2DY3A

Crystal structure of alanine racemase from corynebacterium glutamicum
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
361
structure length
338
Chain Sequence
b'MNLLTTKIDLDAIAHNTRVLKQMAGPAKLMAVVKANAYNHGVEKVAPVIAAHGADAFGVATLAEAMQLRDIGISQEVLCWIWTPEQDFRAAIDRNIDLAVISPAHAKALIETDAEHIRVSIKIDSGLHRSGVDEQEWEGVFSALAAAPHIEVTGMFTHLAETDRQIIAFRRALALARKHGLECPVNHVCNSPAFLTRSDLHMEMVRPGLAFYGLEPVAGLEHGLKPAMTWEAKVSVVKQIERGFVAVVPAGYADGMPRHAQGKFSVTIDGLDYPQVGRVCMDQFVISLGDNPHGVEAGAKAVIFGENGHDATDFAERLDTINYEVVCRPTGRTVRAYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanine racemase
publication title Crystal Structure of Alanine Racemase from Corynebacterium glutamicum at 2.1 A resolution
rcsb
source organism Corynebacterium glutamicum
molecule tags Isomerase
total genus 109
structure length 338
sequence length 361
chains with identical sequence B, C, D
ec nomenclature ec 5.1.1.1: Alanine racemase.
pdb deposition date 2006-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00842 Ala_racemase_C Alanine racemase, C-terminal domain
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 2dy3A01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 2dy3A02
2ON3A 1W8GA 3S46A 2RJGA 3N2BA 1F3TA 4FS9A 3VABA 1VFHA 2TODA 3B8WA 2RJHA 1BD0A 4LUTA 5GJPA 3BTNA 2DY3A 4LUYA 5GJNA 3WQCA 4LUSB 1TUFA 1FTXA 1HKWA 2SFPA 3ANVA 4XBJA 4ZGYA 3NZPA 2QGHA 3AWNA 3MT1A 1D7KA 3GWQA 3AWOA 5FAGA 3UW6A 3N29A 1NIUA 3WQFA 2PLJA 2PLKA 4ECLA 4BEUA 3E5PA 4QHRA 3CPGA 1VFSA 5GJMA 4XG1A 1XQKA 4BF5A 5IRPA 1L6GA 3B8VA 4PB4A 4A3QA 2O0TA 3NZQA 4PB5A 2VD9A 1TWIA 1KO0A 1QU4A 3CO8A 2YXXA 1XQLA 5FACA 3R79A 1KNWA 4LUTB 4AIBA 3WQEA 3ANUA 2J66A 3C5QA 1SFTA 1B54A 1EPVA 3LLXA 1HKVA 2OO0A 3HURA 3WQGA 1CT5A 4LUSA 2VD8A 4KBXA 4BEQA 1XFCA 3KW3A 2ODOA 1SZRA 5FAJA 2NVAA 4WR3A 1L6FA 5BWAA 3WQDA 3B8UA 1RCQA 4Y2WA 4ILSA 3OO2A 4PB3A 1VFTA 4V15A 7ODCA 4BHYA 3SY1A 2P3EA 3B8TA 3HA1A 4DYJA 2NV9A 1NJJA 4DZAA 3E6EA 3N2OA
chains in the Genus database with same CATH superfamily
1LQ0A 4I7VA 1PAMA 2EG8A 3NVDA 3OVRA 5FJJA 1A0DA 4AYGA 1TTQA 1RHCA 3H26A 5F4WA 2J6VA 2X0SA 4V27A 2PDQA 1G67A 4P7RA 4ZEPA 1EDTA 4XO6A 4KT2A 3TIMA 3L0KA 5IBXA 1ZP3A 3WF3A 4JX4A 5GNZA 2YZ5A 5BCAA 5XIMA 5FAGA 2YBVA 3EOSA 5LKYA 1GYMA 4YHEA 3G2GA 4J27A 4XSLA 4FPSA 1I0DA 1HN1A 2ISFA 3NQ8A 1J0ZA 9XIMA 2I5IA 3BZGA 1JL8A 2C71A 4IXXA 1HJXA 5GPRA 1GJUA 1ELSA 2DU2A 5G4EA 2VGIA 3H12A 2GQ3A 4J7RA 3GNDA 3URNA 2O92A 3FJNA 3LRKA 4KBXA 3TSBA 4C1NA 1W1YA 2BOFX 2D69A 1TG7A 4QDPA 1F4HA 1WKYA 1UD2A 4MLRA 3AXIA 4HB7A 5CLTA 4UOQA 3UQNA 2VYOA 4US5A 2XH7A 4DI8A 1XIMA 1KV8A 4PL2A 5AHLA 1EP3A 3ARYA 3COTA 2YW3A 2X1UA 3HJZA 1UWQA 3CGTA 1P4CA 1X6NA 1H7OA 3WDJA 3W86A 1VBUA 1B3WA 3KXQA 3FGCB 3EWZA 2CLOA 3VIPA 3O3RA 1E3ZA 3MWAA 3TW9A 4H7VA 1MRAA 1ZRQA 1BFNA 1GVQA 3BE7A 1IXOA 1QW7A 3FOKA 3H2EA 4FOUA 3SRKA 1FHVA 3NZPA 3G1FA 1OYAA 5D33A 3N2CA 4NASA 2CLKA 3QZAA 3WDIA 3MVTA 3PBUA 3GXNA 1QHZA 2DVUA 4GH3A 3JR2A 3XISA 1Q6RA 3D47A 5BXPA 3KBSA 2E3ZA 3KS5A 3WJWA 1EJTC 4FLOA 1KGXA 1ZB5A 3SRDA 3M46A 2O9PA 2JQXA 1UB3A 1OT1A 4S3BA 3PTKA 1ODUA 3GXDA 4NNAA 4G9PA 4MM1A 5G2IA 5AC6A 4MWAA 1JAKA 2VQTA 3MY9A 3IIVA 2RKXA 4X22A 1NEYA 2E8ZA 3ATZA 2JIEA 2Z7KA 3F2BA 5BOEA 2CNCA 3G6MA 2VELA 3AUOA 1FCBA 6XIMA 3MUAA 1OVDA 3C61A 3O8AA 4HK6A 1B3XA 3LN3A 3L2IA 4DJFA 5DO8A 1EIXA 1F2JA 3CUFA 1A5SA 3PJXA 2FHFA 3HGRA 2VOMA 2BB0A 1L6WA 2KZHA 3MDUA 5DEZA 3QHNA 3G6LA 4HNNA 4UBPC 1R3RA 4GY7A 4PMZA 4IPPA 3NAVA 4CN6A 2ON3A 3H2OA 1EOKA 4DO5A 4AHQA 2MUCA 3TWAA 3AMCA 1SW3A 3UZXA 4RPQA 1EJRC 4NL1A 2PTYA 3GHSA 3LBOA 5HXMA 5A2CA 3T55A 3W75A 3THUA 3VINA 4MJZA 2PCEA 4MZYA 4ZVJA 2QJJA 4S3EA 5FSDC 3SO7A 3SCNA 4H9TA 4JEQA 5EBAA 4JTSA 2H6RA 4K3ZA 1EGMA 1K8YA 2HWGA 4ECLA 4ZO6A 1V3HA 3EA1A 3MU7A 4HTYA 2PURA 1RK6A 4JBRA 3LTPA 3OA5A 3VZYA 4AEEA 1YNYA 3CHEA 2PDYA 4XBSA 4QE4A 1TPFA 3CC1A 9RUBA 2PUZA 1YW1A 4KPLA 4IIHA 2F6UA 1LZOA 1PCKA 2QIWA 2XGZA 2FJUB 2NXIA 3QPEA 5AY7A 5AZ1A 4FLSA 2POZA 4HSOA 2ZRYA 3EB3A 3NQCA 1SMDA 4W9TA 3ZR6A 3EWBX 3UY7A 1LP6A 4GIEA 3OBKA 3ATYA 3SY1A 1XIJA 3WNOA 4NAFB 3H4GA 3L4VA 2A3AA 2ZBTA 3VPLA 1K7EA 4IGSA 1SJAA 1G0CA 3WFLA 2R91A 1DWIM 3T05A 1XBYA 3QW3A 3KVLA 2YDRA 1XF0A 3TYAA 3AUJA 4JZ5A 3GIQA 4U3CA 1XYZA 1QOPA 2Y4SA 1JZ5A 3ANVA 1YPFA 3L23A 3N3TA 4Q4MA 3T07A 2J7EA 3U4FA 1IEIA 4TVUA 3THDA 2ISWA 3IJ8A 4ZQRA 1VHCA 3W7QA 2ZZ6A 4I5RA 4XD3A 4AZ6A 1AFSA 2W67A 3DBNA 1FDJA 2J27A 3QR0A 3UXDA 3R12A 4ADTA 5CXPA 2PTXA 3QM3A 3OVPA 1UW9A 1OQFA 3CQKA 4LAOA 3W1TA 2ONEA 3TFXA 1R3QA 3KP0A 5CC7A 3PPCA 4YVVA 3S9ZA 1GTHA 1JYNA 2XIJA 4GO9A 1HGWA 2A4AA 2Y89A 3PP7A 3IIXA 4IMDA 1DE6A 4IH3A 2ZFAA 2X1SA 1NFGA 4KRZA 5J5RA 2OZ0A 5DT7A 3QZEA 1ITQA 4O18A 3NNTA 3M9YA 4XKMA 5HQMA 1KRMA 2D73A 3H8AA 3QR3A 4GWEA 2BVDA 3JW7A 5EMMA 1JI2A 3D3FA 3AS0A 3HBLA 3KS6A 3NM1A 3OG2A 4V33A 5DCBA 2YDQA 4N2YA 2YBUA 2PA6A 1NF0A 4G1NA 3S2JA 2Z25A 4JDBA 4HNTA 4LYPA 1NDYA 2Y2WA 1HW6A 2WVTA 2NUXA 3QH2A 4WUIA 4JN6A 1NQKA 3NFUA 3VFLA 5CPQA 3ARZA 2QMKA 4D8AA 3N2XA 4GC4A 2RDXA 2CYGA 6XIAA 4IF2A 3SB0A 3ARQA 1BGAA 4ERAA 4BQ5A 4MZ1A 1VAHA 4EF8A 2OWWA 1JXJA 4XV0A 2FHBA 1YBQA 3CPGA 2VR4A 3R0UA 1XGDA 3U3HA 1JPKA 5K9XA 1AH0A 2BFGA 3BLKA 4DXKA 4IPIA 