2DY3A

Crystal structure of alanine racemase from corynebacterium glutamicum
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
361
structure length
338
Chain Sequence
MNLLTTKIDLDAIAHNTRVLKQMAGPAKLMAVVKANAYNHGVEKVAPVIAAHGADAFGVATLAEAMQLRDIGISQEVLCWIWTPEQDFRAAIDRNIDLAVISPAHAKALIETDAEHIRVSIKIDSGLHRSGVDEQEWEGVFSALAAAPHIEVTGMFTHLAETDRQIIAFRRALALARKHGLECPVNHVCNSPAFLTRSDLHMEMVRPGLAFYGLEPVAGLEHGLKPAMTWEAKVSVVKQIERGFVAVVPAGYADGMPRHAQGKFSVTIDGLDYPQVGRVCMDQFVISLGDNPHGVEAGAKAVIFGENGHDATDFAERLDTINYEVVCRPTGRTVRAYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanine racemase
publication title Crystal Structure of Alanine Racemase from Corynebacterium glutamicum at 2.1 A resolution
rcsb
source organism Corynebacterium glutamicum
molecule tags Isomerase
total genus 109
structure length 338
sequence length 361
chains with identical sequence B, C, D
ec nomenclature ec 5.1.1.1: Alanine racemase.
pdb deposition date 2006-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00842 Ala_racemase_C Alanine racemase, C-terminal domain
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 2dy3A01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 2dy3A02
4LUYA 3GWQA 2O0TA 7ODCA 1L6GA 4LUSA 2RJGA 3NZQA 4WR3A 4FS9A 4KBXA 4ZGYA 1XFCA 1RCQA 3CPGA 1D7KA 3AWNA 4BEQA 2PLKA 3E6EA 3E5PA 2SFPA 4XBJA 2DY3A 2NV9A 3NZPA 5FAGA 1CT5A 4PB4A 3WQFA 3AWOA 3N29A 1TWIA 4ILSA 1KNWA 1QU4A 4XG1A 5FAJA 3ANVA 2OO0A 4LUSB 3R79A 4ECLA 2J66A 1B54A 2TODA 3WQEA 1VFTA 4A3QA 3WQCA 1SZRA 3OO2A 1SFTA 4Y2WA 4BHYA 4DYJA 2PLJA 2RJHA 2QGHA 4BF5A 3WQGA 5IRPA 3BTNA 3B8WA 4V15A 1NIUA 3ANUA 5GJNA 1TUFA 1XQKA 3KW3A 1XQLA 3CO8A 2VD9A 5BWAA 3LLXA 1HKVA 1NJJA 5GJMA 3HURA 3WQDA 2YXXA 3SY1A 1HKWA 1FTXA 1W8GA 2ODOA 3VABA 1VFHA 3B8VA 1L6FA 4PB5A 3B8TA 5GJPA 3B8UA 5FACA 1BD0A 3S46A 3N2OA 3C5QA 2VD8A 4DZAA 2NVAA 4LUTA 2P3EA 3MT1A 3UW6A 1VFSA 4AIBA 3HA1A 1KO0A 1EPVA 4BEUA 2ON3A 4QHRA 4LUTB 3N2BA 1F3TA 4PB3A
chains in the Genus database with same CATH superfamily
2PFHA 2HCVA 1VZWA 3UXAA 1SW0A 1QPQA 3F2CA 1FDJA 1MUMA 3N18A 1IR1A 5K3VA 1V6UA 1GZGA 2Z7GA 1EWEA 1CPUA 1RLDA 2C19A 4LJ3A 3WQVA 1HIZA 1ISYA 1QO5A 2V5DA 2PDYA 4G6CA 3IARA 4AUBA 5D9MA 2J7GA 1S46A 3BG3A 4GNVA 3RLHA 2F6UA 4O1DA 3UWYA 3ANVA 4UFIA 3SRFA 1R7AA 5MKGA 4LVAA 3TNBA 3KS5A 1ISZA 1DTUA 2VENA 1W2PA 1GONA 3K30A 1UZHA 4O54A 5F2GA 3MSGA 1JI1A 1UUMA 4NU7A 4UTMA 3CUJA 1Z44A 4BKNA 1Z41A 2BVTA 2EBNA 2WOQA 3EPOA 4MHBA 1Z9AA 4FALA 2YA2A 4TO8A 4R33A 3NVTA 4PODA 2YYTA 2WMJA 1Q66A 3VIGA 2NUWA 1T40A 3DHUA 4F0KA 1E9IA 4D1JA 5EYWA 1K8ZA 5HWJA 4JN6A 3UVAA 3NL2A 2VC6A 1M9HA 2HRWA 4EF9A 2DUZA 4DPQA 2DT2A 3QPZA 4KCVA 3VINA 3OOQA 1MI3A 1JGIA 4GFIA 2Z1XA 5BMXA 4FOUA 2DH2A 4H04A 2WSQA 3IJ9A 4UQAA 1IT0A 4GABA 4GX8A 3AJ7A 3M5XA 2P3ZA 3OVPA 2A3LA 4AC1X 3AOFA 2C1HA 1QDSA 1H49A 3VMPA 2HSAA 8TIMA 3A12A 4QTGA 1BVWA 2PF8A 4FX6M 4XD6A 2CHRA 4MG4A 5A6KA 4AZ6A 1HXJA 5I3KA 4LAMA 4WCJA 1EC8A 1U5HA 1NEYA 2HNHA 3ES7A 4DJDD 1JPHA 3GTIA 3NIYA 4DWSD 1XC6A 4AMCA 4M1BA 4GGHA 1V02A 3CUZA 4KFPA 4WDUA 4XTDA 3EX1A 1XX1A 2GWGA 4QG8A 1KA9F 4NZ3A 1PHWA 3GXTA 1IXQA 4XBSA 4R5EA 1PZ0A 1KCZA 5AN7A 1Y65A 2VC9A 2R1KA 2NT0A 1WNOA 2PTWA 3IAQA 1E1CA 4AH7A 4KWVA 3S1WA 2EHHA 1L6FA 4Q7BA 7ENLA 3IJDA 3VIHA 4XSLA 4WVXA 4ONVA 1UWRA 2QR6A 4LY8A 4XKMA 3K1GA 4GG9A 3BGAA 1XJBA 4JTQA 3WH5A 3IV8A 2PRMA 3TR9A 2VX4A 3M7WA 3W1RA 1DWHM 2ZX8A 3SCPA 3K13A 4OFCA 3OW1A 4AVFA 3V5OA 4YCPA 5HQLA 4L9YA 1XCWA 2IPWA 3AUJA 4WRHA 4XKYA 3LNPA 4MDPA 1KLYA 4ML4A 2WPBA 3D3AA 3VCRA 3FYOA 4NXSA 2C1GA 1XISA 4X0VA 4IF2A 2I17A 3KVJA 3TYEA 1JYVA 1XLJA 3LPGA 1L6YA 1XLAA 2UWFA 1FWAC 3RHGA 2FKPA 3RRAA 1D8WA 1XICA 3VE7A 3D6NA 2VVNA 3MP4A 4GJJA 4JTAA 4FNTA 4N0RA 4S3FA 4M6UA 4PTNA 1Q6OA 3G1YA 3V5CA 3PZUA 3W2MA 1QNSA 1TX2A 3LSBA 1HT6A 1XUUA 3AISA 1HL8A 3SGGA 1WXYA 4GYJA 1E6RA 3F4CA 3MMDA 2PEVA 3KVKA 5CKSA 3QY6A 4OUEA 4X9SA 1TA3B 4GUFA 2NVDA 3N14A 4PCTA 1XM3A 3GNDA 3TN6A 1A5LC 1FY6A 4UIOA 1HGWA 4LOCA 4IQJA 3BLLA 4HTBA 4QSHA 1W2VA 1SPQA 4H9XA 3GXIA 3ZJ8A 2X0YA 3UXDA 3T8LA 3NNTA 1FCQA 2AGKA 2GFTA 5HINA 1S5MA 4GQBA 2GGGA 3V7PA 4H8NA 1ZPTA 4C65A 4LH8A 3WD3A 3FJ6A 1XGZA 4WZHA 2XTKA 1E1FA 1CGXA 5ABHA 1BRLA 3LY0A 5G1MA 3W1AA 5M3WA 3N4AA 3RK8A 2SFPA 3WDJA 1NARA 3FNDA 1LROA 1Q2RA 4AEFA 4DO7A 2J7CA 4XZNX 1AQMA 1OFQA 5I00A 3Q4DA 3GS6A 3VIPA 5IFPA 2NUYA 3W25A 2JKEA 3Q65A 3S83A 3PTKA 1ESWA 1AODA 3ZVHB 1TKKA 1JCJA 1H7RA 3H4GA 3K8KA 1K1DA 4RE3A 4GYKA 1G7VA 4K8EA 1OZMA 5HQEA 4QQ3A 1J4EA 2CBJA 2D2GA 3BJFA 1TV3A 5IHSA 1V0MA 1R0MA 3DHFA 3RFAA 1LOSA 1BVNP 4NASA 4J3TA 3KOYA 1M7JA 1XUZA 4PEEA 3G1SA 4GX9A 1XYZA 1IXPA 2PUZA 4JIQA 1RCOB 1TZZA 2A85A 1FDYA 3APGA 5A8GA 3WN6A 1C9WA 2G97A 1S3TC 4KRUA 1EFZA 4PYSA 1EHAA 3HJEA 4IUOA 1XIEA 3ARRA 1TWZA 3TTYA 1F6PA 4YCOA 2OEMA 2DV0A 1Q4WA 3HG5A 3URBA 1EJUC 4ZGYA 3MUY1 1DIKA 4LVBA 3KOWA 4HNNA 3AMCA 4NNAA 1F3EA 3F2DA 3IK2A 2BGNE 2A3CA 5E6YA 1FWCC 1UPMB 4ZEPA 3NZPA 1A4MA 4E4PA 3GK0A 4ADUA 2VZUA 4O50A 3NM3A 3DHPA 1JI2A 5C2GA 3GC4A 5EBAA 4WIWA 4QLKA 1KQYA 3B9AA 4MUZA 1QI2A 3MP5A 4ZFCA 1ONWA 4HU0A 1D2KA 1DJQA 5FEXA 2GK1B 4NZFA 1CNVA 3VIIA 5HUOA 4MM1A 1HJXA 1KRCC 3W37A 4POCA 3W83A 4HSHA 2XFRA 2ZUTA 1AW2A 