2DY3A

Crystal structure of alanine racemase from corynebacterium glutamicum
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
361
structure length
338
Chain Sequence
MNLLTTKIDLDAIAHNTRVLKQMAGPAKLMAVVKANAYNHGVEKVAPVIAAHGADAFGVATLAEAMQLRDIGISQEVLCWIWTPEQDFRAAIDRNIDLAVISPAHAKALIETDAEHIRVSIKIDSGLHRSGVDEQEWEGVFSALAAAPHIEVTGMFTHLAETDRQIIAFRRALALARKHGLECPVNHVCNSPAFLTRSDLHMEMVRPGLAFYGLEPVAGLEHGLKPAMTWEAKVSVVKQIERGFVAVVPAGYADGMPRHAQGKFSVTIDGLDYPQVGRVCMDQFVISLGDNPHGVEAGAKAVIFGENGHDATDFAERLDTINYEVVCRPTGRTVRAYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Alanine Racemase from Corynebacterium glutamicum at 2.1 A resolution
rcsb
source organism Corynebacterium glutamicum
molecule tags Isomerase
molecule keywords Alanine racemase
total genus 109
structure length 338
sequence length 361
chains with identical sequence B, C, D
ec nomenclature ec 5.1.1.1: Alanine racemase.
pdb deposition date 2006-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00842 Ala_racemase_C Alanine racemase, C-terminal domain
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 2dy3A01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 2dy3A02
1F3TA 4KBXA 3AWOA 1FTXA 3N2OA 2J66A 3VABA 3E5PA 4XBJA 3ANUA 3N29A 5GJPA 3LLXA 1RCQA 4LUSA 4BHYA 4FS9A 1QU4A 4XG1A 4PB3A 4LUSB 3WQDA 5FAGA 2PLKA 1TUFA 1SFTA 4LUTB 3R79A 1W8GA 5IRPA 2QGHA 3WQEA 1XQLA 5FACA 1XQKA 3HA1A 4PB5A 4PB4A 3SY1A 3N2BA 3WQFA 4QHRA 2P3EA 1TWIA 3B8UA 4DZAA 3HURA 5FAJA 1BD0A 1NJJA 3NZQA 3MT1A 4WR3A 2VD8A 3B8VA 1KO0A 1B54A 3WQGA 5BWAA 1XFCA 3BTNA 4ILSA 1VFHA 4LUTA 4BEUA 4DYJA 3UW6A 1VFSA 2TODA 4ZGYA 2SFPA 2ON3A 1D7KA 2VD9A 3OO2A 4ECLA 4AIBA 4A3QA 7ODCA 3B8WA 3GWQA 3WQCA 2O0TA 2NV9A 2ODOA 1L6GA 1HKWA 2PLJA 4LUYA 3C5QA 4V15A 2RJGA 5GJNA 3B8TA 1NIUA 3KW3A 2RJHA 1EPVA 3S46A 1KNWA 3E6EA 2DY3A 3ANVA 3AWNA 2YXXA 3CO8A 4BEQA 2OO0A 1HKVA 4BF5A 3CPGA 5GJMA 1VFTA 4Y2WA 3NZPA 2NVAA 1CT5A 1SZRA 1L6FA
chains in the Genus database with same CATH superfamily
2ACQA 5F2LA 1LRQA 5T26A 1O4UA 3I7RA 1YKWA 2A7PA 3PK7A 4E38A 4JTCA 4FNRA 1LQAA 1NFBA 3AHYA 5HQMA 1XLCA 3TIMA 3H7UA 1EC7A 4PTXA 2QUVA 1AQ0A 4ZXOA 1WO2A 1MW2A 5CPOA 3ATYA 3P60A 1ZBKA 3TK7A 2WMIB 3EWXA 3UA4A 3OHIA 1FCQA 2J27A 3WX7A 5FSEC 2CZFA 1I8JA 2FFCA 1VPXA 2QCCA 1SJAA 3SUUA 4MVAA 3F4WA 2QJIA 1IWBA 2BY2A 2XVGA 1QOXA 4EWND 3MV01 1QXLA 2J7BA 2I5GA 2VP8A 4CD8A 3EKLA 3UWVA 4D2JA 4XAZA 4ZE4A 3W7HA 4I8DA 2BGQA 4PSRA 1KRMA 1VGAA 2OJPA 1V6VA 3IIPA 4FEZA 1GJUA 1XBVA 1QHOA 3QHNA 5DXXA 3V5CA 4F9JA 1Q2SA 3UWUA 1CZ1A 1RA0A 4OZOA 4B92A 3WFAA 3PTQA 3QFEA 1X6NA 2OYLA 3MVIA 3EX4A 1U1UA 2OVLA 2YZRA 1ICSA 5KEZA 4YVPA 3D6NA 3QXBA 1WDPA 3U48A 4ZR8A 2IXVA 3QMSA 3U6WA 3KEHA 5H8UA 3EPNA 1SW0A 3JW7A 2BVYA 1S5NA 2J9YA 2FHCA 2PDNA 3ARTA 1K1DA 4NZ4A 1Q65A 5J04A 1T8QA 4LBUA 1KBIA 5LGXA 2ZRXA 3O9NA 4LUSA 3WH9A 1F2JA 4FX8A 4AD1A 1TPDA 2OZ8A 2MUCA 4QQUA 3N6HA 1E1CA 1E0TA 1HXJA 1CENA 1JZ4A 5FF7A 3U8GA 2I57A 5AHMA 1XI3A 1A3XA 4DZHA 4ZCWA 3CGTA 4QCFA 5E70A 4H41A 4PTNA 3RO8A 1TTPA 1OQFA 4W9TA 5FAJA 2YBVA 1PXGA 4DI8A 1ZS2A 1ENUA 5HUOA 4IPNB 1PKNA 3UZWA 4IG2A 1DQUA 1N2VA 4YTSA 1E9YB 4UTFA 3VTRA 3RUBL 4W8BA 4IFKB 1A5BA 5LIWX 1QI2A 2I9EA 2CKRA 1I0BA 1GQIA 3HQPA 2ACSA 1H7RA 3TVAA 4LYQA 4LRSA 2C7FA 3SGZA 3STFA 4JZ5A 5I6SA 1TUXA 2ZVRA 2PDFA 3BLOA 3OGVA 3N12A 3W88A 3VYLA 2HWGA 4MDPA 4AG0A 5CGMA 1C9WA 1V0MA 3AMGA 3NXLA 1ODZA 1VH7A 2YXXA 1ZQ5A 3HPAA 4IF2A 1HKVA 5G2HA 1XKYA 3CL7A 3WD0A 3WMBA 3ITXA 4DBDA 5I03A 6TAAA 4F0MA 1E3XA 3PWGA 3A21A 4H9TA 1RBOB 1A5OC 5E0CA 2ZX5A 3VDBA 1C7TA 3UQNA 4QROA 5LA0A 4J3SA 3N2MA 2FPTA 3B8SA 3CEUA 5I79A 2NVDA 3UZYA 3QC0A 4U5KA 5TF0A 4UFMA 1RP9A 3KOFA 1PCKA 5A6KA 5FEWA 1DQWA 4FS9A 3W2NA 2WMJA 4UTTA 5DBUA 3MJMA 1HTIA 3L2MA 3TYDA 3VAVA 5K9CA 2X0SA 1J79A 4D6IA 3IVTA 1VEMA 2VELA 4IISA 1GG0A 2C14A 4EACA 1TWIA 4O1FA 5AN7A 2GVJA 1SZEA 3UG5A 5HA7A 3SUVA 2CBVA 4ZQRA 4N7QA 3V36A 4JR5A 1JZ5A 1QNSA 4DZ5A 2ZZ7A 1OC6A 4NYUA 2PTXA 2J7HA 1LF1A 3VGBA 4EF9A 2Z27A 1W6TA 1FWFC 1F3XA 1GOMA 1H41A 3BH4A 4CU8A 2BVTA 4PUNA 4AB4A 1KFJA 1JCNA 2ZUVA 1EA0A 2VURA 4KETA 3QLLA 3QTGA 4LVAA 4UNIA 3VNLA 1TZ9A 1WDSA 3K1DA 4LAOA 1A5KC 4UQCA 2AL2A 3V4BA 3QMRA 4JYDA 3KBWA 1OFEA 3MC5A 3NUKA 5D2XA 3BCDA 1B4EA 5CKSA 2XVPA 3TOPA 3VUPA 2VCBA 3GR4A 3BE7A 3L23A 2WMHA 2OLSA 1L2QA 5F7UA 2QDEA 3FGCA 2CWXA 4IGSA 3WNOA 1RSCA 3GNPA 1BWVA 5DANA 3EMQA 4ADSA 5F2IA 3WQVA 4LUTB 4GIAA 4JFWA 3L5AA 4PCSA 3UY7A 2ZRZA 1BGAA 1RLCL 4NVTA 3MVTA 3VXGA 3LSBA 4LV9A 2WHLA 3AU2A 4XKYA 1YTDA 1CPUA 1JPIA 3GH7A 3O07A 3ARUA 1PJ9A 1YE6A 2W5FA 2CLIA 2J6XA 1J10A 3G5EA 3B05A 2WC7A 2CXEA 4LS2A 5H8MA 3MS8A 3FEMA 1YDOA 4DWSD 1XYAA 1W3KA 3ALGA 2DT0A 4LU0A 4L61A 4WCJA 3S5ZA 1UC5A 2QCFA 2QZRA 4K7YA 3VKJA 3M1ZA 2PF0A 3V75A 3OLEA 4TUFA 5JMUA 3LDVA 2C8NA 3MYPA 1DKWA 2ZCGA 3GKFA 1PZ3A 3WDJA 1TKKA 4JCMA 2R94A 1OGSA 1L6YA 3IUHA 1BKSA 3E0IA 4QTGA 1K02A 1ZJBA 1A5SA 1KGWA 5A69A 5HUPA 3TP4A 3BL3A 5F2MA 1Z42A 2VRKA 3W22A 2PF8A 1ISWA 4N9CA 4WSHA 1T7LA 4B5XA 1XFBA 3OVQA 3DBPA 4R9XA 2OSYA 3C86A 3VNKA 4HHPA 2G3FA 4YJ5A 4NKCA 1M9HA 3W9ZA 4D71A 5HPOA 4GY7A 4AVFA 5FL0A 2ZTJA 1O95A 1JVNA 3AQUA 4G2DA 1BD0A 1J0IA 4Q4MA 4QDWA 2O55A 4GI9A 5HNUA 3AXIA 