2DWZB

Structure of the oncoprotein gankyrin in complex with s6 atpase of the 26s proteasome
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
73
structure length
73
Chain Sequence
b'MDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 26S proteasome non-ATPase regulatory subunit 10
publication title Structure of the Oncoprotein Gankyrin in Complex with S6 ATPase of the 26S Proteasome
rcsb
source organism Mus musculus
molecule tags Oncoprotein
total genus 30
structure length 73
sequence length 73
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dwzB00
4LRTA 1E94E 2C99A 4GITA 2CEAA 2FNAA 5DYGA 4FCVA 3VLFB 3B9PA 3H4MA 3HU1A 1HT2E 4D82A 2C98A 5FTMA 2V6ZM 4LRSA 1IN6A 2R62A 3HU2A 1W5SA 4ZPXA 3ZH9B 4KLNA 4Z8XA 1J7KA 3SYLA 2DZNB 4KODA 2CHGA 2X8AA 2ZAOA 5EP3A 3AJIB 1NJGA 3KW6A 5DYIA 1NY5A 3GLGB 1NVMA 2DWZB 4LJ5A 3EIEA 4FD2A 4LY6A 3PXGA 1C1KA 1G41A 5C18A 1HQCA 4QOSA 5EP1A 1IM2A 3D8BA 2DHRA 1SXJD 4QHTA 4D81A 3GLGA 1NY6A 3WHKA 5FTLA 3U5ZB 1IXSB 1OFHA 1KYIA 3R8FA 2Z4RA 4LGMA 2Z4SA 4QNRA 1S3SA 2ZAMA 3EIHA 1XXHB 3PFIA 4LJ7A 1IN7A 1R6BX 3GLHA 2DZOB 2BJVA 5EP2A 4D80A 1OFIA 2DVWB 3KDSE 4FCTA 2R65A 4L4UA 1SXJC 1G3IA 1XXHA 1L8QA 1IXRC 2ZANA 3M6AA 2QZ4A 3MHVC 4I4LA 3U60B 1DO0A 4LZZA 3HU3A 5EXSA 2KRKA 1HT1E 1SXJE 1LV7A 1IN8A 1IN5A 3GLHB 5EXTA 3PVSA 2CHVA 2C96A 2C9CA 3UK6A 5FTJA 1QVRA 1NSFA 3CF0A 4FW9A 5EQTA 4I81A 1HQYE 3CF2A 4FWDA 4LJ6A 3VFDA 1NJFA 1IXZA 2V1UA 3HWSA 2BJWA 1IY0A 4LJ4A 3SYKA 5FTKA 4LCBA 5EXXA 1UM8A 1SXJB 4QHSA 4KO8A 1JR3D 2QENA 4WW0A 1D2NA 2XSZD 1E32A 5JI2E 1XWIA 3DZDA 4FWHA 1DO2A 4JN6A 5FTNA 3BOSA 3SC3A 2CHQA 3GLIB 4LJ8A 5C1BA 1SXJA 3M0EA 4QNMA 3GLFB 1G4AE 1QZMA 5EXPA 4EIWA 1JQJC 1R7RA 2RKOA 1FNNA 1X37A 1IY2A 5JI3E 1OJLA 2VIIA 1IQPA 2QPAA 5EP4A 2QBYB 3WHLA 1IY1A 4A3VB 3GLIA 4L16A 1KSFX 2CE7A 2HCBA 1IN4A 3K1JA 3GLFA 1W5TA 3U61B 2QP9X 4FWGA 1JR3A 4LJAA 2XSZA 4LJ9A 2QBYA 4FCWA 2C9OA 4L15A
chains in the Genus database with same CATH superfamily
1QAQA 2LVOC 3M7GA 4REZA 1P3QQ 1R4GA 1VEGA 4MGHA 3MJ5A 2VF8A 4JI7M 3AV0A 1EFUB 3KVWA 3KFUG 2N35A 5ITUA 1MU5A 2R6FA 3U6OA 1QZEA 3HU1A 1HT2E 4DUZM 5F3WA 2CUZA 4QOZC 2XFTA 4JYAM 4DR2M 4ZPXA 2DHYA 1WHCA 4HLQA 4OVZB 1SG9A 3ZC7B 2BWBA 3ILKA 5IREB 1V34A 1WXQA 2MGWA 2CHGA 3K92A 4HL4A 4WURA 2ERCA 3TE6A 1NJGA 2LVPC 3CF6E 5DYIA 1NNJA 2L4FA 3F92A 2KRUA 1NO1A 5E6JA 4PD2A 4CIZA 2DWZB 4DV5M 5IT9S 3L28A 3EIEA 4FD2A 2UU9M 2L2DA 2FFJA 3QAUA 1PJSA 2J5YA 3TPZA 1IM2A 4B7HA 2DHRA 1SXJD 4X64M 4AQYM 1L2BA 3E21A 4K0KM 3THGA 2RGOA 1YE9A 1KYIA 4JI6M 1QUTA 3PNVA 4LGMA 4AI6A 3A45A 5IWAM 4JI5M 2WZJA 2YR0A 2CV2A 1XXHB 1GO5A 4G4NA 3GLHA 2F5PA 3IG5A 2JXNA 5EP2A 4DV4M 4LF6M 1VG5A 4AG6A 2R65A 1GL6A 3T1YM 1N77A 4NXNM 4DR6M 1XXHA 5ITYA 4P16A 2I7PA 1WGLA 2O25A 1J5EM 4B3TM 2G5GX 1VDDA 2KZSA 3FRIA 4XK8F 1DGBA 1OAIA 4II7A 4UN2B 1VDLA 2DENA 1EE8A 3CGWA 3HU3A 5EXSA 4ITQA 3GPPA 1LV7A 5ITXE 1WGNA 1IN5A 2ZTCA 4IBKA 2GNOA 1KFVA 2YQZA 4DR4M 3PVSA 1IFYA 3TL4X 4Q7JA 1QVRA 3CF0A 1Q02A 4BB9A 1XMQM 1OKSA 2FS1A 3HX3A 3AOEC 3HWSA 3SYKA 3HHXA 1BVSA 4G3OA 4LJ4A 5FTKA 4RNAA 4IIWA 1SXJB 4M0DA 4QHSA 3KOYE 1WIVA 4KO8A 1E9RA 1ZMVA 2XSZD 1F4IA 2F5QA 2XH9A 4DV6M 3LQQA 2VDBB 3BOSA 3HGIA 3U6DA 3SC3A 1D0LA 4MM3B 1D0MA 3VK8A 1SXJA 2F5OA 2EUCA 1G4AE 5EXPA 3C58A 3GRUA 3GRYA 5H37D 3UZUA 3FYDA 4IBJA 3U6EA 4XGIA 2XFSA 2JUJA 5L8RF 3B74A 1WJ7A 2HAKA 1QANA 2BWEA 4L16A 5FSWA 3I01M 2HCBA 4LGYA 2LWXA 1DGGA 3GLIE 4AG5A 2W82A 2DWNA 1GJTA 1VQ1A 2KNVA 1WR1B 2CP8A 4GRIA 1XHBA 4MGZE 2YNMD 5KPRA 4KT0F 1N36M 2ZTDA 3MK6A 3AJIB 4X62M 2EO2A 2FH0A 2OOAA 2UUBM 3HHWA 1E94E 2C99A 4M9XA 3L26A 2CEAA 2QSFX 4LG2A 1TGUA 5DYGA 2CRUA 2OOBA 3U6LA 3T6PA 3FUVA 2APLA 3H4MA 4JI0M 3L29A 3W68A 3T1HM 1TR8A 1GL7A 1HJPA 2XGNA 3LVWA 4DR5M 2XZUA 2L6OA 2F5SA 2LH0A 1A5TA 5FTMA 3FRHA 4JI4M 3V76A 4KLNA 1IBLM 1Z6TA 2HWJA 1J7KA 2JP7A 2JY6B 3LMMA 3SYLA 3SHFA 3SBJA 3T38A 5EP3A 4R7GA 4IJEA 2DXIA 2LBCA 1NY5A 3GLGB 2L09A 5ITTA 2LHCA 3A42A 2MR9A 2DNAA 4DR1M 1XXHE 3PXGA 1H6UA 1Q3BA 2GQFA 4G4RA 