2DY3A

Crystal structure of alanine racemase from corynebacterium glutamicum
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
361
structure length
338
Chain Sequence
MNLLTTKIDLDAIAHNTRVLKQMAGPAKLMAVVKANAYNHGVEKVAPVIAAHGADAFGVATLAEAMQLRDIGISQEVLCWIWTPEQDFRAAIDRNIDLAVISPAHAKALIETDAEHIRVSIKIDSGLHRSGVDEQEWEGVFSALAAAPHIEVTGMFTHLAETDRQIIAFRRALALARKHGLECPVNHVCNSPAFLTRSDLHMEMVRPGLAFYGLEPVAGLEHGLKPAMTWEAKVSVVKQIERGFVAVVPAGYADGMPRHAQGKFSVTIDGLDYPQVGRVCMDQFVISLGDNPHGVEAGAKAVIFGENGHDATDFAERLDTINYEVVCRPTGRTVRAYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanine racemase
publication title Crystal Structure of Alanine Racemase from Corynebacterium glutamicum at 2.1 A resolution
rcsb
source organism Corynebacterium glutamicum
molecule tags Isomerase
total genus 109
structure length 338
sequence length 361
chains with identical sequence B, C, D
ec nomenclature ec 5.1.1.1: Alanine racemase.
pdb deposition date 2006-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00842 Ala_racemase_C Alanine racemase, C-terminal domain
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 2dy3A01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 2dy3A02
3WQFA 4LUSA 1TUFA 4LUTA 5FAGA 2YXXA 1SZRA 2J66A 4PB4A 1XQLA 4BEUA 2O0TA 3GWQA 3N29A 3AWOA 5GJPA 4FS9A 3WQDA 4DYJA 3CPGA 5FAJA 5GJNA 5BWAA 3HURA 2TODA 1TWIA 4BEQA 1D7KA 2RJGA 5FACA 3ANVA 3MT1A 4KBXA 3UW6A 4QHRA 1CT5A 2P3EA 1HKWA 2ON3A 1BD0A 1XFCA 4BHYA 1VFHA 4LUYA 4V15A 1NIUA 3B8WA 3HA1A 1W8GA 2RJHA 4XBJA 3ANUA 3BTNA 3E5PA 3B8VA 3WQEA 2OO0A 2NVAA 3N2OA 1F3TA 1FTXA 4A3QA 3KW3A 1L6GA 1QU4A 5GJMA 7ODCA 1KNWA 1SFTA 1L6FA 1NJJA 3N2BA 1HKVA 4ZGYA 1EPVA 3E6EA 4WR3A 1VFSA 3LLXA 1XQKA 3B8UA 3NZQA 3VABA 2QGHA 4PB5A 3C5QA 4BF5A 3AWNA 2VD9A 3S46A 4AIBA 2ODOA 3NZPA 1VFTA 2NV9A 5IRPA 4LUSB 4LUTB 2PLKA 3CO8A 2PLJA 4PB3A 3WQGA 2DY3A 2VD8A 1B54A 3B8TA 1RCQA 3R79A 4XG1A 3OO2A 4ECLA 3WQCA 3SY1A 2SFPA 4Y2WA 4DZAA 4ILSA 1KO0A