3CH9A 2YFNA 4H8NA 4P61A 4D8ZA 1WZMA 4A2SA 4A4AA 1V08A 1XL9A 4AWSA 3WLOA 2NQ9A 1KM0A 1OADA 3EDJA 1KCXA 4J3TA 1E72M 4UMCA 5K9DA 1SO4A 1RA5A 3N1AA 4ILSA 4GZIA 3VKAA 5I3FA 1FBAA 5A6MA 3FAXA 3MW7A 1P0DA 1QJWA 4BFAA 3B8TA 2ZC1A 4C5YA 2A85A 3VOGA 4HNVA 1KKRA 3N2OA 3LZ3A 4DZHA 3RITA 3I7QA 3RILA 3VKDA 1S1PA 3I3BA 1TA3A 4NYUA 4QDWA 3DG7A 1F6YA 5KITA 5FJUA 4JNMA 2V5BA 3OLEA 4CEXC 1B0IA 2F38A 1T6MA 3GC5A 3AWNA 1UBSA 3E0WA 4J3ZA 1GT8A 4WGXA 1EEPA 3UG5A 1F3XA 1EC7A 4US6A 3M5ZA 3S5OA 4LYQA 3WFZA 4ZA0A 1GPWA 3DCPA 3INPA 3TROA 4AZBA 3I6EA 3H54A 5C6MA 1SVDA 2PP1A 1VLIA 1EL3A 4H9XA 2NVCA 3VNMA 4DM1A 2Y70A 3P81A 3EA3A 2WCSA 4JEJA 3WLSA 1VBJA 8XIAA 3MSDA 3VOFA 1LLZA 3B0VC 3CQ0A 3NZ1A 3L4TA 4ZZ9A 3BDKA 5JXQA 1H11A 3R0KA 2EPOA 1XICA 3GYEA 3FX4A 1CLKA 3H23A 1O4UA 2I57A 1R5YA 5E6ZA 5FL0A 3MO7A 5I7GA 3ITLA 2F6KA 5CH9A 4HN8A 1TWZA 4YYFA 4KEVA 1S1RA 3S46A 1HVXA 1TTIA 3G1YA 1R6WA 4DWSC 2VEKA 4WXYA 1Y7VA 2A6NA 1JCNA 1FY6A 1JZ4A 3CL8A 3WCZA 4CLMA 1TMHA 5GJNA 1Q66A 3ZSTA 3PZIA 3W07A 4X3ZA 3C52A 4LOCA 2GVJA 3WBXA 1HX0A 7REQA 2W92A 2HNHA 2GVEA 5LXEA 4PMDA 4M6VA 4UC5A 3BO9A 1R85A 4AZCA 1GPFA 3AMDA 3DG3A 4DBDA 2BLEA 3T9PA 4IMAA 4NX5A 1XIIA 2PBGA 3VD7A 2YPIA 1C7SA 2EKCA 3K8LA 4MUZA 1A5AA 3O15A 3G1RA 1RZMA 4PTNA 3WSUA 1ZU8A 4XVDA 1X8FA 4YWIA 2GLKA 1S5WA 1TWWA 1UMLA 5TAOA 4HZ8A 1MVYA 5JH1A 4HYRA 2I9UA 3SSJA 2VM8A 4RZ4A 1LWHA 3FYPA 1G4EA 1XINA 1XH2A 2E9BA 3P7YA 5ECUA 3EOLA 5IOBA 1XHGA 2QXWA 3QZ6A 2X8RA 1AQFA 2PDNA 4DXXA 3B0XA 1A4LA 5M03A 2JKPA 3I6RA 3O0FA 5REQA 1OC6A 3KDNA 1EYEA 4HCHA 3AIEA 4ZE4A 3W7NA 1WQ5A 4LF1A 3WQCA 1KKOA 4D71A 1CENA 1ZAIA 3PY2A 3G3DA 1PZ2A 2EPNA 2VCAA 3BMXA 3L21A 4ORIA 5F1VA 2XVPA 3P5ZA 1XV8A 2X41A 2YLAA 2IUZA 3LGGA 4ZQPA 3VDHA 1EPXA 1Q6LA 3PM6A 1VFMA 4H1ZA 2V3DA 1U1HA 2UWFA 3WMCA 4DF1A 4BR1A 4L1GA 3CZKA 3BARA 3VIFA 3VIGA 3CWNA 5DY3A 1A5NC 3NL3A 3C2FA 3U9IA 1BVWA 2O9RA 4Y9NA 1OIFA 1B9ZA 3AMKA 3ONCA 1Q4WA 1R86A 3AZSA 1FKXA 2OO0A 3N9KA 5CJMA 5DBUA 1CLVA 2OVLA 3IRSA 3CLWA 4GNKB 3QW4B 3C2EA 1MMFA 3ZT7A 3M0HA 3LHUA 1H1ZA 4KWVA 4ZE5A 1VIZA 5I6SA 2NT1A 3WNLA 2XVNA 3M0XA 3T0CA 3L5MA 1OFDA 4IFOA 2X1IA 5G2HA 3TYEA 2P1FA 3W6LA 1WBJA 1V6TA 3LPOA 3DYMA 1JRCA 4AFYA 2RJGA 3IAPA 3UZZA 4ZL1A 4M19A 1HL9A 3EOOA 2YL8A 1M9HA 3ARXA 3OPSA 1FWNA 2DFAA 1YADA 2GDVA 1TRIA 3O1NA 2AMGA 1WXJA 4PODA 3TONA 4HOZA 3POCA 3PPHA 3SFWA 2WB5A 1HKIA 3R7MA 3WQFA 1HVQA 4U2YA 4DPPA 3W1MA 3SCWA 1E5JA 3CIVA 4MNLA 2CBJA 2J78A 3AZTA 1G6CA 3TYCA 3O16A 4BS0A 4JN7A 2Q6ZA 1WOAA 3KX6A 3TKFA 2YCLA 2H3DA 1VFOA 2OT0A 1O5RA 3K1DA 3P2VA 3BK0A 4GYPC 4DHGA 4C6QA 4RXGA 1HKVA 5HNTA 3K13A 4AWEA 1O6IA 1JCMP 3ITYA 2OSYA 3M16A 5I3HA 5CGMA 4OBSA 1OK4A 5CC5A 1S2WA 3BH4A 1BTMA 4H9YA 3WQPA 3ZSSA 3B8UA 1E71M 3SDOA 4JY8A 2QVNA 4LJ3A 3R10A 4UFLA 1C91A 4GACA 2V5KA 1XRFA 1T8QA 1J0JA 4GCAA 2JGQA 1U5HA 3W1RA 3HPZA 1MI3A 2PWDA 4U10A 3W26A 3BOLA 1N8FA 1XLAA 3CAWA 1KA9F 1XI3A 2OG9A 3MJMA 4W4QA 5GJPA 1B4KA 3HFTA 5JIWA 3OHIA 1UH3A 2PGWA 4PH6A 3FHAA 1W3HA 2ZX7A 1O1HA 1Q2SA 2WVVA 4NXKA 4M1BA 4KGJA 1NELA 1GVOA 3U5YA 1W9VA 1OY0A 1AW2A 2VC5A 5FEXA 1VLWA 5BXSA 3RXZA 1HXJA 3PZGA 3G18A 1XP3A 3EWCA 2OKTA 1CXIA 2FZMA 4AZIA 1MNSA 5DLCA 1J5SA 1UIOA 1KRAC 3KVKA 3NYDA 3Q4DA 5DXXA 3AHTA 1DJYA 1PKYA 1QPRA 4D6EA 2XZ7A 3OIHA 2DT0A 4Q4RA 1S38A 3CHFA 3V18A 1B4EA 7CGTA 4NYYA 4NVTA 3ES8A 4PSPA 1JD7A 3CV7A 2DDXA 3MCNA 1T99A 4IG2A 4TV5A 1I45A 1JDEA 2V81A 2VFGA 3TU9A 3FCPA 4E3VA 2D2JA 3I10A 2OYKA 4GX9A 1Z89A 2GUBA 1WZLA 3WF4A 3GNOA 4MFEA 4O13A 2PP3A 1GZ1A 4F48A 4M6PA 3EPMA 5C9ZA 5E1QA 4TR9A 3HQNA 1IEVA 1W9UA 4H4IA 2CZFA 4P8WA 3C8NA 5D03A 4M6UA 3RMEA 2WBKA 4IJCA 2B4GA 1A4MA 1QNRA 4FXJA 1MW2A 1WKDA 3VNKA 2O4QA 2ZXAA 1MUMA 4HOWA 5LNSA 1A5LC 1S2CA 1D7KA 3O2LA 2EO7A 4EPEC 2VUYA 1A3HA 4GD0A 2H8ZA 2GUUA 1GJPA 1EJVC 1ZLPA 4XAZA 4FNTA 1UP3A 3BAIA 3BSHA 5D38A 4OWGA 1J8VA 3SRFA 5C71A 4Q6JA 5G4HC 2ZDSA 3LNMA 3MC5A 4MNKA 3SECA 1TJPA 2PDXA 3ZJ6A 2B7OA 2YA2A 2GJRA 3M44A 2TSYA 2OSWA 1VJIA 1G1YA 1M7XA 4J35A 5D9MA 4CKQA 1AD4A 1VYPX 3WBWA 3C8FA 2ZRUA 2WSPA 2X2GA 2QHAA 2DEPA 4GQ0A 5E6YA 1PYMA 1R9XA 2YSWA 2C19A 4NRSA 2PWVA 5CPTA 2W66A 2BMBA 3ARWA 1LF1A 3MI2A 1A5KC 5BU6A 4BJHA 3QQ0A 1FDYA 2PZ0A 3KZPA 1KM2A 1XSJA 3JZUA 5CPMA 3RDKA 4XTDA 1EJXC 2C0AA 3N9RA 3MA8A 3UXAA 2WJFA 3LB0A 1X1OA 1EA9C 1NWRA 2PEVA 4UZUA 3CZLA 3VKKA 4W8LA 4XKYB 3PVFA 4RW5A 2OELA 3MSRA 1QNOA 3GUGA 3H6OA 3RPDA 1NF7A 4PUEA 3GYCA 3DOPA 4C7DA 4LY4A 2XYLA 3SEPA 3K1GA 3VKBA 2HDJA 4JL1A 3MKVA 4PUWA 1BYAA 1O5XA 3E2QA 2IPWA 1OCQA 4POCA 2ZA3A 2WJDA 4HCLA 2ZZ5A 4IPLA 2G5WA 5AHFA 5A6SA 5T8GA 4WEVX 5CBBA 2OYMA 1YNQA 3DFQA 2X7WA 3UYIA 3N6QA 2WNWA 1CLXA 4KKXA 4UTJA 3ARRA 3EKGA 4MSSA 1VCGA 2X1RA 4NXSA 4EXQA 2XSAA 5LYRA 3R0DA 4PRTA 4KRUA 1SW7A 1QUMA 2I16A 3RJXA 3U7VA 3VX0A 5I3DA 3LX9A 1K9EA 4KCTA 3W73A 1ME9A 5LA0A 4X0NA 3WDPP 3MYOA 4PRWA 1PXGA 4N9EA 4L9YA 2ZZ3A 3H2CA 2WSQA 2ICSA 1MDLA 1DXFA 4BQ3A 3EMCA 2WKGA 4W93A 3UJ2A 4YIWA 1Z6KA 1ITXA 1IZCA 1NU5A 3LV5A 4ZXOA 3UG3A 4D6JA 4GGBA 2QNEA 4QE1A 4UNKA 1B2YA 2XFRA 1GW1A 3GS6A 3RX2A 4DWSB 1O66A 4OBRA 4C7FA 4HA1A 1HUVA 2D3LA 1N8IA 1PIGA 1ZENA 1J0IA 3T4WA 2A7NA 3SN0A 2PC8A 2CC0A 3LXBA 4JTIA 2O0TA 3LBCA 2VO5A 3QGVA 3HG2A 1GVYA 4F9JA 1M04A 2Z00A 2VR5A 