3EBVA 4ZTYA 4RZ4A 3VD3A 1HIZA 3AC0A 3WCZA 3UW6A 4F0SA 2PDXA 4A05A 1AJ2A 4L9ZA 1EUNA 3VVGA 2Z2BA 3O7UA 3B8WA 2OLHA 4FZIA 5LA2A 1EBGA 2BNJA 3NOYA 4MAZA 3T05A 3S8HA 4MG4A 3UWQA 3PJXA 2XN0A 1J2WA 4AHOA 4DX3A 3PZGA 1VHNA 4HYRA 1YDYA 1K77A 3AMCA 4HZ6A 2BVDA 3I10A 4B3ZA 4FIQA 4ICCX 3H22A 4ZFMA 1GPWA 2J7EA 1UWSA 1E5JA 3T8LA 2AOSA 4JTSA 4X9SA 3TYEA 1XYBA 1BPLB 2EKGA 4F0KA 4RDYA 1W56A 3MZ2A 3R94A 3LENA 1LWIA 1HNYA 2DORA 4NF7A 1W9BM 2F7FA 1FWDC 2QDDA 3NQ8A 4UFIA 2PGEA 5HOSA 3VKAA 3GR8A 4B15A 2PLKA 1ZTVA 4MPKA 4V27A 3TC3A 4U3AA 3B3DA 1IV8A 4DZAA 3AS0A 2PEVA 4I6KA 4L6OA 2QR6A 1EJWC 2F2HA 1CGVA 4CVWA 1BXCA 5CBBA 4CU6A 2GGGA 4S3EA 2XJ7A 4TMBA 4DBUA 3M0LA 5AC4A 3I6TA 4MNMA 1WAUA 4O52A 2NV2A 2POTA 3UG4A 3NQDA 4JTRA 4L7ZA 2YLLA 1V3JA 1HL9A 4GJJA 4Q8WA 3WNLA 4D6HA 1EEXA 1K8XA 2X40A 3A5FA 1FVPA 4L4PA 3WLMA 4DN1A 2QYGA 3LHZA 3QGAC 2PZNA 9XIAA 3LLDA 3WLJA 3SJ3A 5M03A 3C3NA 3W2JA 3SCSA 2Q09A 4Y8FA 5EMUA 2ZZ4A 3UF9A 3ZXWA 2YX0A 2BP1A 2V2HA 4MLRA 1W1A1 5C2GA 4TVUA 3LM3A 3SBFA 5AZ1A 3TC7A 3TMQA 4L1XA 3VMOA 3O15A 3PG8A 4IX0A 1SJCA 4NJIA 1CI1A 5A8OA 2HSAA 1HP5A 3UCQA 4ZXLA 3TW7A 3WD2A 1S2UA 2E3ZA 3NQAA 1I9CB 3EEGA 1OIMA 4HPXA 4E4FA 1NWRA 3P8IA 5I24A 3WFZA 1R9XA 1GONA 1JYWA 1E40A 1ZJAA 1GW9A 1IWAA 2P10A 1GZ1A 2WCSA 3PNZA 4HQVA 1F6PA 4NP7A 3GXPA 1V02E 1GWJA 3C2YA 4KCTA 4WOQA 1BYBA 1ZY9A 1QNQA 3K46A 1JPKA 4E5TA 4MMWA 2HCVA 4XD3A 2GVEA 1C92A 2QXWA 3S5YA 4HTYA 3SCTA 3URAA 3EB2A 4HZ7A 3LUTA 1QI3A 2C1IA 1M65A 1EOKA 2BOGX 3T81A 4S3DA 5HDRA 5EBAA 3EMZA 4MY8A 1UD2A 3BAKA 3RK8A 3B9OA 1IZCA 3DI1A 3IJIA 5HPCA 2Y7GA 3HQ1A 1KFCA 3PUGA 4TU1A 1QHZA 1AODA 4WGXA 1VCFA 2GUBA 5LXEA 5AHNA 4PCFA 3NDYA 3GXNA 3G1YA 2JIWA 3MPGA 1EJXC 3WDQA 3NZGA 1A5UA 1XINA 1YIXA 2DIEA 1DJNA 3RU6A 2CLPA 3MZNA 3DZ1A 3WJZA 3WQWA 1MUWA 1TZZA 6REQA 3PC0A 4JHOA 3TJXA 3MSGA 1SR9A 2HEJA 2W6RA 1XQKA 1F73A 3BZGA 3DYOA 2G95A 3R0UA 4EAMA 5CXPA 2BGSA 3LPFA 7REQB 3S2JA 3ZFHA 4HNTA 3QC3A 3ABRA 5EBUA 3CMGA 4BI7A 3A3XA 3TFXA 1YE4A 5MKGA 4ZQNA 3OVRA 4QNWA 3CZ8A 4B5NA 1HJXA 1JNDA 3TQKA 4MTVA 2FKPA 4W4QA 4UTLA 2OX1A 4UR8A 1VRXA 5DT7A 4K6AA 4DUWA 2P8CA 3NAVA 1LWHA 1L6GA 2PTZA 4FR1A 1B9ZA 3S5NA 4UUIA 3PNUA 3K8MA 3IACA 1XYLA 3H7RA 2XGIA 3CUFA 3WQPA 4HU3A 1R0MA 6CGTA 3H2AA 4HP5A 2ZTKA 3VIOA 4G8TA 3PY2A 4MSSA 1W1YA 3TROA 4PCPA 4CNTA 2Y5SA 3P6LA 3SUWA 3W0KA 4ZMGA 3PBVA 4KRUA 3AYVA 3IK2A 4S3AA 2OZ3A 1BG9A 3BJFA 5HMEA 3W1TA 1VP5A 3FXYA 1XM3A 4FMVA 3A9BA 1BRLA 1PO9A 3CH0A 3FDKA 3WF4A 3WNKA 4HHMA 4F2BA 2DT2A 3HGRA 3NQEA 2WKLA 1TJPA 2NQHA 3VCCA 3NVTA 4GQGA 4B9ZA 2X16A 1PX4A 3RNDA 2YCIX 1JDEA 3KDOA 4LF1A 3PR2A 3P84A 2P53A 4DAFA 2X05A 1XBYA 3RPTA 3H6OA 5C9XA 3WH6A 3WLLA 3ARPA 3OYZA 1B54A 4W89A 1UZ4A 1WOAA 2HS6A 1NWTA 3BMWA 2PODA 3W6YA 4JTHA 3F5LA 3CU2A 2Z26A 5CLTA 3NPUA 5CPMA 2VD9A 5EY5A 1X1OA 2OELA 3IV3A 4PZVA 1UC4A 2DZPA 4UFHA 5D2WA 3GC5A 2RJGA 1FY6A 2A85A 4JTUA 3FJ4A 4MYAA 2V68A 4F40A 4QS5A 1EWEA 4PUKA 3PZMA 2OZTA 4QAWA 1SQ7A 2GJPA 3W24A 1NELA 3LMZA 3WBAA 2QF8A 4F2UA 1XXXA 2XVLA 4NX5A 4WY0B 3TJIA 3PPHA 1W5OA 3P80A 4UTMA 2QGYA 1KM2A 5PTDA 2GVGA 3GH4A 3UPBA 2R82A 4ZOAA 2YCJA 3TE9A 3D0CA 3CWHA 3ALFA 1GOQA 5J5DA 4X60A 2PFHA 1TWWA 3WEZA 5C9RA 1M7JA 2W9MA 4NXSA 5JBFA 1F8MA 3NURA 6ALDA 3CMFA 4F66A 3PN8A 3GR7A 3CAQA 2E1DA 1ISYA 4QIUA 2AQVA 3WQEA 2G3JA 2CBJA 2CU0A 1KRBC 4I7VA 4QRNA 7ENLA 4IPJA 1OFDA 5HWMA 2OSXA 4HCLA 1UD4A 4YL2A 4KEUA 1J5SA 4XUGA 5DQPA 3P62A 2YFNA 1PHQA 5CQ1A 3NPVA 4W85A 3VK5A 3GRIA 2O0TA 1X97A 1LZOA 1C7SA 5A1AA 1BF2A 2ABBA 1G7UA 2JE8A 3TLQA 4UZSA 4GX9A 5BRBA 4Q8TA 4RE0A 1OFQA 1UIOA 2BXYA 4QXIA 4JIEA 1GQKA 1CGTA 3HJZA 2OO0A 2PDJA 4K8EA 1G4PA 4NJHA 3CLMA 4XZMX 1H4PA 4HMNA 3QBUA 3UESA 1AK5A 4UXDA 4C90A 4DF0A 1W1VA 1DJIA 2J9ZA 1QNRA 1EXBA 2Y88A 4OHQA 3NL2A 2D2GA 1DYSA 3G1XA 3LMYA 1ZUAX 4AWSA 5FF4A 1O6IA 1ML1A 1US3A 4KERA 1MSSA 4IIHA 3EX1A 1FHLA 2IPFA 1BHGA 3G0SA 4D6DA 4G1NA 1I1XA 1I2QA 3TXVA 4EK7A 3K30A 4XQ6A 1RLDA 4MPQA 4HNNA 4XTDA 1S38A 1G01A 5CZSA 4Q8QA 1FRBA 3URQA 4C6OA 3WJWA 4JPGA 2F84A 2V3GA 3PPFA 2WB5A 1GNXA 3QH2A 4POCA 2EPKX 1A5CA 1CLXA 4V1XA 3W1PA 4XAFA 3GC4A 1V77A 4YXGA 3WL0A 1EHAA 3HG5A 2OODA 4PMVA 1SMDA 2BXZA 4DNMA 3BSMA 4ECLA 2QQ6A 3GWQA 3WY1A 4WK9A 2PDQA 3EA1A 3NPWA 3KBMA 3B8TA 4JFSA 1PYMA 4O17A 2REQA 2E77A 1M6JA 3KFTA 3OODA 1OGBA 3RLVA 1UR2A 1C3FA 1QT1A 3AIWA 4U2YA 4HU8A 3DHPA 3OB8A 3C8FA 1GVYA 5CZJA 4C1KA 2JKPA 1K8YA 5FJOA 4RW3A 4I7UA 2POZA 1XGEA 1BQGA 4RUBA 3GFYA 4MB1A 4OE7A 3S0CA 1ONXA 5CBIA 4AWTA 2XM2A 1BVZA 3VUSA 4Q8OA 4I5UA 1NU5A 4HBKA 4O57A 2J6VA 3P61A 1A4LA 3P7YA 4AU0A 2YPIA 3DIPA 1TUFA 4H01A 4ICNA 4I9TA 5U4NA 3PZIA 1XF0A 2VOMA 4AD5A 3H2CA 4FLSA 5D9OA 4DWDA 2GGHA 2R8WA 3KVJA 4LPCA 4RR4A 4ZSUA 4PCNA 4F3HA 3W37A 2WCGA 3PJUA 1AW1A 2Z1SA 4DELA 3LEPA 3A6OA 2PSNA 1B0IA 3L21A 2FZBA 1EO5A 4Q32A 1A80A 3DCPA 1TV4A 4W5ZA 2Z00A 1L9WA 3NR0A 5CAKA 3WDRA 4K68A 1S5MA 3C2EA 3H12A 2DVXA 4R5EA 3MCOA 3O8AA 4HA4A 5I0DA 1NARA 1OCJA 4UBPC 1XWYA 2QDHA 4UTUA 4MY1A 1B2YA 3W83A 4PUEA 2Y7FA 5EMJA 1A5AA 1DEDA 1W2PA 3WDIA 1TA3A 1KM5A 1LORA 4RZBA 2E40A 2DFAA 2L5HA 2ZUNA 3BUVA 4CKQA 3SQSA 4CCZA 1YXYA 1K9FA 3OIHA 3IIZA 1SO5A 2HBVA 3B40A 1XSKA 2Z0IA 4XZLX 3WNNA 2WSQA 1FCBA 1N7KA 2F9RA 5EB8A 3WLKX 