOA 1DEEB 5B1KA 3X3GL 5IOPB 4IRJD 1BVZA 4BD4A 1NDTA 4XN5A 5FUOH 2PPDA 1LDPL 2XXGA 5KVMC 3F7VB 4X0KB 2XJLA 4OLVL 2J5LB 3HRZC 5CMAA 4HUXA 5T1DH 4IBSA 3WS3A 1W8OA 3MX0A 3S36H 2V2WA 1DL7L 2Y1ZA 2JLPA 3V52H 3X12A 3QC6X 4MXQD 2E7MA 4X80L 2F15A 2ZG2A 3ULVC 3RX7A 5C92A 4Q97A 2VW6A 1I8AA 5KOMC 3UZEC 5CF3A 4I18B 4MNQA 1KDIA 3FFCD 4WEUD 3BAKA 2ZOOA 1UD6A 3VXSA 2CZNA 4JG0L 4S1QL 5HDBE 4PHZA 4U1SB 4RNRA 5F3BA 1AZUA 3US9A 4M5YH 2X09A 3WKMH 2KPNA 4QHMA 2LLNA 4MMXC 3L4UA 2A83B 4PRAB 2CNZA 4HV8B 2GBUA 4DPRA 1M7XA 4YDIL 1IQWL 1G9MC 1KCVH 4HUVB 1M9WA 4OQ1A 2QBWA 4BRJA 5MEQA 1H8OA 4AC2A 4TLUA 4CN1A 4HQQL 1KYOJ 4NRZA 3ZTNH 3HB3D 1JFQH 2EIZB 2LTQB 1B0RB 1BF2A 1V3JA 2XJKA 1I9RH 5TF0A 4OM0L 1MQKL 4P9HL 4MDJA 3L3KB 3AABA 4ODTH 3B3IB 5ICXA 7FABH 1G6RL 2IANE 3O6FA 3LD8C 2FEJA 3ELQA 1XGTB 2IQAA 3O2VH 1MCPH 4DPBX 3LMJL 4J3SA 2F8XC 2IQ9L 1OGAB 1ZA6B 3H42H 4ILDA 1Q1JH 5ESQB 3HMXA 1KB3A 4G3YH 1QO3B 1R5VA 5D1XE 5T33L 3M1BB 3RWDB 4JR9L 3FRPG 3TXAA 5T3ZE 3LKSB 3MV11 2FBJL 1QYGL 3W9DB 4JQVC 3QAQA 4R3SB 5CWSA 3B56A 3BN3B 1TNNA 1G94A 3MCYA 3WMSA 4D0DB 4IRZL 3M7OA 2IH3A 4Y4KA 3KLHC 2B08A 3FT1A 4P2QA 1VCAA 4DP7X 2MPVA 2JCCE 1TJGL 3O3EB 5AVUB 5J1AA 3U0PB 5EEXA 4Z7OB 4F27A 5DMIL 4UT6H 4EXPX 3VXPA 1JPTL 3ME0A 3V6OA 4PWIA 3MZTA 4BH7A 3HPLA 4X5XB 3KVPA 2ZCKH 1NCAL 4LCCC 4UQDA 3RPBA 1LO4H 4LNRA 2R1YB 4HFWB 4U31A 3J8F7 2A77L 1MFAL 2Z4TA 3HBQA 4RAUB 3WN5B 4LVHC 5J6SA 1HZHH 2ZXDA 4K7FB 5J56B 5FYKH 1RAMA 4WTQA 1E4HA 1VACB 2DTSA 4N24A 1EBAA 2HT3C 2XU9A 4GUPA 5AOZA 1XH3A 1ZA3A 2IWEA 2CJ3A 1G6VK 3REWB 1XHHA 4D8PB 4I3RH 3GSVB 4MAZA 3T5WA 3VXTB 4IOSA 1O6VA 4QUOA 4X6BB 2PYEB 3UTTA 5H94A 4U3HA 1S3KL 1JPGB 4X7TA 3RJDA 5D1XD 3HC0A 1N5YL 3GSXA 2B16A 3X13B 4PJEA 1C7TA 4AZUA 3OKKB 5FB8A 4G72B 4GRLD 3LQZA 4HGWA 3RJQB 3SDAB 5LAXB 4NO0D 4E36A 1A66A 