4YVPA 5HR6A 2GDUA 1ADOA 4U4MA 4B9ZA 3VNYA 3W22A 5AZ0A 2I7GA 3DAQA 3Q37A 1K1DA 1J6OA 2VQUA 4XZ9A 1DHPA 3S9IA 4GBUA 2G50A 1MYRA 4LX4A 3LCWA 2WMJA 3IGSA 3NPWA 1XSKA 4IGMA 3WH6A 5I79A 3A5FA 2OLAA 3NSNA 1GHRA 4FX7A 4BY3A 5F4SA 5IHSA 3W7DA 5M3WA 6REQB 4JNYA 5F2IA 4AD0A 4XIMA 3MHFA 1QT1A 1BWKA 3GE7A 3N2MA 3DZ1A 4NF7A 3ZXWA 4FR1A 2HBVA 1I2QA 1C90A 1TX0A 3DKJA 2F9RA 4LVBA 2YCJA 5TNVA 3N04A 3QPYA 4DO6A 4DZ5A 4W8BA 3RR1A 3AXMA 3OZYA 4O1FA 3OGSA 3RM4A 4RE4A 3GH5A 4R5EA 3IIOA 2PAJA 1I9CB 3MUCA 4XIAA 1TVPA 1I75A 2BP1A 3Q45A 4G7EB 2PDLA 3STFA 1REQA 4TXEA 3E2SA 3PUEA 2Z6IA 1XX1A 4ZBCA 4C1LA 4H9UA 3UR2A 2EG6A 3NQ7A 4FO4A 3DESA 5DANA 3WNMA 3AHVA 7TIMA 2VFDA 1LRQA 2FHCA 1KTNA 3IUDA 4EP8C 2B0MA 2OR2A 2VEPA 4M7SA 1XLMA 3EA2A 4OJYA 1LT8A 1E6RA 2XVLA 4JL2A 5JMUA 4REQA 1NOFA 1D8WA 3P62A 4R7WA 1W5NA 4LAMA 3WLRA 1XM3A 2GK1A 4DYJA 2WMIA 1FCQA 3AXHA 1LLWA 3SAZA 1H1NA 4JNZA 4Z2JA 4IJRA 1FRBA 1M1BA 1WXZA 5CZ0A 4H6EA 2D0FA 1YMYA 3PJWA 1UH4A 1KBBA 1FCVA 2W4XA 3W7IA 4IMFA 3UZYA 3GUWA 2D22A 1JQVA 4QLKA 1PJ9A 2J74A 1XRVA 1XCXA 1UR2A 1QNPA 2GYIA 1MZRA 1RCXB 5BWFA 1E9ZB 3N15A 3QQWA 4G1KA 4WSHA 3AQUA 1X96A 2ZA1A 3WLPA 5IBXC 3QLDA 4DBEA 2OCZA 2DUZA 2OX1A 3CXOA 1L0PA 3LRMA 3PUGA 4PYSA 1UR3M 4Z1DA 5JBDA 2P3ZA 1XGEA 4QDMA 4Q8TA 2G4FA 3QVQA 4PB5A 2BASA 1BPLB 5H1WA 3TAKA 1UOZA 4PBGA 1P6WA 3SCSA 3OP2A 3ANUA 1Q5MA 1RR2A 1FDZA 4HHLA 4QE5A 3SQMA 1FWHC 1W31A 2ZRZA 1YTDA 2QPXA 4OOUA 5I02A 2YCIX 2Z6JA 1V6UA 5AECA 4H7ZA 4PUKA 4HN4A 3TN5A 1BYBA 4NRRA 4Q8NA 3CWOX 4TVCA 1R7AA 4W8AA 1XYFA 4ACYA 5FKYA 4AW7A 3A3HA 3K8MA 2YL5A 1OT2A 4F3HA 1KR1A 1K03A 4ZO8A 1YXYA 3WX7A 3S2CA 4KWSA 1GOIA 4L5ZA 1UWAA 3BCDA 3GVWA 1X1ZA 3EX4A 1TUXA 2ZKMX 2ZC8A 4PTVA 3O6DA 4HA4A 4O15A 2D3NA 3SZ8A 4P7OA 1J11A 4EVZA 3BXWA 5EMUA 5DFAA 1Q7ZA 1Q2RA 2H9AB 3MCMA 3WMBA 2G41A 3DU0A 2DT1A 3GR8A 3W1LA 5HQLA 4DPQA 1H3GA 4FP1A 4MADA 3UBPC 3LSBA 5JH2A 2OZ3A 1JRBA 4C5ZA 4CQDA 4JN8A 2FTPA 3S2MA 3LXCA 5I3IA 5DBTA 1RD6A 2ZX5A 1FWRA 4RUBA 2ISSA 3AYSA 1AZ1A 3GTFA 4N9BA 5CGTA 4P7NA 4GY0A 1DTUA 3S2LA 4B5VA 4DWDA 4O52A 3D3AA 1J96A 3S83A 4IIGA 2FZDA 3QHOA 5H6HA 4MWAC 2WSYA 3C3NA 2JKEA 4JY9A 1A3XA 2Z1KA 3C4UA 1LROA 3QV8A 3ZR5A 4NJHA 1JJKA 3TJIA 3PAOA 4LVFA 2JKAA 5T91A 4DJFC 4M6QA 1UP2A 5C5YA 1MXDA 3POHA 4OECA 1LRTA 4UIOA 1UZ4A 2HMCA 3BMVA 2PDCA 5LA2A 5HWMA 1W8GA 5KZMA 4CNPA 3WFAA 1UKPA 2PMQA 3C56A 5E0CA 4K8GA 4FNPA 2XG9A 2GVYA 1JFXA 4PUMA 2RJHA 1DE5A 3RG6A 4KWOA 5FF2A 1TV8A 1YEYA 1NWUA 2DZXA 4L9ZA 5DCDA 5D2TA 4MJ2A 4L56A 2I14A 3SGZA 1XPGA 1E6SM 1QR7A 2CZVA 2R9RA 2XM1A 2W0UA 2XHYA 5TQLA 1GGOA 1K9TA 1QPKA 2GGJA 3LTSA 1ZBKA 5AN7A 4S3CA 4GQRA 5CGQA 4RNHA 5F7UA 2ZUVA 1EX1A 4M8UA 3WDQA 1MRQA 1Q45A 1HP4A 4KS0A 5GJMA 2PLCA 3FJ6A 3E96A 1PTGA 4L4LA 2YGYA 3K4WA 3B9NA 3VD4A 5C7VA 3A3XA 3QSRA 3EEZA 1XBVA 3HJEA 1P7TA 1NVMA 2VD9A 3UR8A 1ZCOA 2OKOA 3W88A 1E0VA 4O50A 1DJNA 4LUTB 1OF8A 2C13A 4GOAA 5DMMA 5CZSA 4C6MA 2ZVRA 2CKSA 2OWXA 4YYCA 3PG9A 5ENLA 1X7IA 3VGHA 1BVNP 1AL7A 3T0AA 3IV3A 4I7WA 1KBJA 2VEGA 3MHUA 5RUBA 1DJQA 3V0SA 1X97A 3CQIA 1EF3A 3BLIA 4AZ7A 1E4NA 2PTDA 4FHAA 2WZMA 3CAVA 2IPFA 5B80A 3NO5A 1XXXA 4NZFA 1J18A 2CHRA 3AU2A 4GH1A 5B7YA 3UWQA 2QDGA 3W76A 2P8BA 4OE7A 2QKFA 1UH2A 4CN4A 3DC8A 4H3DA 1DJWA 3OTRA 3FA3A 3U2CA 2IS7A 1OFAA 3F4CA 4EF9A 3CTLA 1KGUA 4YTSA 5A95A 2QV5A 2WWDA 4BI6A 4CQAA 3ANYA 3NEHA 3WQ4A 2Y62A 4Z1CA 3LCLA 2Y7EA 3IIPA 4GUGA 4TMCA 2CLHA 5BU9A 2CEQA 3HTWA 5IDIA 1TJRA 2A3BA 2V3EA 3QR1A 3OIXA 1S39A 1CGVA 4TTUA 2A7PA 1ZQ5A 1TV7A 1VHNA 3WLHA 2AL1A 2O4MA 2R1LA 5D37A 1W5PA 3T81A 3EXRA 5D4YA 1E6QM 4ZR8A 4LW7A 1MDRA 4W85A 1V51A 3L2MA 4L7ZA 3F7JA 3RHGA 3BANA 4IISA 1BHGA 1UJQA 3W7RA 4JTTA 4M0XA 3AO0A 4AU0A 4IQEA 3NUKA 1R87A 3PFRA 1GUVA 1H09A 4Y2WA 2NLIA 3PWGA 4S38A 3FGCA 4CQBA 3R89A 2E5DA 3HMCA 4JTLA 3DEQA 3TNOA 1RALA 4EXAA 1TCMA 4UTHA 2CBIA 1F7BA 4NZ3A 3EKLA 4PEKA 3OVGA 3CUZA 3LLFA 4HK7A 3TCSA 1GOXA 2OEKA 1XKYA 4QP0A 4F0KA 4IMCA 1W1ZA 4LUYA 1LL6A 1W2VA 3H7UA 4RNJA 3SRHA 1RY0A 4BKNA 3NVTA 4UFJA 3TEVA 4TVDA 1TVLA 5FJIA 4O12A 3BGAA 2HK1A 4JIPA 5C9XA 4F79A 2WAGA 3BSMA 3UR7A 3KCJA 4Q8WA 4AY1A 4UTWA 1UD4A 4RZBA 5ECVA 5HUPA 1L9WA 5E09A 5D8WA 5CCZA 1D9EA 2GL5A 4R85A 1QI2A 3HPXA 1X6UA 3BG3A 4N02A 4ADUA 4RR4A 4JFUA 1LQ2A 3RPTA 3B9AA 1WNOA 1I2OA 1AH4A 3QMTA 4HYWA 1UA7A 4EK7A 5U7SA 2UV8G 1ADDA 4NG3A 5I00A 1XCWA 1JQXA 1ECEA 3W2UA 1F5ZA 4C90A 3S1WA 1QW9A 5C2GA 4WSJA 3V0TA 1QNSA 1ISXA 1U33A 3GXMA 1GEQA 1EXPA 4HJWA 2YB1A 3SCVA 5A8PA 1NWTA 2VJXA 1EGVA 3C0SA 3M0MA 5DY2A 3O06A 4O28A 5C9UA 3QYSA 1GQNA 4V1XA 3AIQA 5A1AA 3LCXA 4GIRA 3W74A 1JR1A 3GR7A 4M80A 3NZRA 3MT1A 1YE6A 1I60A 5A6AA 2WNQA 4YXGA 3UXLA 4RV3A 1TWDA 3ECQA 4W86A 3EPOA 3L4ZA 4QG6A 2BHUA 3FKRA 2E5CA 3CV6A 4PTDA 5A8QA 1TPVA 3IGXA 3CBWA 3NQMA 2YW4A 5ABTA 4PB4A 5MKGA 2PRLA 4NHVA 4WIWA 5AVHA 4I9JA 3STPA 3C2RA 2FH6A 1TPUA 4PCNA 1EJSC 5G4WA 1GONA 3FNDA 5AFDA 2VEMA 4ZQNA 3K4AA 2ABBA 4FNRA 4N9DA 5C54A 3NQEA 4S3JA 4UOJA 4V28A 4NAFA 2AMXA 1ZP4A 2CLFA 5LA1A 4GGHA 3UERA 4JAWA 4Z17A 4JTCA 6ALDA 1VZWA 3WQ6A 4JCMA 3C86A 3WUFA 4K68A 2Z24A 2X30A 3H70A 1IWBA 1KM3A 4MB3A 1E1CB 1S2TA 4MPQA 4PUDA 4F8XA 5I3GA 3EXTA 2CU0A 1W32A 3E49A 4F0MA 3ITOA 4P7QA 5H2ZA 1JCTA 3LTYA 2WLYA 5MHBA 1OZQA 