chains in the Genus database with same CATH superfamily
2TAAA 5D2VA 7REQA 3SCTA 2Y6ZA 2EKCA 5HWNA 4M6PA 4RNFA 2PWEA 3A24A 4INFA 2C7FA 4ASTA 2R1LA 1MW2A 3VM7A 1Y8BA 3G18A 1TJPA 2Y89A 3ZO9A 3OIHA 3LNPA 2YCKX 5FEWA 2DUXA 2VM8A 5AB3A 1KW1A 2QULA 5T9CE 1MNSA 5CGTA 3P84A 3BJFA 1GKQA 1RHCA 1NTHA 1WZMA 3W2LA 4EPBC 2CLFA 2P10A 3GNXA 2GJNA 3TROA 2ADAA 3DERA 3OB8A 2OR2A 1GVEA 4IGSA 4JHOA 3JZEA 7PTDA 3QVQA 4G2DA 3VIFA 4CCEA 3MPGA 2Z1VA 4LSBA 3CWHA 3TNBA 1CXEA 1TCDA 1G4TA 3NZGA 3PBMA 1CGXA 1D9EA 3VC6A 1C7SA 4DI9A 4M6VA 1BG9A 4Q4OA 1DEDA 4LEFA 4P5UA 1AG1O 3W9ZA 3DFSA 3DYMA 3FA4A 1E1CA 4ZL1A 2INEA 1CLKA 5K7JA 4CNOA 3R0KA 3O7UA 3TEVA 1YMYA 4ZQNA 5DN1A 4M7SA 3PBWA 4KRZA 4MJMA 3WLLA 4N02A 3AIQA 4K7YA 4B5WA 5HNUA 2G37A 2RAGA 4CN4A 1W56A 3MKKA 4AF0A 4X9SA 3CAKA 4JQAA 4A8LA 1PKYA 5B7YA 5AYXA 4QTGA 3TWBA 1TA3B 2JIWA 4J3UA 1E0TA 4XZ9A 4KH2A 4HU0A 4US5A 4LF2A 2BASA 4DVOA 1B4KA 3W72A 1O6IA 2OGJA 4I8DA 1PZ3A 4ATDA 1NIUA 3G6LA 3TYCA 3SAZA 4W7UA 1UP3A 3HA1A 1BF2A 5B80A 4J3TA 4AY8A 4DLMA 1N7KA 4H19A 3MZ2A 4GY7A 1BVWA 2PBOA 5HNTA 2E28A 2B81A 3AS1A 3WYZA 1UD4A 1E43A 4MTVA 4FOUA 4GUHA 1ZCOA 2HMCA 3E6EA 4GBUA 3C8FA 2OQYA 4WDXA 3TYZA 3EWCA 5TBOA 4IQLA 4WD0A 1CDGA 4FEZA 3QJAA 1VFTA 4MY8A 3LZ5A 1ZL1A 5KMYA 2GUBA 1MW1A 2WHLA 1DJYA 4DJFA 1TYGA 1QW7A 1UD3A 1HKMA 3W82A 1GOWA 3UZYA 1V08A 3MZNA 2PDCA 1GPFA 2WJDA 3M0YA 1UCWA 2ZZ7A 3NG3A 2PFHA 3KL0A 4KMQA 3AI0A 3F4VA 2OU4A 3VD4A 1D3GA 3DUGA 1DIOA 4LB4A 1QPKA 2QEZA 2WQPA 3SCOA 1W5QA 3VNDA 1YBQA 4Z1CA 5CCZA 4F2TA 3RHGA 4O14A 1M53A 1PYFA 3GHTA 