3C8FA 1KCXA 3WG6A 3SSZA 2CLLA 3DKLA 3KW3A 3GE7A 3GLCA 1Y0EA 2X2YA 1T96A 1KTNA 3M0HA 3W1TA 3FFSA 2B7PA 1H7PA 1VYSX 1CGVA 1O1HA 5DMLA 1E0VA 3CXOA 4GQGA 1XIIA 1CB2A 2BS9A 5D32A 1I45A 1EGVA 3N04A 3CAKA 3SCNA 4M56A 2PD9A 3W7QA 1DWJM 3SBFA 1V3IA 3GB6A 5TD4A 3WLPA 3IIOA 4IP4A 3HQPA 3SUWA 3SZ8A 1XBYA 4HSNA 3GWQA 4QROA 3UESA 1P7TA 4TMBA 1DOSA 4LAOA 1E51A 1XYCA 2CFFA 1JRBA 4MFDA 5A6LA 3FXYA 5I5RA 1VCFA 4PMYA 3BO9A 2TMDA 4A3HA 3D46A 4AMAA 3WCZA 3M5YA 3SCWA 3SN0A 5D2XA 1VLIA 2ZRYA 3SB0A 1UYQA 3UGRA 2WZEA 4B2DA 3F5LA 3WLRA 2D0GA 1DYSA 3I7RA 3TV8A 3AS1A 2E28A 1ZCCA 3DCPA 2Y4SA 4MY9A 3W7IA 5AVNA 3LG3A 3AYRA 4HKPA 3TXZA 3XINA 1GOIA 2YZRA 3LQLA 1BHGA 4NSBA 3QR1A 3WO8A 4HMEA 2ZUNA 2V30A 4E2DA 2WHJA 4AZBA 3MUIA 1Z32X 3VNKA 3BURA 3N6QA 2E4TA 5FI8A 1R2SA 1MQQA 3W01A 4LALA 4RR4A 1ZGDA 4LCRA 4O52A 2I7GA 3B0YA 4QEHA 1XSJA 4YHGA 3FEQA 4Z1YA 3TROA 3B9OA 4AAJA 4XISA 4IP7A 1GVSA 1E6NA 3CU2A 5GNYA 3IGXA 1JZ3A 3MO4A 5LIUX 2EXOA 2HBXA 2GLKA 1I2QA 3GXDA 4B4FA 3W7MA 2OOGA 3G1AA 1E6PA 1UQYA 4PGLA 1R86A 1UCWA 2VX6A 1HVXA 2QHAA 1E71M 1QI3A 3DERA 4PMJA 4XO6A 4MWAB 4FF7A 3LDVA 3BAXA 3A3XA 3N73A 3K1DA 4WX2A 3MUZ1 4RDYA 3T0BA 3B9NA 4LCSA 3CHCA 3MI2A 4LBSA 1AD4A 2X1TA 3SCRA 3ZR5A 2QJJA 1A0DA 2PDLA 4LS1A 4GXWA 1OQFA 4ICNA 1DKWA 3SQLA 3LCHA 3I6EA 2OT1A 1EL3A 2DP3A 4IP5A 2XJ7A 3B4UA 1JAEA 1HJUA 3KTCA 4LEQA 5CAHA 1OF6A 4QX4A 3W6YA 3RCNA 1ZHAA 1I2PA 1J0YA 5FEWA 4UQBA 1AMKA 3P14A 3SCUA 2J7FA 4MWAC 4H00A 1LYXA 4JYDA 3PPFA 1KWKA 1WE5A 1B3VA 1I0DA 1C8YA 2V38A 3NURA 3WNLA 4GE8A 3AIVA 2R82A 2GJPA 2O92A 4P7NA 2WNNA 1UR2A 3SECA 5DANA 2E5BA 4Q7NA 4LX4A 4PMQA 2QCCA 1W37A 1BVZA 3LRLA 2WXDM 2FGLA 3STCA 3VX1A 3ABRA 3SN1A 3RILA 1JDFA 5H8MA 2DZAA 4MPKA 4O13A 2DT1A 4OGZA 4AYSA 3KRUA 3UR2A 3A9BA 4FX7A 3HPZA 2E9MA 3AMKA 3QR0A 3NQGA 3K46A 4YYCA 2XUCA 3GKAA 1EJTC 3QKZA 5F4WA 1X7IA 2NZLA 5I23A 4Q22A 4CU6A 3AXIA 4IOTA 3H55A 3WJXA 4NX5A 3UZJA 5HNTA 4TV6A 4RUBA 1HFBA 3NSNA 3RDKA 1HX0A 1TCMA 3D47A 4H9YA 4OECA 3ANUA 1ECQA 1YLVA 3BOFA 2IPGA 4Y9AA 3TVAA 2G3FA 3UZYA 3VM7A 4A29A 1Q7QA 4DNHA 1CLVA 1W1TA 2HISA 4PMVA 4HZ7A 2ZADA 4ZQOA 2VYOA 4RW5A 4O1CA 4Q33A 1OSEA 4K8GA 3M0KA 4PUNA 4HZMA 3TQ0A 3HPFA 3L4TA 3UW6A 2ESCA 1F8MA 1OT1A 1X8CA 3V35A 4CKQA 4B5XA 3AXXA 1TV7A 4WKFA 4QLLA 5HJLA 4YVXA 4IPLA 5D2YA 3D5HA 4O0QA 1RZMA 3UR8A 3EX6A 1DEDA 2OKTA 4Y9PA 1FWFC 2WQPA 1DQUA 5T9BG 3QV8A 4JTFA 1SW3A 1OC6A 4W9TA 5FJOA 1I2RA 2PDGA 3CZJA 3SGUA 3H2EA 1WXZA 3UPBA 4P5UA 4MKVA 1YNYA 4Q4RA 1TELA 2FFCA 4MVAA 3A22A 3BW2A 2XIMA 1YE4A 1GOMA 4ZOCA 4UOJA 3PBWA 4QR6A 3CYJA 3ZSSA 3K8LA 4LT9A 4AWSA 4A4AA 3HG4A 4LXFA 3PPCA 5BNKA 5A6BA 3W6LA 1FWGC 3GYEA 5FA5A 3RR1A 1GOOA 2WHLA 2X1SA 1D3GA 1JL8A 1LWIA 2H8ZA 3WF1A 3PTMA 1FBAA 4YMZA 2HZGA 4D71A 2EJ1A 3R6IA 1PHQA 1WKFA 4H2CA 2DVTA 1B4KA 1F76A 1XLEA 1UBSA 4ACZA 4H7CA 5CJMA 5AYZA 1MDLA 1I2OA 1C29A 3BLPX 5FACA 4JTCA 2VX5A 3PN8A 1TG7A 1M7XA 1H1NA 4UMBA 1UD3A 1SFLA 3KBWA 2YB1A 4UTJA 4HT3A 4JKLA 1JGMA 1ZUAX 1RV8A 3DESA 2QS8A 2J9XA 1GQIA 1Q6FA 2R94A 3VUPA 3AQUA 1DJWA 3GZAA 2YDAA 5BYWA 2ISSA 3TP4A 3GNRA 4AHOA 2ZUUA 1U5VA 2Y63A 4GY7A 4I3GA 4ZODA 2VFEA 5DF0A 2CZVA 1R2RA 2FDSA 1KFLA 4H2HA 4L4PA 3TJXA 1X6LA 4IQEA 4R27A 3WELA 4ZB0A 1D9EA 2XG9A 3UWEA 3GG7A 2J62A 4BFAA 4LTSA 4MWAD 1FQ0A 3BW3A 3LBCA 3R25A 1H1ZA 5A6MA 3LRKA 2R9RA 3W27A 5D38A 3EDFA 2OXNA 2FHCA 3V0UA 2QCMA 3T6CA 4DN1A 4W7UA 5CXPA 1XLGA 4ERGA 5JIWA 1T6MA 3DXIA 2Q3OA 2OG9A 3TMQA 2UZ9A 1F9CA 1UD5A 1U2YA 1R9XA 1PB0A 4NX0A 5CZTA 4HCHA 2GJXA 3KZPA 3TDFA 4KIRA 2QJMA 2OZTA 4C6BA 1XDLA 1XYMA 4O14A 1AL7A 3L4UA 2DQXA 4GI6A 4QNWA 3SCSA 1BPLB 1EUAA 4FNQA 1HJQA 2VOTA 3NR0A 4GZ7A 3O6CA 4CCEA 1AK5A 3MWAA 4GQQA 3VGFA 2PBOA 1BWKA 1ENUA 2F6KA 3TSMA 1SU5A 4C6FA 2AKMA 1RJQA 2R91A 2Y7EA 1GVOA 2PP3A 4E4FA 1SMDA 1SQ7A 4DNMA 4C7GA 2DSUA 1ZP3A 4PA8A 4KT2A 2O9OA 1SZEA 3VDBA 4ROPA 1HG3A 3WNPA 1Y5VA 3SAZA 3CIWA 4O17A 3WBXA 2DZTA 2ZZ7A 4YLWA 1QK2A 1VFMA 1H09A 5GQBA 4BWLC 1WA3A 5TIMA 4K3ZA 2CLPA 1WKEA 2G96A 1WAUA 4X2RA 1VF8A 4TQTA 1K02A 3VXGA 4GNKB 1XQKA 4ZB2A 3W87A 1MEIA 4QJ4B 3DOPA 3H2OA 5HDRA 2ZFAA 3HIJA 3KWSA 1IT7A 3AALA 3RITA 4ENLA 5HWMA 2WJEA 4CD8A 2JK2A 4AD2A 3WLLA 4TVUA 3G5EA 3GU1A 2A5HA 1EPVA 3FJLA 1E70M 2JEPA 2O55A 3BV4A 3UYIA 4IFOA 3O7UA 3WF4A 3G1DA 3N25A 5HOSA 4GUHA 1E15A 3NZGA 4NIRA 2FPVA 3BSMA 1F2JA 4IZGA 1PPIA 5DRIA 4CVUA 3S2LA 1F8IA 3CH0A 1G4PA 1CDGA 2ZC1A 2UY5A 4KMQA 4WJEA 4GKLA 1EJSC 2B7QA 2E77A 4H6KA 2IMRA 4PTWA 1XYFA 3QMTA 3EDKA 5TAOA 4Y7EA 1G94A 1IEXA 3Q58A 1S1PA 3H6OA 4DO4A 3VKBA 3L4XA 2CLKA 1O66A 3PZIA 2H3DA 8CGTA 4PCNA 3VKCA 1I8JA 1X6UA 3UP8A 2V2HA 6REQA 3OO2A 4CNPA 1OFBA 4G7EA 2GVGA 4J3UA 1NDZA 2JF6A 2PB1A 2V3FA 1NM9A 1UQZA 1US3A 3K4WA 4U5KA 2JGQA 4UZSA 3LGDA 3F4WA 4Z2HA 4Q8QA 4CQBA 2IQTA 2AMGA 1XQLA 3TUUA 1B30A 3O8AA 4PE8A 3FA5A 3U57A 4NNBA 2C6QA 2BHYA 1C90A 4BK9A 2WKJA 1GPWA 3USBA 3LV6A 2NSOA 3ZZ1A 3N19B 3QYSA 3U2OA 1YKWA 4V28A 4DZAA 2Q02A 4AZCB 3B0UX 4UFHA 1O6IA 3C0LA 2BB0A 2PDWA 2BV9A 2EKCA 1DIEA 4IX2A 2I56A 2Y2WA 5B7YA 1DWIM 2O7QA 5BOFA 1EYEA 3AZSA 4GJ1A 3SRDA 4UTIA 2XVKA 1FH7A 4WEVX 1KM2A 1ZJBA 1L8PA 1E4LA 3C61A 4JQAA 2E1WA 1MW2A 1SO5A 4MY1A 5AB3A 1ZQ5A 3OBKA 3S47A 3AHYA 2ZZ3A 3E12A 4QP0A 4RV3A 3SO7A 1GHRA 3REQB 