5EP1A 4F1IA 5BR8M 4YHHM 1OIPA 4QHTA 4AZFA 4D81A 3LCUA 3GLGA 2YFQA 1ORYB 3WHKA 3U5ZB 2CV0A 1OFHA 1N34M 1LTMA 3Q8XA 3GQ5A 5LMUM 3AOGA 4QNRA 2ZAMA 3R9XB 2JY5A 3EIHA 4MB7A 2R4JA 2Y0TA 4AKIA 2UXBM 1R5LA 4R3DA 4ANRA 2ZM6M 3U5ZA 4F2LA 1DGHB 3SAWA 4L4UA 3T15A 1GJSA 4G4QA 2G3QA 2KXEA 1G3IA 4NXMM 4GKJM 2DAIA 4B08A 3HKPA 3KOXE 1Z59A 3FUTA 2QZ4A 2J7NA 3TQSA 3FTEA 2HL7A 2LVQD 1AUAA 3OTOM 4LZZA 1DGHA 3MMPA 3NBIA 4B3SM 1R2YA 1GVNA 2KRKA 3CTWB 1SXJE 1IN8A 3GLHB 4GMQA 3K9OA 3RE8A 4DV3M 1HR0M 3FTFA 1QQWA 4GKKM 4CHTB 4IJFA 1NSFA 5EQTA 1E9SA 1HQYE 2XLJA 2JY7A 2R4EA 4LJ6A 3NBXX 2DWMA 1NJFA 1G59A 4LF8M 2V1UA 2BJWA 3I04M 4HEOA 3IG8A 3JAMS 2F5NA 2ZBKB 2KDLA 5KO3A 2Y21A 4R71A 2UUCM 4NC6A 3LW5F 4DV0M 1XWIA 1N32M 4JN6A 1HNWM 2UXDM 3U61A 1OQYA 3FKEA 1DGFA 2CHQA 3W0FA 2QNJA 1L1ZA 4PDIA 1R2ZA 3GLFB 3GRVA 4EIWA 1QYRA 1JQJC 1VEJA 1X37A 4NL4H 2OPFA 2K6BA 2VIIA 3RFWA 3SASA 2FOIC 2KA6B 3DOAA 2J7OA 4FVMA 5EP4A 1ZMWA 3VK7A 1GKIA 2K9DA 3L27A 5KPTA 1PGYA 3QYEA 3K1JA 4DV7M 3PNYA 3GLFA 3U6PA 1PJJA 2CV1A 3J7AS 4GHAA 3B7ZA 5KPZA 3U6SA 4GC5A 4LZJA 1XNRM 1L1TA 4JI8M 3NWLA 4JXJA 4IBCA 5ITRA 1TTEA 2D7EA 3J81S 3RGPA 3AOEA 1Z5AA 4JI2M 1I94M 3JR5A 3D8LA 3FUWA 4GITA 3GPYA 1HNXM 3SATA 2JA2A 3KP0E 1XB2B 3UMMA 1TH4A 2DI0A 1YSYA 2OQ4A 4M0WA 2UUAM 2DAKA 3GLGE 5KQ8A 3KOZE 4G4OA 1TH3A 1IBMM 2C98A 4LRSA 1PM5A 2K47A 2R62A 1D0KA 1VEKA 1W5SA 2EKFA 3BBZA 3FUXA 2DAEA 1YUBA 4Z8XA 1GLNA 3K8ZA 2QQ8A 2HHHM 4KODA 2X8AA 2ZAOA 1T43A 2P5TA 4M9ZA 2R18A 1QDRA 4IBDA 2E5LM 4IBFA 4YY3M 2EA0A 3B7NA 1NHGC 4IBGA 2H5XA 1NVMA 4DR3M 3FTCA 4XBOA 5LMNM 4NRVA 2L7IA 3I4YA 2Z3XA 4LY6A 2Z8YM 3SARA 4GEWA 3SMSA 4WP2A 5IZ7D 2VQFM 3VDPA 8CATA 4AKHA 2JNHA 2D7HA 4DUYM 3GPUA 1NY6A 4B7FA 3SAUA 1AIPC 1IXSB 3BXWA 3LCVB 3R8FA 3IHPA 3FUUA 1GABA 2DZLA 4AW4A 3U6CA 1Y8GA 2QCUA 3H4JA 1OIZA 1V92A 4LJ7A 1IN7A 1R6BX 4Y28F 4Z6YA 3U6QA 1Z5BA 2KEBA 4D80A 1IXSA 2M5ZA 3LVVA 2DKLA 2DVWB 3GLHE 1PJIA 4OU7A 2XEPA 1IBKM 3UGJA 1MN3A 3A98B 3E9SA 3DA1A 1PJQA 2LXEA 1CUKA 1QDTA 3LQRA 1IXRC 2ZANA 3M6AA 3VKGA 2KNAA 1V33A 3GO8A 4MGKE 4JI3M 1XMOM 1L2DA 4DR7M 2JY8A 5DFLA 1G8PA 2C5RA 2WSCF 1NV9A 3JR4A 2LVNC 4L15A 5EXTA 3J80S 1T3TA 2CHVA 3HY5A 4LF9M 2A5YB 1EIJA 5FTJA 3SHGB 1NHWC 1XNQM 1MX0A 1J09A 3AFHA 2Y0QA 3C3EA 3K9PA 1QAMA 2EJSA 3CF2A 4FWDA 2QHOB 1IXZA 2CFOA 4BBAA 2K0BX 1T6OA 1IY0A 3GLFE 3L25A 4LCBA 1UM8A 4RF1A 1TDZA 2QENA 3QWLA 4WW0A 5GKNA 1L2CA 1E32A 1JB0F 3DZDA 4FWHA 4IBBA 1DO2A 2LNHC 2L4EA 1N75A 4L78A 3GQ3A 4B3RM 1NNUC 2R45A 3GLIB 5C1BA 3C9PA 3A46A 3I51A 3M0EA 4QNMA 1R7RA 3TWKA 1FNNA 5ITQA 1IY2A 3J7BA 2XF3A 4I5SA 1IQPA 4LF7M 2QPAA 3QYBA 3WHLA 2V1CA 1IY1A 3GLIA 3IECA 4AKGA 1KSFX 1NV8A 1IN4A 2JZ0A 3W67A 3Q8GA 2JZ1A 2Z7JA 1N33M 1W5TA 3U61B 2QP9X 2R46A 4MH0E 5EJCA 4FWGA 1JR3A 2FE8A 3KXEC 4MGIE 3GPXA 2X4AA 3U6MA 4LJ9A 3KP1E 4OVZA 2MH8A 1IN6A 4FCWA 4G6ZA 4GH9A 2I7NA 1OAOC 1YLAA 4LRTA 2WSEF 3SAVA 2UXCM 3B7QA 2FNAA 1Q39A 4GC9A 2MJ5B 1K82A 4X65M 4FCVA 3E4RA 3FE3A 4M9SA 2VF7A 3VLFB 3HHZA 3B9PA 4NSRA 2DAGA 3KOWE 4D82A 3SFZA 2O5RA 1K3XA 2V6ZM 3ZH9B 2CWBA 3HU2A 7CATA 4DV2M 3VDUA 1Z5CA 2DZNB 2VQEM 4OX9M 4JV5M 2MROB 3KW6A 2Y20A 4W5WA 3J2PB 4LJ5A 3HHYA 4B7GA 4LFAM 1C1KA 5BPVA 1G41A 4S12A 3W0LB 1TDHA 5C18A 3KS8A 1HQCA 4QOSA 3D8BA 1TH2A 3KSXA 1N78A 1ZV1A 4LF4M 4RKUF 4IBIA 5FTLA 3ZCBB 3GQ4A 3VKHA 4CISA 2Z4RA 3E46A 2Z4SA 3HJSA 4OW0A 4LF5M 1S3SA 4PDGA 3PFIA 5A2QS 3KSJA 2DZOB 2BJVA 2KZUA 3UJNA 3GRRA 3SMPA 2Q2EB 4B3MM 1OFIA 1RU3A 2KW0A 3KDSE 4LFBM 4FCTA 1XC8A 3TWMA 1SXJC 2HKJA 5E26A 2LHGA 2M60A 3GP1A 1Q3CA 1L8QA 4L6V6 4P17A 4L8RC 2DAMA 3MHVC 4I4LA 2RGHA 2KHHA 4MGYE 1PJTA 2G8LA 3U60B 1DO0A 4BLCA 3HZJA 3B89A 2F4VM 1HT1E 1OTRA 2WSFF 5FLXS 1TF0B 1K3WA 4DBGB 2C96A 4NOOB 2C9CA 4GHLA 3UK6A 2H1RA 2KNZA 1MJGM 1PRBA 3FTDA 4FW9A 2DWLA 4JI1M 1ZQ9A 2EKKA 1UFZA 4I81A 3U60A 4NSOB 4X66M 3AKZA 1QAOA 4RF0A 2R0IA 3VFDA 2JWSA 2X49A 1FJGM 3HJQA 3TWLA 5EXXA 2XZFA 1JR3D 2NQ8C 4PCZA 3RGSA 1D2NA 1JR3E 4CGYB 2D7GA 5JI2E 3HJ8A 4I8OA 3J27B 1I4WA 5FTNA 4CJ6A 1G71A 5DNYA 1C7YA 4IBEA 4NRWA 4KHPM 2B3TA 4GIPA 4LJ8A 2OO9A 5ITXA 1QZMA 2RKOA 2LTUA 2RRUA 1DV0A 3KS4A 4TUWA 5JI3E 1QUSA 1OJLA 4PT5A 1ZMUA 5KQDA 3FD9A 2LVAA 1HNZM 3ZQJA 2O01F 2QBYB 4A3VB 3AL0C 2CE7A 2L7HA 3DFZA 3I4VA 3C3DA 2R44A 3L2AA 2AHMA 4DV1M 4LJAA 2XSZA 4LFCM 3K2LA 2QBYA 2C9OA 1ZAEA 2BNKA 3FYCA