2W67A 4O50A 3KRUA 1XRTA 3APTA 3O0KA 3AHZA 4K2SA 1LCOA 1E6QM 4B9YA 1UP0A 3I3BA 3U7BA 5IHRA 2WWDA 4DO5A 4KWOA 3NQ7A 2WVVB 4GY1A 3L0GA 4JL2A 5FL1A 3MT1A 4RX0A 3V35A 3AFBA 3NDZA 4AZ5A 5C71A 1IXQA 3FOKA 3KHJA 3OG2A 4GPNA 1DWGM 2G37A 3NOEA 1W3HA 3BLFA 1GORA 2Z6JA 1Y5VA 5D30A 4KW2A 4IQDA 3RO6A 2EJAA 4INFA 4UFKA 3R13A 2W3ZA 3TR2A 1UHVA 5DO8A 3W1NA 1SM9A 4MY9A 3BAJA 3MUZ1 3IARA 1H7WA 1F3EA 4Q4OA 1JDCA 2J7FA 3M6YA 3E2QA 4BQ4A 5DT5A 1UWIA 3KM8A 1XDMA 2H8XA 2YL5A 3W7MA 2QUMA 5LA1A 1L6WA 2OGYA 4XD6A 2YFOA 1EQPA 3BO9A 3RM4A 2J78A 4A35A 2Y8UA 5DX7A 1C90A 2TRSA 3M43A 2NXHA 3E0FA 2XINA 5CBJA 3ZVIA 3VIIA 2AL2B 3SY8A 1UD5A 3C3UA 4UNLA 2Y5EA 4WZHA 3L4UA 4JNZA 4P8UA 3GXIA 1W0MA 4JFTA 4JTLA 1UKPA 2DVTA 3GH5A 3HPSA 4C5ZA 3F2BA 3M0HA 1CB2A 4QSHA 2Z1KA 5K2ZA 3WIJA 1UP2A 4ADTA 3MW7A 3R43A 5H1WA 1DL3A 2PE4A 5CC3A 2CFFA 2V5KA 1RA5A 1N55A 2ANUA 9CGTA 2Y2WA 5DEZA 4GG9A 5K3VA 4L80A 1EWDA 1P6BA 1W37A 2OT0A 1X8CA 2PMQA 1CYGA 4JKMA 2QPSA 3WLIA 3KZPA 2WO5A 2ZA1A 4FA3A 3VDHA 1EX5A 3LTYA 5FOOA 5EMLA 1A0EA 2OTDA 2EKCA 4K8HA 4MIMA 1BTMA 2RJHA 3KVKA 4CEUC 5I3IA 4WDWA 2D69A 3A5VA 4H19A 3CNYA 1Q4NX 2V9DA 4H9MA 2YJQA 1F9CA 4E6MA 3PBWA 4BF5A 3CQIA 3O6CA 2ASHA 3DYMA 1KGXA 1V7AA 4A8NA 4QNEA 1AW2A 5CG0A 1UUQA 3CAWA 5DMLA 5JH1A 5B7YA 1UH4A 4AEEA 1B90A 4GXMA 4JIRA 3BICA 3ABOA 3VOJA 3MKKA 5F4SA 4NT0A 3OZOA 4NZ3A 3UVIA 4GUFA 4I9MA 2RDXA 2AL1A 2YW3A 4IGHA 3UWWA 2PA6A 1XISA 4L56A 5GNZA 4BI5A 3NO5A 2IPWA 1NOUA 3LCXA 3FA5A 1QK0A 4E8GA 4F0HA 1I0DA 4Z1YA 1KD0A 1XIBA 1NP2A 1UUOA 3GD6A 4AD0A 3PBUA 3IAPA 5CG7A 2E5DA 1GJPA 4IP7A 1V0NA 2OT1A 3ZO9A 1AZ1A 3RGTA 4XZNX 2TSYA 1K03A 1PDYA 2E6FA 4S3CA 2X2GA 1VFSA 3L4TA 3A47A 1B3YA 1W91A 3G1SA 1V3IA 3MV11 4ACZA 2A3HA 1TWDA 4GRSA 3S46A 2EXOA 3IGSA 2VVSA 2O9RA 2PAJA 1KWKA 2DVUA 1BFNA 1QNPA 4ASTA 4A29A 2QW5A 4CNPA 3SSJA 4RV3A 4JTDA 4XSMA 1K8ZA 2QCHA 3QY6A 1TPH1 3BOXA 3QQWA 2HS8A 3DERA 8CGTA 2E5BA 3ZJKA 4DB7A 4OBRA 3N2OA 3VE9A 4ML9A 3GXMA 4XAPA 5I3DA 3OBKA 3LLXA 4I9AA 4YTTA 4PRWA 5AYZA 1FKWA 3UWEA 4O1CA 4Z2KA 2Q6ZA 5BXSA 3ORWA 4CD6A 3EWZA 4LSBA 3TONA 3W71A 5GPRA 2VX5A 3R79A 3T0TA 2BGNE 1PDZA 3GNNA 4GQQA 3PPCA 4HNCA 3MSDA 4AY7A 1DP0A 4EXBA 4LFYA 5LIKX 1OFOA 2PP1A 5M5DA 4C65A 4YTRA 2A7NA 3M7WA 2VXNA 2A2IA 3VNJA 3KE0A 3SIMA 5T8GA 2FTWA 1TFVA 3GQYA 3DBNA 1BSIA 3CPRA 3PB0A 4M8UA 1KTCA 2V3FA 2W91A 3B06A 1TX0A 1OFPA 1A3HA 2AKZA 3GW3A 3HG3A 5AC8A 4KFNA 4CNUA 3XIMA 2G5WA 4Z0JA 4N02A 3E12A 1QBAA 3R7MA 3EWYA 1I2RA 4JKKA 4GUIA 1TSIA 4H9VA 4XKYB 4FP1A 1XH1A 3S9IA 3WUEA 4BJHA 3TKFA 4KFOA 1UQYA 4AWUA 1WCGA 1E0WA 3RLGA 2J66A 3RG6A 1P7TA 3SN4A 4AIUA 2G0WA 3V0UA 3CUZA 1W9UA 5CZTA 3U7VA 1R5YA 3APYA 4TX9A 4WY0F 3PG9A 3FFSA 1HJQA 4U10A 3T4CA 3ZYZA 4LCRA 1GOKA 4JYEA 1C29A 3GBDA 4UCFA 1SSGA 2ZRYA 3PHAA 4MNJA 4AH7A 4DJDD 3EWWA 4DWSB 3QY8A 2QGHA 5CSRA 2X7VA 4Q4KA 3QTPA 4J2MA 1XD1A 1OT1A 1VB9A 2X0YA 4BF7A 1R7AA 4HZMA 1UKOA 1FWNA 3VILA 3W1QA 4LUTA 5E9AA 2HBXA 1QNOA 3UWYA 3B9DA 2PP3A 2ZA3A 4N9EA 3FIGA 2HK1A 4W7VA 4HU4A 5C54A 1P0NA 3ITTA 1EPVA 2DSZA 2Y8KA 1XDLA 2QCGA 1SO4A 1IEXA 3UCDA 2WWCA 1YBQA 1KXQA 4KCWA 2C15A 5KINA 1DXFA 2XH7A 1XIFA 4GUHA 2CW6A 3H26A 4EPBC 2P0IA 1X8FA 1MO0A 3E1F1 3MUY1 3V0SA 2A0NA 3MSRA 4WXYA 3VNZA 5I2UA 1LT7A 2OU4A 2DZSA 1CTNA 3BAIA 2EPHA 1D8CA 5GVJA 3WQ8A 3QLDA 1Q66A 4GK8A 3CV6A 5EMKA 3SADA 1KQYA 3WBYA 1W1B1 1J0YA 4DNHA 1PTAA 4JGDA 3BW4A 3M0MA 2JEQA 3TW9A 1UR4A 3N2XA 1OVDA 9RUBA 2IQTA 1HGYA 3TTEA 2YW4A 1PIGA 1Q8AA 3I3EA 4EVZA 1VLIA 2GQAA 2PU1A 1GJWA 3N6JA 1LYXA 1VPQA 3KOYA 1TQXA 5FIPA 2VGFA 3H53A 4MB4A 2FTYA 1H0IA 1RUSA 2QCDB 1US0A 2WNWA 3PZUA 1B57A 3NPXA 4MZ8A 4GA8A 3ZT5A 1XCWA 2VC9A 4PH6A 2UY4A 4ORIA 4NNCA 2FMOA 2QCNA 3OVGA 4ORMA 1DVJA 4C7GA 4FAMA 1YNQA 2Q3RA 2V5LA 3T09A 1LL7A 1ZALA 3GK0A 1NDWA 1C8VA 1QO2A 2GOUA 1KGUA 1H50A 3W7NA 1OGGA 3SAZA 2DZXA 5BXPA 3KS6A 1P4CA 5DY3A 1J18A 3BJTA 2J4GA 3QPYA 3RCNA 1UW9A 2IPJA 2WHKA 4J2PA 1E1CB 3DESA 4IXHA 2F6UA 4RZ5A 5DCDA 4PMRA 4M51A 4YWIA 4O4VA 2P50A 5BU6A 1M01A 3FY1A 3UPWA 2Y5JA 4ZE5A 1JF5A 2GGEA 2GDUA 1KBKA 1AZ2A 1Q2RA 5JVLA 1CGXA 3LBMA 1S1PA 3SCPA 1XG3A 3R2GA 1PZ1A 1ONEA 1GVRA 4H6EA 2Y61A 1YHTA 1TV2A 4GNJA 1TB3A 5TBOA 1F8IA 3IIVA 2VI0A 4I8YA 1TCDA 2VFEA 1Q6OA 2V0TA 3S3GA 2BY1A 3TN6A 1QCWA 1IHIA 1EOMA 1J96A 4RLIA 1E6RA 3CUIA 5FCZA 1H5YA 3BK0A 3SN0A 4C6EA 1D3CA 2YSWA 4MHBA 1IEQA 3OEXA 4GMEA 2MANA 3CS2A 3B8IA 3M0ZA 4GCXA 1ECQA 1FKXA 4Q7IA 3GFZA 2BASA 1NQKA 4NZ5A 4LWWA 3ANYA 2PDCA 1ZZMA 1LDCA 3M64A 3DFHA 4X0VA 2E6AA 2Q8ZA 4JTTA 1VD6A 3SR7A 2FB3A 3BWWA 4I7WA 4ZZ9A 1B5TA 1JNEA 4NX0A 4JCLA 2VDIA 4I9JA 1O5RA 2YR1A 3M0IA 3SRFA 1MQPA 2DQWA 1ZENA 1NDVA 4Q4PA 3D3FA 1WXZA 3M5VA 3EOSA 2W79A 4HPHA 4LY4A 4O14A 1W5QA 4XX6A 4DM2A 4XO6A 3L5MA 4XZWA 4LAUA 3KAOA 1BXNA 3HTWA 1PWMA 2P88A 3W7EA 1C8XA 3HMJG 1TTQA 2ALRA 3WZ0E 1J6PA 4FNUA 2I16A 5EYWA 4E2OA 1T96A 1U30A 1WKDA 2AAAA 6TIMA 1TCMA 4J4KA 3HMCA 4GKTA 3VIMA 4BQ5A 3W7RA 1V5XA 1DWIM 2BY3A 1Y8BA 3DFTA 3ZOAA 1ITXA 1S1RA 3RITA 1JYNA 2YA2A 2C0HA 3GXTA 1LRNA 2Y85A 3SO7A 3OO2A 3KVMA 1NVMA 2O9PA 1YX1A 3QOKA 3PZ9A 1ITUA 1AG1O 2O92A 3DC0A 3I65A 2XUCA 1OSEA 1UZDA 2EGZA 3EXRA 3TSBA 3THDA 2V2DA 3W26A 4HA1A 3GHRA 4RCXA 5BMWA 5I3KA 5GJMA 4GGBA 1IIHA 1UZ1A 2AMGA 3F5KA 