1TQXA 3TTQA 1CXIA 4G8TA 3W38A 4PUDA 1WOBA 1EA0A 1IZCA 1QPOA 1UJPA 1OY0A 3SQSA 1TTQA 2XU2A 2CESA 1Q5MA 3PZTA 1T8XA 4AX6A 4E5TA 3GTXA 3QV9A 1JNDA 3E2VA 4HK5A 2QF7A 3CIVA 3TA6A 3KLKA 2DZWA 4XSMA 3O63A 4AF0B 1XIDA 2CW6A 3S1XA 5EKYA 1J10A 3CQKA 1OT2A 3HFTA 3NQDA 3W07A 3ZT6A 2AOSA 4LYKA 5E09A 3WUGA 1OG0A 1IHIA 3DI1A 1XLKA 1XF0A 3NDZA 2F84A 1BG9A 4OBRA 3F7JA 3VOCA 3EWXA 3VD9A 5I09A 3TYAA 2OSWA 4PTDA 3U4FA 1R9ZA 1ZAIA 2I5IA 4P8WA 3LX9A 1OC5A 5D9NA 1OCJA 3TLLA 1SJDA 4IQLA 3T0AA 2ZE3A 2GWNA 3GAKA 3CV1A 3GG0A 3NUKA 4M29A 5AHLA 3LPPA 2JALA 2VZVA 1A5OC 3LN3A 5C9XA 1L6GA 1HJVA 2GUUA 3IIZA 4ZQCA 2Z6IA 4ADSA 3AXMA 1UPPA 4J2MA 4AZIA 5HNUA 2HK1A 1MW0A 4B90A 1EDTA 4KGLA 3HB9A 1JXKA 4CLMA 3CGTA 4AWUA 3H2CA 1AQ0A 5LHFA 3KOZA 1YTEA 4UFMA 2TRSA 4C6DA 5K9XA 3WBEA 1DXEA 3BUVA 5BXPA 3COTA 3B40A 4D1IA 4ZBCA 3G0XA 3LMZA 4ZQNA 3ZM8A 3LBOA 4XB3A 1H7WA 1G67A 4YWIA 1V5XA 1SSDA 1WX0A 4N42A 4XTIA 2OLSA 4NQ1A 1VBGA 1DWAM 3N4EA 4M6VA 4AHQA 3K4AA 1L9WA 4ZSTA 4HB7A 1DE6A 1F3WA 4W5UA 3VGBA 1O60A 4JIPA 3CK5A 5H8PA 1TPWA 2OWCA 1LF1A 2XHYA 5IBXA 2DGAA 3B8TA 2E6FA 1EDQA 2CXEA 1BD0A 3EZ4A 3E1F1 4GUIA 1EPXA 3VFCA 4AIBA 2DQWA 3GRIA 2X41A 4QAIA 3ABQA 4NYYA 5AHNA 5DMNA 4JCLA 3EEZA 1UD8A 1DXFA 1UROA 3U2ZA 3JU2A 3BAWA 3BANA 5G2IA 1OD0A 3H4WA 2YSWA 3BZJA 1XLMA 3W82A 4HU8A 3GDBA 2Z27A 3DH7A 1MO0A 1ZZMA 4DI9A 3HMJG 3HGOA 2V8ZA 5C7VA 5A94A 3B0PA 4XUYA 3H23A 4UNLA 3PZVA 2WMIA 4C1NA 4JQ1A 3G1VA 5IFTA 3UU0A 1F61A 3O9NA 4YPJA 3LXCA 1OWQA 5RUBA 4AG0A 5E0CA 1A80A 3UBPC 4ZQPA 2YCLA 3ATZA 5M5DA 3W73A 1X7FA 3S2MA 3USZA 2DZSA 2P0OA 4GFSA 4GJIA 4FO4A 1SSGA 3O0FA 2QUMA 1A47A 3QSRA 2WNZA 3R11A 2QJGA 1UOZA 4D8LA 5G4HC 4X2PA 1E56A 4CCCA 4A22A 2PGFA 3S42A 2PTDA 2DSKA 1LG2A 2C0AA 4H1ZA 3B8UA 2FYMA 3CC1A 3UY8A 1D8CA 2O56A 3WLMA 2DZXA 1OHLA 4TX9A 1VEMA 2Z1SA 2QCFA 1FP8A 1LBLA 2EPOA 3R0DA 9XIMA 1ADSA 3SUUA 4DM2A 3IVSA 1A4LA 1AZ1A 3BG5A 5I3IA 4Z2JA 3A4WA 4O1BA 2J79A 3QFEA 2PP0A 5JXQA 4EXQA 2RGMA 5F7UA 1DBTA 3QZAA 4G9PA 3KL3A 4A3RA 1L6WA 3NWRA 3TW7A 3GVGA 2EG6A 4UTLA 2CZFA 3QMSA 1SO3A 1SJBA 2A2IA 3KOFA 1YDYA 1W3JA 5F4SA 1JYXA 3G1FA 4GO8A 4AW7A 3QY8A 2W63A 2ISDA 4XAYA 1RALA 2GSHA 2YW3A 4AZGA 1G5AA 1J18A 2WC4A 1YBQA 4UMCA 3STGA 3VA8A 2WWCA 3PM6A 1A5MC 3EOSA 3G8EA 3SJNA 5E6ZA 4BHYA 2AQVA 5KZMA 4H9ZA 1DXIA 1M01A 3OIXA 4KEUA 3K2GA 3E0IA 6PTDA 4MB4A 3L65A 3FAWA 4GY1A 5BWAA 3E49A 4C6CA 2J7BA 3NQEA 3BMWA 1TYGA 4JAWA 5MKGB 3VD7A 1W5OA 5AECA 4F4RA 4DLMA 2WCGA 1PKYA 4HPNA 3LV5A 2Q6ZA 3S46A 4HIBA 2INEA 4S3JA 2CETA 3VIFA 2YL8A 3QPYA 4XUGA 2A79A 4IPJA 3RMEA 3H2AA 4EX4A 1Z69A 5JBDA 3RIKA 2ZWZA 1JCXA 3LQGA 4MJ4A 3T0DA 1PDZA 2ZXAA 5AZ0A 3NQMA 3BK0A 4L7ZA 4BJHA 3ABXA 3HG2A 2VFIA 1L0PA 3PWGA 3HQNA 4OIFA 5U7SA 3RU8X 1Q13A 3KLLA 4KEZA 1GQNA 4F2TA 3THUA 3QW4B 1Q8AA 5KSWA 3S6OA 5KEZA 4TVDA 2R6OA 1DJZA 3IJIA 1J11A 2YIHA 1YADA 5HANA 2V5LA 1N8WA 3E2RA 5CSYA 3VVGA 2PI6A 4MF4A 3QF0A 1PKLA 5M03A 3QH2A 1EC7A 3QTGA 1PZ1A 3LTSA 1GNXA 3QZ6A 3FSUA 4JKMA 4AX7A 3OLIA 1QBBA 1V8EA 4PUUA 1J2BA 3LGEA 4J9JA 2QIIA 3I4KA 5CH9A 1PCWA 1E3ZA 4J3WA 2P0IA 3IGUA 3PR2A 5GJMA 4UNIA 1F3XA 3WLHA 3VABA 1W5QA 4RK8A 1MVYA 2ZX9A 4FOKA 4P8VA 3C2OA 3RN6A 3EOUA 2YB4A 3RG6A 3VNZA 4J27A 3GNNA 4GVHA 3WF0A 2VZOA 1J6OA 4PRRA 4DJEA 3W88A 4W89A 3VCCA 7ODCA 1GVIA 1YX1A 3L0KA 3UJFA 1P1XA 5L9FA 4AXNA 1QW7A 3VMNA 2OOFA 3UCCA 4K6AA 3DAQA 4JQ4A 2X1IA 1TPC1 2R1PA 3TAKA 1WDPA 1NWUA 3HPXA 1OG6A 1G69A 4FNRA 3U2CA 2PWFA 3PULA 2XGZA 6CGTA 4MB1A 2QNEA 3CWNA 4DZIA 2VGFA 3H7UA 2HVMA 3VDAA 2WLZA 2ZA1A 1UD6A 5AVHA 1U5JA 3GH7A 4KEVA 4Q4QA 3C8NA 4ZVJA 3WNKA 4XKYB 4AD4A 1UG6A 5HNRA 4MFEA 2BBFA 1TTJA 3TTSA 3WQGA 1S3HA 5H2ZA 4Q7IA 2D20A 1UMLA 1JZ8A 3MKVA 1QNVA 3ITGA 4A8NA 4U31A 1YYAA 4K1WA 4GBDA 2ADAA 3A5FA 3CS2A 4EPKA 3SCQA 4CQCA 5H6HA 3II1A 3KBSA 2D3NA 2PDCA 5A8OA 2OQYA 5DCBA 2WV8A 1W3HA 3H7RA 2XH4A 2QW5A 2D0FA 1OX4B 3BCFA 2CITA 4HU3A 1LOQA 3GSMA 9CGTA 3W2UA 1SM9A 1JYWA 1NP2A 1QRQA 1TIWA 3KWXA 3OQEA 3SUVA 5ABTA 3BSGA 1JDCA 4MAZA 4BI6A 1RCQA 4GHRA 5ABGA 3OG2A 4GYFA 1EC9A 1VLWA 1PIIA 3E5PA 3PS7A 1YPXA 3URQA 3KM8A 3DHDA 3GTNA 4FLRA 4JTIA 2BOEX 2F2KA 1V3MA 4QRNA 4YTRA 4QM1A 3N29A 1IEVA 2OSXA 3WY1A 2E25A 2WJFA 1VJZA 3OZOA 4FHAA 4JL2A 4FLQA 5LNSA 4M7TA 4YIWA 4LF2A 5KINA 2VHLA 3UJEA 1UKOA 3W2NA 1XP3A 4MTVA 3WQ8A 3T0TA 1FCVA 1TREA 1A5AA 5KZEA 3FDKA 3QBUA 3CAWA 1E0TA 3AU6A 3IIXA 1NJJA 1BSIA 4GQ0A 1X8FA 4R88A 1ZY9A 1RQHA 3PNUA 3FA3A 3QV6A 1VB9A 4MLRA 4H9UA 3GXFA 4XD5A 4CNTA 2RAGA 5EB8A 1S5NA 2AMXA 3H22A 4OT7A 4MOZA 3TX9A 3DZ1A 5I79A 2YLAA 3AUOA 1IIGA 2XN2A 4LW7A 2OVLA 1L6SA 3VOFA 3MO7A 3T1GA 2P53A 3BAKA 2HJPA 3MHUA 1X1ZA 2P76A 1WDSA 3GHRA 1VFLA 2BMBA 2R24A 3W70A 2XN0A 4ZMGA 4L6HA 4UQCA 5I3FA 1CW2A 4GUGA 1XR2A 2ZX7A 4LFYA 2G37A 5JIPA 2NWRA 3QEZA 3QSTA 2KX9A 2R1LA 3G0UA 1G7UA 3N2CA 2BTMA 2YL6A 3TJ4A 3GDLA 3MDWA 1KR1A 2XWDA 5DXXA 1S5VA 1FA2A 2OEJA 1O12A 3EWUA 4MIMA 2WK2A 1O5RA 1W91A 3UWUA 3FHAA 3GUGA 1BTMA 1F73A 3PJXA 4ZSUA 3A47A 3CQIA 2ZXBA 4HNLA 1QVBA 3AICA 2ZZ5A 1GKQA 5KITA 1NELA 3B8VA 1P48A 3WUFA 4I7VA 1Z89A 3U0HA 1KRAC 3BJTA 1RJPA 3CEUA 1H11A 2NV2A 2YFNA 2YXGA 3HA1A 1KO0A 4BI7A 2YOCA 2C7FA 3WLSA 4DJDA 3G2GA 3OG3A 4Q4OA 3A64A 3KRBA 5A8NA 1A5BA 1O95A 3TTOA 3A23A 3KX6A 