chains in the Genus database with same CATH topology
1QAQA 3M7GA 4REZA 4MGHA 3MJ5A 4JI7M 3AV0A 3KVWA 3KFUG 5ITUA 1MU5A 3U6OA 3HU1A 1HT2E 4DUZM 5F3WA 2CUZA 4QOZC 2XFTA 4JYAM 4DR2M 4ZPXA 4HLQA 4OVZB 3ZC7B 3ILKA 5IREB 1WXQA 2CHGA 3K92A 4HL4A 4WURA 2ERCA 3TE6A 1NJGA 3CF6E 5DYIA 1NNJA 2KRUA 5E6JA 4PD2A 2DWZB 4DV5M 5IT9S 3L28A 3EIEA 4FD2A 2UU9M 2FFJA 3QAUA 3TPZA 2F5SA 4B7HA 1IM2A 4AQYM 2DHRA 1SXJD 4X64M 4K0KM 1L2BA 3THGA 2RGOA 1YE9A 1KYIA 4JI6M 3PNVA 4LGMA 4AI6A 3A45A 5IWAM 4JI5M 2YR0A 2CV2A 1XXHB 4G4NA 3GLHA 2F5PA 3IG5A 5EP2A 4DV4M 4LF6M 4AG6A 2R65A 1GL6A 3T1YM 1N77A 4NXNM 4DR6M 1XXHA 5ITYA 4P16A 2I7PA 1J5EM 4B3TM 2G5GX 1VDDA 2KZSA 1DGBA 4II7A 3HU3A 1EE8A 5EXSA 4ITQA 3GPPA 1LV7A 5ITXE 1KFVA 1IN5A 4IBKA 4DR4M 2YQZA 3PVSA 3TL4X 1QVRA 3CF0A 4BB9A 1XMQM 3AOEC 3HWSA 3SYKA 3HHXA 4LJ4A 5FTKA 4RNAA 4IIWA 1SXJB 4M0DA 4QHSA 3KOYE 4KO8A 1E9RA 2XSZD 2F5QA 2XH9A 4DV6M 3LQQA 3HGIA 3BOSA 3U6DA 3SC3A 4MM3B 3VK8A 1SXJA 2F5OA 2EUCA 1G4AE 5EXPA 3C58A 3GRUA 3GRYA 5H37D 3UZUA 3FYDA 4IBJA 3U6EA 4XGIA 2XFSA 1QANA 4L16A 5FSWA 2HCBA 4LGYA 2LWXA 1DGGA 4AG5A 2W82A 2DWNA 4MGZE 4GRIA 1XHBA 2YNMD 5KPRA 1N36M 3MK6A 3AJIB 4X62M 2EO2A 2UUBM 3HHWA 1E94E 2C99A 4M9XA 3L26A 2CEAA 4LG2A 1TGUA 5DYGA 3U6LA 3FUVA 3H4MA 4JI0M 3L29A 3T1HM 1GL7A 2XGNA 3LVWA 4DR5M 2XZUA 2L6OA 2LH0A 5FTMA 4JI4M 4KLNA 1IBLM 1Z6TA 1J7KA 3SYLA 3LMMA 3SHFA 3SBJA 3T38A 5EP3A 4R7GA 4IJEA 2DXIA 1NY5A 3GLGB 2L09A 5ITTA 3A42A 4DR1M 3PXGA 4G4RA 1H6UA 1Q3BA 5EP1A 5BR8M 4YHHM 4QHTA 4AZFA 4D81A 3GLGA 2YFQA 1ORYB 3WHKA 3U5ZB 2CV0A 1OFHA 1N34M 3Q8XA 3GQ5A 5LMUM 3AOGA 4QNRA 2ZAMA 3R9XB 3EIHA 4MB7A 2R4JA 2Y0TA 4AKIA 2UXBM 4R3DA 2ZM6M 3U5ZA 3SAWA 1DGHB 4L4UA 3T15A 4G4QA 2KXEA 1G3IA 4NXMM 4GKJM 4B08A 3HKPA 3KOXE 1Z59A 3FUTA 2QZ4A 2J7NA 3TQSA 3FTEA 2HL7A 3OTOM 4LZZA 1DGHA 3NBIA 4B3SM 1R2YA 1GVNA 2KRKA 3CTWB 1SXJE 1IN8A 3GLHB 4GMQA 3RE8A 4DV3M 1HR0M 3FTFA 1QQWA 4GKKM 4CHTB 4IJFA 1NSFA 5EQTA 1E9SA 1HQYE 2XLJA 2R4EA 4LJ6A 4LF8M 2DWMA 1NJFA 1G59A 2V1UA 2BJWA 3IG8A 3JAMS 2F5NA 2ZBKB 5KO3A 2Y21A 2UUCM 4DV0M 1XWIA 1N32M 4JN6A 1HNWM 2UXDM 3U61A 3FKEA 1DGFA 2CHQA 3W0FA 1L1ZA 4PDIA 1R2ZA 3GLFB 3GRVA 4EIWA 1QYRA 1JQJC 4NL4H 1X37A 2OPFA 2VIIA 3RFWA 3SASA 2FOIC 2KA6B 3DOAA 2J7OA 4FVMA 5EP4A 3VK7A 1GKIA 3L27A 5KPTA 4DV7M 3K1JA 3PNYA 3GLFA 3U6PA 1PJJA 2CV1A 3J7AS 4GHAA 5KPZA 3U6SA 4GC5A 4LZJA 1XNRM 1L1TA 4JI8M 3NWLA 4JXJA 4IBCA 5ITRA 2D7EA 3J81S 3RGPA 3AOEA 1Z5AA 4JI2M 1I94M 3JR5A 3D8LA 3FUWA 4GITA 3GPYA 1HNXM 3SATA 2JA2A 3KP0E 3UMMA 1TH4A 1YSYA 2OQ4A 4M0WA 2UUAM 5KQ8A 3KOZE 4G4OA 1TH3A 1IBMM 2C98A 4LRSA 1PM5A 2K47A 2R62A 1W5SA 3FUXA 1YUBA 4Z8XA 1GLNA 3K8ZA 2HHHM 4KODA 2X8AA 2ZAOA 2P5TA 4M9ZA 2R18A 4IBDA 2E5LM 4IBFA 4YY3M 2EA0A 1NHGC 4IBGA 1NVMA 4DR3M 3FTCA 4XBOA 5LMNM 4NRVA 2L7IA 3I4YA 2Z3XA 4LY6A 3SARA 3SMSA 5IZ7D 2VQFM 3VDPA 8CATA 4AKHA 4DUYM 2D7HA 3GPUA 1NY6A 4B7FA 3SAUA 1IXSB 3R8FA 3FUUA 3U6CA 4AW4A 2QCUA 4LJ7A 1IN7A 1R6BX 4Z6YA 3U6QA 1Z5BA 2KEBA 4D80A 2M5ZA 3LVVA 2DVWB 1PJIA 4OU7A 2XEPA 1IBKM 3UGJA 3A98B 3E9SA 3DA1A 2LXEA 3LQRA 1IXRC 2ZANA 3M6AA 3VKGA 3GO8A 4MGKE 4JI3M 1XMOM 1L2DA 4DR7M 1G8PA 2C5RA 3JR4A 4L15A 5EXTA 3J80S 1T3TA 2CHVA 4LF9M 2A5YB 5FTJA 3SHGB 1NHWC 1XNQM 1MX0A 1J09A 3AFHA 2Y0QA 1QAMA 3CF2A 4FWDA 1IXZA 2CFOA 4BBAA 1IY0A 3L25A 4LCBA 1UM8A 4RF1A 1TDZA 2QENA 3QWLA 4WW0A 5GKNA 1L2CA 1E32A 3DZDA 4FWHA 4IBBA 1DO2A 2LNHC 1N75A 4L78A 3GQ3A 4B3RM 1NNUC 2R45A 3GLIB 5C1BA 3A46A 3I51A 3M0EA 4QNMA 1R7RA 3TWKA 1FNNA 5ITQA 1IY2A 3J7BA 2XF3A 4I5SA 1IQPA 4LF7M 2QPAA 3WHLA 2V1CA 1IY1A 3GLIA 4AKGA 1KSFX 1IN4A 2Z7JA 1N33M 1W5TA 3U61B 2QP9X 2R46A 4MH0E 5EJCA 4FWGA 1JR3A 2FE8A 3KXEC 4MGIE 3GPXA 2X4AA 3U6MA 4LJ9A 3KP1E 4OVZA 4FCWA 1IN6A 4G6ZA 4GH9A 