4HNLA 1YEYA 3NO3A 3UXKA 5A95A 4TQTA 3MTWA 3SM0A 1LBMA 3I3DA 1UUMA 4JNYA 5E5CA 3V5OA 3BGGA 4H3DA 3PB2A 1QI0A 7TIMA 3BXWA 5AYIA 1F76A 3MHGA 1P1XA 2XISA 5D38A 5EL1A 4O0KA 1EPXA 1RCQA 1NOWA 2G97A 2OYKA 3LQGA 1X6LA 4J3WA 2XYLA 3GVQA 3GY1A 4DHGA 3FW6A 1R3QA 4J3TA 2EHHA 4HD5A 4HU0A 1FDJA 1QPKA 1LBFA 4DWSC 1EJUC 2PLCA 3EWDA 4Y9PA 2VT0A 1WE5A 3N73A 1PTGA 4GZEA 1NFPA 4DJFA 1TO3A 2C16A 4C6DA 5E0KA 3WEMA 5K7JA 4GI6A 2XSBA 2INZA 2O9OA 3UJEA 4MUPA 1LQ2A 2ZXBA 1L8PA 4AIBA 1NAL1 5ABHA 3UBPC 3ZT6A 4V15A 3L68A 2QIWA 3K4WA 1G6CA 1IF2A 3OLIA 4HHLA 4LS0A 4PMJA 3C6CA 1E55A 1A5LC 4L1GA 1XGDA 3BOLA 3VM5A 3T44A 3NSMA 5A3HA 1W5PA 3A22A 1F6KA 5AYBA 4NZCA 2VCAA 1TJRA 4HK7A 2PWGA 1GVSA 1I2PA 2BS9A 2GJNA 1XCXA 2D24A 1EGZA 3DG3A 3QR3A 5C0QA 4P7NA 1QASA 4JIIX 2Z7GA 2PWFA 2JQXA 2OXNA 2YBUA 3FJNA 5MHBA 3UG3A 1HUVA 1JQVA 1SFLA 2QVNA 4G1KA 5HJXA 4KH2A 4XK2A 1HFBA 3FYPA 4ZQCA 3F7JA 3Q94A 2F2KA 4AZBA 2XFWA 3CIVA 2NWRA 3II1A 4Y9OA 1WAWA 5ABFA 1GVOA 3GTHA 4WDUA 4PULA 2Y24A 3B03A 3SJNA 2ZXAA 3TWAA 3VKKA 2VWSA 3ABZA 5G5IA 1UR9A 1XL9A 2GVLA 1OK6A 4IQJA 3AUOA 2Z1BA 1PX3A 3WMSA 2ZUTA 4P8VA 3ZWSA 4EANA 4H7ZA 3W7OA 1X96A 5CPTA 1RALA 4HMDA 3GU9A 1HZYA 4IMEA 2A3AA 4UFLA 2IXUA 4O28A 3BV7A 2HISA 4D1JA 4H6QA 3G1DA 4RDVA 2ZYFA 3OLDA 1ALDA 2J7DA 2C6QA 3W81A 2NXGA 4WY0A 1QTWA 1AD4A 3L4VA 1O5QA 4PMXA 3FYOA 1WUFA 3GTFA 3P81A 1REQB 1QVBA 2D0HA 1UJPA 1UP3A 2J7CA 3URBA 1CLKA 2WLYA 4FB7A 3FCPA 4YHEA 3PZQA 4GNVA 4AHQA 5KSWA 3N4FA 5CZ0A 3FK4A 1I4NA 3V18A 3ARWA 2R6OA 4FR6A 3U4FA 4GC4A 1UH2A 4B4HA 2GQ9A 1KM3A 3U2EA 1SJDA 1XDJA 5HQEA 3VCRA 3N13A 1MEHA 1AQFA 4JNMA 1NJJA 1SZGA 1OD8A 2RDUA 1H7OA 2VO5A 2J24A 4PUUA 3T4WA 1EYEA 5G2IA 4FPSA 5H8PA 1UR8A 4QJ3B 7TAAA 1W31A 4GWEA 1SZFA 1JFHA 1MYRA 5CAHA 2VUNA 3GZ3A 3GIYA 3K13A 2E7FA 1IGWA 3NVDA 3DDMA 4Z2GA 1SGJA 5CSYA 4HJWA 4AX7A 5AVNA 1OZQA 3G1RA 3ABSA 4UB9A 4ZFCA 1ESWA 5IBXC 2GJXB 2KAUC 7A3HA 1JJKA 2DEPA 5BU9A 2XVNA 4MWAE 4DXKA 2WNQA 2CNCA 1IE7C 2CHNA 1K7XA 2VZSA 3SQLA 2VM8A 3EYPA 2VC6A 4Y8EA 3K8KA 3LTSA 3UP8A 3W87A 1H7NA 3UU0A 1CBGA 4V2XA 2HTMA 2NWSA 2OWCA 4GLEA 3S5SA 5JBEA 1F05A 2QKFA 3L66A 1PS9A 1SFTA 2XZ7A 2G3MA 5HAOA 4UR9A 1VLWA 3FJ6A 3HV9A 3VFLA 3W3OA 4K3ZA 2BXVA 4DUXA 1WXJA 4UTJA 2TAAA 4ZBCA 2ICSA 1HP4A 3W23A 3AZTA 2PTDA 1KR0A 4Y6GA 2G41A 3W28A 3N11A 4MWAA 4OV4A 5I7GA 4RE3A 1XIMA 2D0FA 4IJCA 3W00A 1K9TA 1OBAA 5D2YA 4HGXA 3B0VC 3LXAA 3A12A 2FZNA 1HJUA 5CJNA 5I77A 3FLUA 3GO2A 3ARSA 5ECUA 2Z7KA 1AH4A 5M3WA 4IJRA 3N34A 3R8RA 2A3BA 1CT5A 3NL6A 4QG6A 3AYSA 2A3CA 3C0SA 3UGVA 5A6AA 2QNEA 2YYTA 4N42A 1BGGA 5MKGB 3QPEA 2VGIA 4JIPA 4GIYA 3WF0A 1IZKA 3O6AA 2D23A 1VIWA 3DOPA 2A1YA 1KKRA 1NEYA 3O3RA 4AEFA 1XLEA 2BFGA 4MADA 1JRBA 3UT0A 4YNGA 3DYPA 5IHSA 1AD1A 2FVKA 2J74A 3KOWA 3TCSA 1KBJA 1P5BA 4XBKA 1KFLA 3EMCA 4R53A 3VI2A 1KFKA 2YDQA 1KCKA 2EBNA 1Z89A 3C2OA 4MNKA 1LLOA 1IYXA 4CQDA 4HVXA 3UXAA 2DUXA 3BAXA 2RDTA 2FIQA 3BQ6A 1U2YA 4X22A 2CHRA 1TRDA 2PZ0A 3Q65A 1OINA 3S1VA 4GVIA 1HX0A 2X30A 4UR7A 2FGLA 3MSYA 4OGZA 3EA3A 4AD4A 8TIMA 1FWBC 5CJMA 2EG7A 4KGJA 4Q6XA 2X8RA 1DJWA 3KOXA 1CXLA 2HROA 4LEQA 2IKIA 3WMLA 3IPWA 1QFEA 4TTUA 2GL5A 4J28A 4KF1A 4I3GA 3SRDA 4IMAA 4GJIA 5G4EA 1NFGA 2WSYA 5C5YA 4FALA 2YA0A 1ZGDA 3M46A 1R3VA 3GTIA 5C9WA 1P0KA 2VZVA 3B0XA 4OVXA 5CJ5A 3DGBA 3AS2A 2Y70A 1QMLA 1R30A 4YVVA 1PTDA 1B30A 3LHUA 2E4TA 3VNIA 4WEVX 3B0YA 2RFGA 2ADAA 4RKAA 3S6DA 1IT0A 3FSTA 3DC8A 1KCZA 4Y9AA 4AZHA 4A6GA 3RU8X 4P8XA 2H8ZA 1LOLA 1C8QA 3Q45A 1QBBA 4LYRA 3HJEA 3NIYA 3MO7A 2XH4A 4NL1A 1XBZA 1V0LA 1TR1A 1CXIA 2XFYA 1SFSA 1V6TA 5D32A 1X1NA 4E3TA 4JQ4A 2HXTA 3BTNA 4PBEA 3MCMA 1MW0A 1VCGA 4Z42C 3VM7A 4JX6A 3CZEA 3NZ1A 1K3UA 1BTCA 2ZIDA 3AICA 3K1GA 1EF3A 4JN7A 2PCQA 1XSJA 1LOSA 3WQ5A 1WDWA 1BG4A 2FZDA 2TPSA 3PWIA 1ZRQA 3KUMA 3U2ZA 4F79A 4QLLA 1OK4A 4H7CA 3ARQA 2PP0A 1EL3A 1DWJM 3AU6A 2OMAA 1Z8AA 1SVDA 5G1YA 4HA0A 2WBKA 5E09A 5EFFA 1IEWA 2VFGA 3VABA 3N9RA 3E5PA 3BJSA 3F5JA 3HB9A 1V7YA 2ZZ3A 1CW2A 3SRKA 3XINA 1KLZA 2HVNA 4Q8PA 1B3XA 1RK6A 4XAYA 4W88A 2PC4A 1O7AA 3BVJA 5IBXA 3P5YA 1E9LA 3UWZA 5DMNA 1YQ2A 2UY2A 3UPMA 4UIOA 3S42A 3U5UA 2OQLA 2WMKA 5KMYA 1FWWA 1V6UA 3L4XA 4L9XA 4YYFA 3BLPX 5C7VA 3MBFA 3V0TA 3WFLA 2C13A 2QVHA 3U57A 2QPUA 4GX8A 4LTSA 5BOOA 4ONVA 2ZWYA 5LIUX 4W87A 4GVFA 3CHFA 3KWSA 4GIRA 3OGRA 6REQB 5E0FA 4DYJA 1ZL1A 1YPFA 1LUCB 3AXXA 3EOLA 3UA3A 4M81A 3O06A 3TQ0A 2VGGA 3B97A 4NI3A 1UWRA 2IS7A 3CL8A 2YXOA 2NX3A 3N4AA 4UOJA 4G6CA 1ONWA 2WANA 3AMLA 4YPJA 3SDOA 3WK2A 3N2TA 3KDNA 5D03A 1RBAA 3EKGA 1Y0EA 4HK5A 1TRIA 3GXDA 3QV7A 4Y96A 4DO4A 3DXIA 3H2NA 4O16A 1KKOA 1EEPA 5LIYX 5C9UA 1WZAA 2YCLA 1OFBA 4WSKA 2WKGA 5AC5A 4AY1A 1PB0A 4PTVA 3TYUA 4JKLA 3I6EA 2QJGA 1IXOA 2VX4A 4XZ9A 2V5DA 4F4RA 3AWOA 3CHDA 3TYZA 1GKRA 1V6YA 1J93A 4HOZA 1V3HA 1GVFA 1K4HA 3U3HA 5HINA 2VRQA 3VX0A 3L67A 3T2OA 4FLQA 3GAYA 1S2WA 4FOUA 3TMLA 1YPXA 5FAGA 3R8GA 2PPGA 5DXYA 3PZTA 5A2AA 3DFSA 1H09A 3ITYA 1PHWA 3QOMA 1F4HA 3R12A 1PKYA 1WX0A 3KCOA 1R85A 4AISA 3GDBA 3A23A 1RD5A 5I09A 3NQVA 1OADA 3VGFA 1X39A 1ONRA 2MNRA 5FD0A 4XZIA 2D2JA 3N3MA 5HWJA 1OCQA 4IGMA 4KQNA 2X42A 3CC1A 4H00A 1F61A 1GHSA 1ZBCA 4MAVA 3HGJA 3PPGA 3UR2A 4H2CA 5DFAA 4N2YA 4B16A 1DTUA 3ITVA 4LOCA 3I4EA 