1QTWA 2GVYA 3W7OA 1OYCA 3CV6A 2Z2UA 2A7RA 2IKHA 2Z1WA 2VGIA 4V2XA 1FUYA 1C9DA 3BPWA 2C79A 1K6WA 5JH2A 5D37A 1FX6A 1PBGA 1L2QA 1XDJA 3W81A 3TC7A 5EU9A 2V82A 1CGTA 3FOKA 3MDUA 3P7YA 3AIUA 3R79A 5J5DA 3ABZA 3VNLA 1P7TB 3BVJA 3LZ5A 1FDZA 1NFBA 1WPCA 1F6YA 4PCPA 4QS6A 1FCUA 4WJ8A 3NOYA 4IL2A 4WUIA 1JZ5A 3L5AA 4PFHA 1V6XA 5CBBA 3VK5A 5I77A 2XN1A 1DHPA 3P5YA 3RAOA 4H3DA 1YTKA 3NPVA 4XWUA 2ZUWA 3EDJA 1EP2A 1FRBA 4IMAA 3WLTA 3HQ1A 4GNJA 3ALFA 5FSEC 3L7RA 2B7NA 4ZE4A 1R7OA 3NEHA 4PMUA 5CSSA 3NA8A 4XAZA 1ISVA 3O0KA 1KM3A 1E4NA 5BOOA 4NAEA 5DEZA 4LBRA 2YGYA 4WY0F 2H90A 4CN4A 4D6DA 3MC5A 4QIUA 1XLDA 5DMMA 3WDHA 3GDMA 3W7CA 3GR8A 1TFVA 3ARTA 2ZBTA 4GK8A 3UJ2A 2GQ9A 1G0CA 2QEZA 5FF2A 3DBPA 4WDWA 3UG5A 2WANA 2HS8A 1YXCA 4ZO7A 4OZOA 2Y61A 1CT5A 1XLLA 2ABBA 2Z28A 1K4GA 4MLJA 5AHIA 3TJIA 3GD6A 4YTSA 2EO7A 4DJFC 1KTBA 1IWAA 4ECLA 2G50A 1N82A 4HJWA 2HMCA 4MZ8A 1I4NA 2XDFA 2VOMA 4FSAA 1UZ1A 3NL3A 1JDAA 1W8SA 1RQEA 4O57A 5FJRA 5IXEA 4M51A 1KFJA 4B92A 1QO2A 4CCZA 5GJNA 3CL6A 2QT3A 1AD1A 4K38A 1B9BA 4M0XA 3INPA 4QQUA 1D3CA 1H7NA 3EOLA 1YNPA 1KM5A 1ITCA 3EB2A 2WC7A 3EWDA 4WXZA 2ZDSA 4O8AA 1XIFA 2OSYA 4DF1A 4DUOA 3P61A 5K7JA 5AY7A 2CLEA 5BRQA 3VDHA 3ARXA 4AEOA 4LUYA 4L64A 3E5BA 4M8UA 2FVMA 3MANA 2BOFX 4XV0A 3ZLGA 1E43A 2ACSA 3OVQA 1PL9A 3OGSA 1W6TA 4WF7A 2OLAA 4OV9A 4EPEC 1RA5A 5HPOA 5K4XA 4ZE5A 1WCGA 2G8ZA 3U9IA 1ZL1A 3RLGA 2VRJA 2E7FA 2A1YA 3M0ZA 3CT7A 3H53A 2VFDA 4B9YA 2QCLA 4F0RA 4CCDA 4HVXA 1IF2A 1DJHA 2QQ6A 3O6DA 4J28A 4I7UA 3CIXA 4LV9A 1P0DA 2ALDA 3P0XA 3S6TA 1W5MA 4QDMA 5HQMA 1KV5A 3PAOA 1MZRA 3NZRA 1W5PA 1Q6QA 3W7GA 1UR1A 1E40A 3ZYZA 1XYBA 3TU9A 1EYWA 2V2DA 3GHSA 3VYLA 3RF9A 1JQVA 4AISA 2JKAA 6ENLA 1AH4A 4P8UA 3KCLA 5LXEA 2CZ5A 8RUCA 4RE0A 2J78A 3XIMA 1PZ3A 2EJAA 4BEUA 3NL6A 2ALRA 3CJPA 1XD0A 3P84A 1RD5A 1VCGA 2VTFA 3WQ5A 1XIGA 1EBHA 4UR7A 1TJPA 4HPXA 1VHNA 4U10A 1K9TA 4JPGA 1TZ7A 2CLOA 1GVQA 1V0KA 2V63A 4JIEA 3BXWA 1NSJA 1HP4A 3C3NA 1NVMA 1LRNA 1H0IA 5T26A 3SCOA 2Q8LA 2QGYA 5EGRA 1F4AA 3TOYA 4HGXA 4TVCA 1X98A 2CLFA 3ZSTA 1XIBA 4JCMA 5K9CA 1M03A 3UQNA 4W93A 5CQ1A 4UTWC 3VPLA 1HGYA 3DGBA 1ICPA 1W9PA 3MMUA 4FLSA 3UVIA 1B57A 1OFEA 3AHZA 1PIFA 2Y8VA 4IUGA 2BODX 3OBEA 2D2OA 5LNWA 1KM0A 1Z42A 2PTYA 5FF0A 3MUCA 1MUWA 4PCSA 2NSXA 2FQIA 3GXNA 1PZ2A 8A3HA 4R9OA 1Y5XA 1JNEA 4IJCA 3VE9A 4O53A 1GVRA 3EXSA 1B3WA 4X60A 4DO6A 5CSRA 5CLTA 2PGEA 3UEQA 1SO6A 2XH7A 4CD4A 1JD7A 4FLOA 4C6PA 2WM1A 2QVHA 3MV11 3Q67A 1JD9A 1VEOA 1ZAJA 4MGGA 3TCSA 4ACZB 1S2TA 1R2TA 2JBMA 3LHTA 2XGIA 4DJFD 4GINA 4M6PA 3T44A 1CXEA 4CU8A 2J24A 3UWZA 1BGGA 3NQ7A 3JZEA 3CBWA 2WBGA 1FHLA 2VEGA 3T9PA 2PDQA 2XISA 2ZIDA 3W24A 1F6KA 1ONEA 2VC5A 3MUXA 1FWDC 1VJIA 3KOXA 1W3TA 1BYBA 5K9DA 1F07A 3T40A 4JTLA 2DVXA 4US5A 3DUGA 4K1GA 1WQ5A 1Q8JA 1UASA 1NFPA 4EACA 4O12A 3AHXA 4DWDA 4FZIA 4JL1A 5CPOA 5A1AA 2DW6A 4I7WA 4LGXA 5ECVA 1GHSA 1SZNA 1RR2A 1LWHA 4FXFA 2XIIA 4IMEA 1GKPA 1KGWA 4H9TA 1BXBA 2YDRA 4I6KA 4J4KA 3AIEA 4JTDA 5B80A 1JCLA 3SSJA 1GQKA 3N4FA 1LJYA 1QT1A 3LLDA 3C2EA 4LUJA 4PR4A 3L5MA 4B16A 4Q6XA 4DM1A 5LNVA 3TEVA 4MYXA 1EB3A 4F79A 4AVNA 3TYUA 2OU4A 3WD1A 4Q6JA 2XVGA 3IAPA 1JPIA 1CIUA 4C60A 4RXGA 3I65A 1OX6A 3VILA 3FSTA 4BEQA 2ANUA 4HQVA 5CBJA 5HA7A 3A4AA 1IV8A 1HUVA 3KBNA 3M0LA 3NEVA 4GMEA 3DKJA 1WBHA 9RUBA 2FZ8A 3O6AA 4Q4KA 4EWJA 3QHMA 5LGXA 3GAYA 1X1NA 4IQDA 2OYLA 5EPDA 4BQ2A 4ZOEA 3AZTA 4PCFA 3GHTA 3WLIA 2GJXB 4RV8A 4NZ4A 2PSNA 4N9EA 1LWJA 4US6A 4PFMA 3L4YA 1VFTA 5AC6A 4PUWA 4UCGA 3UZWA 1EJWC 3QC3A 2BVDA 1G1YA 3M6YA 4HHLA 4H7ZA 1E9ZB 2GJNA 1LQAA 1W17A 3LUTA 1KRMA 3LEPA 3TC3A 1CXFA 4D6EA 3I3BA 4PRTA 1P0NA 5I6SA 3WQ6A 4PUKA 3MVTA 3PBUA 5DN1A 3VDCA 2HBVA 1VFFA 3ITXA 3RYSA 3TCEA 3N3TA 1OK4A 2W4XA 3DBNA 4MB5A 4IGHA 1CBGA 3S9ZA 4B5TA 2WHKA 1J96A 4M7SA 1QNRA 1EX5A 2BDQA 4DRSA 3QFWA 1OF8A 3BCDA 5G4EA 5CSUA 1UP2A 5FF3A 2RJGA 3HG3A 1AA1B 4IXXA 3OQ8A 4UMAA 3LRMA 1J93A 3W76A 3UNDA 1DP0A 3KHDA 1JUEA 3TN4A 3NDOA 3T0CA 3WIJA 3FLUA 3YPIA 4GYPC 1XYLA 2PAJA 3AS2A 3VD3A 1E6XM 5LA2A 4PBEA 4D6GA 3LS9A 1LRQA 3OLDA 1WDDA 2ZOXA 3C0JA 3LI1A 1TUXA 3PAJA 3MKCA 3N3MA 3ITCA 1LQ0A 2BY3A 2OGJA 3IV3A 1RH9A 2RGLA 4PUMA 2WMHA 1WO2A 1CECA 5J5RA 3B03A 2P10A 3TK7A 3W1PA 1AVAA 1BYDA 1WDRA 2XIOA 2PE4A 3GR4A 3FX4A 1UZ4A 3EX2A 2JIEA 3RO8A 3WMLA 4TTUA 2CIPA 4MNMA 4MKNA 4TMCA 1HJWA 4Z2LA 3W1NA 2OWXA 1GOWA 2AL2B 3STEA 3RJXA 3TC6A 6REQB 1MWOA 1MNZA 4FIQA 4LUIA 1FKXA 1H5VA 3A6OA 6TIMA 1IE7C 3I4EA 2QF8A 3TQVA 2DSWA 1BF6A 2X2GA 5LSMA 5D04C 3RU6A 1JIBA 4BR1A 3IRDA 4Z2GA 3TA9A 3BLIA 3CL7A 4I9JA 4PL2A 3IK4A 2FZNA 4REQB 4XAGA 3WF2A 1EQPA 5EMLA 5CCZA 3TWBA 2VT0A 3KP0A 4UFKA 4IIHA 1W3IA 1H1YA 3UZ5A 1JEZA 3FJNA 3HPSA 4FEZA 4DAIA 3ECQA 1XKYA 3PPGA 1W0MA 5H1WA 5EMKA 2WQDA 3LTPA 3U3HA 1QU4A 3L5LA 1UIPA 3UG8A 4H6RA 2ZVRA 2PCEA 1AG1O 3WZ0E 2VELA 1TWDA 1FHUA 3QJAA 5REQB 1D7FA 4NZ5A 2YL9A 2PWGA 1RBOB 4UQEA 1UWSA 4P7LA 4AVOA 3FGCB 1VJSA 4Y96A 4RXFA 2NQZA 2VCCA 2YDQA 4HCLA 2VUYA 4KF1A 3CUHA 4XZBA 2FFIA 4DY1A 4XX6A 3V4BA 4JIIX 2NX9A 1TVPA 1MXDA 3L2IA 3MSDA 4ZB5A 1DVJA 4NZCA 2NVAA 1A5UA 1KXQA 1VEPA 2XZ7A 4PTMA 1US0A 3G6MA 2WZHA 5HR6A 5C2XA 4Q8WA 3IJ8A 3GC2A 4JD4A 3MI3A 3QN3A 4GCXA 1XIMA 4JFTA 4NHVA 3IACA 3CPGA 4RNJA 1RVKA 4MWAA 