2NWSA 3E2QA 1G4EA 1HKIA 3VIIA 5I06A 3BAYA 3S3GA 1RAKA 2PDUA 4W8LA 5BXTA 3OW1A 4GX9A 3W29A 3IGXA 4XZHA 1RCOB 6XIAA 5HMFA 1OG0A 4UOZA 2GPTA 2QIIA 1SW7A 2XGBA 1VFSA 1ZB5A 3E12A 5AC7A 3RPTA 4K7VA 5A6AA 5D37A 3WLNA 1UPMB 4I7VA 3TA9A 3HGJA 1VBHA 1FWTA 4CCZA 5CBIA 4PMUA 4AH7A 2VUYA 1DVJA 3MP4A 1XYMA 4P7OA 2CYGA 4GK8A 3UCQA 4EXBA 7REQB 4C6BA 5FF0A 1SPQA 3NYDA 5FJPA 3UWWA 3T0CA 3FJLA 2QCNA 2DP3A 3M07A 2CWNA 4KS0A 3I3BA 3W1LA 1RBLA 1PDYA 1DJNA 1EXPA 3ZWSA 1ZUAX 2OLAA 5DF0A 1GQNA 1TZ7A 4E2OA 2BBFA 1XYCA 4CNTA 2EG6A 2AL2B 3SQSA 4FS9A 4AZIA 2QR6A 4MYXA 2AAAA 1QAPA 3IJ6A 3E96A 1WOBA 3QSTA 2FTYA 4UQCA 3EEZA 5LHEA 2CZDA 4GA8A 3L5AA 1F5ZA 1J11A 4C6KA 3PM6A 4NZJA 3KHDA 5FCZA 1ICQA 1G01A 2VCBA 1JJKA 3KCJA 5GVJA 4K36A 1TIMA 4H04A 4ENLA 3SCVA 3W7PA 3XISA 1EX5A 2ZXBA 1TE1A 4WHBA 3P5YA 1TMLA 2POZA 3GXFA 1QU4A 1EO7A 2OFJA 5HPCA 3BLIA 3SCQA 4CUCA 4HA3A 3AIEA 5DT7A 2EQDA 3EX3A 1FHUA 1RSCA 3F1QA 4TMCA 2PWVA 1E1CB 3TYUA 1FFQA 6A3HA 3VMNA 3W01A 3UR7A 3LX9A 2VWSA 3HG5A 4QG6A 5JUVA 1TPC1 1ZENA 5C0QA 3AISA 2Z1WA 2A79A 1W1ZA 1HFBA 5CPMA 3LGGA 2QVNA 2QKFA 1JCMP 1XUZA 5G5IA 3CYVA 4EK7A 4AVFA 1E4IA 1EP2A 2I7GA 4JIRA 4LS0A 3QW3A 3H7RA 4MLRA 2ZUVA 1WQ5A 2YA0A 5KZMA 5LGXA 4CU8A 3BC9A 2W62A 2BY0A 4DQWA 3OQ8A 1XIIA 1V3MA 3NQFA 1KTCA 3MMDA 1ZJAA 3QKZA 4QLLA 1M7OA 4ZENA 3NUKA 4QIUA 3G1SA 1TVPA 3N25A 3WLTA 3TYAA 1QMLA 4E6MA 3CAQA 3MT1A 3PZTA 3CL6A 1NDWA 2VDGA 3ZQ9A 3W73A 1KV8A 4L1XA 2F84A 3DFHA 3HGOA 5EPDA 1DQUA 2YB4A 3LXCA 1CTNA 3NQCA 2GGJA 1DWHM 5FSDC 1TPDA 1NWTA 5CXPA 3STPA 1EX1A 4U10A 4JX4A 2D20A 1OSEA 3UF9A 4OFCA 2F8QA 3EOSA 3SI9A 5HINA 4KETA 3OGVA 2ZRWA 3TQ0A 1GONA 5T8GA 3U5UA 2RDUA 4JQ4A 3RILA 3D46A 3CMJA 1X97A 1YLVA 4AIBA 3VI2A 3WJXA 2D2JA 2VX7A 4KERA 5H1WA 1RK6A 1TJRA 4TTGA 