4B2DD 2NLIA 3FKRA 2PDBA 3G8EA 2DDXA 3S1XA 1U5HA 1UD3A 3F4DA 2E9MA 2PGFA 4Z2LA 3OP2A 4ZOCA 4NXKA 3NQ2A 3GX9A 3GAKA 1BWLA 3V1PA 2FJUB 3M5ZA 4HB7A 2NVAA 2CC0A 4DBSA 1F3TA 1FTXA 3AIQA 4QE5A 1MUCA 4ZO9A 3S5OA 4MNLA 4TTGA 3PF3A 2DSKA 2WSRA 3ZVHA 2PGWA 1Q13A 3MP5A 4D8ZA 4XB3A 3ZMRA 4G7EB 2PDHA 4W8LA 2Z29A 5I3JA 1ODUA 2CPUA 4LUSB 2VENA 3EWBX 3S6TA 4U3CA 1W3IA 5A8QA 3JZEA 1P1MA 3T0AA 3G1AA 4JTKA 2PURA 3B0UX 1RH9A 4CUCA 1PKMA 2ZUUA 1PIFA 3MYOA 4EPKA 1A5MC 2QCMA 3INPA 2FLIA 3CXOA 4GBUA 3AMDA 1TVPA 1WKEA 1XYMA 4FI4A 4IFRA 2IUZA 3VD4A 3MCNA 1JD7A 3B8DA 5CC7A 5A8NA 2CZ5A 2YL9A 3OG3A 3ZVHB 3G8RA 4CQBA 4UQDA 2WXDM 4NASA 5GJNA 4LV4A 1WYIA 4YCOA 5AECA 1VS1A 1V93A 3L12A 4JBRA 3IUIA 2YL8A 4BWLC 5BRQA 3WLNA 2DY3A 3LA4A 3BZJA 3LK6A 4KIRA 5XIAA 3GIQA 3AOFA 3EZ4A 1JCJA 2WSPA 3W7CA 3TN5A 2QMJA 2RGMA 3CTTA 2W27A 4HTBA 3CWNA 1IWPA 2EQDA 4GYKA 1XLIA 1AL7A 3CUGA 4AMAA 3RDKA 4M56A 4FIRA 3CQKA 4D9PA 3UJ2A 2D20A 3A13A 1XGZA 3RF9A 3S2LA 1QW9A 4GQRA 4DO6A 2XIIA 3R4IA 5AC6A 1TMLA 3ZM8A 4WQ6A 3EOOA 1L2UA 1S3HA 4QJ4B 2WVVA 1Q6EA 1OJXA 1Q63A 1IR2A 2GSEA 4M80A 5G2WA 1ADOA 1M7PA 1ZNNA 2VVNA 4R7OA 1E9ZB 2ZWZA 5LNVA 4GBDA 1XIGA 1DBTA 3BLKA 2VTFA 2XU2A 4RL3A 3GSMA 2AKMA 4BY3A 1H63A 3AHXA 3WLOA 3O6DA 4O1EA 4OJYA 3RX4A 3IRSA 3MWAA 1HVQA 2B7PA 4YU1A 3UZXA 3N17A 1MXSA 1P43A 5CPSA 1UB3A 3RHGA 2NW0A 3LRKA 1MUMA 4E8DA 1VBGA 4RPQA 2E6YA 4UQEA 2I9UA 5FJJA 4AD2A 3H8AA 2GQ8A 4CN6A 5G4HC 3QSTA 1MNSA 4GQ0A 2ACUA 1EC9A 4XO7A 3UEQA 4S23A 2ZZ5A 1GYLA 5BZAA 5AYXA 1EZ2A 2CLFA 1YNPA 2A6NA 5BWFA 1KV8A 1ELSA 3KCLA 9XIMA 3DHDA 3P93A 2D3LA 2Q3OA 4GYJA 3W82A 6XIMA 1N8WA 3STEA 5BNKA 1VFMA 3WK3A 3BGJA 4EWJA 4HMEA 1BVWA 4LB3A 4C6LA 3A3HA 4NZ1A 8XIMA 1DJXA 4PB4A 1QOQA 2YKKA 3LRLA 3EX3A 5AOUA 3TH6A 5AY7A 4A8LA 1Y65A 3B8VA 2V5BA 2WNNA 1HO1A 1GOWA 1OT2A 3GDKA 3LYEA 2ON3A 4Z1BA 5IM51 1NOFA 3TX9A 3ARVA 1TTJA 4PEEA 4LRTA 2Q71A 3LX9A 2ZICA 4UQ9A 1FWSA 1JGMA 3AZRA 4CEXC 1B31A 3W7PA 5DLCA 1WKFA 4US6A 4DPQA 1EIBA 5REQA 1JZ2A 2A5HA 2PDPA 3BLEA 1W3JA 1RV8A 5JH2A 3EAUA 3OIXA 2EG6A 4PMDA 2G3NA 1MFUA 1RHCA 4RPPA 1R7OA 1E71M 2XH2A 4S38A 4IIGA 3NYZA 1TELA 1QR7A 3GKAA 4ACYA 4QEHA 3W27A 3T6CA 2C1GA 2C71A 3WG6A 1XIIA 1KFEA 1BRLB 3QHMA 4MDOA 3ISIX 1S5TA 1VIZA 4FXSA 4NQ1A 5D8WA 1E4IA 4XIAA 4UQBA 1SZNA 1M7XA 1JUEA 3WK1A 1QDSA 1EJTC 3A4WA 1AH0A 4LT9A 1RZMA 1A49A 1B3WA 1KQZA 4BCEA 2A6LA 3MY9A 1G1YA 3T40A 1JPDX 2PD5A 3EDEA 1R3RA 1GOIA 3LPOA 3ZLHA 4FLOA 2D0GA 2VR2A 2ZA2A 2OGJA 3FHAA 3DAQA 4G5DA 3SB0A 4O8RA 1ICPA 1ADSA 4NSBA 4L65A 1JZ3A 4M0XA 1JULA 1H7PA 3G1FA 7XIMA 4HOXA 4NJKA 4P5UA 2WK2A 2VOTA 1V79A 3REQA 4EXAA 3S83A 1M7OA 1Q7MA 3HIJA 1U22A 1PUDA 1VBRA 4RV8A 1R9ZA 5IDZA 3VDGA 1DWFM 3FJLA 2PDKA 3GDLA 3FA4A 1T99A 1KNWA 3W25A 2LLEA 4RNHA 1TMHA 4BEQA 5TAOA 3LSCA 3U0HA 2VR5A 3LPGA 2IW0A 3XISA 5CH9A 2G96A 3LXCA 4LBRA 4PMZA 3ONBA 4H1ZA 5I3FA 4H2HA 1VR6A 3PUOA 2H90A 1RQHA 1CGYA 1F4AA 5D4YA 3ES7A 3LBCA 3GNRA 4BR1A 4ACZB 4HSOA 4DVOA 3CB8A 5C2CA 4HKPA 3TOYA 4IP5A 4H6RA 3UXIA 4C6FA 3W74A 3M0YA 1YDVA 2B7NA 2WYSA 4E3VA 2BB0A 1QWKA 1K6WA 2GYIA 3PTMA 5G1TA 1P6CA 5AFDA 3N18A 3KRSA 2YGYA 3ID7A 3TV8A 1J9YA 1LTDA 4EPDC 1CGUA 4IQLA 1VFHA 4F0RA 4EKJA 2XG9A 4O4WA 3H23A 3STGA 2PWDA 3G18A 4JYFA 3WDHA 1PEZA 3MP4A 4M6UA 4B3LA 3DG7A 2JF7A 2XPKA 4Q7NA 4NIRA 1HKJA 2GK1B 2QS8A 2PLJA 3V16A 3BSHA 3WLQA 4BZYA 3N15A 5C9ZA 5A6JA 4AZCB 3DFNA 2EG8A 3BURA 4IFKA 1JYXA 5BOFA 2O4MA 4GCAA 1KTBA 3DH7A 4FNSA 2PRHA 1UBPC 4E4PA 5HR6A 1JDFA 3F2CA 3QQ1A 3W02A 4O1AA 4J7RA 4UNKA 4KBXA 1W1TA 5FF0A 5D02A 1E5NA 4S3GA 4Z1AA 1B3OA 1YXCA 1KLYA 1TIMA 4IH3A 1TV8A 1TR9A 4M6QA 3P0WA 4QBXA 2E67A 2OB3A 2FPVA 4R27A 1HL2A 4DJFC 2EPLX 4WDXA 2FVMA 1UOZA 5FSDC 4PCTA 4OUIA 1WUEA 3WJSA 4B3KA 4DXXA 5AKQA 5FEPA 3ZLGA 4HYVA 5FACA 4DWSA 3LNPA 2Z24A 4ES4A 3QR1A 2BX7A 2ZX7A 2XN2A 3S1GA 3VNMA 1W9XA 4MJ4A 1XPGA 3PZVA 1U5VA 3T9PA 4A22A 2RUSA 3HQOA 3FDGA 3CTLA 1UWTA 1NTHA 4FF7A 2WOQA 2PU0A 5LHEA 2IQDA 3LZ5A 2G4FA 4GACA 2VMFA 2C1HA 2ATSA 4WXZA 2E0PA 1T6MA 3GVGA 4KWVA 1E72M 3SW6A 1J0JA 2G8ZA 4PUDA 3NCOA 4H6KA 3UETA 3UZJA 3GHTA 4RJEA 4OOUA 3LGEA 3N14A 3ZWTA 1C8YA 5BXRA 3C8NA 4IUOA 4DIAA 1GW1A 3AXHA 3NQCA 3KBJA 4DJED 3N3TA 1QATA 4QM1A 3C2VA 3WBWA 2VZOA 3EKZA 5FF2A 1JD9A 4ATDA 3BC9A 3A4AA 3EXTA 4TMCA 3L4YA 1I2OA 2QJHA 4QE4A 3T0CA 1QRQA 5AHIA 2CERA 2V38A 3BAWA 2QHAA 1SO6A 1BVNP 1XYCA 3O1NA 4NHVA 2PRLA 3RJYA 3STCA 5EMMA 1TPFA 2X09A 2BBFA 2HQAA 3M5YA 1TVNA 3KRZA 1NQ6A 2BHUA 1GTEA 3TYCA 2V5JA 1HO4A 1FWHC 3S2NA 4AYSA 4IL2A 5AVHA 4OT7A 1SMAA 3UFYA 1GKPA 3QR0A 1K7EA 2Q01A 2JEPA 4V28A 5B7ZA 1H11A 2Y4SA 4J3ZA 3RX3A 3H2FA 3RM8A 2R14A 4PL1A 1XLDA 5L9FA 3QEZA 4JXCA 3D3AA 2VKZG 4KEVA 3DU0A 3R11A 1JFXA 1HKKA 2EPOA 3P2VA 1TPUA 1XLGA 4C6PA 1MVYA 1US2A 2WVUA 3BMVA 1FWGC 3KL0A 1BLIA 3M7SA 2JGQA 4HIBA 5BXTA 3LHVA 2OFJA 3COTA 1XBXA 4LNCA 3M16A 4WX2A 4C6NA 3W2KA 1LT8A 3WENA 2AQOA 5ENLA 1TA3B 1XIJA 1TG7A 4B5UA 2VGBA 1UYQA 1KA9F 4LVFA 1KCXA 1J0HA 4Q8NA 2JFEX 3G3MA 1NP0A 3AIVA 1WP6A 3E0LA 3URNA 4AZIA 1Y7VA 2PTWA 4IGNA 5A6BA 5E9XA 1CGWA 2AGTA 1DIDA 2QPXA 4ZO8A 3IS4A 4IZGA 2Z4GA 1XICA 3L65A 1EH9A 3VO0A 3WF2A 3NTYA 2VEFA 2AAMA 3JU2A 1TWSA 1PBGA 1DJYA 2WJEA 3RCYA 4LALA 4G7EA 5BRPA 1UBSA 1VC4A 1PAMA 3E38A 