2I7NA 4LRTA 2UXCM 3SAVA 2FNAA 1Q39A 4GC9A 1K82A 4X65M 4FCVA 3E4RA 4M9SA 3VLFB 3HHZA 3B9PA 4NSRA 3KOWE 4D82A 3SFZA 2O5RA 1K3XA 2V6ZM 3ZH9B 3HU2A 7CATA 4DV2M 3VDUA 1Z5CA 2DZNB 2VQEM 4OX9M 4JV5M 3KW6A 2Y20A 4W5WA 3J2PB 4LJ5A 3HHYA 4B7GA 4LFAM 1C1KA 5BPVA 1G41A 4S12A 3W0LB 1TDHA 5C18A 3KS8A 1HQCA 4QOSA 3D8BA 1TH2A 3KSXA 1N78A 4LF4M 4IBIA 5FTLA 3ZCBB 3GQ4A 3VKHA 4CISA 2Z4RA 2Z4SA 3HJSA 4OW0A 4LF5M 1S3SA 4PDGA 3PFIA 5A2QS 3KSJA 2DZOB 2BJVA 2KZUA 3UJNA 3GRRA 3SMPA 2Q2EB 4B3MM 1OFIA 2KW0A 3KDSE 4LFBM 4FCTA 1XC8A 3TWMA 1SXJC 2HKJA 5E26A 2M60A 3GP1A 1Q3CA 1L8QA 4L8RC 3MHVC 4I4LA 2RGHA 4MGYE 2G8LA 3U60B 1DO0A 4BLCA 2F4VM 1HT1E 5FLXS 1K3WA 2C96A 4NOOB 2C9CA 4GHLA 3UK6A 2H1RA 3FTDA 4FW9A 4JI1M 2DWLA 1ZQ9A 4I81A 3U60A 4NSOB 4X66M 3AKZA 1QAOA 4RF0A 3VFDA 2X49A 1FJGM 3HJQA 3TWLA 5EXXA 2XZFA 1JR3D 2NQ8C 4PCZA 3RGSA 1D2NA 4CGYB 2D7GA 5JI2E 3HJ8A 4I8OA 3J27B 1I4WA 5FTNA 5DNYA 4IBEA 4NRWA 4KHPM 4GIPA 4LJ8A 5ITXA 1QZMA 2RKOA 3KS4A 4TUWA 5JI3E 1OJLA 4PT5A 5KQDA 3FD9A 1HNZM 2QBYB 4A3VB 3AL0C 2CE7A 2L7HA 3DFZA 3I4VA 3L2AA 2AHMA 4DV1M 4LJAA 2XSZA 4LFCM 3K2LA 2QBYA 2C9OA 1ZAEA 2BNKA 3FYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LRT A;  1E94 E;  2C99 A;  4GIT A;  2CEA A;  2FNA A;  5DYG A;  4FCV A;  3VLF B;  3B9P A;  3H4M A;  3HU1 A;  1HT2 E;  4D82 A;  2C98 A;  5FTM A;  2V6Z M;  4LRS A;  1IN6 A;  2R62 A;  3HU2 A;  1W5S A;  4ZPX A;  3ZH9 B;  4KLN A;  4Z8X A;  1J7K A;  3SYL A;  2DZN B;  4KOD A;  2CHG A;  2X8A A;  2ZAO A;  5EP3 A;  3AJI B;  1NJG A;  3KW6 A;  5DYI A;  1NY5 A;  3GLG B;  1NVM A;  2DWZ B;  4LJ5 A;  3EIE A;  4FD2 A;  4LY6 A;  3PXG A;  1C1K A;  1G41 A;  5C18 A;  1HQC A;  4QOS A;  5EP1 A;  1IM2 A;  3D8B A;  2DHR A;  1SXJ D;  4QHT A;  4D81 A;  3GLG A;  1NY6 A;  3WHK A;  5FTL A;  3U5Z B;  1IXS B;  1OFH A;  1KYI A;  3R8F A;  2Z4R A;  4LGM A;  2Z4S A;  4QNR A;  1S3S A;  2ZAM A;  3EIH A;  1XXH B;  3PFI A;  4LJ7 A;  1IN7 A;  1R6B X;  3GLH A;  2DZO B;  2BJV A;  5EP2 A;  4D80 A;  1OFI A;  2DVW B;  3KDS E;  4FCT A;  2R65 A;  4L4U A;  1SXJ C;  1G3I A;  1XXH A;  1L8Q A;  1IXR C;  2ZAN A;  3M6A A;  2QZ4 A;  3MHV C;  4I4L A;  3U60 B;  1DO0 A;  4LZZ A;  3HU3 A;  5EXS A;  2KRK A;  1HT1 E;  1SXJ E;  1LV7 A;  1IN8 A;  1IN5 A;  3GLH B;  5EXT A;  3PVS A;  2CHV A;  2C96 A;  2C9C A;  3UK6 A;  5FTJ A;  1QVR A;  1NSF A;  3CF0 A;  4FW9 A;  5EQT A;  4I81 A;  1HQY E;  3CF2 A;  4FWD A;  4LJ6 A;  3VFD A;  1NJF A;  1IXZ A;  2V1U A;  3HWS A;  2BJW A;  1IY0 A;  4LJ4 A;  3SYK A;  5FTK A;  4LCB A;  5EXX A;  1UM8 A;  1SXJ B;  4QHS A;  4KO8 A;  1JR3 D;  2QEN A;  4WW0 A;  1D2N A;  2XSZ D;  1E32 A;  5JI2 E;  1XWI A;  3DZD A;  4FWH A;  1DO2 A;  4JN6 A;  5FTN A;  3BOS A;  3SC3 A;  2CHQ A;  3GLI B;  4LJ8 A;  5C1B A;  1SXJ A;  3M0E A;  4QNM A;  3GLF B;  1G4A E;  1QZM A;  5EXP A;  4EIW A;  1JQJ C;  1R7R A;  2RKO A;  1FNN A;  1X37 A;  1IY2 A;  5JI3 E;  1OJL A;  2VII A;  1IQP A;  2QPA A;  5EP4 A;  2QBY B;  3WHL A;  1IY1 A;  4A3V B;  3GLI A;  4L16 A;  1KSF X;  2CE7 A;  2HCB A;  1IN4 A;  3K1J A;  3GLF A;  1W5T A;  3U61 B;  2QP9 X;  4FWG A;  1JR3 A;  4LJA A;  2XSZ A;  4LJ9 A;  2QBY A;  4FCW A;  2C9O A;  4L15 A; 
#chains in the Genus database with same CATH topology
 1QAQ A;  2LVO C;  3M7G A;  4REZ A;  1P3Q Q;  1R4G A;  1VEG A;  4MGH A;  3MJ5 A;  2VF8 A;  4JI7 M;  3AV0 A;  1EFU B;  3KVW A;  3KFU G;  2N35 A;  5ITU A;  1MU5 A;  2R6F A;  3U6O A;  1QZE A;  3HU1 A;  1HT2 E;  4DUZ M;  5F3W A;  2CUZ A;  4QOZ C;  2XFT A;  4JYA M;  4DR2 M;  4ZPX A;  2DHY A;  1WHC A;  4HLQ A;  4OVZ B;  1SG9 A;  3ZC7 B;  2BWB A;  3ILK A;  5IRE B;  1V34 A;  1WXQ A;  2MGW A;  2CHG A;  3K92 A;  4HL4 A;  4WUR A;  2ERC A;  3TE6 A;  1NJG A;  2LVP C;  3CF6 E;  5DYI A;  1NNJ A;  2L4F A;  3F92 A;  2KRU A;  1NO1 A;  5E6J A;  4PD2 A;  4CIZ A;  2DWZ B;  4DV5 M;  5IT9 S;  3L28 A;  3EIE A;  4FD2 A;  2UU9 M;  2L2D A;  2FFJ A;  3QAU A;  1PJS A;  2J5Y A;  3TPZ A;  1IM2 A;  4B7H A;  2DHR A;  1SXJ D;  4X64 M;  4AQY