2X8RA 5IXEA 3QYQA 4F79A 2OKOA 4I5UA 1J0KA 2I56A 3QKEA 3O2LA 2OEJA 2Y5JA 3FNDA 4JTJA 3OA3A 1GK8A 2Y63A 4R34A 3OPSA 2REQA 4Q8OA 3RPDA 2Q8ZA 3MB9A 4A3YA 2WC4A 3S5YA 3CS2A 3LRMA 4AYSA 3NFUA 4H8HA 3DKLA 4DJDA 4XIMA 1D3CA 2FQIA 1GT8A 3TCSA 5EBAA 3FEMA 4RZ6A 3BOXA 2VRQA 1OZQA 4OVXA 3CQ0A 4UTJA 2B4GA 3EB2A 5A8GA 2PGWA 2OSYA 1ONEA 2GLKA 3A64A 1REQA 3EOEA 4M7TA 3WENA 2G8ZA 2C3ZA 1M41A 4LVAA 2Z6IA 1FWIC 2DH3A 1NDZA 3HIJA 4MB5A 4A3HA 3M6YA 4PCSA 4DIAA 1O5KA 3UWUA 2CLLA 4Z08A 3LB0A 1T40A 3Q4DA 1SYTA 1AJ0A 3WUFA 3BLKA 2PDKA 4JNYA 1I0DA 5JBDA 4Y9OA 5AYYA 3ITLA 4QXIA 1XXXA 3HU7A 1UR4A 2YCIX 1HG3A 1RALA 2VZSA 4MVAA 4DO5A 2ZA1A 1WZLA 4ZSTA 4XZBA 3PBGA 5CZTA 3R79A 3NCOA 3TAOA 5RUBA 2HPIA 4WY0A 2Y7FA 4B5NA 1Q6OA 1IWAA 1B57A 1B2YA 2D0FA 1CX9A 1UUMA 1GVRA 5CBBA 3N14A 3RX3A 3LSBA 5E6ZA 4MMWA 4O0QA 1ISWA 3FVMA 1XDLA 3NQEA 4LX4A 3UR2A 1FXPA 3K46A 4JTQA 5F4XA 2QV5A 1E9ZB 4IL2A 2WM0A 2Q8XA 3VOGA 5HWJA 1T7LA 2G3FA 2GVGA 1YEYA 1OFPA 1CLXA 3H22A 2PWUA 1MEWA 3KRZA 1XIEA 3AMKA 5C5YA 1LOSA 3W7QA 4H9MA 1Q85A 4WOZA 3AU6A 1VR6A 4AMCA 1FTXA 4A8NA 1AW5A 4DWSB 2BVTA 3HPAA 1R2SA 4DUXA 3RPMA 1OM0A 2NQZA 4HCHA 4S1FA 4GZJA 1GOXA 1QPOA 4WXYA 3EMZA 1QO2A 2L5HA 4YCPA 1Q45A 1Z8AA 4DN1A 4IT1A 5T9BG 4Y9AA 5KINA 4LNCA 1YNPA 2E8ZA 4MKVA 3A5FA 3KM8A 3GHSA 4HSNA 2OX4A 3FJNA 3UP8A 2XH7A 3PZQA 4FXFA 4GQQA 4GJIA 3M43A 3PZUA 3NO1A 3QHOA 4JTEA 5DRCA 2EXOA 2ZA3A 2NXGA 2GQ3A 3R13A 2HPMA 4UQEA 3TONA 4YVXA 1V6YA 1SZRA 4WKHA 2F61A 1DIEA 4K2SA 5JIWA 1P0EA 2YA2A 1K8ZA 2V5KA 3G1YA 1FXQA 4CD6A 3OQEA 3S4TA 5XINA 1TWDA 1G67A 3Q94A 1M9HA 1UH3A 1UQZA 2WPGA 2BFGA 3D5HA 5F2LA 4ACZB 1DIKA 1Q66A 4B92A 1SJAA 4CNUA 1UZDA 3VTRA 2VXNA 3BG5A 3C86A 2EPHA 2JEPA 3HN3A 3BZGA 3P67A 3LM3A 2D23A 4AIUA 5KEZA 4DY1A 1XW8A 1SFSA 3PNZA 