2QJMA 2W61A 4MFEA 4JTGA 2BG5A 5LKYA 2CXGA 3WD3A 5CGTA 3WD1A 2YLAA 5CGQA 3DHFA 4ZGYA 3GM8A 3EPMA 4M29A 4IJBA 1AA1B 3AHVA 1FWEC 1MZHA 3W53A 4L1WA 2OSWA 1EJVC 3M07A 3VD5A 2PGRA 2P3ZA 5K4ZA 2I56A 3DEQA 1OIFA 3H4XA 2ZZ1A 3KTXA 2CZEA 4WGHA 2CHOA 2TMDA 3CPUA 2I5IA 2ZE3A 4LC6A 1CWYA 1R38A 5I23A 3PSVA 3ABXA 1R3WA 4W8AA 2KX9A 4AXNA 3CYJA 1XIEA 4Y2WA 1SZRA 1A4MA 1AQHA 3SFWA 4YMZA 5LGZA 3OVPA 4HA3A 4PUWA 1HQTA 5I06A 3PBYA 1TPWA 3EGJA 5K4XA 1ZCCA 4JQ3A 4K1WA 2F38A 3VNYA 2JKAA 4NYYA 2H9AB 4GYFA 1JCLA 1K70A 4GZJA 4Q3MA 1A5NC 1I60A 2CLKA 4K37A 4LUJA 3L5LA 3A4JA 4DJDA 3W1AA 1UKQA 3U5YA 3W2UA 1NM9A 3SGUA 4A4AA 3N19B 3WF3A 2XH0A 1KC7A 3STPA 2XTKA 3G6LA 3EB3A 4DBWA 1P48A 3AZSA 4XIMA 4OBTA 5A8PA 3NSNA 1TTIA 3T0DA 1IT8A 3EWCA 3CASA 4G56A 1R2TA 4AC7C 1JZ8A 3A64A 4GO9A 1OG0A 4P7OA 2VNCA 4A3RA 1WZLA 1HT6A 4CD7A 2NV9A 4N6FA 3C5QA 1S2AA 2HNEA 4ROPA 4D6JA 2JF6A 3GG7A 5BYWA 1E3ZA 3RFAA 3M0VA 4NJGA 3ZJ6A 4A3UA 4GO8A 4ZB5A 1J11A 1JCMP 2GDVA 1E56A 4Q8MA 1JXKA 3OHMB 3S6OA 2VZTA 4KFPA 3F4NA 1S3TC 5JBDA 4ML4A 2PDIA 4CNNA 5DY2A 3N9SA 2EJ1A 3GB6A 5I3GA 4IICA 2XFRA 1UCWA 3S4TA 3GDRA 1AJ0A 1S2VA 2CEQA 1LOQA 1EZWA 1RPKA 3B04A 5BW6A 3QQ0A 1ZAJA 4XSLA 4Z08A 1CXEA 3KWXA 4XWUA 4Z17A 5A6SA 1VJIA 2V30A 1FWAC 2OZ0A 3WH7A 2DV0A 3R8HA 2J25A 1Y5XA 1VRDA 4PBFA 1CX9A 1G4EA 4N9BA 5FEXA 3LBOA 1S5VA 3FYYA 5HJLA 2YZ5A 3BANA 3MMTA 2DZWA 5IDIA 1QJWA 5D2TA 1UPPA 2V2CA 3CZKA 1EP1A 1H60A 1PIIA 2QAFA 2OCZA 2VDHA 3UZZA 1TWZA 2B0MA 5E93A 2EF9A 3RIKA 1PZ0A 1UPMB 4NY2A 4WKHA 5H6HA 3L7RA 4Z2HA 3FX4A 3ARXA 4C7FA 1RJQA 2FPYA 2YB1A 4GI8A 2AQWA 2I14A 3E02A 3MI2A 5EMYA 4AAJA 4HCDA 1GVIA 3WKZA 3W2MA 3QYSA 2OOFA 1HJSA 5JXQA 1EHNA 1KFWA 2E8ZA 1Z41A 3AAMA 2UV8G 4UCGA 1TJ0A 1EXPA 1DQXA 1QO5A 3BLLA 3E2SA 2D2HA 4PUMA 1PV8A 2DPEA 1PVNA 1TE1A 4LCSA 4U33A 3MMUA 4MLJA 1Z9AA 3HO8A 1E4LA 4C5YA 4YTQA 5HANA 4O12A 2VHLA 4QR6A 3LD5A 1A3WA 3M0XA 3SURA 3SCRA 1FQ0A 4WUIA 2V6AA 5AHLA 5HNTA 2XIOA 4XVDA 3LPPA 4C1LA 1E6SM 4GQBA 1NDZA 3ABQA 3TWBA 4B91A 4E2VA 2BOEX 3OZMA 3W86A 3AXMA 2NX9A 4G7FA 2JGYA 1B9BA 2VQTA 3ZR4A 3VGDA 4A2RA 1BWKA 4YLWA 4A3HA 3GDMA 4FXRA 4YN5A 3M0KA 1M04A 1ZPTA 1ZLPA 1KXHA 4ALDA 3UYCA 1K4GA 4C6KA 4D1IA 1BYDA 2OQHA 1UG6A 4O0ZA 1X98A 1G67A 3L4ZA 4PFHA 1VFTA 5I00A 2PDGA 1REQA 2FDMA 4C6MA 3CMJA 4GJ1A 2OYMA 4JFVA 3W76A 2W0UA 5BROA 3QF0A 2XIBA 1O68A 3OU8A 2QEZA 1TJ2A 1HG3A 3FSUA 3T42A 3R58A 4FLRA 2P76A 4W7UA 1B4KA 3WQDA 1RQBA 4QAIA 2HDJA 3PBMA 2KZHA 3REQB 3NQ6A 4GIEA 4U4MA 4HNVA 3MI6A 5I02A 4C6QA 3U4AA 4M7TA 3VDCA 4MWAD 3TNOA 3CJPA 1XR2A 4JTEA 3Q37A 3MKVA 5CLWA 5HBFA 3TTYA 3D5HA 3SECA 4LEFA 3RMEA 1K8CA 2YCKX 3I7SA 1D7KA 2VRJA 5EFDA 4R85A 3NGFA 4TV5A 4M1BA 4LUYA 3CQJA 4MKVA 3KBNA 3EDKA 4NAFB 1EFZA 1SYTA 1EUAA 1KFBA 1Q5MA 2FTPA 3AROA 1OM0A 1Z69A 2Q02A 4QE1A 1ZP3A 1FX6A 3AO0A 5A6LA 2JALA 2YOCA 3CO8A 1XG4A 1W17A 4JDBA 1NY1A 2E1WA 2Z25A 4MUZA 2NX1A 1KM4A 2YIHA 3F4CA 5D9PA 3E9AA 1BKHA 1EP2A 2PUZA 5F1UA 4O18A 1D9EA 1S5WA 2FFIA 4WSJA 2OOGA 2R1LA 3AALA 3Q58A 2OO6A 1EB3A 5D9NA 4V33A 4LNYA 4F0LA 1RQEA 1SJBA 3CT2A 5M2FX 1XRVA 2ZRVA 3PFMA 3VMNA 4IFOA 3VU2A 3BARA 1XYZA 1G4TA 2B81A 3ZLFA 5BCAA 1XLHA 4LB4A 4QCEA 4PE8A 1DPMA 1CECA 3L9CA 2XIJA 5T91A 1MXGA 5DRIA 1A50A 4MKNA 1O94A 3PANA 3IVSA 5ECVA 2EAWA 2GPTA 2PWHA 1E0XA 4XZBA 3W7KA 2VX7A 1XLMA 3SCQA 1FWJC 4BEUA 2V63A 5AC7A 2YBTA 3GG1A 4W93A 5JQ9A 2ZZ6A 4KGLA 4J1OA 1ISXA 2HK0A 4LY8A 4J27A 3UCCA 4S3FA 4CD4A 2PI6A 1FXQA 1ZCOA 1DHKA 1T5AA 4AD3A 4D6EA 3T07A 3A4XA 3EDJA 4C6JA 4L4OA 3H21A 1UWQA 1R3YA 1GOXA 1I45A 4MB5A 1UH3A 5GNXA 1PCWA 4QLJA 1WBJA 2J79A 4N4PA 3ECQA 4AZ6A 1JUKA 3NM3A 3DKJA 2PB1A 4HOWA 2GGJA 4EOUA 1J01A 4AIEA 5IXEA 3B4UA 1Q7ZA 4GXPA 3W73A 1RVKA 1YW1A 5DCBA 4FX6M 2E9LA 4DUOA 2O4QA 3SRHA 5F2GA 2CLOA 4HPGA 2BODX 1BSLA 2V8ZA 3N9KA 3GVVA 1QU4A 4UFJA 4WRHA 1V4YA 4LAMA 5IFTA 2RKXA 3L0NA 4J3XA 1DORA 3TEVA 5J5RA 3SEPA 2WHMA 2ZE0A 1FH9A 5DCEA 4B2DA 2QIIA 4LYPA 1ZJIA 4FOJA 1MEIA 1CXHA 4Y9NA 1M3UA 1ME8A 4GVGA 2QUNA 2DZUA 2BY0A 3VKDA 4TX8A 3UXDA 1JEZA 3H4WA 1HKMA 4PRRA 1DJGA 3AISA 3RILA 3WNMA 1CLVA 2BV9A 3ZR6A 4GHRA 3VGEA 3MKCA 3CZGA 2QUTA 2J8TA 1TYGA 3WL1A 1DJZA 4EE9A 3CWOX 2CESA 2UY5A 3H70A 2E28A 1YDNA 2Z6IA 4K38A 2EEXA 1YADA 2W62A 3VOCA 2I7GA 1LL4A 1QNVA 3VKCA 3LN3A 1KB3A 5CPLA 5AHFA 4IIFA 4AXKA 4DYEA 2D1ZA 2FH6A 4V1YA 4Z2IA 3KTCA 3BAYA 4OUEA 2PBOA 1AJZA 1TX2A 3KTSA 3M4HA 4TOQA 3LRMA 3GW0A 2E8YA 4JOMA 4DBEA 1KCLA 1KBLA 3VE7A 3RM9A 2QCEA 2QV4A 4LBSA 3KZSA 4L64A 3EDDA 3WBEA 3ZQ9A 1YTKA 1O1ZA 3LS9A 4JAWA 1KR1A 3T7VA 3LCWA 2QT3A 3FKKA 4O1BA 3NL3A 5HR7A 4X63A 2FH8A 4PA8A 3TLLA 3E74A 3NO1A 1P7TB 4S2CA 1DHPA 5A6TC 2DJLA 4WHBA 1MRQA 4L9YA 4NAEB 1FDZA 4X61A 5A2CA 1UA7A 4IM4A 3ERPA 1Q6GA 5DMMA 1KO0A 1OF6A 1W3NA 1X7IA 5IOBA 4FK9A 3BCJA 1BXBA 3KBSA 3NG3A 1W5MA 1XW8A 1WXYA 2GDQA 4AC1X 3B9EA 1RVGA 3IAQA 4HPNA 1TE6A 1RR2A 2YDSA 1V8EA 2EPMX 1ICQA 3MUAA 2D2OA 3TXZA 1ITCA 3MMDA 2BWGA 3MHUA 1HJVA 3PWAA 3EXSA 3T1GA 1XLFA 2E6DA 3H4GA 1HN1A 4NNBA 1VFFA 4XUYA 4A3YA 4YVXA 1OX4A 4ZQMA 3IJQA 4M1RA 3GYEA 3LXBA 3W7QA 1MI3A 3NM1A 3V1HA 3MI3A 3AIBA 2J47A 3UZ5A 3KBVA 1MW1A 3IGUA 2WJZA 1FFQA 4KESA 3VOGA 2ZOXA 2J88A 3T8QA 3FA3A 4JQ1A 4DXVA 4MJ2A 3CUHA 2ZBTA 1XUZA 3KP1A 2WJFA 3LERA 