M;  1L2B A;  3E21 A;  4K0K M;  3THG A;  2RGO A;  1YE9 A;  1KYI A;  4JI6 M;  1QUT A;  3PNV A;  4LGM A;  4AI6 A;  3A45 A;  5IWA M;  4JI5 M;  2WZJ A;  2YR0 A;  2CV2 A;  1XXH B;  1GO5 A;  4G4N A;  3GLH A;  2F5P A;  3IG5 A;  2JXN A;  5EP2 A;  4DV4 M;  4LF6 M;  1VG5 A;  4AG6 A;  2R65 A;  1GL6 A;  3T1Y M;  1N77 A;  4NXN M;  4DR6 M;  1XXH A;  5ITY A;  4P16 A;  2I7P A;  1WGL A;  2O25 A;  1J5E M;  4B3T M;  2G5G X;  1VDD A;  2KZS A;  3FRI A;  4XK8 F;  1DGB A;  1OAI A;  4II7 A;  4UN2 B;  1VDL A;  2DEN A;  1EE8 A;  3CGW A;  3HU3 A;  5EXS A;  4ITQ A;  3GPP A;  1LV7 A;  5ITX E;  1WGN A;  1IN5 A;  2ZTC A;  4IBK A;  2GNO A;  1KFV A;  2YQZ A;  4DR4 M;  3PVS A;  1IFY A;  3TL4 X;  4Q7J A;  1QVR A;  3CF0 A;  1Q02 A;  4BB9 A;  1XMQ M;  1OKS A;  2FS1 A;  3HX3 A;  3AOE C;  3HWS A;  3SYK A;  3HHX A;  1BVS A;  4G3O A;  4LJ4 A;  5FTK A;  4RNA A;  4IIW A;  1SXJ B;  4M0D A;  4QHS A;  3KOY E;  1WIV A;  4KO8 A;  1E9R A;  1ZMV A;  2XSZ D;  1F4I A;  2F5Q A;  2XH9 A;  4DV6 M;  3LQQ A;  2VDB B;  3BOS A;  3HGI A;  3U6D A;  3SC3 A;  1D0L A;  4MM3 B;  1D0M A;  3VK8 A;  1SXJ A;  2F5O A;  2EUC A;  1G4A E;  5EXP A;  3C58 A;  3GRU A;  3GRY A;  5H37 D;  3UZU A;  3FYD A;  4IBJ A;  3U6E A;  4XGI A;  2XFS A;  2JUJ A;  5L8R F;  3B74 A;  1WJ7 A;  2HAK A;  1QAN A;  2BWE A;  4L16 A;  5FSW A;  3I01 M;  2HCB A;  4LGY A;  2LWX A;  1DGG A;  3GLI E;  4AG5 A;  2W82 A;  2DWN A;  1GJT A;  1VQ1 A;  2KNV A;  1WR1 B;  2CP8 A;  4GRI A;  1XHB A;  4MGZ E;  2YNM D;  5KPR A;  4KT0 F;  1N36 M;  2ZTD A;  3MK6 A;  3AJI B;  4X62 M;  2EO2 A;  2FH0 A;  2OOA A;  2UUB M;  3HHW A;  1E94 E;  2C99 A;  4M9X A;  3L26 A;  2CEA A;  2QSF X;  4LG2 A;  1TGU A;  5DYG A;  2CRU A;  2OOB A;  3U6L A;  3T6P A;  3FUV A;  2APL A;  3H4M A;  4JI0 M;  3L29 A;  3W68 A;  3T1H M;  1TR8 A;  1GL7 A;  1HJP A;  2XGN A;  3LVW A;  4DR5 M;  2XZU A;  2L6O A;  2F5S A;  2LH0 A;  1A5T A;  5FTM A;  3FRH A;  4JI4 M;  3V76 A;  4KLN A;  1IBL M;  1Z6T A;  2HWJ A;  1J7K A;  2JP7 A;  2JY6 B;  3LMM A;  3SYL A;  3SHF A;  3SBJ A;  3T38 A;  5EP3 A;  4R7G A;  4IJE A;  2DXI A;  2LBC A;  1NY5 A;  3GLG B;  2L09 A;  5ITT A;  2LHC A;  3A42 A;  2MR9 A;  2DNA A;  4DR1 M;  1XXH E;  3PXG A;  1H6U A;  1Q3B A;  2GQF A;  4G4R A;  5EP1 A;  4F1I A;  5BR8 M;  4YHH M;  1OIP A;  4QHT A;  4AZF A;  4D81 A;  3LCU A;  3GLG A;  2YFQ A;  1ORY B;  3WHK A;  3U5Z B;  2CV0 A;  1OFH A;  1N34 M;  1LTM A;  3Q8X A;  3GQ5 A;  5LMU M;  3AOG A;  4QNR A;  2ZAM A;  3R9X B;  2JY5 A;  3EIH A;  4MB7 A;  2R4J A;  2Y0T A;  4AKI A;  2UXB M;  1R5L A;  4R3D A;  4ANR A;  2ZM6 M;  3U5Z A;  4F2L A;  1DGH B;  3SAW A;  4L4U A;  3T15 A;  1GJS A;  4G4Q A;  2G3Q A;  2KXE A;  1G3I A;  4NXM M;  4GKJ M;  2DAI A;  4B08 A;  3HKP A;  3KOX E;  1Z59 A;  3FUT A;  2QZ4 A;  2J7N A;  3TQS A;  3FTE A;  2HL7 A;  2LVQ D;  1AUA A;  3OTO M;  4LZZ A;  1DGH A;  3MMP A;  3NBI A;  4B3S M;  1R2Y A;  1GVN A;  2KRK A;  3CTW B;  1SXJ E;  1IN8 A;  3GLH B;  4GMQ A;  3K9O A;  3RE8 A;  4DV3 M;  1HR0 M;  3FTF A;  1QQW A;  4GKK M;  4CHT B;  4IJF A;  1NSF A;  5EQT A;  1E9S A;  1HQY E;  2XLJ A;  2JY7 A;  2R4E A;  4LJ6 A;  3NBX X;  2DWM A;  1NJF A;  1G59 A;  4LF8 M;  2V1U A;  2BJW A;  3I04 M;  4HEO A;  3IG8 A;  3JAM S;  2F5N A;  2ZBK B;  2KDL A;  5KO3 A;  2Y21 A;  4R71 A;  2UUC M;  4NC6 A;  3LW5 F;  4DV0 M;  1XWI A;  1N32 M;  4JN6 A;  1HNW M;  2UXD M;  3U61 A;  1OQY A;  3FKE A;  1DGF A;  2CHQ A;  3W0F A;  2QNJ A;  1L1Z A;  4PDI A;  1R2Z A;  3GLF B;  3GRV A;  4EIW A;  1QYR A;  1JQJ C;  1VEJ A;  1X37 A;  4NL4 H;  2OPF A;  2K6B A;  2VII A;  3RFW A;  3SAS A;  2FOI C;  2KA6 B;  3DOA A;  2J7O A;  4FVM A;  5EP4 A;  1ZMW A;  3VK7 A;  1GKI A;  2K9D A;  3L27 A;  5KPT A;  1PGY A;  3QYE A;  3K1J A;  4DV7 M;  3PNY A;  3GLF A;  3U6P A;  1PJJ A;  2CV1 A;  3J7A S;  4GHA A;  3B7Z A;  5KPZ A;  3U6S A;  4GC5 A;  4LZJ A;  1XNR M;  1L1T A;  4JI8 M;  3NWL A;  4JXJ A;  4IBC A;  5ITR A;  1TTE A;  2D7E A;  3J81 S;  3RGP A;  3AOE A;  1Z5A A;  