3VC6A 4IJBA 2CLEA 2NWSA 2FZ8A 4GI6A 4JX5A 4JTJA 2NZLA 4IT1A 3FVMA 5LIKX 3QV7A 5AC7A 5LZLA 3LPFA 2VRKA 2QLYA 1TR1A 4XZHA 1ZJHA 2RDTA 3UW6A 1J79A 2QDDA 3RMJA 1Z42A 2C1HA 4AG0A 4O54A 3SURA 3G1VA 3CPRA 4IFKA 4MFDA 4GI4A 2QUTA 4KERA 1UZ1A 3B4UA 1SUXA 2YKKA 3E74A 5T9CE 4R27A 3I4EA 4UUIA 4FALA 5F2MA 4L80A 1DOSA 1JG9A 4UTKA 1IT0A 4YMZA 4GX8A 5IXEA 4HMEA 4DBWA 1NY1A 4K2SA 2Q3RA 1FWIC 2X0YA 4CD7A 3O07A 4Y90A 4GUHA 3ALFA 1V0KA 5IHRA 2DW7A 1L6FA 3LBMA 4QROA 1L6SA 3NQFA 4EPDC 3UF9A 1KFJA 3H2AA 1VJZA 1US0A 2PI6A 2V5CA 1RQEA 2W63A 3ARTA 3HA1A 4DXVA 3LXAA 3JZEA 1C93A 3ZM8A 2VTFA 5HWNA 4N9CA 5TD4A 4J3SA 4EXBA 5AHNA 2CKRA 4V1YA 4WDUA 3UWZA 4BQ4A 3AIUA 4BCEA 1TZZA 2DQWA 2R1KA 4C1NB 1VBHA 4QM1A 3SW6A 4DLMA 3NYZA 3VNIA 1M3UA 1Z32X 5CEWA 3FSUA 3ZWTA 1W5MA 2QVHA 3WN6A 3NA8A 2DSVA 4Y8EA 1UR9A 3ZVIA 2PLJA 1W54A 1AK5A 2A6LA 1QK0A 1E0UA 4PCPA 1EWEA 5LGXA 2OPJA 4JGDA 2ZYFA 1F6KA 1W0MA 3P67A 4K8HA 1KO0A 3LLDA 4BA0A 2OB3A 2FPVA 4FNUA 4QFUA 3PG8A 3KHJA 3TN4A 1JDFA 3AYTA 1F3EA 4QR6A 3BURA 2OGJA 1AMKA 2J7HA 3UWWA 3BAWA 5I09A 3NL5A 3NJ3A 4V15A 1ZS2A 3T4CA 2ZA2A 4HZ6A 3SR7A 4OIFA 3VMPA 4JQ1A 4KRTA 2A21A 4MWAB 2JF7A 1L8NA 1UA3A 3ELFA 1JCYA 1DQUA 4W84A 2JEQA 3ZR4A 4UOZA 2E68A 2ISVA 1B3VA 4M24A 3PZ9A 5LXXA 1FWAC 2WXDM 3UR5A 3WLIA 4ICNA 5AC5A 1A5MC 3KE0A 1IYXA 1BLIA 3CIXA 1H0IA 1Q65A 4PE8A 1NM9A 3REQA 3E02A 2J8GA 1J0HA 4FA3A 4H7CA 2QT3A 3PZOA 4S1FA 1WO2A 2WSKA 3H7RA 1FWBC 3CQHA 3GTNA 5AB3A 2WZEA 1MQRA 4AD3A 3SUSA 4QAWA 1IEXA 3T09A 5A94A 1YE4A 1H41A 3CMJA 5F1UA 4UTLA 3AIVA 2BOEX 4GO8A 5EFDA 1SSDA 1RLDA 3ITVA 4LANA 1IGSA 4PMQA 5M1TA 3KWXA 1P0BA 1T5AA 1W3NA 3QY6A 1JF6A 5AC4A 2ZRWA 3PTDA 1RUSA 5FAJA 2WMKA 2PDHA 2NVAA 2PDIA 1TV4A 2YL6A 4GPNA 3O63A 1ZBWA 3P14A 3PS7A 4PB3A 2QJNA 4JICA 1PYFA 1ZJAA 4JTKA 1E4MM 4W5ZA 3OOQA 1PPIA 1IT7A 1UZDA 4O19A 1LYXA 3THQA 2C91A 1UWSA 1E15A 3AMLA 2VXNA 1JGMA 2D20A 4N0RA 3WBYA 4UQ9A 2QCGA 1JZ6A 4PZVA 5CZJA 5HAOA 4JXCA 4KW2A 2VWTA 5C0QA 3BC9A 3C2VA 1IIHA 2SFPA 1EFZA 4PTMA 2YFOA 3IJDA 1FWCC 3ARPA 1GOQA 1OZMA 3RGTA 4LSBA 4MNJA 1XUUA 2EEXA 3URAA 2TMDA 3GVVA 3WQVA 4QSHA 2WNNA 2PWEA 4ML9A 1JYVA 4H8UA 2HXUA 1KR0A 3GG7A 1O7AA 1D8CA 3OZOA 4JD4A 3UZ5A 4A3QA 1IR1A 3B06A 4CNUA 5HPOA 1UQYA 3XIMA 4ZTXA 2FTYA 1ICPA 3KBJA 3O6YX 2EKGA 4HYVA 3CHDA 3KL0A 2VZUA 4KFPA 3U2ZA 4CU7A 3AC0A 1OX5A 2YOCA 3STGA 1ONEA 4GJIA 5BNKA 1L2UA 1W3KA 4QS6A 4W7UA 4Y7EA 2PFHA 2GJXA 3DKLA 2VZTA 1I1XA 1IWAA 4LALA 4OBTA 3OO2A 2V5JA 4YWSA 2VFEA 1CBGA 1XYBA 4PL1A 2BY2A 2DIKA 4L64A 1HJQA 3MZ2A 3OYZA 4NQ1A 4B90A 4QEHA 2VDGA 5C55A 2ASHA 4ROPA 3ZJ8A 1C7TA 4IIFA 1ZNNA 3O05A 3RO6A 1C29A 2XINA 4WDTA 3MCOA 3F5LA 3BGJA 4YCOA 3W87A 1JCJA 2XM2A 5JUVA 3ABZA 2QJIA 2RDUA 3TE9A 1AVAA 1TV5A 4CCCA 1DL3A 3LRLA 4E6MA 4HMNA 1UWIA 1OEPA 1P6CA 1DQXA 2VR2A 4UTMA 3U48A 2CETA 4NIRA 5CG0A 2D2OA 4RZ6A 3VGDA 2XU2A 3F1QA 4F0HA 1CEOA 1AZ2A 1UC4A 1NQ6A 2Y7GA 3T44A 4AZGA 4GHRA 4CU8A 5A3HA 3UVAA 1EBHA 4X0VA 1XLFA 4QRNA 4ZTYA 5AYXA 4GK8A 2Z28A 1FWFC 1PDYA 4GABA 1QPOA 3LMZA 4RNIA 4MKNA 1FOBA 4I7UA 2YDSA 4JHMA 1J2BA 1N7KA 2EQDA 4WDXA 1CXLA 3VD9A 3SUUA 3KOXA 2QUMA 3LCHA 3P0WA 4HKPA 1Z48A 1EGZA 1S46A 2HROA 2PLMA 4EAYA 3W0KA 3LGEA 4AISA 3VNJA 1OX4A 2NV1A 1OD0A 3VGBA 3M0IA 5C70A 4QBXA 3ABRA 3MJYA 3T2OA 4RL3A 1IXNA 2C14A 4HNLA 3U4AA 2ZUWA 2E6DA 2BTMA 5TBOA 2Q01A 3L65A 1N8WA 3KOYA 3KLKA 1XYAA 1XLLA 4XBJA 3P74A 4HQVA 2J7DA 4FK9A 4Q4KA 3BUVA 4R7OA 3MV11 4AY8A 8A3HA 1QDSA 1XGZA 1C8YA 2FPTA 3FW6A 1G4TA 3LA4A 2A3EA 3EBVA 4ADSA 4KQNA 3RJYA 3BICA 3N17A 3DGRA 5FF4A 4BEUA 2FZNA 1ML1A 2VGBA 4HT3A 1POJA 3WF0A 2PRHA 4WGHA 5E70A 6PTDA 4CCEA 4ORMA 3WUGA 4DQWA 2PB1A 3AYRA 5E0KA 2V30A 2DZPA 5E93A 3AOFA 1O94A 1TA3B 1GQLA 1ALDA 2CESA 1I2NA 4N7QA 5FJOA 4JFVA 3HG3A 4N4QA 3QXBA 2IKJA 3UXKA 3V35A 2B7NA 4ZO9A 1A0CA 1DBTA 4RDYA 1KFKA 4JYFA 1EF2A 1NTHA 2QCMA 4DO7A 2BXYA 2E09A 4BWLA 1LOSA 4JIRA 1N55A 2IXVA 1KFEA 2YA1A 3ZO9A 3Q67A 5CSUA 4Q8OA 1A5BA 5A2AA 1T40A 3IEBA 5EA9A 4HSNA 1R3WA 2D23A 3VDBA 2C18A 1R9ZA 2W27A 4AX7A 4GVGA 3LPGA 4B3LA 4HBKA 2EJAA 4EE9A 4QSFA 2VVSA 1AG1O 1GZJA 1GEHA 3PZQA 4H8HA 4NZCA 2YLLA 1LUCA 1DHKA 3TJ4A 3AROA 3TQKA 4O8AA 3MZNA 4UFIA 4XQ6A 3L4XA 1D7FA 4HJFA 1PX8A 3KRSA 4H9VA 5HMFA 1P1XA 2X2YA 2JK2A 4NNBA 1A50A 3GVGA 1AD1A 3CWHA 3EMZA 3EXSA 4ZXLA 2GJPA 4I9AA 1V03A 1XIBA 4PFHA 3GKAA 3L66A 3R25A 2NWRA 4CNNA 3EZ4A 2UY3A 3MKCA 2IQTA 2PU0A 5IRPA 2Y8VA 1EA0A 2DSUA 3UD6A 5D04C 1HZYA 4X9YA 4B4FA 1QU4A 1YTEA 3VI2A 4OGZA 1Q6GA 1WKFA 4HZMA 1FCUA 2V69A 2YIHA 3NQAA 3BQ6A 1K3UA 1NDZA 4ZODA 4AXKA 4JQAA 1KBIA 1OABA 3WQGA 1U30A 5DF0A 3CMFA 1CT5A 1LRNA 2OLHA 7REQB 2VD8A 1RY8A 2GGIA 5D9OA 2ZRVA 3LHTA 4ZOEA 2QV4A 2DZWA 1X7FA 3M0ZA 1L8PA 4XO7A 4AUBA 4C6FA 4CUCA 1H50A 4AZCB 3ZMRA 4RCXA 5KTLA 5CJ5A 4NJGA 2ZQ0A 3KEHA 1GHSA 4A8RA 5CC3A 2VWSA 5DMYA 1A0EA 4GISA 4PUUA 3TR2A 5LHFA 1V4YA 3C0QA 1F73A 3W85A 2EJ1A 3BVJA 3GK0A 4ONVA 1KFLA 2EPKX 2A1YA 1PKNA 1VBRA 1Z3NA 5HWJA 1JDCA 2YA0A 3G24A 1ZBVA 4K7YA 5KSWA 3RUBL 5D02A 2EPLX 2GGGA 4GJ1A 1KM5A 4ZSTA 2H90A 5M5DA 4PMRA 1K4GA 3T8LA 1WX0A 1VENA 3PPFA 1PZ1A 1RVKA 2Y8KA 3AAMA 1XFBA 1TFVA 3G1AA 4HP5A 5C7HA 5EU9A 2V9DA 1Z41A 1O1ZA 1UR4A 3VZXA 2WZHA 1B9BA 5HDRA 2DV0A 5REQB 3P84A 4U5IA 2INEA 1HQTA 