3THQA 4B5VA 4TIMA 1EYWA 4QQ3A 3SI9A 5D05A 2PWUA 2Z1XA 5LNWA 4KWUA 1KBBA 3CV2A 2RDWA 3HFTA 2ZX8A 2D3NA 1OYCA 4GABA 1XHGA 2UY3A 2NZLA 1H1NA 4D8LA 2OQYA 1BF6A 2I17A 2Y7EA 3TJ4A 4NAEA 2GSJA 3OA3A 3HURA 4URIA 4UTIA 3EX6A 3QM3A 4DLMA 3LCHA 4Z0SA 3ENLA 1FCVA 5IFPA 1LWJA 4K36A 4IMDA 4HCHA 4ADUA 1TPC1 3W29A 1JAEA 2ABAA 4JTJA 5FESA 3NFUA 1R9YA 2XGBA 3APGA 4G9PA 5CCZA 2VFFA 3SCOA 3IVUA 2UWFA 3R25A 1U33A 1H0GA 4JICA 3TFCA 2V3DA 1P0DA 3UVAA 2ISWA 2X1IA 2YDRA 2ZUWA 2NT0A 4QITA 3EOUA 2YL6A 1S2CA 1JR1A 4PSPA 3UR8A 4B5WA 2CKSA 1H61A 3USBA 2WW5A 1BYAA 4BK9A 2X41A 4QG8A 1JPMA 1FA2A 1L6FA 4PMUA 5F1VA 2VDGA 1VJZA 2DH2A 3ZSTA 5LNSA 4WOZA 3IJ6A 4CNOA 3OBAA 4ZO6A 1TPB1 2NQZA 4ZA0A 1FHDA 1SFJA 5FJIA 4N0RA 1FDYA 5CC6A 1V03A 2E09A 1DIEA 2Y63A 4RXGA 2IKGA 3AYRA 5HATA 2CLLA 1Z3NA 3MMWA 1JL8A 1VEPA 3OZYA 1EO7A 2A79A 5FI8A 1RBLA 3EDFA 5ABFB 4QHRA 7REQA 1LP6A 3G3DA 2NQ9A 3GLCA 1POJA 2C3ZA 3GIPA 4J35A 3WQ6A 3LI1A 4OBSA 2ZRWA 1UKSA 2R24A 1D2KA 1AVAA 3QMTA 4PUJA 4QS6A 1BEUA 3DG6A 5REQB 1PL9A 4AF0B 3ITOA 2JIEA 2WPBA 5D33A 1MFVA 3HOJA 4A3QA 3WQCA 4R88A 4ERGA 1F6YA 4FSAA 3GUWA 1Q6LA 3R5EA 4O19A 2E68A 2DW7A 1V02A 4HN8A 1FCUA 1N8FA 1E6ZA 3C56A 1ZBWA 6XIAA 1ZB5A 1WKYA 3M44A 4PBGA 1LROA 2DQXA 3ZIZA 5GNYA 1WV2A 1FFRA 4XV0A 5HULA 4C91A 5A5WA 3VNDA 4XBJA 2F61A 1M53A 3MHFA 4IOTA 4WVXA 1DE5A 5HJYA 1X38A 1GYNA 2QV5A 3WUFA 2R1KA 4M5PA 1LLWA 1EQCA 4OQVA 3WDPP 4MF4A 5DBTA 5J8LA 2TYSA 3RJXA 1V51A 1C93A 3LLFA 1QUMA 3OTRA 2GQ3A 4DI9A 1EP3A 3TUUA 3MB9A 1J6OA 5B80A 3MQTA 2PCEA 4GI4A 3WQFA 4OTKA 3CAKA 2PDMA 3PAJA 4AVOA 3NEVA 1DTNA 1EIXA 3W7IA 1GVQA 2HVOA 1Z6KA 1OHLA 1TREA 3THAA 1GPFA 3QYQA 3C4UA 5GQBA 1X6UA 2ZVIA 1XH0A 4JTQA 4PEKA 1VQTA 5G1MA 3TC6A 4C60A 3T2QA 4D6FA 2ISVA 3G0UA 2DUZA 4UTWC 3AYTA 3F03K 3E96A 4Z1DA 3HG4A 1OCBA 4IX2A 1W54A 3FS2A 4IPIA 1PPIA 2GLKA 2ZC1A 3DGRA 3K4DA 3QPZA 3NQFA 3VD9A 4HK6A 4UMCA 1W1PA 4O53A 3QVQA 2INEA 2VEMA 3B9NA 3NXFA 2GK1A 3FAWA 1GK8A 2A3EA 1JI2A 1IXPA 3I4KA 3GU2A 3W84A 4FNPA 3OZPA 4US5D 4D6CA 1Q6QA 3UXLA 1VENA 4HNOA 1PWLA 3S2MA 1CXFA 4JIQA 1K9EA 1OG6A 4LVBA 3QZEA 2F6XA 3QV6A 4PMQA 1EJRC 3K5XA 3N2CA 4I90A 4ZQPA 2Z1VA 4H4IA 3GTXA 2O7SA 4MOZA 4E0CA 4P7LA 2A21A 2XWEA 2Z2UA 3W6LA 1W8GA 4B5SA 3I68A 5HNNA 5T9CE 4DLFA 2IQ0A 3QHOA 4UOZA 4DJDC 4CQ9A 1DV7A 5A8GA 1A0DA 4TR9A 3GS6A 1EJ7L 4QX4A 2XHYA 3POCA 2PDUA 1GQLA 3C61A 1MXDA 1YLVA 3TQVA 3IIXA 1OF8A 1EBHA 5LXXA 4H7VA 2CZVA 2ZQ0A 3H7VA 4HNUA 1UR1A 3CIWA 3NNTA 1FOBA 1GEHA 3C2RA 4D8AA 3W07A 3BDKA 3E6EA 4YTUA 1HL8A 3CZJA 3ONCA 1E0VA 1FXPA 1CB7B 3TSDA 5EPDA 3WNPA 1NWUA 1GUVA 2H3BA 4GFIA 3QW3A 3CUXA 1ZHAA 4XD4A 4CN1A 5LSMA 4W84A 1A0CA 2W4XA 4N6EA 3EA2A 1ZSXA 1MQQA 1XIHA 2CYGA 3A9IA 3UNDA 3TU9A 3R10A 3H2EA 3U9IA 4YHGA 3DI0A 1XX1A 1TV7A 3OLGA 1J5TA 8XIAA 1PE1A 4LAKA 1WZMA 3E3HA 3BSGA 1JXJA 2C79A 2E9BA 5HWNA 5EU9A 4GH3A 3AHTA 2O7QA 1VFOA 1QI5A 2Y6ZA 2QDGA 1HKIA 4AFYA 2Z28A 3QRHA 1XV8A 1OC5A 4IWWA 1WZKA 2OR2A 1GZJA 3PTDA 4TXEA 3SCNA 4OU1A 4KS0A 4DF2A 1R87A 1OX4B 3IWPA 4GH1A 4M6VA 3JRKA 1ZJHA 3KHDA 4ZEPA 3N04A 2NQJA 4GKLA 4ENLA 2ZC8A 1W9VA 4AUBA 1VBJA 1XLBA 5HXMA 4CCDA 2QF7A 2AGKA 2VQUA 4C1NA 3WEOA 3LB0A 5C8BB 3S9YA 4KRTA 3A24A 3GFXA 4K7VA 4QFUA 1XKJA 3TR9A 1H3GA 2J7GA 1ME9A 4Q22A 4LVDA 3IUDA 1S46A 5CPQA 3SN1A 2PWVA 3OPSA 3LHWA 3MJYA 1OX5A 1F07A 1P0BA 2P0OA 4LAZA 2EPNA 2Z2AA 3BCFA 3GNDA 3TSMA 1GOOA 3WQOA 3VOFA 4BHYA 1VCVA 4JQAA 3IJLA 4H8NA 4H8VA 2HV5A 4ZO7A 3F4VA 1W1IE 4L6HA 1EA9C 2D22A 4IQEA 3SCVA 4REQA 4L5ZA 4O8AA 1XQLA 4EAYA 4IMGA 1XLAA 1U83A 4JIHA 1FBAA 4TO8A 4C6BA 5JUVA 4MWAC 5ABEA 4S2BA 3UERA 3WF1A 2VR4A 3AIEA 1GQNA 3AIRA 2FHFA 3LM7A 1GYMA 3VZXA 1ME7A 2HNHA 7ODCA 4QDMA 2CIPA 2WZEA 4JHMA 2OLAA 2ODOA 2VYOA 4P7RA 4O1DA 4CU7A 2RH9A 1N8IA 1JRCA 3BG9A 4LXFA 4JEJA 5D2VA 1XLKA 3WLHA 1LG2A 4IHCA 3G1HA 4AF0A 3CUJA 1HVXA 4S3JA 1MZRA 4AHPA 2OWWA 1XD0A 3B9AA 1ADDA 1D7FA 3CZLA 3LU2A 1R86A 1QWGA 1RY8A 3USZA 3B0PA 2XGZA 3E0VA 2VWTA 4NI8A 1S39A 2C0AA 1QW7A 1JUBA 2VJXA 3LOTA 1MQRA 2IMRA 2WQDA 1K9DA 3CHCA 3QSRA 2NVCA 1IIGA 4GY0A 1J2BA 3SGGA 3ICJA 2GSHA 4HSNA 3E2RA 1A53A 2QLYA 2YCEA 3KL3A 3TCEA 3TQPA 7PTDA 2ZDSA 5LIXX 3ARZA 3FVMA 1EDQA 3I6RA 4N9DA 4A8RA 3N2BA 3B8UA 4TX6A 3DFOA 3P82A 4PL2A 2XZ9A 3WN6A 1EC8A 3P0XA 4WJ8A 2GWGA 4LQ1A 1VYRA 1RJRA 3GHUA 3S1WA 3CEPA 1LJYA 1H7XA 3EB4A 4UQAA 1RP8A 3VC6A 1W32A 1AMYA 4H9YA 3CHEA 3LV6A 3VZZA 1VYPX 3L2IA 4QEEA 3RPDA 2BSLA 3KW3A 2ATMA 2VC5A 1MEWA 4JY9A 2Z1WA 1D8WA 3T0BA 3MDWA 4S3BA 4D6GA 2R9RA 4PTDA 6A3HA 4PMYA 4DO7A 3LCIA 2QUUA 3P3BA 3VDAA 4M19A 4P61A 4JX5A 5LNRA 1HW6A 1I75A 3W1MA 2PWEA 1G7VA 3CK5A 3ZS4A 3K2GA 3Q2DA 4P7QA 2BTMA 4IXXA 1E6PA 2DZAA 3OJGA 4XD5A 1UMYA 3PJWA 3LG3A 4C1NB 1FP8A 1LBLA 3FVDA 2X7WA 3UYIA 4CN4A 4QISA 3Q67A 3SFKA 1MRAA 1EDGA 2UBPC 1GCYA 1HF6A 2P8BA 4KKXA 4JHZA 4E2DA 4WDTA 3PAOA 2G50A 4RNJA 3CIXA 5M1TA 2FZ8A 2ZXQA 2C19A 2JK2A 3LZ3A 1WNOA 3SY1A 3UGRA 4QJ5B 4HHHA 4PR4A 4TV6A 5FJRA 5I07A 1AL8A 3HPZA 3UD6A 5E6YA 3W4RA 5BWAA 3ITLA 3P8JA 3TW6A 4IPLA 3VZYA 1QPRA 5CZKA 3NYDA 1VBUA 3NGJA 3EX2A 1KV5A 2VZUA 3R89A 2CWNA 3PTKA 5HQLA 3QJAA 2WBGA 3OGSA 2QCLA 4YIWA 4RXFA 4ZB0A 3L0KA 3VMPA 3NJ3A 1E43A 1Q7QA 1ZP4A 1EKOA 3BMXA 5KTLA 1WQ5A 4HT3A 3SUSA 4JEQA 1K7FA 