4JI2 M;  1I94 M;  3JR5 A;  3D8L A;  3FUW A;  4GIT A;  3GPY A;  1HNX M;  3SAT A;  2JA2 A;  3KP0 E;  1XB2 B;  3UMM A;  1TH4 A;  2DI0 A;  1YSY A;  2OQ4 A;  4M0W A;  2UUA M;  2DAK A;  3GLG E;  5KQ8 A;  3KOZ E;  4G4O A;  1TH3 A;  1IBM M;  2C98 A;  4LRS A;  1PM5 A;  2K47 A;  2R62 A;  1D0K A;  1VEK A;  1W5S A;  2EKF A;  3BBZ A;  3FUX A;  2DAE A;  1YUB A;  4Z8X A;  1GLN A;  3K8Z A;  2QQ8 A;  2HHH M;  4KOD A;  2X8A A;  2ZAO A;  1T43 A;  2P5T A;  4M9Z A;  2R18 A;  1QDR A;  4IBD A;  2E5L M;  4IBF A;  4YY3 M;  2EA0 A;  3B7N A;  1NHG C;  4IBG A;  2H5X A;  1NVM A;  4DR3 M;  3FTC A;  4XBO A;  5LMN M;  4NRV A;  2L7I A;  3I4Y A;  2Z3X A;  4LY6 A;  2Z8Y M;  3SAR A;  4GEW A;  3SMS A;  4WP2 A;  5IZ7 D;  2VQF M;  3VDP A;  8CAT A;  4AKH A;  2JNH A;  2D7H A;  4DUY M;  3GPU A;  1NY6 A;  4B7F A;  3SAU A;  1AIP C;  1IXS B;  3BXW A;  3LCV B;  3R8F A;  3IHP A;  3FUU A;  1GAB A;  2DZL A;  4AW4 A;  3U6C A;  1Y8G A;  2QCU A;  3H4J A;  1OIZ A;  1V92 A;  4LJ7 A;  1IN7 A;  1R6B X;  4Y28 F;  4Z6Y A;  3U6Q A;  1Z5B A;  2KEB A;  4D80 A;  1IXS A;  2M5Z A;  3LVV A;  2DKL A;  2DVW B;  3GLH E;  1PJI A;  4OU7 A;  2XEP A;  1IBK M;  3UGJ A;  1MN3 A;  3A98 B;  3E9S A;  3DA1 A;  1PJQ A;  2LXE A;  1CUK A;  1QDT A;  3LQR A;  1IXR C;  2ZAN A;  3M6A A;  3VKG A;  2KNA A;  1V33 A;  3GO8 A;  4MGK E;  4JI3 M;  1XMO M;  1L2D A;  4DR7 M;  2JY8 A;  5DFL A;  1G8P A;  2C5R A;  2WSC F;  1NV9 A;  3JR4 A;  2LVN C;  4L15 A;  5EXT A;  3J80 S;  1T3T A;  2CHV A;  3HY5 A;  4LF9 M;  2A5Y B;  1EIJ A;  5FTJ A;  3SHG B;  1NHW C;  1XNQ M;  1MX0 A;  1J09 A;  3AFH A;  2Y0Q A;  3C3E A;  3K9P A;  1QAM A;  2EJS A;  3CF2 A;  4FWD A;  2QHO B;  1IXZ A;  2CFO A;  4BBA A;  2K0B X;  1T6O A;  1IY0 A;  3GLF E;  3L25 A;  4LCB A;  1UM8 A;  4RF1 A;  1TDZ A;  2QEN A;  3QWL A;  4WW0 A;  5GKN A;  1L2C A;  1E32 A;  1JB0 F;  3DZD A;  4FWH A;  4IBB A;  1DO2 A;  2LNH C;  2L4E A;  1N75 A;  4L78 A;  3GQ3 A;  4B3R M;  1NNU C;  2R45 A;  3GLI B;  5C1B A;  3C9P A;  3A46 A;  3I51 A;  3M0E A;  4QNM A;  1R7R A;  3TWK A;  1FNN A;  5ITQ A;  1IY2 A;  3J7B A;  2XF3 A;  4I5S A;  1IQP A;  4LF7 M;  2QPA A;  3QYB A;  3WHL A;  2V1C A;  1IY1 A;  3GLI A;  3IEC A;  4AKG A;  1KSF X;  1NV8 A;  1IN4 A;  2JZ0 A;  3W67 A;  3Q8G A;  2JZ1 A;  2Z7J A;  1N33 M;  1W5T A;  3U61 B;  2QP9 X;  2R46 A;  4MH0 E;  5EJC A;  4FWG A;  1JR3 A;  2FE8 A;  3KXE C;  4MGI E;  3GPX A;  2X4A A;  3U6M A;  4LJ9 A;  3KP1 E;  4OVZ A;  2MH8 A;  1IN6 A;  4FCW A;  4G6Z A;  4GH9 A;  2I7N A;  1OAO C;  1YLA A;  4LRT A;  2WSE F;  3SAV A;  2UXC M;  3B7Q A;  2FNA A;  1Q39 A;  4GC9 A;  2MJ5 B;  1K82 A;  4X65 M;  4FCV A;  3E4R A;  3FE3 A;  4M9S A;  2VF7 A;  3VLF B;  3HHZ A;  3B9P A;  4NSR A;  2DAG A;  3KOW E;  4D82 A;  3SFZ A;  2O5R A;  1K3X A;  2V6Z M;  3ZH9 B;  2CWB A;  3HU2 A;  7CAT A;  4DV2 M;  3VDU A;  1Z5C A;  2DZN B;  2VQE M;  4OX9 M;  4JV5 M;  2MRO B;  3KW6 A;  2Y20 A;  4W5W A;  3J2P B;  4LJ5 A;  3HHY A;  4B7G A;  4LFA M;  1C1K A;  5BPV A;  1G41 A;  4S12 A;  3W0L B;  1TDH A;  5C18 A;  3KS8 A;  1HQC A;  4QOS A;  3D8B A;  1TH2 A;  3KSX A;  1N78 A;  1ZV1 A;  4LF4 M;  4RKU F;  4IBI A;  5FTL A;  3ZCB B;  3GQ4 A;  3VKH A;  4CIS A;  2Z4R A;  3E46 A;  2Z4S A;  3HJS A;  4OW0 A;  4LF5 M;  1S3S A;  4PDG A;  3PFI A;  5A2Q S;  3KSJ A;  2DZO B;  2BJV A;  2KZU A;  3UJN A;  3GRR A;  3SMP A;  2Q2E B;  4B3M M;  1OFI A;  1RU3 A;  2KW0 A;  3KDS E;  4LFB M;  4FCT A;  1XC8 A;  3TWM A;  1SXJ C;  2HKJ A;  5E26 A;  2LHG A;  2M60 A;  3GP1 A;  1Q3C A;  1L8Q A;  4L6V 6;  4P17 A;  4L8R C;  2DAM A;  3MHV C;  4I4L A;  2RGH A;  2KHH A;  4MGY E;  1PJT A;  2G8L A;  3U60 B;  1DO0 A;  4BLC A;  3HZJ A;  3B89 A;  2F4V M;  1HT1 E;  1OTR A;  2WSF F;  5FLX S;  1TF0 B;  1K3W A;  4DBG B;  2C96 A;  4NOO B;  2C9C A;  4GHL A;  3UK6 A;  2H1R A;  2KNZ A;  1MJG M;  1PRB A;  3FTD A;  4FW9 A;  2DWL A;  4JI1 M;  1ZQ9 A;  2EKK A;  1UFZ A;  4I81 A;  3U60 A;  4NSO B;  4X66 M;  3AKZ A;  1QAO A;  4RF0 A;  2R0I A;  