1ZU8A 1TIMA 4F8XA 2CERA 4K39A 1P0EA 2PDMA 3TN5A 2CLMA 2VWSA 2PDBA 1KFKA 2B31A 4JTHA 4K2SA 3CHVA 1CX9A 3WQWA 2YJQA 4BI5A 4XO7A 4W4QA 1UKTA 3UXLA 1FWEC 1WZAA 2YBVA 3M47A 2JGYA 4YXGA 2CYGA 4L6OA 2G95A 2CNCA 2NLIA 3ABSA 4IFKB 2ZZ4A 2HQAA 3RM8A 4C5YA 3ICJA 4QG9A 4Y9MA 2D1ZA 3ZOAA 4XZWA 3EGJA 1EP1A 1XSKA 4P8XA 5KMYA 3QGAC 3WLJA 2A6LA 3L12A 4J3VA 2VCAA 2ZTKA 1ZRQA 1CXLA 3NDYA 3LCWA 4GI4A 3TKFA 4F0SA 2Z25A 1AH0A 3TFCA 4Z1BA 5HJYA 4GIEA 1LL7A 1AQFA 4QSFA 3ZJKA 2DZUA 3ZJ7A 3CHDA 5DQPA 2CWXA 4JNYA 1VPYA 2XSBA 5C7HA 4ICCX 4ICMA 4XVDA 2VEPA 1TJRA 4XZIA 5XIMA 3I10A 4LUTB 5ABEA 5FJTA 3FDGA 4K68A 3EEGA 3KHJA 4HCDA 4OE7A 1TTIA 1HL9A 3AHVA 3PANA 1KD0A 1VHCA 4GVGA 4HYRA 3PNZA 4AY7A 3T8QA 1RY0A 4JKKA 4RE4A 3NL5A 1PX4A 1WDQA 1MW3A 1N55A 4KRZA 2OYKA 1T7LA 1VPXA 3Q2DA 4FK9A 2X7VA 2KZHA 3WNOA 4K37A 4AWTA 2QCEA 2VQTA 3C4UA 4GOAA 4IGNA 4PMDA 1RHCA 1K3UA 1P5BA 4YVVA 2DSVA 2I5GA 1JXJA 1P1MA 4Z1CA 3AJXA 1JRCA 4HA3A 3EB3A 1MQRA 4N2YA 3ITYA 1DWFM 3VNIA 2FB3A 2PWEA 3SGZA 1SZGA 3CAQA 4R7WA 1AH3A 3TN3A 2Q8ZA 3JR2A 2Y5SA 4CQDA 2PPGA 3VUSA 1ELSA 4QNEA 3VZYA 4B3KA 1QMLA 4MB3A 2B4GA 1TUFA 2XIBA 4W8BA 2GPTA 2QJHA 4C1NB 1VBUA 2WSYA 1E72M 1M41A 2BP1A 2NLYA 4AY1A 4B91A 3PUOA 4PMXA 5E5CA 1MRAA 1DORA 3OA5A 4FNPA 1JFHA 5BCAA 3PF3A 3NXLA 1KQZA 1AZ2A 2YCLB 4IIFA 4WOZA 4O11A 3N9SA 2WYSA 2ZXDA 3BOXA 4EANA 4P7OA 4LBUA 3WFAA 3GDKA 2FTWA 3R4IA 3UA3A 2BVWA 4HNUA 1QAPA 1QI0A 1RP8A 4N9BA 3T81A 4WGXA 5HMFA 5G1TA 3WK0A 1V7YA 3R0UA 2J6XA 1GYMA 3FYPA 4CQ8A 7REQB 1KLZA 3FV9A 2CPUA 5T8GA 2VZSA 1V02E 2X7WA 3GDTA 2ISVA 3ZLFA 1BXNA 4FP1A 4G56A 3DG6A 3Q94A 2C16A 3F4DA 5LIYX 2F2HA 4O0ZA 4GUJA 4A3QA 4HNOA 4RJEA 3CQHA 2VFFA 4OJYA 3FVMA 4Z0SA 5HMEA 2E9LA 5LNRA 5AYIA 2CLHA 4C1KA 1NOUA 2WSPA 3H12A 1UBPC 2OJPA 3OGVA 4AXKA 3H54A 4C7FA 5FKYA 2MUCA 4JY8A 1FXQA 2IQDA 1FP9A 4IJRA 3BG9A 3PZ9A 1ITUA 3K4DA 2CBVA 1JCTA 4M81A 3LCLA 1R3TA 4ZCWA 3B0VC 4Q4SA 2ZZ6A 4K8HA 4HA1A 2JE8A 4Q8VA 2E8ZA 3WFZA 3ZT7A 1B4EA 4GC3A 1P0KA 2O0TA 4JEJA 2XFYA 2OB3A 3ITLA 1E0WA 5EY5A 1FKWA 2ZA2A 1CXKA 3GVQA 2E68A 5CC3A 2A6NA 3VIKA 4I5UA 1BKHA 1S1RA 5JBFA 4HMDA 1OM0A 4U2YA 2Z4GA 5I02A 3N15A 2WSKA 2Q8XA 2E09A 1ME8A 3S5SA 2UBPC 3A21A 2DT0A 2W79A 1H61A 1BF2A 7CGTA 2VVSA 1HKKA 1XHGA 2QCHA 4WDTA 3WEZA 4AZHA 3GFZA 4BA0A 1KFWA 4JYFA 3TIMA 3BAYA 1KFCA 3WK3A 2VFGA 1YXDA 4WKAA 2J7HA 1KFEA 1PV8A 3NFUA 3TYCA 4E2BA 2NWSA 2VEKA 2PWDA 3MTWA 3QPEA 1CWYA 4C6JA 4ZTXA 1S2WA 3G22A 3QYQA 3W7JA 3LXBA 6A3HA 3EB4A 4CNNA 1ZJAA 5BRPA 4ZQRA 1JCMP 1UWTA 2O9PA 1VGAA 4GXMA 3VKKA 3H70A 1W8GA 3KRZA 2BOGX 3OVRA 3TH6A 2IW0A 1Q65A 4JTKA 5D9PA 4CUCA 2ZX6A 1PS9A 5D2TA 2VD8A 4OVXA 4YN5A 4B15A 4BWLA 3JVAA 5HAOA 2VFHA 3EKLA 1G4SA 3RO6A 1PTAA 3LI0A 2BVYA 2Y7DA 2BGQA 3W7KA 4L1GA 1R30A 3NSMA 5CG7A 3KAOA 3GIPA 4QCFA 4YU1A 3OIHA 3NQFA 5TBOA 4YHEA 5CPTA 1QASA 2Z26A 2G3JA 3W29A 1DQXA 1V03A 4MKSA 1V77A 4IM4A 4LSBA 3EOOA 3GIYA 3AWOA 4U3CA 1ZBVA 2E67A 1TPB1 4DUXA 3CASA 3VOHA 2GGIA 2J8FA 4F0LA 3CZLA 2V2CA 5AC8A 5AHFA 4NT0A 2HPIA 2ATMA 3OZMA 1SJAA 2CWNA 1JPKA 4O10A 4LRTA 4MSSA 1UH4A 4EIVA 1CGWA 3OYXA 4US5D 4PN2A 3A3WA 4MPQA 3S1UA 1XXXA 3EX4A 4GH1A 4BQ4A 1QWKA 1ZBWA 3ZWSA 1POJA 1VBJA 4LVGA 3SY8A 1C92A 1FWBC 3P60A 4AWEA 4KWUA 4J3ZA 1SZFA 3W85A 1R47A 2V3EA 2KAUC 2ZWYA 3UPMA 4BS0A 5BXRA 1A5NC 4IJBA 4TR9A 5C9ZA 5I7GA 2VQUA 1HTIA 4DYEA 4ERAA 2GJRA 2QV4A 4DB7A 3U7BA 1PIGA 4FA3A 4M80A 3I7QA 3UY7A 3CB3A 4J35A 4JEQA 3QTPA 4UOZA 5JH1A 1P6CA 2J6VA 3PZNA 4CVWA 1AJZA 4PB4A 4DBDA 1R9YA 4RNIA 3N1AA 2VRQA 2OZ0A 3DFHA 4RKAA 4C6OA 2FMOA 1REQB 3ISIX 1OX5A 3TQPA 2PP1A 3NYDA 2QYGA 1QJWA 2YYUA 4E8CA 3KUMA 1OK6A 2BX7A 3NG3A 2VWTA 1QATA 4TV5A 2FPTA 1C7TA 1GVEA 2C91A 4S3GA 3MKKA 1B2YA 3KS6A 3NQ2A 3L67A 5HXMA 3PTDA 3NSXA 1HQTA 3CV7A 3VCNA 3DYMA 3MSYA 4RLIA 3TW9A 3NO5A 4NZ1A 1LLZA 4Z1DA 1KR0A 1CTNA 1EUNA 4X3ZA 4AZCA 4GLEA 2XVPA 4CNOA 4J3SA 1A49A 1UWQA 3BH4A 3EWZA 3TLQA 3N2OA 1EOKA 4EAMA 1GGOA 2GUBA 4U2ZA 1XPGA 4QCEA 3SADA 4W88A 2QCNA 1X97A 4A2SA 3E74A 2OGYA 5C71A 2PDHA 3ZR4A 3RMJA 3E38A 3WJYA 3LCIA 1KM1A 1A3WA 5DXYA 4DAFA 3THAA 4CEXC 1E9LA 3WEOA 4C6MA 4Q4MA 2VP8A 5TNVA 1PX8A 3UG3A 1KNWA 4KQNA 4BF7A 4Z42C 3MB9A 4OKDA 3SY5A 2QZRA 3C86A 4JTJA 1UHVA 3TQKA 5J04A 4JTEA 3B9DA 1EXBA 2VEIA 3EYPA 3VX0A 4A3YA 2Y85A 4JFSA 1AJ2A 2XH0A 2GVLA 3N9RA 3L21A 4AF0A 2BNJA 3NTYA 3GW0A 3DC0A 2QCGA 3RRXA 3EMZA 1JF6A 3QMRA 3UFYA 4O18A 3NM1A 4NJKA 2P5NA 5F1UA 2QMKA 3GVWA 1NAL1 1ZFJA 1ZB5A 5A6TC 2F61A 1I60A 3QHOA 1H50A 3H24A 3QVQA 2OTDA 4EPBC 4FXJA 1XCXA 5LKYA 1O68A 3U48A 4EWND 4PB5A 3LHZA 4IXHA 2YBTA 2QLYA 1F74A 1ZLPA 4ZENA 3OPSA 5C9RA 4HA0A 5BWFA 1Q6RA 3PZQA 1U33A 3CV2A 4JTTA 1F3TA 2YBUA 1NWTA 5E0FA 1EIBA 3GU9A 2DIKA 4XVEA 3AMLA 4GIYA 1NWSA 1CEOA 3AWNA 3VOJA 1KBJA 4OUIA 3R13A 3L2MA 1ONXA 3W2JA 3IJ7A 1H3GA 4Y90A 1UKPA 3W23A 2D23A 1TQJA 3ITTA 3SRKA 4L9XA 3R10A 3P0WA 2XIQA 2PGRA 1E6ZA 2W27A 1LOLA 2DUXA 4IPIA 4DWSB 1VR6A 3WQEA 4K7VA 3ZS4A 1R3QA 3GVVA 2ZE0A 1VC4A 2EGZA 1GYNA 2HE5A 1W1YA 1QUMA 1SMAA 4L4MA 3LMYA 1OEPA 5HMSA 5E1QA 4URIA 4IG2B 3V0TA 3BOLA 4DBUA 3MP3A 1KV8A 2FHBA 3LM3A 3E0VA 2GOUA 1GVYA 3OEXA 4WSJA 3VAVA 1KXVA 4JQ3A 5JUVA 3EXTA 1TZ9A 1NF0A 3EBVA 3S3GA 1CI1A 3EXRA 2V0TA 3RXZA 4DEFA 3CUIA 1TSIA 4L1XA 