1RLCL 2AGKA 2V0TA 4GXWA 3CYVA 5IFPA 3WMLA 3P82A 5I24A 1KTBA 3KOFA 2E1WA 4PTWA 1PVNA 3EWYA 1WCGA 5DQPA 1XLDA 2WKLA 4S3DA 2I56A 4R53A 4RNFA 1F74A 3L0GA 3R94A 3THAA 4GNVA 3YPIA 1M41A 4A29A 1GK8A 5H91A 2QYGA 3AS2A 3SCUA 1TRDA 2FLIA 4KWUA 3T0DA 1XPYA 4X60A 1VR6A 3OBEA 1QBBA 4AVOA 1IEWA 2ACQA 3GDLA 2JBMA 2A79A 3MI3A 4FR6A 7A3HA 2CFFA 4XKYA 5HUOA 1YX1A 3GVRA 3GFXA 7XIMA 2I1OA 2PWUA 5J5DA 1WV2A 3H2FA 1JZ8A 3NXLA 1WKEA 2VDIA 1HP5A 1PO9A 3ERPA 4HVXA 4AD1A 1RSCA 1TPWA 2HVNA 3LG3A 1SFJA 4KCVA 5HATA 1F3WA 2E7FA 2HS6A 4MY8A 1QWGA 2XN0A 3V1HA 4NAEB 3APYA 4O11A 1P48A 1EDGA 4UFHA 1ADSA 3FFSA 2R8WA 1PIIA 4IMEA 4MUPA 3NOEA 4B5NA 4KFOA 4XG1A 1IXQA 1DP0A 3MUXA 4ASTA 4JYDA 3FXYA 3UA4A 2EPHA 1ZGDA 3WO8A 4ROQA 3P6LA 3R79A 4FSAA 4JIQA 1UC5A 1KXQA 4YJ5A 4ACZB 4Q4OA 2WC3A 3UPWA 2PODA 1I1WA 2PDPA 3BPWA 1EXBA 2J8TA 1A5UA 3LM7A 2OX4A 5D2VA 4XK2A 3TDFA 2Y1HA 3URQA 1OGBA 1KRCC 1RBAA 1VF8A 1H7WA 4JTDA 5H8MA 3K2GA 5D2XA 1PX3A 1BXBA 3E1F1 3GAYA 4WF7A 1R2TA 3SCRA 4QGCA 3N6HA 1K77A 2YCLB 3F03K 5C9RA 4MY9A 2F84A 3FKKA 1V0NA 4L9XA 4FX6M 3U57A 2LLEA 2E5BA 3OHMB 1ZTVA 3B03A 5FA5A 1EOMA 1BF2A 2PC4A 1TB3A 4OVXA 3R11A 2CLLA 2Q8ZA 1SJBA 3VIHA 1WUEA 3V5FA 2R1PA 1UR1A 4TOQA 3A5VA 1VP5A 1CZ1A 4DAFA 1PB0A 1E0XA 3NQ2A 4GBDA 3ITCA 1WAUA 4MVAA 3UEQA 4C91A 3UU0A 3W23A 3W71A 1TPDA 2C0HA 1AQ0A 1TQXA 4UZSA 1MEIA 2WVSA 3M4HA 3FJLA 3GHUA 4AIBA 2VMFA 4F9DA 2D2HA 2J66A 3C5QA 3HURA 3SN1A 3F4NA 2AAAA 4JQ2A 2WVVB 5DX7A 3W7CA 2C15A 1K9DA 4LGXA 3B8DA 3R43A 4A8IA 4GYJA 1ONRA 3WBEA 3RLVA 1UBPC 4JS3A 1TPEA 3MSYA 3FY1A 1FHUA 3EWXA 1W2PA 3PANA 1TTPA 2Z29A 1BQGA 2BHZA 1OHLA 4G5DA 2QCDA 3DG6A 3GNPA 1QVBA 1DXIA 3LY0A 4OU1A 2V2CA 5CSYA 1F3TA 5HOSA 1LDCA 4GKTA 4MAZA 3N3MA 2GSEA 4IG2B 2PTZA 3G0UA 1KTCA 2PDBA 4N4PA 5A6KA 3FJ4A 3UNTA 2WOQA 2EG7A 5BMWA 5CBJA 3BAYA 4I3GA 1KQZA 4B5UA 1JZ2A 1F9CA 3S0CA 4E0CA 4GYKA 3TW6A 1XCFA 3IV8A 4B3ZA 3I6TA 4B5SA 4JTAA 4PCFA 3W1PA 3IJIA 3GBDA 3M0LA 3WQWA 5FF3A 3S47A 2DZTA 3AIBA 4O8RA 1OM0A 3LMYA 1UR8A 2WWCA 3T42A 2VX7A 1MXGA 5EL1A 2VNCA 1K7XA 2XIQA 4LS2A 4KH2A 3N4EA 4C6BA 4GLEA 1XIGA 5AYBA 2ACUA 3VVGA 1M5WA 2YR1A 1F07A 4B16A 4WKFA 5EMYA 1H61A 2X0HA 4AHPA 2ZDRA 1A3WA 4DBSA 1QI3A 1J5TA 2H8XA 2JE8A 2FVKA 3RNDA 2WHKA 3PUDA 4JFTA 2HVMA 3EDFA 3K5XA 2CWNA 3W25A 3UXIA 2P3EA 1TKKA 4CGTA 2WM1A 1KXHA 3Q58A 1I2RA 1HJSA 3EDKA 3DFSA 4CNSA 4UR8A 1XH0A 2HV5A 3BLDA 1V02E 3GO2A 1P6BA 3B97A 1I6NA 3L5AA 1HO4A 2WZIA 3BLPX 4IGHA 2PGFA 3TXVA 3C2YA 3QOMA 3URBA 3BV4A 1KV5A 3R2GA 2WANA 3BMWA 1WBHA 3W1AA 5BW6A 3W7GA 4XSMA 1TMQA 1ZUAX 4FI4A 3T40A 2OTDA 2XTKA 3VNZA 1XIFA 3GKFA 4GC3A 4OUEA 5A6JA 2F8QA 3FIGA 4LH8A 2CXGA 2NXGA 2Y7DA 1V77A 2WC4A 1WZAA 1GNXA 1GQKA 2R1NA 3QOKA 4S23A 3DDMA 2OFJA 1WP6A 3B8IA 1VB9A 3LS9A 2GUYA 3JS3A 3CK5A 1UHVA 1UJPA 1UKQA 3NSMA 4QX4A 1OINA 3M43A 4BF9A 2VGGA 2G97A 1EB3A 3UG8A 1CDGA 4GVIA 3QY8A 4KCUA 2REQB 3QC3A 1R38A 1Q6OA 3PBMA 2PDJA 2NXHA 3OODA 2QQ6A 1RQHA 2DT3A 4I8DA 1NSJA 3M7SA 1J12A 1UWTA 3UP8A 2C79A 4CQCA 4CQ9A 5DMNA 3SI9A 2DSZA 3VUSA 1WDDA 2H9AA 1ICQA 3PTMA 1W9XA 4GRSA 4O0ZA 3VM5A 2O9TA 1E9YB 2HCVA 3DH7A 2OGYA 2VFHA 3AIWA 3R13A 2J9YA 3W7OA 5AYZA 3TYZA 3MO4A 1XDJA 3N12A 4MY1A 3EOEA 1WAWA 4C6DA 3T7VA 3KOZA 5BRPA 1H49A 2E9MA 2E28A 4FNQA 1RCOB 2GWNA 1OFBA 1ZAHA 1XS2A 4O0KA 3VKCA 5AVNA 1SR9A 1JF5A 2YDAA 3T8QA 1ISVA 3FHQA 3RK8A 1C3FA 2NX1A 3CZEA 3QMRA 3E9AA 4QLLA 3U7BA 1TPC1 3UT0A 2IXUA 3B9OA 4TQTA 3B8VA 1ZFJA 3A6OA 3TTEA 2HNEA 2Z1WA 4HHMA 4UTWC 3W2MA 2PF8A 1IR2A 4A3UA 2IQ0A 1OB0A 1W1A1 3L4UA 3CQJA 3GXTA 1E0WA 1Y8BA 4O1AA 4TX9A 3HQOA 3OQEA 2HISA 3BZJA 5CJNA 4R7JA 4AVFA 1PE1A 1U5JA 2UY4A 4MGGA 8TIMA 1E56A 1EUAA 4DUVA 1MWOA 4HU8A 3CV2A 4ZO7A 1H1YA 2PD5A 3VIIA 4JDYA 3TA9A 4ZQMA 4CVUA 3VK5A 1V3JA 3PB2A 3KBVA 4XWUA 3W2NA 3M0JA 3KLLA 2OZ8A 3I3DA 1X6LA 5E9XA 3TW7A 3B40A 1EJ7L 2JALA 4FXFA 4FOKA 2Q02A 4M82A 5G1MA 1QAPA 2J77A 2V6AA 4Q4SA 4R34A 3UA3A 2QAFA 3RPMA 1UPPA 3VE7A 4LYRA 4P8XA 1BRLA 4J3WA 3I68A 3NL2A 3N73A 3W7KA 1XJBA 1UCWA 3GW0A 2BY1A 3PZTA 1E4IA 1EP2A 3K30A 2NQHA 1Z9AA 4LAKA 3ZWSA 1T96A 3AALA 3TJXA 1ZSXA 1R2SA 2DUXA 3VIKA 3THCA 2I17A 2OWCA 2HBXA 4H41A 1VIWA 3P0XA 2DP3A 1BAGA 1CTNA 3RX3A 2ZE0A 4ZB0A 3UJFA 4Z1YA 3FN9A 5AOUA 2J7BA 4YTRA 1OC5A 1RVGA 4GI9A 4RZ5A 3WD2A 5HA7A 1CGYA 1AJ0A 1RPXA 2NQLA 3O9NA 1TSIA 4AC1X 1FH9A 3EMQA 2FZBA 3PB0A 1JCLA 2P10A 1UD3A 5D2WA 4JX6A 1Q85A 1KCZA 1UP0A 4F0LA 4QJ4B 2WSRA 1UWUA 2HE8A 3SN4A 1P0NA 1XLKA 2UY5A 5K4XA 1OFEA 4HPXA 4CCDA 2HE5A 4C6OA 3ARVA 1JPHA 4UQAA 2Q8XA 3DYOA 1EX5A 3OVQA 4CD4A 2D1ZA 2E1DA 3G1XA 5M17A 3HM7A 4M1RA 1E55A 1REQB 3OBAA 1EZWA 4C6PA 4TUFA 3VIOA 2DZAA 3VILA 3MB9A 4WD0A 2QF8A 4A21A 2JGYA 2AKZA 2GJLA 3NIYA 1VFHA 4MDOA 4L1WA 4FB7A 4LS1A 2FVMA 2FQIA 4CNTA 1HJWA 2XGBA 5CPSA 4S3FA 3O6AA 4WJEA 2EF9A 4REQB 3B8SA 5FI8A 3BL3A 4YCPA 4KESA 2BNJA 4H8VA 1EQCA 3GTHA 1LBFA 3UETA 1B5TA 3ZZ1A 4IPNB 3UCDA 2JEPA 1HJVA 4ALDA 1WUFA 1HF6A 3LZ5A 3W7HA 4MB4A 1V02A 3CUJA 4HPJA 4JTRA 5T26A 5CKSA 1FP8A 1BSLA 4B9YA 4YL2A 2CZDA 2JIWA 4WJXA 2V5DA 4OHQA 3KAOA 3L5LA 1J01A 4Q8MA 1E3XA 3SBFA 4RV8A 4LUSA 3M7WA 2HPIA 2PP0A 2WMFA 1Q8AA 1JZ7A 4LF2A 4WJ8A 3G0SA 3KCLA 1U22A 3GSMA 4QEEA 4JTHA 2DVTA 2OT1A 1E6ZA 5BRQA 3WIJA 1QI0A 1S3HA 5LHEA 