3VFD A;  2JWS A;  2X49 A;  1FJG M;  3HJQ A;  3TWL A;  5EXX A;  2XZF A;  1JR3 D;  2NQ8 C;  4PCZ A;  3RGS A;  1D2N A;  1JR3 E;  4CGY B;  2D7G A;  5JI2 E;  3HJ8 A;  4I8O A;  3J27 B;  1I4W A;  5FTN A;  4CJ6 A;  1G71 A;  5DNY A;  1C7Y A;  4IBE A;  4NRW A;  4KHP M;  2B3T A;  4GIP A;  4LJ8 A;  2OO9 A;  5ITX A;  1QZM A;  2RKO A;  2LTU A;  2RRU A;  1DV0 A;  3KS4 A;  4TUW A;  5JI3 E;  1QUS A;  1OJL A;  4PT5 A;  1ZMU A;  5KQD A;  3FD9 A;  2LVA A;  1HNZ M;  3ZQJ A;  2O01 F;  2QBY B;  4A3V B;  3AL0 C;  2CE7 A;  2L7H A;  3DFZ A;  3I4V A;  3C3D A;  2R44 A;  3L2A A;  2AHM A;  4DV1 M;  4LJA A;  2XSZ A;  4LFC M;  3K2L A;  2QBY A;  2C9O A;  1ZAE A;  2BNK A;  3FYC A; 
#chains in the Genus database with same CATH homology
 1QAQ A;  3M7G A;  4REZ A;  4MGH A;  3MJ5 A;  4JI7 M;  3AV0 A;  3KVW A;  3KFU G;  5ITU A;  1MU5 A;  3U6O A;  3HU1 A;  1HT2 E;  4DUZ M;  5F3W A;  2CUZ A;  4QOZ C;  2XFT A;  4JYA M;  4DR2 M;  4ZPX A;  4HLQ A;  4OVZ B;  3ZC7 B;  3ILK A;  5IRE B;  1WXQ A;  2CHG A;  3K92 A;  4HL4 A;  4WUR A;  2ERC A;  3TE6 A;  1NJG A;  3CF6 E;  5DYI A;  1NNJ A;  2KRU A;  5E6J A;  4PD2 A;  2DWZ B;  4DV5 M;  5IT9 S;  3L28 A;  3EIE A;  4FD2 A;  2UU9 M;  2FFJ A;  3QAU A;  3TPZ A;  2F5S A;  4B7H A;  1IM2 A;  4AQY M;  2DHR A;  1SXJ D;  4X64 M;  4K0K M;  1L2B A;  3THG A;  2RGO A;  1YE9 A;  1KYI A;  4JI6 M;  3PNV A;  4LGM A;  4AI6 A;  3A45 A;  5IWA M;  4JI5 M;  2YR0 A;  2CV2 A;  1XXH B;  4G4N A;  3GLH A;  2F5P A;  3IG5 A;  5EP2 A;  4DV4 M;  4LF6 M;  4AG6 A;  2R65 A;  1GL6 A;  3T1Y M;  1N77 A;  4NXN M;  4DR6 M;  1XXH A;  5ITY A;  4P16 A;  2I7P A;  1J5E M;  4B3T M;  2G5G X;  1VDD A;  2KZS A;  1DGB A;  4II7 A;  3HU3 A;  1EE8 A;  5EXS A;  4ITQ A;  3GPP A;  1LV7 A;  5ITX E;  1KFV A;  1IN5 A;  4IBK A;  4DR4 M;  2YQZ A;  3PVS A;  3TL4 X;  1QVR A;  3CF0 A;  4BB9 A;  1XMQ M;  3AOE C;  3HWS A;  3SYK A;  3HHX A;  4LJ4 A;  5FTK A;  4RNA A;  4IIW A;  1SXJ B;  4M0D A;  4QHS A;  3KOY E;  4KO8 A;  1E9R A;  2XSZ D;  2F5Q A;  2XH9 A;  4DV6 M;  3LQQ A;  3HGI A;  3BOS A;  3U6D A;  3SC3 A;  4MM3 B;  3VK8 A;  1SXJ A;  2F5O A;  2EUC A;  1G4A E;  5EXP A;  3C58 A;  3GRU A;  3GRY A;  5H37 D;  3UZU A;  3FYD A;  4IBJ A;  3U6E A;  4XGI A;  2XFS A;  1QAN A;  4L16 A;  5FSW A;  2HCB A;  4LGY A;  2LWX A;  1DGG A;  4AG5 A;  2W82 A;  2DWN A;  4MGZ E;  4GRI A;  1XHB A;  2YNM D;  5KPR A;  1N36 M;  3MK6 A;  3AJI B;  4X62 M;  2EO2 A;  2UUB M;  3HHW A;  1E94 E;  2C99 A;  4M9X A;  3L26 A;  2CEA A;  4LG2 A;  1TGU A;  5DYG A;  3U6L A;  3FUV A;  3H4M A;  4JI0 M;  3L29 A;  3T1H M;  1GL7 A;  2XGN A;  3LVW A;  4DR5 M;  2XZU A;  2L6O A;  2LH0 A;  5FTM A;  4JI4 M;  4KLN A;  1IBL M;  1Z6T A;  1J7K A;  3SYL A;  3LMM A;  3SHF A;  3SBJ A;  3T38 A;  5EP3 A;  4R7G A;  4IJE A;  2DXI A;  1NY5 A;  3GLG B;  2L09 A;  5ITT A;  3A42 A;  4DR1 M;  3PXG A;  4G4R A;  1H6U A;  1Q3B A;  5EP1 A;  5BR8 M;  4YHH M;  4QHT A;  4AZF A;  4D81 A;  3GLG A;  2YFQ A;  1ORY B;  3WHK A;  3U5Z B;  2CV0 A;  1OFH A;  1N34 M;  3Q8X A;  3GQ5 A;  5LMU M;  3AOG A;  4QNR A;  2ZAM A;  3R9X B;  3EIH A;  4MB7 A;  2R4J A;  2Y0T A;  4AKI A;  2UXB M;  4R3D A;  2ZM6 M;  3U5Z A;  3SAW A;  1DGH B;  4L4U A;  3T15 A;  4G4Q A;  2KXE A;  1G3I A;  4NXM M;  4GKJ M;  4B08 A;  3HKP A;  3KOX E;  1Z59 A;  3FUT A;  2QZ4 A;  2J7N A;  3TQS A;  3FTE A;  2HL7 A;  3OTO M;  4LZZ A;  1DGH A;  3NBI A;  4B3S M;  1R2Y A;  1GVN A;  2KRK A;  3CTW B;  1SXJ E;  1IN8 A;  3GLH B;  4GMQ A;  3RE8 A;  4DV3 M;  1HR0 M;  3FTF A;  1QQW A;  4GKK M;  4CHT B;  4IJF A;  1NSF A;  5EQT A;  1E9S A;  1HQY E;  2XLJ A;  2R4E A;  4LJ6 A;  4LF8 M;  2DWM A;  1NJF A;  1G59 A;  2V1U A;  2BJW A;  3IG8 A;  3JAM S;  2F5N A;  2ZBK B;  5KO3 A;  2Y21 A;  2UUC M;  4DV0 M;  1XWI A;  1N32 M;  4JN6 A;  1HNW M;  2UXD M;  3U61 A;  3FKE A;  1DGF A;  2CHQ A;  3W0F A;  1L1Z A;  4PDI A;  1R2Z A;  3GLF B;  3GRV A;  4EIW A;  1QYR A;  1JQJ C;  4NL4 H;  1X37 A;  2OPF A;  2VII A;  3RFW A;  3SAS A;  2FOI C;  2KA6 