4GVIA 1XH1A 5FJJA 4FNUA 2DU2A 3IJ6A 3OLGA 3WLOA 2PLCA 2WB5A 3M07A 1VQTA 3APTA 3W1LA 4F2UA 4LUSA 3BARA 3IS4A 4BY3A 4TX6A 5M1TA 2EPLX 4AEEA 4WXYA 1GQLA 2CBUA 4J5NA 2XPKA 2QUTA 1TRDA 1LUCA 4RPQA 3W22A 2G0WA 1IEIA 4R34A 3WH9A 2OZ3A 4O1EA 1Q6EA 3DEQA 3RX4A 5EMJA 2WZTA 4H01A 3UXIA 2NQLA 3HN3A 2Q3RA 3LLFA 4WY0B 1OCNA 1E5NA 2PA6A 4CU7A 1OC7A 3VU2A 4WQ6A 3TZNA 4ZO6A 1EJRC 2FH8A 1R3VA 3M5ZA 1EH9A 2FB2A 3CQ0A 3SDOA 3UR5A 1PAMA 1CENA 1LZOA 1CCWB 6TAAA 3DFNA 4F0HA 2NQJA 3A5VA 2RDUA 1YDNA 1EJ7L 1KCKA 3IWPA 3PJUA 1M65A 3B8IA 3LB0A 3MPGA 2HTMA 1M7PA 4XAPA 3TJLA 3CWOX 1TTPA 1OGBA 4NI3A 5E9XA 3WLNA 3UNTA 5BXSA 2V81A 4F9DA 3G3MA 5KZDA 1K4HA 2VL4A 1ME7A 3LPOA 3W7NA 1WUEA 4I8YA 2V67A 4QS5A 1MEWA 4OQVA 2P8CA 2YXOA 3IEBA 1BFNA 1HVQA 3QW3A 1XPYA 4FPSA 1V6YA 1RPXA 4BF9A 3T4CA 3S2NA 2G4JA 5JQ9A 1LORA 4I5XA 3JS3A 3RR4A 1AMYA 2Y88A 5K2ZA 4G7FA 3OLEA 2IUZA 4L4OA 2QDGA 1J0ZA 5EMMA 5DT5A 2UY4A 4HK7A 3KE0A 1QCWA 4CN1A 5KTLA 4NZJA 4U33A 1US2A 4W7WA 1RK5A 3BQ5A 3GQYA 5FAJA 3HM7A 1KKRA 1ADDA 5A8MA 2TPSA 3MJMA 4GGBA 5FL0A 3NAVA 2E1DA 3PPHA 4JDBA 3TE9A 4HN4A 2HEJA 3DFYA 5M17A 3B3DA 4NAFB 3SUTA 1LCOA 1WZMA 4DHGA 1UH2A 3KBVA 1OYAA 4Q8MA 2Y5JA 1XRTA 4D6IA 4EPDC 1UP0A 1NF7A 1QXLA 1KC7A 4QISA 4UXDA 1FOBA 3BLOA 3EWYA 2TSYA 3KXQA 4PL1A 1VFHA 4UTUA 1H4PA 2WVVA 3AIWA 2G3IA 4CNUA 5FL1A 3QOMA 1C8VA 2ZRUA 3JUGA 2P3EA 4NF7A 4YL2A 1VBHA 5DELA 3M64A 3H26A 3UCDA 4UQ9A 1XC4A 4DYKA 3DN5A 4KFNA 3CEPA 3HBLA 3K8MA 1TWSA 1EJVC 2W3ZA 3MVIA 5HR7A 3ZWTA 2OX1A 3NQAA 2VCBA 5FEPA 3L23A 3PZOA 2BLEA 4JICA 5IM51 3CTLA 3ONCA 5IHRA 4AD3A 2PLMA 3LSCA 4D6HA 3WDRA 2ZCGA 5G2HA 5C0QA 1JFXA 4O1AA 2F7FA 4LEFA 2FTPA 2WWDA 5DLCA 3VZXA 2O4QA 4PUEA 3IIPA 3TNOA 4TTGA 1QW8A 3KEHA 3I7SA 4E3VA 1VIZA 2P1FA 3MSRA 2NUXA 1G9HA 1B3YA 4B5WA 2E3ZA 2YA1A 4MJ2A 3G1RA 4Y2WA 2J47A 1I2NA 3A3HA 3CPUA 4P2VA 3O05A 4DBSA 5LZLA 1EO5A 2NT1A 3S9IA 4FI4A 4B5VA 4O4VA 2GYIA 3MMWA 3OHMB 3R89A 3LK6A 1K8YA 3WQ4A 3SY1A 4O28A 3T08A 1A0EA 4A8IA 5EMUA 4U28A 2BY0A 5DT7A 5HWNA 3GU2A 3S0CA 3EWWA 1Q6CA 3GXMA 5DRCA 3QLLA 3W28A 1J0KA 4NKCA 1BWLA 1DWGM 4ZFMA 4N4QA 3T07A 1R6WA 3FN9A 2VI0A 4LAKA 3I6TA 2O9RA 3DFOA 3RGTA 1UB3A 4KBXA 1QR7A 2DZPA 3BW4A 3SQMA 1IXNA 1EKOA 1XBXA 9XIAA 1V51A 3W7RA 2W92A 2Z7KA 2UY3A 3C3UA 4KW2A 3PTQA 4C1LA 3H2MA 4L6DA 5D09A 1O1ZA 3PBGA 1MFUA 4H8UA 1Z6KA 3MYOA 3M44A 4O8RA 3C2FA 3ZJ6A 4HNVA 5I2UA 3WNMA 2OMAA 5DY2A 5AYYA 4UTKA 1IT8A 3UR7A 2PRHA 3VGHA 5K4ZA 3WX7A 3JRKA 2E6YA 3UETA 2WLYA 3DX5A 2JFEX 3AAMA 2QXWA 5ABFB 5LYRA 2DJLA 1K9DA 2VC7A 5BU6A 2WCSA 2FDMA 2IKGA 3W7EA 5KZ6A 3PC0A 3QC0A 1BQCA 3SFWA 4ZOBA 1VCVA 3UD6A 1QNPA 2BHZA 1SGJA 4LNCA 1V93A 2W6RA 4PSPA 1SR9A 3HGSA 4HU4A 4UFLA 3UXKA 1E5JA 1QBAA 4MUPA 1OX4A 2YCJA 2Y89A 4OV4A 2FZBA 3CAVA 3U5UA 3KDNA 1RAKA 8XIAA 5A6AA 3BV7A 1WP6A 1QWGA 1VPQA 2X0HA 1ZBCA 3R8GA 4LYQA 5LA1A 2D2HA 3GM8A 2REQB 4RX0A 4JX5A 1R46A 4GO9A 3CZKA 2B81A 3C52A 2HVNA 3LOTA 5CAKA 3M16A 4M82A 3UT0A 3CUFA 2XIJA 3TSDA 5CPQA 1PWMA 3QXBA 2R1MA 3W1MA 1NOFA 3FA4A 3ONBA 4Z2IA 4NP7A 2NV9A 3AYVA 5G5IA 2C1IA 2D2JA 2ZRWA 4LAUA 4PMNA 1YRRA 1WV2A 3QR3A 1G4TA 2ACUA 2VRKA 1J2WA 1TJ2A 3R0KA 2PODA 4JNMA 1RJRA 3VNMA 1ECEA 1UIOA 4ATDA 4GWEA 4ZA0A 1H7OA 1V6VA 1OIMA 1S2UA 4HHPA 4NRRA 5BRBA 4QXIA 4DVOA 4H9MA 3T2QA 4GI9A 1FXPA 2G4FA 4RDVA 3OVGA 1T0OA 1PUDA 4JTSA 1A5SA 2FGBA 4D72A 2VDHA 1JZ7A 1XD1A 4LVDA 1X38A 5HUPA 1GTEA 2A7PA 2PCQA 5AOUA 2EPHA 4NI8A 1EF2A 2WBKA 3QOKA 4IFRA 3C5QA 1J9YA 2IKJA 3GG1A 4JXCA 1YMYA 1KGUA 2RKXA 3EAUA 4FNSA 3AIRA 3M43A 1F5ZA 1PKNA 1C91A 3PSVA 5CZKA 3AROA 4U5IA 3WH8A 3E2QA 2I57A 4HMCA 2AKZA 4QDWA 1R3SA 1XSIA 3WK1A 1D7KA 2X40A 1I1XA 3AS0A 3BAIA 3P62A 3V0SA 3HQOA 4N02A 3MCMA 3BJSA 3VKDA 3W0KA 5AC5A 1CLKA 1LL4A 3VKAA 4ZQMA 1XCFA 2CZEA 1PYMA 4PH6A 4KESA 4KCUA 3NQVA 3HO8A 3N13A 4L5ZA 1J0IA 3PUEA 2Y5EA 1T5AA 1C93A 4EAYA 1EO7A 2EEXA 4S39A 3LU2A 1NP0A 1TPH1 3V75A 1PTGA 2CXGA 3LM7A 2XH2A 1OYBA 1W32A 3BC9A 1SW7A 5HJXA 3BMVA 3GG8A 3SW6A 3ZFHA 5MF5A 3O6YX 5A69A 2V5BA 3W00A 3DG7A 4CEUC 1BLIA 3AYTA 2A3HA 4MDOA 1SO4A 4R9XA 4QAWA 1UUQA 2V69A 4A6GA 2JF7A 3G6LA 3ARUA 3VD5A 3O2LA 4E8DA 4EOUA 5SWUA 2NXGA 3TR2A 4UTTA 2INZA 4IMFA 3KZSA 5F4XA 4E0CA 5F2IA 3BICA 7A3HA 1NDVA 3VOGA 2WPGA 1XLIA 1M6JA 3ZR6A 1EGMA 1UKQA 2QJNA 2Z6JA 4KS0A 3BMXA 1M1BA 4A8RA 3VZZA 2D0HA 4RDWA 5AKQA 2PU0A 2DJXA 4I9MA 2DEPA 1DHKA 5C8BB 4ILSA 3RPMA 1K7EA 3WD2A 2VNCA 3M46A 1J6PA 3WUBA 3VC5A 2VDIA 3DECA 1TCDA 4DI8A 1POKA 4O1FA 4AD5A 2D24A 5CJNA 2XSAA 4GZIA 1UR4A 1TMLA 1ML1A 1VENA 3PG8A 2QV5A 4UCFA 5BU9A 1HNYA 2YW4A 1GOQA 4KCTA 2J4GA 1GWJA 3IVUA 4DJFA 4C6QA 1IWPA 2I1OA 2C71A 3E0FA 1ADOA 4GISA 4I5RA 5C6MA 1NU5A 1S5TA 1VFUA 1B0IA 4H9VA 5BZAA 4A21A 4E2VA 1M68A 1GCYA 4J1OA 3W53A 1ZSXA 4P7RA 5DO8A 3VNYA 1KBLA 4GACA 1TMHA 3WJZA 1VH7A 2C3ZA 5A5WA 1KCLA 2BY2A 1QPRA 2RFGA 1E4IA 3E2SA 4K36A 1JZ2A 4QG6A 3MI6A 1E3XA 2DORA 3APYA 1UR8A 2DVUA 3EKZA 2W91A 5FAGA 3RM9A 1PJ9A 1V08A 3T09A 3W26A 1TPDA 1JQXA 2OZ8A 4GCAA 3RCYA 4KFOA 4XG1A 3A4XA 4QLJA 4NG3A 4HA4A 3AC0A 1GOKA 4WD0A 4IPPA 1OZQA 1XLBA 4DUVA 2VDGA 1T99A 4RZBA 4C6NA 1OIFA 1XYAA 2HXTA 3QRHA 4MYAA 4N9CA 4PEKA 3UA4A 3LGGA 4IMDA 1M53A 2VEMA 1HN1A 1DPMA 4UTFA 1W9UA 2XVLA 2ZQ0A 1LL6A 1M3UA 3MZ2A 4H8VA 