3ZLGA 3W2LA 3GM8A 5AHMA 2RGMA 3TMQA 2V63A 4XZNX 5LNUA 4NJKA 4JTFA 3TYBA 1IWPA 3GH4A 4INFA 1WDRA 3WK1A 1W37A 4EANA 4EKJA 3DHDA 2B81A 2AGTA 4GVHA 3TZFA 4DEFA 1BTCA 1EHNA 5FSEC 2PD9A 1V6XA 1RK5A 1DPMA 1I0BA 2PDKA 1XBXA 4ES4A 3ENLA 1ZCCA 2ACRA 1P5BA 4HPGA 3CL6A 3MBFA 2VI0A 3MVIA 3QFEA 4HA3A 3D6NA 3VUPA 5AC8A 3HV8A 3IJ9A 1JVNA 1XQKA 4IQJA 1LM1A 3F4DA 3AZRA 1HNYA 1VS1A 2IMRA 3HGOA 5LNWA 2W9MA 2VZOA 2HJPA 3HU7A 2TPSA 3WL1A 1NWSA 2ZUSA 3M1ZA 1SZFA 3CHVA 4GCXA 4L4PA 1F8IA 5FJPA 1ZALA 1SPQA 3DUGA 3VMOA 1XD0A 2ZADA 3NXFA 1TR9A 1R3SA 2D0GA 3L12A 2VCBA 4WKAA 2UY2A 2G95A 1RD5A 3V75A 3W6YA 1S5NA 1EQPA 2WQDA 5D8ZA 4XZBA 4AD2A 3TYUA 1THFD 4QQ3A 4LAUA 3W1QA 5EYWA 4MG4A 1KQYA 3UWUA 2P5NA 3W83A 4NZ1A 1D3GA 4J1OA 4G6CA 1YRRA 2DY3A 1UOKA 1SW0A 1GVRA 1ZAJA 3EPNA 3NDZA 2FDMA 4N6EA 1R8LA 1B1YA 2NQZA 4J5NA 2XIOA 2NT0A 4J3VA 1W5OA 4OZOA 4WHBA 2XWEA 3M41A 3TSMA 3KBNA 5L9FA 3TJLA 3W7MA 3OYXA 4HU4A 3PTQA 3TMLA 3E5PA 4QHRA 5BROA 2I5GA 2DH2A 4Q7BA 4AIUA 1CX9A 1FWSA 3NO3A 3ZJ7A 4DM2A 3BAKA 4C65A 3LOTA 4JIEA 3MV01 3VA8A 4HOXA 3TR9A 4C7GA 2J88A 4AY7A 4TO8A 4Q8QA 3F5JA 3VOHA 4PMNA 1F76A 2OO6A 1AODA 4F4RA 5DELA 4YU1A 1EBGA 5DCEA 1H4PA 3S1VA 4IX0A 3TXZA 2C8NA 4ZQCA 4O57A 3UZJA 3BAJA 2BX7A 4YS1A 2DJXA 3TZNA 2GSJA 4Q3MA 4JKKA 1Q8JA 1UWRA 3STCA 5KEZA 3C3UA 1OCJA 2WMGA 4PUJA 1FTXA 4E2VA 1QRQA 3EKZA 4B3KA 4PULA 3I7SA 3PBYA 2GSHA 2FKPA 4IP5A 3PJTA 1DXEA 2Z7GA 2XZ9A 3HMJG 2WNZA 3OJGA 2Z0IA 3I65A 4B5XA 3C2OA 1QHOA 3MSGA 3LHYA 2YXOA 1FQ0A 3DXIA 5I77A 4HNUA 3WLQA 2PDMA 4GZ7A 4ZMGA 1FHLA 4R9OA 7PTDA 3WH8A 1BG4A 3UESA 2OSXA 3S9YA 1QHPA 2NQ5A 2ESCA 2WMHA 3UNDA 1U83A 4HGXA 1VEOA 3PZNA 1CCWB 4O1CA 1C9DA 1W5QA 3H2MA 4HZ7A 1G4SA 4Z08A 3RO8A 2KAUC 1GKQA 1O60A 3CHCA 8CGTA 1F6PA 3NEVA 1YHTA 4IUOA 7ODCA 4J4KA 3AIRA 4R9XA 1QFEA 1V79A 3OA3A 1UMYA 3V1PA 3ZIZA 1SO3A 2OQYA 2V67A 1E51A 5FJRA 1ECQA 2QS8A 4W5UA 3N2BA 1AJZA 4E8DA 5L6UA 1QATA 1JZ3A 1EIBA 1ISZA 2BGQA 3OLDA 3AS1A 1CB7B 1YDYA 4I5UA 3EWDA 3T0TA 2E6YA 4E4PA 2PU1A 3M5VA 1PZ3A 3NQBA 3NDYA 4E8CA 1CGTA 1CIUA 1QNQA 3MMWA 3RU6A 4Z2LA 3VGFA 3NGFA 2Y6ZA 3EOUA 2FYMA 3RRXA 2Y5JA 4HU3A 3NDOA 4QCEA 1Y5XA 3LQGA 3H21A 4UTTA 4ZFMA 3MDWA 1M7PA 5GQBA 4WOZA 2O56A 1CXHA 1Y0EA 2J6XA 2J47A 3AMGA 4F2BA 4E2OA 1Q4NX 2PSNA 1TWIA 4M5PA 1E0TA 4Y9MA 1KM1A 4HA0A 4RE2A 2VC6A 2ZX8A 1LOQA 1P1MA 3USBA 1EPVA 1SGJA 4IM4A 3A4AA 4Y9AA 2DSWA 4YTQA 1OFPA 1W1VA 3S5YA 4CCZA 2W5FA 3AI0A 4E5TA 2G8ZA 3G0XA 2D0HA 2DT2A 1OYBA 4AMAA 4D6GA 4LNCA 3VGEA 5FL1A 4LQ1A 3DFPA 7TAAA 4A2RA 4DZAA 4ZB2A 1EC9A 4CD5A 2WQPA 4V2XA 1DYSA 1SO6A 1VC4A 4XZLX 1TYGA 4NX0A 1LG1A 4Z1BA 1PKMA 4IHCA 3UGRA 3T2QA 2WZTA 3AJ7A 5E5CA 3D5HA 1JEZA 1MQPA 3P5YA 4K1GA 1NOUA 3EX1A 2GFTA 3LHZA 2XH0A 4GXMA 4LPCA 1XC6A 1XIEA 1PTAA 1AQHA 5EKYA 5CG7A 2B7QA 3IARA 7ENLA 5D05A 3W01A 4JTEA 4NZJA 4HTBA 1W3IA 4QNWA 5FJTA 3MMDA 3KBWA 1R2RA 3FDKA 3GY1A 3VAVA 1XH1A 1TCDA 1L6YA 5I2UA 4PMJA 4PBFA 3W00A 2QF7A 4AIOA 3HOJA 3WELA 3S6TA 3PUOA 3G1HA 4PMOA 2G3MA 1QO2A 5CC6A 3HF3A 4LRTA 3A9BA 5JBFA 4E8GA 2ATMA 3CU2A 1WDPA 1SFTA 4LCQA 4LV9A 2YCKX 1C8XA 1QW8A 2I5QA 1WA3A 3OB8A 1IT8A 2DORA 5HMDA 3WDRA 2C1IA 2HRWA 3NOYA 1SZRA 3S6DA 5A8NA 4K1WA 1W9DM 4RLIA 1EZ2A 4C6CA 2C16A 1UYQA 4GG9A 1RCQA 2XSBA 3KWSA 3IJ7A 4ZSUA 2PWFA 3G77A 3PWIA 3FVDA 4FOJA 1W3JA 3TQ0A 2HPMA 4BWLC 1PHWA 1UQZA 2BVTA 1ITCA 4H6KA 4AF0B 4AEFA 5MKGB 2P50A 4L4MA 4IP4A 4WCJA 3PSWA 1DIEA 5H8UA 3QGKC 3KVJA 5CQ1A 5A5WA 5I5RA 5KMYA 1RXOB 1D2KA 4CD8A 2ACSA 2CCRA 3NPUA 5HJLA 4HCDA 1FWTA 3IACA 1LWJA 5CPOA 3FYOA 4DVOA 2OODA 2VC9A 3M0YA 1FWDC 3EX6A 4DI9A 4IOTA 3MQTA 1KWKA 1GOOA 4CD6A 3VNLA 4LB3A 4E4FA 1VPYA 2EBNA 4GJJA 4IIEA 5CSRA 3HZ3A 3W7LA 1TO3A 5EMLA 4AAJA 3NM3A 3F4WA 3SY8A 4U5KA 1KD0A 3BCJA 3ZOAA 1US3A 2AOSA 4YPJA 2Y88A 5ABFB 4DJEC 1V6VA 2X40A 3C6CA 4GUJA 1OC7A 4MIMA 1T7LA 3MP5A 4MZ8A 4FLQA 2OMAA 3GDKA 5CSSA 1E43A 2YXGA 2PGRA 2Y24A 3ZVHB 2VDHA 4GXPA 2C6QA 4Q33A 1LBMA 1JXKA 4FXRA 1GQJA 3GU9A 5EMJA 1FH8A 4UCFA 2GWGA 4IFKB 4ML4A 2AL2A 1J9YA 2W3ZA 1R3YA 3GTXA 1CB2A 4R33A 3EAUA 3GHTA 4UR9A 3WJZA 3A23A 1BKHA 3FEQA 2E6FA 3S1XA 2QCCA 2FTWA 4I9MA 2XISA 2O55A 1WXYA 1DJZA 4DY1A 3ZT5A 3U2EA 1TUFA 3DC0A 5FF7A 1IZKA 1B3ZA 3ISIX 1WDWA 3BLLA 2PWHA 3W7JA 4PR4A 3N4AA 5C2CA 3GWQA 4HHPA 4Y6GA 2XWDA 3VYLA 1V7AA 2XVGA 4EAMA 1RBLA 2A3CA 5H8PA 3RFAA 3WNPA 5F2LA 4O1EA 1YNPA 3S5ZA 4MAVA 2WJZA 5HJXA 1W6TA 1CXEA 4XAYA 1A5OC 2UZ9A 1LL4A 1XQLA 3UZWA 1HIZA 2Z2BA 4RPPA 3WLMA 1SJDA 3HGJA 5DRCA 4H19A 3QV9A 1E73M 4FNSA 2PDFA 3KTCA 2R94A 1O12A 3DGBA 3TCEA 4O53A 4ICMA 3TH6A 1JAEA 2YYTA 2KX9A 3WEMA 1GJWA 4XAPA 1EKOA 1TE1A 3ITXA 1EJWC 1E1FA 1YXDA 4WDWA 1V3KA 1QOQA 3LK6A 4NSBA 3EB4A 1MO0A 1FFQA 2XFWA 3QKZA 3VD5A 3MMUA 1UR0A 2J24A 3IRDA 1YPIA 1S2VA 4L6OA 1PX4A 2HZGA 1KXTA 1GKPA 1EWDA 3MUY1 3P60A 5AHIA 4Q32A 4FS9A 3CNYA 3ITTA 1NFPA 4LT9A 4Y8FA 4LU0A 3EEGA 2YYUA 4GZEA 4UQBA 4MHBA 1WOBA 2V82A 2PRMA 4XZMX 4PMUA 1O5QA 2ZXQA 4R88A 1UKTA 1VKFA 1NARA 2ALDA 3CT2A 3WJXA 4HU0A 1QPQA 1GCYA 1Q6FA 4FX8A 1A49A 4JHZA 3NQ6A 4MKVA 3RCMA 4ATLA 3KVMA 1UZHA 1ZL1A 1Y5VA 2NUYA 3S5SA 3N9SA 4ZOBA 1P43A 1S5TA 3PFMA 3PBVA 4ZFCA 4J9JA 1JCXA 4PGLA 4WOQA 4PMVA 4BF7A 1W8SA 4XUGA 2VOTA 4WY0B 2H3BA 4P8VA 3WQOA 3REQB 1VEMA 3MHGA 