5CUSL 1CLCA 3FF8A 3C6LA 1HSAA 4ODUA 4IW4C 3GB7B 4M4PA 3AWEA 2DJSA 3BVWA 1D9KB 5IMOB 3KYMB 1YEFH 3APDA 3OR6A 5EC1A 4DPCX 5CKAA 4DTGL 4OIBA 1WBYA 4PJDA 4X98A 3SCMD 1M05A 4GAYB 4UT9L 5T8IA 3D4ZA 1S7WB 3GMOA 3QJQB 3ROOB 4ELME 2GBVA 1BREA 5DUML 3GJFH 1XGRB 3QHFH 3UO1L 3IS1X 4PTTB 1FC1A 2ZYHA 3F05A 3EJUA 1A3LL 4XP6H 2YK1L 4YAQA 5HVGB 4R8WL 2PO6A 4X5WA 2QADB 5SWZB 5ISZA 2ZUTA 2Z4QA 1QHPA 2ZE0A 5EOQH 3PP3K 1ROCA 1IFGA 1XR8B 3CDGA 2DQEH 5AW0B 4ZSOE 1Z9LA 1AGDB 3L13A 3IRPX 2Y23A 3K71B 2GUYA 4MD4A 2R27A 1XF1A 4LCVA 1JS4A 2CKBB 4ABUA 3ZGIA 2VUOA 3T77B 2QPDB 1MFCL 1J5CA 2ZAHA 3A67H 4DUVA 1AS8A 4OBSA 1BXVA 1YN6B 2DBJA 1O6TA 2EAEA 4LGRB 5TFSL 4NAMA 1LNUB 2Y1VA 3CBKB 2BIIA 3EW3B 1IZKA 15C8H 2X6UA 4RX4A 3L9YA 4N0UE 3IT8D 2V7NA 1CT8A 2ESVB 4FEIA 4DP1X 2QSVA 4E9WA 2ZUXA 4NZRH 5FA4B 4X9HA 5EU6D 4QRSB 1GH7A 5LBSL 3ZE0F 5AFAA 1UUSA 2QQNH 4S0HA 1VGEL 3NFNA 2IXQB 3VB8A 1ZSDA 2DLIA 2RHEA 4WGWB 4GG6E 5DSCB 4KK9D 3KZ8A 4P9HC 3ZT5A 1DVUA 2N7BA 5FYKE 4IRSD 4K9EH 4OJFL 1LO5B 5I16A 2ZWNA 1KC5H 1QFHA 3D2UB 5BZXA 3IGLA 5I0DA 3UP6A 2BY1A 3FQRB 3ZE1F 5HHOB 3HMXH 3UP1A 5I23A 5HYJE 5LNDA 3U2JA 2VISA 2ADFL 3WUWG 1W0WA 3ARQA 4ZUUB 1WZKA 3GT6A 4QAMB 4U0RC 5TH2B 4HJ0C 4QRPB 4WHTA 5IBTL 3T08A 1OOAA 1MAML 4AMKH 1PG7L 1JP5A 2O5XH 5FO9A 3PP3H 5B1CA 5KJRH 3P02A 2YGVA 3MV7B 4PJEF 3F85A 2G2RA 4FTVE 4WF7A 1T1XB 3TEUA 1OSZB 3WTTA 4PJXA 1OPGH 1TQSA 2AW2A 1WSST 3GIVB 3MGOB 4DEPC 3V6ZB 1I1CA 2FHFA 3EBAA 3FO2A 5F88B 1FVCA 1J8SA 5JIIA 1I1YB 5G55A 1CICB 3O2WL 4H0LC 4QRRA 3KLQA 1XAUA 3TA3C 4ZOCA 5IBLC 4BWTA 4M8UA 1U0QA 4ZXBC 2DEXX 4KKAC 5F0LB 3L3GB 2CR3A 4KUZL 2GCYB 4U7MA 1NGXA 3S4SG 3DX4A 3L3IA 3ZHKA 3FQXA 4Z76A 3P40A 5CBAA 3MRRB 4DSYA 1XCWA 5FUOL 4LHUA 3IBEA 4K07A 2LGNA 4FABH 5BNXD 5IFHH 3ZPDA 4TTGA 5CN3A 3BSHA 2F8OA 5AW1B 3FTUA 4X4XB 4U4IA