1MXGA 2V5CA 3BDKA 3WFLA 5A2CA 4LQ1A 3N11A 4X9YA 3P5ZA 4XZ9A 1E1CB 1XLHA 3B97A 5GJPA 3NJ3A 1C8QA 3CZ8A 3ZO9A 5A8PA 1W9BM 2VUNA 5JVLA 1D3HA 4W85A 1ONRA 2EKGA 5DFAA 3HJZA 4JS3A 3QQ0A 2E6DA 4ADTA 5BOEA 1BYAA 4RNHA 2A3AA 4L80A 3PK7A 1R3RA 3CH9A 1TR1A 3LHWA 1AW1A 2Y62A 4PMOA 1JCYA 5D30A 4P61A 3BLEA 1H41A 1KGXA 3EDEA 1HKJA 1L8NA 4QDPA 4XQ6A 1VBRA 4PBFA 1ZJIA 1UOKA 4B4HA 3WD4A 1DJXA 2D3LA 1TJ1A 2G41A 3A24A 3F1QA 4M3PA 1LM1A 4JTRA 3S1VA 2I9UA 4ORMA 1IEWA 4Q8OA 4KRTA 1Q7MA 1PCKA 1SFSA 4EE9A 1RD6A 5BW6A 3GNOA 3SIMA 1A50A 1K9EA 3VOIA 3EX3A 4GZEA 3B8WA 4V15A 1UD4A 4HYWA 1R87A 2XFWA 2EF9A 3F03K 3IANA 3OYZA 3UERA 1HKVA 3TMLA 1XINA 1UC5A 3IRSA 3T05A 2PD5A 3L4ZA 4YTTA 2UV8G 3MWCA 3F4NA 3PBVA 2O7SA 4NJJA 4UTWA 3OODA 4PTXA 1GUVA 2VURA 3UWQA 4ES4A 5I3JA 2FPYA 2NW0A 2OYMA 3S4TA 4MNJA 2V5JA 2QIWA 1MZHA 1E73M 3CUXA 1ME9A 5D8WA 3RPDA 5J8LA 2XYLA 5A8QA 3AO0A 3PY2A 3T78A 1FWHC 4EF8A 3NPXA 3ABOA 1XRSA 3B06A 5A2AA 2WJDA 1RP9A 1OFDA 1H0GA 3NZQA 4ZTYA 4R85A 3FVDA 1Q6LA 2YPIA 3DU0A 3M7SA 1FWIC 3ARQA 3WBAA 2YLLA 1YTDA 3G3DA 4E3TA 3KP1A 3GBEA 1R85A 1KTCA 1BRLB 1XLFA 4L4LA 2OR2A 4RDZA 2IKIA 3RX2A 3W9ZA 3K5XA 1TVLA 1CYGA 4H7VA 3ZIZA 2IQ0A 2PBGA 3GR7A 4V33A 1AFSA 1DJYA 3CL8A 4A8LA 3LBMA 2QCDA 2G3MA 2NV1A 1SFTA 1O4UA 1EA9C 1OB0A 4Q8NA 5CZSA 4MZ1A 3MMTA 1TRIA 3AXKA 4KETA 4IGSA 3M5VA 3W71A 3TAOA 3FEMA 3S5ZA 1TJ0A 2A3BA 4J7RA 1PKMA 3XISA 4QEEA 2A3EA 1N2VA 4Z2KA 1FH8A 3AHTA 5BROA 3TYBA 3C6CA 4AQLA 1CZ1A 4DQWA 1I6NA 2W61A 3NGFA 1U83A 3MV01 2G5WA 3WENA 1S39A 2GVEA 2C0HA 4JDYA 1W9DM 1XG3A 1IZJA 5C54A 1OFAA 4K7YA 2GGEA 1HO4A 1QNOA 2ISWA 3BE7A 2CHOA 3STPA 2ONEA 1EWDA 2OWWA 3PB0A 3A4JA 1QNQA 4DZ5A 5C55A 2G3NA 3E6EA 1GQJA 4JHZA 3TOPA 3NQ8A 3CLMA 3LHYA 5D4YA 2ACQA 2AQOA 5CC7A 1FWRA 2YCIX 1WB0A 3U5YA 3THCA 4DLFA 5C9WA 2GDVA 1KXHA 4GBUA 4ZXLA 1OCQA 2GQAA 1LP6A 1P4CA 3U7VA 4XIMA 7TIMA 2AGTA 5DX7A 2HNEA 1T41A 2V9DA 4IICA 1Q85A 3WF3A 1YEYA 2DUAA 1W1VA 2PDPA 5AC4A 3O15A 4AU0A 1W56A 2AQWA 3KVMA 3IJLA 1VYRA 2FZ9A 5XIAA 1MMFA 2YA0A 5A6SA 4HOWA 2YL5A 3AFBA 4F2BA 2P50A 4NXKA 4AIUA 4AB4A 4KEMA 3R12A 1UMYA 2IXUA 2X0SA 3HTWA 1DIDA 2ISFA 4HOXA 1W54A 4INFA 1OBAA 1Y8BA 5AFDA 4R53A 4O4WA 4UOQA 3KCJA 1HKIA 1GYLA 1EHNA 4HPGA 2QUUA 2PU1A 4KWWA 2Y0FA 3ID7A 4WDXA 5DY3A 3T4WA 4YTQA 1KBBA 4JY9A 3IGSA 4DX3A 1WXJA 4S23A 3V16A 4GXPA 2XFFA 3S9YA 1HKMA 4R3UA 4Y9OA 2JQXA 4Q8PA 1AJ0A 4FX8A 4UTTC 4FF5A 5EBUA 3P8JA 2GDUA 3WQFA 3H8AA 1BAGA 3MW7A 1GZ1A 3N2XA 2Z24A 3ZLHA 4ACYA 3VGGA 2IPJA 1QHZA 3DFPA 1BSLA 2FH6A 3NZ1A 1LBFA 3GX9A 4FAMA 3KTSA 3SI9A 1C7SA 1UWAA 2J7EA 4HD5A 4JQ2A 4S3KA 4C6EA 2INFA 3P93A 4GYPA 2DW7A 1XW8A 1ZBKA 3BGJA 1OGGA 4NJGA 3E9AA 4F66A 4WSHA 1CGYA 3DDMA 3WJWA 2LLEA 4IPNB 4UTHA 3O3RA 2FVLA 4DUWA 4F48A 2W0UA 2E0PA 3I6RA 4D2JA 5A3HA 5CPLA 3OB8A 4Z17A 1A0CA 3HURA 2HVOA 4U4MA 3LERA 4X22A 3KDOA 4J2PA 4KWSA 4C6KA 4FIRA 1EP3A 1VYPX 1DE5A 2A21A 3ARYA 4LNYA 1O7AA 5I3HA 2PZ0A 4QITA 2XVNA 1TVNA 5HK4A 1XH0A 2OO6A 3BL3A 2QDEA 5CPMA 2BXZA 3UF9A 2H9AA 4CQAA 1W9XA 2OCZA 3CPRA 4WKHA 2EG8A 3VI2A 2ZYFA 3RLUA 3RJYA 4H83A 1FH9A 1PSCA 5CEWA 2VX7A 3FYYA 3QGKC 2WMGA 2X16A 1ZNNA 5JU6A 3OP2A 3TFXA 2PTZA 2HXUA 3R5EA 1JR1A 2J66A 3VNJA 3LNMA 2TODA 4G2DA 3QLDA 3W02A 3VM5A 1XG4A 1N8IA 4X63A 4HNCA 5CPSA 3GO2A 4DYJA 1XS2A 5HMDA 1M7OA 4KH2A 3BTNA 2Z1BA 1H62A 1O5QA 3VO0A 1VD6A 4GIAA 2GJLA 2AL2A 3UJRA 1JUKA 5D2WA 3WQDA 5C70A 3NCOA 2GQ8A 2C15A 2OEKA 2D69A 2JKPA 4LY4A 2EPMX 3BZGA 3GW3A 1TPEA 3MT1A 3V18A 3ZT5A 4AZ5A 1O94A 1V3KA 1MSSA 3N2TA 2HS6A 3URNA 4GPNA 4PSRA 1B3OA 1ISWA 3GIQA 4M24A 1WYIA 3WYZA 2C13A 4IX0A 4REQA 4PMRA 4HPHA 4TX8A 4AD1A 1QFEA 4PMZA 3LCFA 3HGRA 1XFCA 1PWLA 1U22A 1IQ8A 4S38A 1OVDA 1WBJA 2PURA 2PTXA 5CC6A 3AIQA 5DBUA 1E1EA 4KPLA 5CBIA 3NGJA 1PYFA 5GVJA 5IDZA 1LLOA 1B9ZA 3BQ6A 1JULA 3NPWA 3DENA 3VMOA 1W3LA 3EPMA 2J9ZA 2J8GA 3UZZA 3N12A 2VR5A 3BAJA 1YDOA 3H7VA 4W8LA 5XINA 4UZUA 1RXOB 2H8XA 5REQA 3E0WA 4UFJA 2NXIA 5CGQA 1TPUA 2EPNA 3FGCA 3MS8A 3GVRA 4W87A 5I0DA 1I9CB 3W1QA 3W75A 5LIXX 2PDUA 3SCTA 4HHHA 2Y7FA 4BZYA 4LB4A 4YNGA 4EVZA 4ZOAA 4ZO8A 3PZMA 4O15A 3FHQA 4FR1A 1U1HA 1TR9A 3SCVA 2BXVA 4NILA 4A3UA 2FTYA 3P81A 2PDJA 3WD0A 2PC4A 1QOQA 2PDFA 1YNQA 2ZICA 4RW3A 2W67A 4M19A 1K9FA 2FJUB 3EOEA 5C5YA 5F2LA 1J12A 1UR3M 4LC8A 1Q6DA 2GQ3A 3GDRA 1XV8A 4JOMA 1Q45A 2E9BA 3W6MA 2W9MA 4NVTA 1Y7VA 2WO5A 2XWEA 3T42A 4ZXOA 4JHMA 1FVPA 1UH3A 4CN6A 1WZKA 4UB9A 3TXVA 4EXBA 1IR2A 4WJXA 1UW9A 4AFYA 3ARSA 3BWWA 4CD7A 4OBSA 3CT2A 3WDPP 3P3BA 2RDTA 5ECUA 2Y70A 4MMWA 1PO9A 3UGVA 2E8YA 2X1RA 3ARZA 5GNXA 3UCQA 3EWCA 4C7DA 3MZNA 4D6CA 1GW1A 1RBAA 1MXSA 2XGBA 2OO0A 4IFKA 1K03A 4DO5A 5AC7A 1JDDA 4PUJA 1RVGA 4WSKA 2J25A 1YE6A 3B8DA 2ZUMA 1BWVA 2IXVA 2RDXA 4PTVA 5FIPA 3U4AA 5FESA 2ZX5A 1WAWA 1HF6A 3P80A 3TYDA 3OU8A 5A95A 2CHNA 2X09A 3LD5A 2WHMA 2IPFA 1OFPA 4CD5A 1EX1A 6ALDA 1A53A 1JZ6A 2YCEA 2PDXA 1CLXA 3VKJA 1EEPA 2BWGA 4W84A 3B0XA 4J3XA 4B2DD 4F40A 1JPMA 4JTUA 3T55A 4N6EA 4RZ6A 1UP3A 3OZPA 2FVKA 3QV7A 4S3AA 5AYBA 2J88A 3E02A 4JN7A 4RZ5A 4LUTA 3POHA 3B9EA 2BZNA 4WHBA 1XGDA 4UC5A 3W84A 1VKFA 3ENLA 2FZMA 1L2UA 4MNLA 2VJXA 3AXHA 3L9CA 3PHAA 3P6LA 3W86A 3NO3A 4GRSA 4LYRA 4ASTA 1RUSA 1N7KA 1SVDA 1Z48A 3NYZA 3GC5A 1UWIA 4OOUA 