3DIPA 3E0VA 3JRKA 1H7PA 4JTGA 4AMCA 3II1A 4AYSA 1B57A 5K2ZA 1SFSA 3TOPA 1SMAA 3CZ8A 3GNRA 3STEA 1J93A 1NDVA 1MFUA 3E2VA 3NCOA 3GB6A 2CBUA 5T9BG 2QUNA 3WEOA 4IQDA 3H55A 3E6EA 3QBUA 4S3AA 4B15A 2HSAA 1MW0A 4DO4A 3S8HA 1G69A 2NX3A 1YPXA 3OLGA 1VPXA 5CPNA 4AB4A 3IJLA 1XYMA 1OSEA 4A3YA 4BZYA 4QS5A 3JUGA 2QR6A 2W91A 4JQ4A 4UTFA 1XWYA 3KCOA 4GZJA 3MTWA 1V3IA 1EYWA 4JQ3A 2NX9A 3MP4A 3W24A 2BZNA 4IICA 1EHAA 1H7NA 2YB4A 3WUEA 3DX5A 3TSDA 1WDQA 1KM6A 3ITGA 2HVOA 4MJ4A 1HJUA 4QTGA 4UMAA 3DFHA 4NI3A 1MFVA 2AKMA 4FLRA 4JKMA 2UBPC 1NH6A 1EO7A 1KFBA 2VP8A 1MNZA 5DRIA 3BW4A 4Q8PA 2PZNA 3KW3A 4JFWA 5HQEA 4Z2IA 4G2DA 4KEZA 1XLJA 2DVXA 2WO5A 3TN6A 1W91A 3RYSA 3ARUA 3EWUA 1PWMA 3M5XA 3LI0A 1PZ0A 3Q65A 1JIBA 4C60A 3BLFA 3HPSA 1TPB1 5JIPA 3CZJA 4QNEA 3SCOA 3CPUA 2ZVIA 3KDOA 1VJSA 4Y9PA 1BYDA 4AVNA 1JD9A 2ZZ4A 5KINA 3LNPA 2BGNE 1IV8A 4D72A 4M56A 1CYGA 4LY8A 3IJQA 5I3KA 2GJXB 3MMTA 2W61A 4KEMA 3B9EA 3BLEA 1BWVA 3DFTA 2QULA 1SZNA 4ZENA 1XW8A 1ISYA 2ZTKA 2PLKA 1B30A 3GVQA 6ENLA 3VO0A 3WLTA 2FFIA 3QC0A 1CXKA 2C1GA 4I5XA 1JNEA 3ORWA 1R0MA 1JUEA 4G7FA 2WCGA 5K3VA 4IWWA 2ALRA 1XLHA 3WK2A 2GQ8A 1V0LA 1QOXA 5CZTA 1L2QA 2AAMA 3UFYA 1H2JA 4EPKA 3BJTA 3BCFA 3MYPA 1DEDA 1D3HA 5HJYA 3GRIA 1XYCA 3CTTA 3E2RA 1ZHAA 1K4HA 1IE7C 1AA1B 3K4DA 2NUWA 1N82A 2OEMA 1VFTA 1MEHA 1FWWA 3QQ1A 1W1B1 2DJLA 3F2CA 3GDBA 1PIFA 1E6NA 1FWJC 4KWWA 5DT5A 2XH4A 1AQMA 2YBTA 5A6BD 4NAEA 3QGAC 1LQAA 1XLCA 1GTEA 4DRSA 3VMNA 5CZKA 3MI6A 2A0NA 1F61A 4QISA 1TJ0A 4D6HA 4PEEA 3H4XA 3A3WA 1V8EA 4MPKA 2Z26A 2VGFA 9CGTA 4H2HA 3GG1A 2X42A 3W4RA 1BKSA 4B91A 2GOUA 3RCNA 1SZEA 1KW1A 1OX4B 5C8BB 4EOUA 3TAOA 4CU6A 3W6MA 4ACZA 5LIWX 3A64A 3G1DA 1L6GA 4Q22A 1ME8A 1VD6A 3IGHX 4LC8A 4GKLA 3W27A 2C3ZA 4MTVA 1M53A 1XISA 2OLSA 2WJEA 1PUDA 5PTDA 4URIA 3UCQA 2ZCGA 4H6QA 4LAZA 3WLKX 3CYJA 3MPGA 4GMEA 3RR4A 1XR2A 3NQDA 1XUZA 3C0JA 3TC3A 3TWBA 1NOWA 2YL9A 1S3TC 2CBVA 1JPMA 1OCNA 4MB1A 3V36A 4G8TA 3LUTA 1FA2A 1T41A 1SYTA 3FV9A 4XVEA 4AXNA 4JPGA 3B04A 1KM4A 2XUCA 1UG6A 1V3LA 2PCQA 1U2YA 2XGIA 2VZSA 4MJMA 4B92A 3RLGA 3BQ5A 4WVXA 4AWUA 3ABOA 1OGGA 3GLCA 3TVAA 2ZX9A 2VURA 4KF1A 1XIDA 1QO5A 2J13A 5D2YA 2RFGA 3M0VA 1M68A 2Z4GA 3PWAA 3FYYA 5HULA 1QI4A 1XRTA 3LV6A 3M5YA 3V5OA 3TYDA 1MSSA 2Y0FA 4LBRA 3DI1A 3LM3A 3FK4A 5J04A 3CMGA 4WXZA 2HQAA 1EEXA 1P0KA 4J2MA 4BK9A 4C6KA 1R30A 1K8XA 1MQQA 2OYLA 1T0OA 3GW3A 3CEPA 1FXPA 5B7ZA 3ABXA 4DAIA 1LUCB 3R4IA 3KTXA 1YQ2A 3KZSA 3WLNA 2FDSA 2BVYA 1H0GA 1K6WA 3R8GA 1G9HA 4XZWA 5KZ6A 2GGEA 2FZ9A 3M6YA 4J40A 1EUNA 3WNKA 4DYEA 3HQPA 2GVGA 3VCRA 3W70A 3WL0A 2VENA 5ABEA 4S3KA 3GD6A 2HEJA 2W62A 4Q6XA 3IK4A 1GW9A 2QMJA 3N6JA 1UIPA 2W79A 4JTUA 1LG2A 2XJ7A 1EP1A 2Y5SA 3BJFA 3G3MA 3VABA 1YIXA 4UQCA 3ABQA 1DJIA 3L2LA 3W7EA 1E6XM 4A6GA 1TELA 3QTPA 4X2RA 1WE5A 4L61A 2BWGA 3UG4A 2OQHA 5I03A 3SGUA 2XIBA 4E2DA 2A7RA 4J2PA 5D09A 8RUCA 3NR0A 3SY5A 2ZIDA 4XTIA 2OXNA 4PN2A 3T2PA 4TTGA 2DZUA 4MDPA 2FB3A 4HNCA 3K8KA 1JPIA 1W9BM 3NL6A 1IXPA 1NDWA 5C9WA 3L4WA 2VHLA 2JFEX 4H2CA 1X39A 2XN1A 3SQSA 3S42A 1XLEA 1R9YA 3QPZA 1UD8A 3T0BA 5FACA 3OGRA 1V7YA 4X2PA 3A22A 4AZHA 4N6FA 3D46A 1FUYA 1GZGA 3TTYA 3KUMA 2J75A 1FKWA 5A8MA 2CZ5A 1M7OA 4RXFA 3AYVA 1S2UA 5EMKA 1OF6A 3E5BA 2PWGA 4JCLA 2WVUA 3B9DA 1S2AA 1QBAA 4QAIA 3KRZA 1XDMA 3TLLA 3CUHA 3DYPA 4C6NA 2RGLA 1CPUA 2E8YA 2BV9A 1DJXA 4Y9OA 3ZS4A 4E2BA 3LI1A 2PS2A 3TA6A 3KOWA 2PE4A 5A6BA 4I6VA 3R58A 1AW5A 1OG0A 5HINA 5GNXA 1VYRA 3L9CA 4PRRA 2B7PA 3WUBA 1KB3A 4DJDC 2VFIA 3L7RA 2W6RA 4GY1A 2POTA 1HKMA 1GG0A 4EPBC 1SQ7A 4Z1AA 3UJRA 1TV3A 3WJSA 3A13A 4H01A 2FGZA 2Z1VA 3PBGA 1UROA 3ONBA 3GFZA 2REQA 2YXXA 3GZ3A 2QUUA 1LWIA 4DB7A 3LPPA 5XINA 3EWWA 1LLOA 2PGEA 1W1IE 4D6DA 1NP0A 2IKGA 2Z2UA 3TQVA 4NY2A 4U3AA 5D9PA 4MF4A 3VOIA 2CWXA 4Z0JA 3NQGA 1Z8AA 2HK0A 3WQDA 2G0WA 3I7RA 5I06A 1V3MA 2PBOA 1N2VA 5LIYX 5GNYA 1QNVA 3N25A 2BODX 2AQVA 3IANA 3O0KA 5CAKA 1S5VA 3E3HA 1B31A 3BG5A 4MNMA 3TNBA 3N11A 5HBFA 2OQLA 1U1UA 3RAOA 5SWUA 4O0QA 4NILA 1D3CA 1YKWA 1KGWA 1M7JA 3DFOA 1OK6A 2G96A 2VRQA 1HL8A 1TTJA 1OGSA 4LVAA 3WQ5A 2P0IA 2X1TA 4UFKA 4OV4A 1VGAA 3WQ8A 3B4YA 4QJ3B 5AYYA 1MUWA 3TP4A 3H24A 3WF2A 4B5TA 1FX6A 3IIZA 4RKAA 4E38A 3W84A 4TX8A 2VRJA 2AQWA 2FPYA 3G1SA 3BLOA 4U33A 2RDWA 3NZQA 1KC7A 3CL7A 1GQIA 1BYCA 3VDGA 3F2DA 4D2JA 4KEUA 4KFNA 3LSCA 1AH3A 5BOOA 3WD3A 4RDVA 1HGYA 5DMLA 3IWPA 4LYKA 4OFCA 2DSKA 1OX6A 2QCLA 3NTYA 3QHMA 2NW0A 3GG8A 5BYWA 4KIEA 3MBDA 3EDDA 3QJAA 1TJ2A 1SM9A 3HG4A 2WKJA 1ZY9A 3ZFHA 1K02A 1U5VA 1GOWA 3GBEA 4EWJA 4NUWA 2QCFA 1UUOA 3LHWA 1H5VA 4RK8A 3A9IA 2BY0A 3A24A 4O10A 2IW0A 3TOYA 4GQBA 3SGGA 1NJJA 1MEWA 1TQJA 2QEZA 2Q09A 2WHLA 4D6FA 1GVEA 2V8ZA 4HK5A 1CGWA 5BOFA 3FXGA 4DJED 1OJXA 1VYSX 4KETA 3E0FA 3DHUA 2Y61A 1GORA 1QASA 3APGA 4IX2A 4D6IA 1VEPA 3ME3A 4LTSA 3GXPA 4GQQA 4XISA 1RJPA 3APTA 2QCDB 4Z42C 2XIIA 2OU4A 4W87A 4AD4A 4CVWA 3V16A 2HXTA 2CXEA 3P8JA 1XKJA 4Y96A 2ANUA 3PNUA 3R6IA 3WQEA 1LCOA 1QXLA 4JR5A 1PWLA 1ITUA 2E77A 2TRSA 4A8NA 3AHYA 4AC7C 3EX2A 3VC5A 4PBEA 2EHHA 4CN1A 3SJNA 5ABHA 3AISA 3OGVA 2DPEA 1JNDA 5HK4A 1BEUA 4H6RA 1K8CA 3NPXA 4A05A 3GU1A 2XN2A 2QPSA 1X8CA 4I90A 3W7PA 1E9IA 1KFCA 1B3OA 3HN3A 3JVAA 4GA8A 1R3TA 4Q4PA 3WENA 4ZCWA 1XLBA 3OG3A 