B;  3DOA A;  2J7O A;  4FVM A;  5EP4 A;  3VK7 A;  1GKI A;  3L27 A;  5KPT A;  4DV7 M;  3K1J A;  3PNY A;  3GLF A;  3U6P A;  1PJJ A;  2CV1 A;  3J7A S;  4GHA A;  5KPZ A;  3U6S A;  4GC5 A;  4LZJ A;  1XNR M;  1L1T A;  4JI8 M;  3NWL A;  4JXJ A;  4IBC A;  5ITR A;  2D7E A;  3J81 S;  3RGP A;  3AOE A;  1Z5A A;  4JI2 M;  1I94 M;  3JR5 A;  3D8L A;  3FUW A;  4GIT A;  3GPY A;  1HNX M;  3SAT A;  2JA2 A;  3KP0 E;  3UMM A;  1TH4 A;  1YSY A;  2OQ4 A;  4M0W A;  2UUA M;  5KQ8 A;  3KOZ E;  4G4O A;  1TH3 A;  1IBM M;  2C98 A;  4LRS A;  1PM5 A;  2K47 A;  2R62 A;  1W5S A;  3FUX A;  1YUB A;  4Z8X A;  1GLN A;  3K8Z A;  2HHH M;  4KOD A;  2X8A A;  2ZAO A;  2P5T A;  4M9Z A;  2R18 A;  4IBD A;  2E5L M;  4IBF A;  4YY3 M;  2EA0 A;  1NHG C;  4IBG A;  1NVM A;  4DR3 M;  3FTC A;  4XBO A;  5LMN M;  4NRV A;  2L7I A;  3I4Y A;  2Z3X A;  4LY6 A;  3SAR A;  3SMS A;  5IZ7 D;  2VQF M;  3VDP A;  8CAT A;  4AKH A;  4DUY M;  2D7H A;  3GPU A;  1NY6 A;  4B7F A;  3SAU A;  1IXS B;  3R8F A;  3FUU A;  3U6C A;  4AW4 A;  2QCU A;  4LJ7 A;  1IN7 A;  1R6B X;  4Z6Y A;  3U6Q A;  1Z5B A;  2KEB A;  4D80 A;  2M5Z A;  3LVV A;  2DVW B;  1PJI A;  4OU7 A;  2XEP A;  1IBK M;  3UGJ A;  3A98 B;  3E9S A;  3DA1 A;  2LXE A;  3LQR A;  1IXR C;  2ZAN A;  3M6A A;  3VKG A;  3GO8 A;  4MGK E;  4JI3 M;  1XMO M;  1L2D A;  4DR7 M;  1G8P A;  2C5R A;  3JR4 A;  4L15 A;  5EXT A;  3J80 S;  1T3T A;  2CHV A;  4LF9 M;  2A5Y B;  5FTJ A;  3SHG B;  1NHW C;  1XNQ M;  1MX0 A;  1J09 A;  3AFH A;  2Y0Q A;  1QAM A;  3CF2 A;  4FWD A;  1IXZ A;  2CFO A;  4BBA A;  1IY0 A;  3L25 A;  4LCB A;  1UM8 A;  4RF1 A;  1TDZ A;  2QEN A;  3QWL A;  4WW0 A;  5GKN A;  1L2C A;  1E32 A;  3DZD A;  4FWH A;  4IBB A;  1DO2 A;  2LNH C;  1N75 A;  4L78 A;  3GQ3 A;  4B3R M;  1NNU C;  2R45 A;  3GLI B;  5C1B A;  3A46 A;  3I51 A;  3M0E A;  4QNM A;  1R7R A;  3TWK A;  1FNN A;  5ITQ A;  1IY2 A;  3J7B A;  2XF3 A;  4I5S A;  1IQP A;  4LF7 M;  2QPA A;  3WHL A;  2V1C A;  1IY1 A;  3GLI A;  4AKG A;  1KSF X;  1IN4 A;  2Z7J A;  1N33 M;  1W5T A;  3U61 B;  2QP9 X;  2R46 A;  4MH0 E;  5EJC A;  4FWG A;  1JR3 A;  2FE8 A;  3KXE C;  4MGI E;  3GPX A;  2X4A A;  3U6M A;  4LJ9 A;  3KP1 E;  4OVZ A;  4FCW A;  1IN6 A;  4G6Z A;  4GH9 A;  2I7N A;  4LRT A;  2UXC M;  3SAV A;  2FNA A;  1Q39 A;  4GC9 A;  1K82 A;  4X65 M;  4FCV A;  3E4R A;  4M9S A;  3VLF B;  3HHZ A;  3B9P A;  4NSR A;  3KOW E;  4D82 A;  3SFZ A;  2O5R A;  1K3X A;  2V6Z M;  3ZH9 B;  3HU2 A;  7CAT A;  4DV2 M;  3VDU A;  1Z5C A;  2DZN B;  2VQE M;  4OX9 M;  4JV5 M;  3KW6 A;  2Y20 A;  4W5W A;  3J2P B;  4LJ5 A;  3HHY A;  4B7G A;  4LFA M;  1C1K A;  5BPV A;  1G41 A;  4S12 A;  3W0L B;  1TDH A;  5C18 A;  3KS8 A;  1HQC A;  4QOS A;  3D8B A;  1TH2 A;  3KSX A;  1N78 A;  4LF4 M;  4IBI A;  5FTL A;  3ZCB B;  3GQ4 A;  3VKH A;  4CIS A;  2Z4R A;  2Z4S A;  3HJS A;  4OW0 A;  4LF5 M;  1S3S A;  4PDG A;  3PFI A;  5A2Q S;  3KSJ A;  2DZO B;  2BJV A;  2KZU A;  3UJN A;  3GRR A;  3SMP A;  2Q2E B;  4B3M M;  1OFI A;  2KW0 A;  3KDS E;  4LFB M;  4FCT A;  1XC8 A;  3TWM A;  1SXJ C;  2HKJ A;  5E26 A;  2M60 A;  3GP1 A;  1Q3C A;  1L8Q A;  4L8R C;  3MHV C;  4I4L A;  2RGH A;  4MGY E;  2G8L A;  3U60 B;  1DO0 A;  4BLC A;  2F4V M;  1HT1 E;  5FLX S;  1K3W A;  2C96 A;  4NOO B;  2C9C A;  4GHL A;  3UK6 A;  2H1R A;  3FTD A;  4FW9 A;  4JI1 M;  2DWL A;  1ZQ9 A;  4I81 A;  3U60 A;  4NSO B;  4X66 M;  3AKZ A;  1QAO A;  4RF0 A;  3VFD A;  2X49 A;  1FJG M;  3HJQ A;  3TWL A;  5EXX A;  2XZF A;  1JR3 D;  2NQ8 C;  4PCZ A;  3RGS A;  1D2N A;  4CGY B;  2D7G A;  5JI2 E;  3HJ8 A;  4I8O A;  3J27 B;  1I4W A;  5FTN A;  5DNY A;  4IBE A;  4NRW A;  4KHP M;  4GIP A;  4LJ8 A;  5ITX A;  1QZM A;  2RKO A;  3KS4 A;  4TUW A;  5JI3 E;  1OJL A;  4PT5 A;  5KQD A;  3FD9 A;  1HNZ M;  2QBY B;  4A3V B;  3AL0 C;  2CE7 A;  2L7H A;  3DFZ A;  3I4V A;  3L2A A;  2AHM A;  4DV1 M;  4LJA A;  2XSZ A;  4LFC M;  3K2L A;  2QBY A;  2C9O A;  1ZAE A;  2BNK A;  3FYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...