1F3WA 3BOFA 4QSFA 2X1UA 3Q4DA 3LGDA 4IIEA 2X1SA 5EKYA 1E4MM 3ZR5A 3C52A 3GU1A 3M41A 1JCYA 1J8VA 4DAIA 3QN3A 3PSWA 1XCFA 4Y7EA 1JIBA 1RXOB 4UZUA 3DKLA 3CM4A 1UD8A 4K8GA 1ZBVA 5E1QA 2XM1A 4KEZA 1UKTA 4X9YA 4FNQA 4KPLA 4RK8A 1IQ8A 3ANUA 5GJPA 1AH3A 4DJEC 3SCWA 3VA8A 3M6DA 3O0FA 1Z7AA 4OKDA 4ZB2A 1C9DA 3CT7A 3IIOA 4IP4A 5F4XA 4MB3A 4GGHA 2WV8A 4PN2A 3IK4A 1JDDA 4HZ8A 2VEIA 2PLMA 1AW5A 1CIUA 3IGXA 2BMBA 1XH2A 7CGTA 4Q8VA 4XISA 3LQLA 2NT1A 3THUA 4BWLA 4D72A 3GXFA 2HVMA 3GE7A 3IJDA 1CEOA 1IR1A 1THFD 4Q6JA 1UR3M 2W92A 3WQGA 3HF3A 4Y9MA 1XRFA 1U5JA 2A7RA 4AEOA 4PTMA 3FHQA 4JS3A 4RZ6A 1W9DM 1MW3A 3JR2A 2DSWA 1YBQB 1JYVA 2XFFA 3I7QA 1D3HA 3U2CA 3HGSA 1I1WA 5FJUA 1DWAM 4NRRA 4QG9A 1Q45A 3WUGA 1NIUA 1Q6DA 3TA6A 4XTIA 1OABA 3KX6A 3F1QA 5LNUA 2VUYA 1E70M 2BHYA 2CZDA 5H91A 4AQLA 1YRRA 1DJHA 1UD6A 3WELA 4HN4A 3P74A 3KRBA 1QPQA 1WDDA 4KCUA 1WDRA 1R2SA 2J13A 3GDTA 3K4AA 3OQ8A 3JVAA 4QLKA 2F8QA 2GJLA 2XVKA 3UJFA 1F5ZA 3SY5A 5C6MA 1P6WA 3WK0A 3FN9A 5C70A 1W3TA 3NQGA 3A3WA 3TTOA 1V3KA 6PTDA 2NV1A 3AMKA 3OBEA 1DOSA 4YWSA 1KXTA 1VFLA 2W66A 3ZZ1A 3NQBA 2R1PA 1B3VA 4BQ3A 1QHPA 1KXVA 1GT8A 1YMYA 1AFSA 2WVSA 3OYXA 3UR5A 1E4NA 2XSXA 2ZRUA 3ZJ7A 4KIEA 3D46A 1FUYA 4RNIA 3VOIA 1FWTA 1OYBA 2V69A 4DUVA 5CSSA 4C6CA 3ZSSA 1YTEA 3CQ0A 3WD4A 4M82A 5AZ0A 2TODA 2SFPA 2P5NA 3MDUA 3NQMA 4BI6A 3FEQA 3G77A 2HZGA 2WMGA 3GG0A 2EO7A 2ISFA 2HJPA 3ME3A 4ZODA 2J75A 2J9XA 3WH8A 1G9HA 1IEVA 3HPFA 1HJWA 3AS3A 3CV7A 3FAXA 1ZAHA 4I5XA 3HM7A 2ESCA 4MM1A 3RX2A 4Q7BA 4OOZA 3BW2A 2OEMA 4JQ2A 2XWDA 4ATLA 1U1HA 4CD5A 4AZ7A 2ACRA 1LG1A 5TD4A 3M5XA 4M6PA 1XUUA 3IJ9A 2X0HA 1FWIC 3B4YA 3E5BA 2W63A 3N29A 2DUAA 4R7WA 3RRAA 3WH5A 4CVUA 4AWEA 4LVGA 4CGTA 3MUXA 3VINA 1JCTA 2V82A 3W7JA 1TVLA 1TV5A 2Y62A 4WLCA 1ZAIA 4XG1A 2DIKA 1KW1A 2A3LA 1EX1A 1TJ1A 4BS0A 3HGOA 4LCQA 3H54A 5D8ZA 2ZADA 4IIDA 5I5RA 3W2LA 1QW8A 3VKBA 3PJTA 3TDFA 1V3LA 1VKFA 3WUBA 1J0KA 1OD0A 2VL4A 1B1YA 2VD8A 3W6MA 4E4UA 4IT1A 3D47A 1R8LA 3CYVA 2HXUA 1LQ0A 1TIWA 2FVLA 4GE8A 4UWMA 4WJXA 2Y8VA 3RLUA 2PDWA 4FXFA 3WYZA 1UQZA 2ZX9A 1LUCA 1Q6FA 1NSJA 4MKSA 5HNRA 4JN6A 4FHAA 3KOZA 2ZKMX 3AXKA 1VAHA 1KWGA 4UC5A 2WCAA 4PRTA 4NU7A 3C2FA 4X3ZA 1SSDA 3R0DA 1OFRA 3TN4A 4CLMA 1SW7A 3T78A 4N4QA 1W9PA 2HMCA 3GTNA 1B3ZA 4I6VA 2DIJA 3MANA 2YCLB 4EX4A 1W1ZA 2X1RA 5DRCA 1YNYA 1V08A 2PS2A 4I5RA 5G4WA 3WJYA 2WMIA 3R0KA 4DRSA 2WAGA 2NLYA 2V5CA 4O54A 2RAGA 2WKJA 3S2CA 3BQ5A 3PULA 1OY0A 3LHTA 4Z1CA 5DN1A 1GG1A 4QJ1A 2DSVA 4PB3A 4MZ1A 3WBXA 2FDSA 5CSUA 3SCUA 5FEZA 1TPEA 1G4SA 1O12A 8A3HA 4M3PA 2QAPA 4Q33A 3RXZA 1Z44A 3HG2A 3LCLA 4AW7A 3NZRA 1KTNA 4X2PA 1HGWA 1DIOA 1MNZA 2WZIA 4GXWA 4AY8A 1JG9A 1GEQA 3E2VA 4E8CA 3NEHA 3KL5A 2FYMA 3L2LA 1SUXA 2V67A 1ECEA 1QAPA 1O66A 1C91A 3N6QA 4A2SA 3H2OA 1M5WA 1VF8A 1W2VA 2ZX6A 2CLMA 2OEKA 2VEGA 2DW6A 3MP3A 4AMCA 1TV3A 3CAVA 3H24A 4AIOA 4WKFA 4DJFD 1GKQA 3DFYA 2WC4A 1Q6RA 3TYBA 3EWUA 3MA8A 3ITGA 3KS5A 2Q8XA 4XKMA 5MF5A 2VFDA 3AWNA 4UMAA 2NUYA 4A8IA 1I2NA 1UA3A 4S3KA 3DECA 5DF0A 2PRMA 3VD7A 4J40A 2NUXA 1EDTA 4NG3A 1Q85A 4RE4A 1WBHA 3POHA 1T41A 4MFDA 4DEFA 2QULA 2REQB 4PGLA 1E9IA 4W7WA 4IPPA 1XC6A 1UIPA 3FNDA 3R1ZA 3WJXA 3LY0A 4LYKA 3PUDA 3PZOA 4H8UA 3G24A 2WZMA 3S47A 3W85A 1WPCA 4KCVA 3OQEA 1XRSA 3EEZA 1O1HA 1E0UA 2WNZA 2ZDRA 3C0QA 4J3UA 4Q4QA 1FHVA 5IRPA 4JTIA 2VCCA 2BVWA 3V5FA 2CITA 1T0OA 1JCXA 1Z32X 4UTWA 2XSAA 2Q8LA 3MO4A 2NSXA 4LW7A 3ARYA 4CQAA 3ZT7A 1UZHA 1E51A 3BPWA 3ITCA 3GNXA 1LL6A 3K8LA 4ATWA 2FGBA 2JBMA 1RK5A 1HKWA 1XSIA 5I3HA 4F8XA 1Q8JA 2DT3A 4JFUA 3UY8A 4H9UA 5AB3A 1L6SA 5LYRA 5I78A 3CQHA 4K39A 3DX5A 2ZZ2A 3HU7A 3RN6A 3M47A 1XYFA 4TVDA 3G0XA 4MYXA 3T08A 4EF8A 5KZDA 1ZFJA 2HE8A 2CLEA 2G3IA 4CNSA 1H1ZA 4GFSA 3VIGA 2QJNA 5CPNA 4XZHA 2DP3A 1VEOA 2XIQA 4U5IA 4AVNA 3GUGA 3AIUA 4C7DA 1CNVA 2ONEA 2B31A 1FH7A 4Y90A 1JZ6A 4ZQOA 2V3EA 4P8WA 4FXJA 3CHVA 1H2JA 4PC8A 1PSCA 2QJJA 1QPNA 2H3DA 4EIVA 3NDOA 3RYSA 3VIPA 3WSUA 3DUGA 5KZMA 1MDRA 3ELFA 2X2YA 2DU2A 1DJQA 1NDYA 2VX6A 2V81A 2Y7DA 3BV4A 4LH8A 1R46A 4PB5A 4H9XA 4WF7A 5U7SA 1UASA 5M17A 1QI4A 5L6UA 4GNKB 3GG8A 1WOBA 3M0JA 3V3WA 1I6NA 1VPYA 4DM1A 3GVWA 1IGSA 5D04C 3RMJA 5AYYA 4W86A 3TTQA 3N25A 3NL5A 4M7SA 2ZUSA 2O56A 2ISSA 4AYGA 1XPYA 4JY8A 3WLRA 1KM6A 4X0NA 4BKNA 2BDQA 1V6WA 4R3UA 3O6YX 1QPOA 1UWAA 1E73M 3G2GA 3UR7A 4ERIA 1O60A 3SIZA 4CCCA 4O13A 1F7BA 1O5XA 2UZ9A 2DGAA 2FQIA 5C2XA 1R3SA 4O10A 4GYPA 3PZNA 2YYUA 3QGKC 4ZOBA 4O15A 1ITQA 1M41A 4DF1A 1QK2A 5K9DA 4UOQA 4E2BA 3PVFA 4US5A 2GOKA 2VEKA 1MWOA 3H55A 1GHRA 3TZFA 3AJXA 4M24A 4F48A 4Q4RA 4R34A 1Z48A 3RCMA 4ZENA 3O05A 4FX7A 4YCPA 3LTPA 3SSZA 3W1RA 2VFHA 2PC8A 3GYCA 1R6WA 5DMYA 3N4EA 2GFTA 2VEPA 1OX6A 4KEMA 1XS2A 3MWCA 1XFCA 3W1LA 3J7HA 5XINA 2Y89A 1RJPA 2F6KA 2NSOA 4B4FA 1V0KA 4UMBA 3P14A 1CDGA 3GVRA 4GVHA 3VIJA 4H83A 4GZ7A 3BLDA 3HPXA 4LANA 3VFCA 3RR4A 4GOAA 2R1MA 1SPQA 3S9ZA 4MJMA 4R9OA 1EGMA 2R1NA 2DJXA 3ANVA 1A47A 1WA3A 3OA5A 5F4WA 1VFUA 4OV9A 1L0PA 1GGOA 1OFAA 3C0LA 8RUCA 2X1TA 4GUGA 4J9JA 3NZPA 1DXEA 2DZVA 4NRSA 2PDLA 4PTWA 2OWXA 2B7QA 1TQJA 4MWAB 4RDWA 1X7FA 1V3MA 2A4AA 3TNBA 3W1XA 3CLWA 2WC3A 2Y0FA 3SUTA 4CCEA 4Q4SA 3DN5A 5HMDA 5CEWA 3TN3A 1QOPA 1XJBA 5TIMA 3ARRA 3HQNA 1KM0A 4JX4A 3TAOA