1M6JA 1YLVA 4DELA 4ZOAA 1TJ1A 5EY5A 4W7WA 3LCGA 4P5UA 4ZGYA 1XRSA 2YX0A 4M29A 3W2KA 3IK2A 3UVIA 1RJQA 2VX4A 5TF0A 3MUZ1 5HNNA 3WLLA 2CW6A 1PEZA 3LU2A 4QJ5B 2O9OA 4IIDA 4LEFA 3VCNA 3A4JA 4HIBA 4GI8A 1FWEC 1QWKA 4S3GA 3VKJA 1GOKA 2G3NA 3QSTA 4H00A 1KLYA 3WNNA 1XIHA 5LGZA 3GFYA 3LCFA 1ZPTA 3AXXA 1PS9A 1YBQB 1VCVA 3IAQA 3K46A 1VFFA 2G3FA 3IVUA 4WY0F 3TFCA 1DKWA 3GAKA 4FZIA 4BI7A 4ATDA 3VDCA 2VZVA 2F2HA 4GINA 1VRXA 1OG6A 2P53A 4BHYA 3WZ0E 4G56A 4UXDA 3PZVA 4E4UA 2QCHA 1W9PA 2J4GA 4EACA 2ZZ2A 1LBLA 1NFBA 1C92A 4F66A 1GVIA 2WYSA 1UKSA 3W1NA 2VCCA 2FH8A 3LYEA 1RAKA 1HKWA 2VFFA 3DERA 3QRHA 3RLHA 5FEPA 2FMOA 4H83A 1A80A 3A4XA 4L65A 5FEZA 2BSLA 2D24A 1HKJA 1Q63A 2A5HA 1BSIA 3FAWA 2V3FA 3PSVA 1W3TA 2YCEA 4L6DA 2Z1XA 2ZUMA 4IFRA 2J25A 4AD5A 2CPUA 4UQEA 3GZAA 4MKSA 3ES7A 3HGSA 4UTTC 1A47A 3W38A 1OYCA 3SADA 3RN6A 1HG3A 2ZUUA 4J3XA 5CBIA 1ICSA 3UWYA 2CLMA 3W02A 3PULA 3QTGA 2INFA 2FGLA 2EXOA 5U4NA 1DIKA 2BBFA 3PR2A 3VXGA 3S2NA 2FMNA 4Q4QA 4QQUA 2Z1BA 1DV7A 1YDVA 4OQVA 4AQLA 4OTKA 1J4EA 3CM4A 1G01A 1E70M 2VC7A 2A2IA 5HNUA 4NP7A 1DQWA 3TK7A 5J8LA 3GIPA 3PN8A 1BXCA 1O68A 3N14A 3U0HA 4N42A 4XAGA 4PUNA 4HSHA 1ODZA 2ATSA 4E3TA 3XINA 4LV4A 1GWJA 1Y65A 4DWSD 5A69A 4AZ5A 4AEOA 1J10A 4NU7A 2Q8LA 2CERA 1Z69A 3VFCA 3AS3A 4IIBA 2ZRXA 2VUNA 4UCGA 1X98A 2J7CA 2XIMA 2ZWZA 4P7LA 4L6HA 2ZE3A 4UQDA 1FHDA 1TZ9A 3OEXA 2XPKA 3CUXA 2G37A 4OOZA 1G5AA 1A53A 2BS9A 2B31A 4DJEA 4C6LA 3VCCA 3ABSA 3HQ1A 3WBAA 3TLQA 3HPFA 2WCAA 1G7UA 3ZQ9A 1TMLA 4TV6A 1KCKA 1TX2A 4DNMA 4KIRA 5HMEA 5FOOA 3UCCA 1G4PA 2J79A 1PKLA 3LGDA 3J7HA 4K39A 3A12A 2J62A 3A4WA 1EC8A 2G3JA 1HFBA 3TUUA 3EGJA 1LT7A 3T08A 3VIJA 3H22A 3MUIA 2PTWA 1IEQA 4KMQA 5K4ZA 3A47A 2GGHA 5A8OA 3IUIA 5D30A 3SUTA 2VT0A 5BXRA 3UGVA 4C6IA 2PDUA 1BRLB 1TIMA 1TREA 4PFMA 4RDZA 4RE3A 1CGUA 3HV9A 1PTDA 2YZRA 4W88A 2J9XA 4CEUC 1JULA 3USZA 1W3LA 1LOLA 3GIYA 5GVJA 1SFLA 1KFWA 1LL7A 4XZIA 3IJ6A 4K37A 2BG5A 3CO4A 4I8YA 3CAKA 3B0PA 4XD4A 2ZICA 4F40A 4PC8A 3W53A 3LQLA 4GIAA 5AKQA 4O4WA 3QYQA 3EB2A 3GH7A 5EB8A 3QFWA 4I6KA 4TIMA 3PZUA 1KCLA 1JUKA 1RV8A 2OEJA 3SCPA 1XG4A 3F5KA 1W1TA 3S1UA 1SSGA 3SUVA 4IZGA 3HO8A 1WB0A 2AQOA 2O7QA 5G2WA 2J7FA 1HL2A 4J28A 4ZB5A 3N29A 4IL0A 4TMBA 4M51A 2V2DA 4XD6A 4XX6A 1B90A 1H7RA 4JYEA 2Q71A 2DUAA 3RM9A 4IQLA 3N13A 4S2CA 3WEZA 1RP8A 1KNWA 3G8EA 3VOJA 2GQAA 4GQGA 2DGAA 1H63A 4M7TA 4Z0SA 4GNJA 2QCNA 4YN5A 4GUIA 3UPBA 4HD5A 4F2TA 1KWGA 4JIIX 4QIUA 1AL8A 5K9CA 2ADAA 3IS4A 5EBUA 3DI0A 2VEIA 1YTKA 2IQDA 3A21A 4X63A 5F4XA 2BHYA 2X05A 4LBUA 3LEPA 3TC7A 3WKZA 4XD5A 1UUQA 1VPQA 4L4OA 3QEZA 2FJKA 3SSZA 5F2GA 2ZTJA 3W1UA 3QV6A 1PHQA 3QLLA 4DNHA 4LFYA 5ABGA 3M07A 1XYLA 1OCBA 3FS2A 2IKIA 2G4JA 5XIAA 3RF9A 1EDQA 2R14A 4LUSB 4B5WA 4IXHA 4ZOCA 1POKA 4HMCA 3NURA 4PCSA 3IVTA 5FCZA 4LRSA 4IGNA 1VRDA 5HNRA 3WMSA 4Q8UA 5IDZA 4C1KA 3W3OA 4LB4A 4YVXA 3R1ZA 3N4FA 2NV2A 1C8VA 3AFBA 3KRUA 3SFKA 3DFYA 6CGTA 3JU2A 3NG3A 5I07A 1XLIA 4JHOA 1EJUC 3CZGA 3R8RA 4ERIA 2QJGA 1V5XA 2P76A 1K6AA 2ZWYA 3SM0A 3ALGA 3OLIA 5BRBA 5G1YA 4IPJA 4OKDA 2RH9A 5IFTA 1DWJM 4D6CA 2QPUA 5BWAA 2BY3A 3OZPA 4GYFA 1CNVA 1TZ7A 4AX6A 2CITA 4FMVA 3O6CA 3W81A 1K8ZA 5E9AA 3C0LA 4DWSA 3NPVA 1CW2A 3HB9A 3V7PA 2QJMA 5LIUX 2V5LA 4LUJA 1RH9A 1GYNA 3OZMA 2CZEA 3R5EA 1HT6A 4F0RA 3RIKA 3RRAA 5BMXA 5G1TA 4O4VA 3CUGA 2A3HA 1DORA 1HKKA 3WH9A 4UR7A 4QG9A 4A3RA 1GYLA 2ABAA 3MKKA 4GVFA 2Q3OA 3FA5A 1DVJA 2VVNA 3UJEA 2V3GA 3PBWA 3KL5A 4H04A 1ESWA 1M65A 4NT0A 3U6WA 1J0YA 6REQA 1OFOA 3KTSA 3M6DA 1BWLA 1X38A 5M2FX 3RU8X 3B3DA 1FXQA 1XBZA 1E6PA 4K8EA 4FEZA 2QW5A 3W9ZA 4WSKA 1OFRA 4LCSA 3GNNA 1V93A 1YXCA 2RAGA 4DN1A 2DIJA 3DN5A 1Q7MA 1VFUA 1IGWA 4MMWA 2WHJA 4AF0A 1LJYA 1TPH1 2NLYA 3RX4A 4NZ5A 4W89A 4WR3A 3QMSA 1Q13A 3PAJA 4RW3A 3LD5A 3CIWA 3CS2A 5CPLA 2PDGA 3WLJA 1IZJA 4JFSA 1R47A 4F0SA 3CAQA 4KGLA 2XFFA 4G7EA 4GFIA 2HTMA 4R3UA 5A2BA 4M81A 2E67A 1XC4A 1JPDX 2QIIA 1PL9A 1FVPA 2E4TA 1TV2A 2BXVA 1JI1A 5FF0A 3GC4A 1G7VA 3TC6A 1QMLA 1RP9A 3HIJA 3ZLHA 1MXSA 2QGHA 2EAWA 5EGRA 4HPHA 1ZZMA 3AWOA 1M01A 2VX5A 3UYCA 1DWHM 1OFQA 3VM7A 3TV8A 3FEMA 4NZ4A 3DFNA 1H62A 2BOGX 5ABFA 1W17A 4H9ZA 3KL3A 2WV8A 4HMDA 3W72A 1VFSA 2NSOA 3DECA 1JYXA 4BF5A 3PHAA 3G22A 3S5NA 3N2TA 4HNOA 4M3PA 1JDAA 2IPGA 1GG1A 3DHPA 4AWTA 1DWAM 3UY8A 2GDQA 3ZVHA 1PDZA 3WH5A 1B54A 4U2ZA 3LLXA 4UTUA 3IPWA 2E6AA 2IPJA 3FLUA 3CH0A 3MS8A 3UWVA 4BEQA 4P2VA 4MYAA 4AH7A 3P3BA 3GXIA 1UASA 2WLZA 8XIMA 5DN1A 3PZMA 1QPNA 5KZDA 3M47A 3MWCA 4DJDD 2QAPA 4DX3A 4FXSA 3CB3A 3GC2A 2MANA 4K38A 3V0UA 2CIPA 2I9EA 3G5EA 3WK0A 2PDWA 4QG8A 3VDAA 2NV9A 1K9FA 5HMSA 1GOMA 3DENA 4X61A 2Y7FA 1H5YA 1IF2A 1SJCA 1QTWA 1DJHA 5LIXX 3MP3A 3WH7A 4O17A 5FD0A 3ZJKA 4Z2HA 2ZZ7A 5AYIA 2QDEA 4LWWA 3L0NA 2E40A 3WY1A 5FIPA 3H2NA 1WPCA 1ZJIA 3PNZA 3GHRA 1RPKA 6TIMA 1C9WA 1P0EA 4RE0A 2TYSA 3NGJA 1AMYA 3HPAA 4XUYA 3ZT6A 4FIRA 1G94A 2FFCA 3W2JA 2X16A 3B0YA 5KETA 3W37A 1XD1A 2Z2AA 1LTDA 1O5KA 4PA8A 1BQCA 3WJYA 1ENUA 1S5MA 1KBLA 4BQ2A 1KLZA 6A3HA 1DIDA 1GVFA 3NO1A 3F4VA 5BXTA 1E40A 3OU8A 3DBPA 3WDHA 2FGBA 1WYIA 4Q7NA 2QJHA 1MZHA 3QN3A 2Z27A 3P61A 4GYPA 3WD0A 3HG5A 1LORA 3N34A 2DIEA 1Q6EA 4NNCA 3TTQA 4PMXA 4LCRA 3BAXA 2P88A 4NI8A 1O95A 3LENA 5JU6A 3BJSA 3KRBA