2F6XA 5E93A 3O1NA 1OABA 2I5QA 2ZC8A 1GG0A 1FFRA 3ME3A 3BLFA 1B1YA 2QAFA 4IT1A 4D6JA 1TA3A 3MU7A 2WCAA 3F5KA 4HTYA 4LYPA 4LUSB 5D03A 1S5WA 4ATWA 1NY1A 1RSCA 4GH3A 1XWYA 1MFVA 1U1JA 3CMFA 1Z3NA 2XZ9A 3FS2A 3WNNA 3RCMA 2AAAA 5FJIA 1LUCB 4Y6GA 2ZRVA 3PUDA 1W1ZA 2F9RA 1XL9A 2NQ9A 2GL5A 4JIHA 3B04A 1SUXA 1MEHA 2QDHA 3D3FA 5I03A 1UA7A 2QUNA 1B3ZA 5KETA 2XM2A 2Q09A 3A13A 3EKGA 2J27A 4IMGA 2B0MA 3N17A 3P8IA 3BCJA 4I9AA 2WJZA 3WQPA 2CKSA 3ATYA 1EJXC 3OBAA 2JEQA 4MY8A 4XZLX 4YJ5A 2AAMA 5T91A 4CNSA 2Y7GA 4PRWA 5C9UA 1X39A 2PS2A 3CQJA 3WLKX 1ZALA 3EA3A 4A05A 1K70A 2BG5A 1QI5A 1DQWA 4ATLA 2E6AA 1GZJA 3SN4A 3WH7A 4H4IA 4S3DA 4GY0A 4DZHA 3PWAA 1XGEA 4TU1A 1JUBA 1EBGA 5EMYA 3ZVHA 1BKSA 1E0UA 1ZTVA 3Q45A 5IDIA 7REQA 4N6FA 5F1VA 1PX3A 4KIEA 5DMYA 2WZIA 3THQA 3IPWA 2PDNA 4YWSA 1FCBA 3DYPA 3GKFA 2Z2AA 3MA8A 4C6LA 3GHUA 4HHMA 3PP7A 1JCNA 4OOZA 1FWTA 1I75A 4V27A 3WSUA 3L66A 5CJ5A 1LBMA 1M5WA 4I6VA 1W3KA 4LRSA 4NYUA 4JYEA 3CUGA 2P8BA 4P7QA 2WM0A 4D8AA 5T9CE 1THFD 2ICSA 1IGWA 3R58A 4FB7A 1XI3A 3IJQA 3S6DA 2POZA 1ITXA 3WMSA 3WDQA 3DG3A 5JMUA 3L0GA 2HDJA 1YPIA 1FTXA 3DGRA 2I16A 3W1XA 1U1UA 3S8HA 3GTHA 4I8DA 2QDDA 1V3JA 4EP8C 7TAAA 5LHEA 1JZ4A 4H6EA 2X8RA 3VDGA 4IIEA 3QHNA 2WW5A 2W62A 3N9KA 4ZZ9A 1AW5A 3F4VA 4E38A 4I9TA 3OGRA 1PEZA 2PMQA 2WVVB 1BGAA 4GZJA 2PLKA 2GK1A 4FXSA 4UNKA 4JNZA 1BTCA 5I3DA 2ACRA 3AMDA 2C8NA 1J5TA 4IHCA 2OODA 1UD2A 1KBIA 2CZDA 3M0VA 5L6UA 4L61A 3C2YA 3UG4A 2RH9A 1UKSA 2V6AA 1GT8A 1Q2SA 3UWWA 3S5OA 1TE6A 4YYFA 1NDYA 3ORWA 4O16A 1H60A 1NH6A 1OFRA 4QJ3B 2HE8A 1B90A 1ITQA 2J77A 5EFFA 1XDMA 2R8WA 5B7ZA 4JZ5A 3IVTA 4G7EB 3G18A 4M6QA 3S2CA 1OCBA 2EPKX 4IIBA 4E8GA 2DH3A 4KERA 5AYXA 1DV7A 5U4NA 5CGTA 3Q37A 2X05A 3CO8A 3VTRA 3NOEA 4XIAA 2WVTA 1UZDA 1HKWA 2EG7A 4F9JA 5A6BD 3NQ6A 1S2CA 2I9EA 5CG0A 1FHDA 2VR4A 3BLDA 2VM8A 3MQTA 4YVPA 1ODUA 2WNWA 3IUIA 1R3YA 3LXAA 4F3HA 1GTHA 3ERPA 5FCZA 5G4WA 3R94A 3M0IA 2HPMA 1VS1A 4QJ1A 4TIMA 4UBPC 4HK6A 2WMKA 3M1ZA 1Z8AA 4MJMA 4ALDA 2AL1A 4HPJA 1ZJHA 2RHGA 2L5HA 1CXHA 1FHVA 1NQ6A 1W1PA 1UWUA 2JIWA 5FOOA 2XSXA 1RLCL 2ZKMX 4GD0A 3WH6A 3FK4A 4UR9A 3EDDA 5ENLA 2QPXA 1E6QM 1WUFA 4H8HA 4X0NA 4GVFA 1WZLA 4NY2A 1K7FA 2MANA 5EFDA 4AIEA 4LS2A 2E5DA 2ZA3A 2PZNA 3RNDA 5MHBA 4IGMA 3G77A 3GUWA 1JVNA 2ZXQA 1T8QA 1BG4A 3W7LA 2HWGA 2Y8UA 4Q3MA 2YDSA 3LYEA 3ES8A 1TE1A 3UPWA 2QULA 4PBGA 1ICQA 3RM4A 1TMQA 2ODOA 3U6WA 3AYSA 3TW6A 1EEXA 1Q6GA 2DZVA 2BSLA 5BMWA 4LU0A 1ZAHA 4B9ZA 2YX0A 5BXTA 1YQ2A 4DXVA 5HBFA 4DF2A 3CO4A 4NL1A 2GOKA 4LS0A 1R3WA 1LRTA 3PVFA 4BQ3A 3OHIA 1Q3NA 2QVNA 3MHFA 4AY8A 2CLIA 3GZ3A 3V36A 1ZP4A 2OQHA 3J7HA 4WR3A 4BCEA 1E0XA 1BQGA 1HJSA 3MY9A 1SYTA 3ZXWA 2C14A 4UQDA 1OGSA 1P6BA 2QPSA 3S5YA 1GW9A 1DTNA 2X1UA 2WMFA 3CLWA 1LLWA 3SUSA 1V6TA 2I14A 3H2FA 1P0BA 1TWIA 1REQA 5TF0A 3VGEA 2CCRA 5I24A 4NNCA 3AU2A 2VXNA 1F05A 5LNUA 1P6WA 3W1UA 3KBJA 3CHEA 4ZO9A 2X30A 4JGDA 4L9ZA 1N8FA 1W31A 4PC8A 3HV8A 3PBYA 4DXKA 4Y8FA 2ASHA 4X61A 1ISXA 3I68A 3SRHA 3RX3A 1H63A 1ZCOA 1JF5A 2D73A 2VGBA 1IIHA 1JG9A 4DPPA 1J8VA 4PULA 1I0BA 3LZ3A 1KM4A 1J0HA 3JW7A 1RQBA 4GQRA 1XLCA 3D0CA 1RK6A 4B5SA 2VGGA 1R8LA 4Z1AA 3O06A 4QFUA 1V79A 4XZMX 3O07A 4JN8A 5CGMA 3RUBL 1VFSA 2PWHA 4Q8UA 4E2OA 1TB3A 3SIZA 1DJNA 1PDYA 1QHPA 3ZMRA 3GY1A 3W72A 3V3WA 1HL2A 1VAHA 4N7QA 1PVNA 3GNPA 4XAFA 3P82A 4ML9A 2R14A 4Y9NA 2Y6ZA 4RE2A 1TPVA 4V1YA 3IIVA 2YCKX 3CMGA 4OHQA 5H91A 1JDEA 2HK0A 4M1RA 4XZHA 3LENA 1W9VA 1Q4NX 3HFYA 1XIJA 4QE1A 1MYRA 2GVJA 3PFMA 3CMJA 4M5PA 1UJQA 2VKZG 2PWUA 3OJGA 2Z0IA 1NFGA 2Z2BA 4JFUA 1O5KA 2WMIB 4F0MA 4C90A 4D8ZA 2Z1KA 2F38A 1XBZA 3P67A 5IBXC 5LA0A 2GSEA 2X42A 3JZUA 1WKYA 4O0KA 4RPPA 1KWGA 4LAZA 2PLJA 4XD3A 2QKFA 3LHVA 2WKLA 3DFTA 4Z08A 4NUWA 3HZ3A 5DCDA 1W5NA 3FY1A 5I06A 1YPFA 2NX3A 1NIUA 2DFAA 5D9OA 2ZVIA 5FEZA 1NQKA 2J13A 5E0KA 1V4YA 1PTDA 4JHOA 3LLXA 4RCXA 3DYOA 2E5CA 3TTEA 1TV4A 1ZS2A 2FIQA 4MADA 3R2GA 2W66A 2V3DA 2PC8A 3H21A 2VR2A 2OKOA 5D05A 3FJ4A 1F7BA 2WC3A 1C8XA 1E9YB 4MWAE 4U3AA 3MBDA 5HULA 2ON3A 1CGUA 4H6QA 4GKTA 4D6FA 3U2EA 1UUOA 4WK9A 3M4HA 4TXEA 2YZ5A 1GVFA 2J9YA 3NO1A 4LC6A 4AIOA 2QUVA 4H19A 4WGHA 1KFBA 3MUAA 3CZGA 3EMCA 1MNSA 2ZUSA 5AZ1A 4CQ9A 1YW1A 4LANA 3RPTA 3SFKA 5D33A 1FWNA 1EDGA 4DWSA 1VRDA 1LDCA 5AHMA 5GPRA 5I3GA 1GORA 4LVFA 4OTKA 2FJKA 1SZRA 3CTTA 3PFRA 5CC5A 2O9TA 8XIMA 3WJSA 2OELA 1YBQB 3AZRA 1AQHA 2VMFA 4AHPA 1K6AA 3GBDA 3KBMA 3PG9A 2Y24A 5F2MA 3SJ3A 3EA1A 4KCWA 3AS3A 4IG2A 1GJPA 1JAKA 1GEQA 3IGHX 2EQDA 4IIGA 3FAXA 4HZ6A 1V6WA 1ICSA 3FIGA 1H7XA 3MJYA 4HSOA 3KTXA 1HZYA 3GYCA 2YKKA 5I07A 1XRFA 4I90A 5CZJA 2QPUA 4V1XA 5D8ZA 4OBTA 5FD0A 1BYCA 2A7NA 1XBVA 3M9YA 1IWBA 2CU0A 5G1YA 3V1PA 3MYPA 5A2BA 1H2JA 2PF0A 1ALDA 1PXGA 1QPKA 4L65A 3DIPA 1EOMA 2POTA 4GI8A 4C5ZA 3W7DA 4QBXA 2BXYA 3POCA 2WKGA 4Z0JA 3P2VA 5CPNA 1HP5A 1JPDX 1AL8A 2GSJA 4OWGA 4XBJA 2DY3A 3G0SA 3LCXA 4NRSA 1TPFA 3QQ1A 4WY0A 4EXAA 3BSHA 1NWRA 3LA4A 1OFOA 1ODZA 4ZR8A 3ARWA 3WMCA 3W74A 1NDWA 1MQPA 3FW6A 3TYZA 2ZTJA 3L2LA 3CZEA 1XH2A 4QE4A 5TQLA 4HZ8A 4B3LA 4C6IA 1GJWA 3T7VA 3DC8A 4Q4PA 2QGHA 4BF5A 4LV4A 1F4HA 4FMVA 1J79A 3R43A 3EA2A 3ZQ9A 1UA3A 1UC4A 5G2WA 1TV5A 2C18A 4AZ7A 5A6JA 1C3FA 1TV2A 2CC0A 3M0MA 3WDIA 3HGJA 4G1KA 3VIOA 1Z7AA