1QPQA 3VOJA 2DT2A 1W32A 4OUEA 2D69A 4YPJA 3ZJ8A 4OJYA 1KTNA 1ZJIA 3VNMA 5C9UA 3K2GA 1A5MC 1QI3A 2Q02A 3B0UX 1AD4A 3VDHA 3OLEA 2A3CA 2VWTA 1P5BA 3W70A 3MSRA 3URQA 4ZB5A 5M03A 2XUCA 1Z6KA 1JIBA 1QI5A 1LQ0A 2REQB 1GVYA 3T2PA 5HK4A 2FH6A 2ACSA 3F2DA 1DJWA 3P0WA 2IPJA 1K8CA 4NJGA 3AIVA 1VPXA 1RJQA 2CZFA 3P14A 1XISA 2IS7A 2D2OA 2VX4A 5I23A 2HK0A 3I6TA 5A6MA 3W4RA 3L2MA 8TIMA 2E3ZA 4PL1A 1C92A 2H8XA 3DC8A 4C60A 4K37A 2CW6A 3SUWA 2TPSA 4UR7A 1EO5A 1A3XA 1QHPA 4UMAA 3N12A 3BL3A 4U33A 1ODUA 1GZ1A 4W88A 2JEQA 5C9RA 2E5BA 1D8WA 3C2EA 1B3XA 3CZEA 3MUAA 1NF7A 4PUMA 1ECEA 2J7FA 1DXEA 1KCLA 3VK5A 3BMXA 3ZYZA 4XAGA 4DYEA 3H4GA 1IWBA 2WANA 5HOSA 3GAKA 1QNRA 2DV0A 2QDEA 5F2MA 4S3KA 1QR7A 3TE9A 1XS2A 1OX5A 4Q8QA 4K39A 4M1BA 2AKZA 3SR7A 3DZ1A 2J77A 2NSXA 1IHIA 4NJJA 4IP7A 4D1JA 4O1FA 1C91A 3WQCA 3FSUA 4LAKA 4MB4A 1L2UA 1NVMA 3FHQA 4PR4A 2FZ8A 4O1CA 3S5SA 3CM4A 1NWRA 2YX0A 1FWAC 3VNKA 3G6MA 4AC7C 4PCFA 3D47A 3I7QA 1BXNA 3K8KA 2R8WA 3PULA 1J0IA 3WFLA 3WQVA 1MVYA 1FH8A 3WQDA 4H1ZA 4H9ZA 4UTKA 4FA3A 1LLZA 4YNGA 1F3WA 1UC5A 2EF9A 2OZ8A 3ZOAA 3WD0A 4WX2A 3W75A 3BSHA 3AIUA 4IPJA 3UJSA 2YL9A 2NVDA 4PMZA 4HCLA 1LG2A 3MSDA 5E0CA 3U4AA 3RDKA 3EA1A 3IIZA 5LKYA 1FHDA 4OOUA 5F4SA 4ATLA 1UOKA 2PURA 1KXTA 5CBJA 1EB3A 4TX9A 4C65A 1PX3A 2QF8A 1FWFC 1DJGA 3EZ4A 4HCDA 3USBA 5EMJA 3SCPA 3PFMA 3AS0A 4AZBA 3B97A 1R3QA 2ZRVA 1MUCA 4E8GA 1P43A 1BAGA 5A8NA 1RJRA 3H21A 2ZX9A 3D3FA 3GR7A 4WIWA 1H50A 1XX1A 2GFTA 1E6ZA 1EKOA 3W6MA 3ZFHA 3N18A 4AQLA 3TTQA 4LPCA 4GZEA 1JF6A 3N73A 3M0MA 3AIBA 3GDRA 2ATSA 2NUYA 3IS4A 3TYEA 5ABGA 4HMCA 2WHKA 4RXGA 3BARA 1BFNA 1BWKA 1F61A 2XN0A 3VKJA 1TO3A 4KGLA 4R7OA 3B9AA 2HEJA 4QDWA 1BSLA 4KEZA 1GJPA 3P0XA 3AWOA 1X6NA 3IIVA 1LYXA 5CKSA 1V51A 1VCVA 4S3JA 3M5XA 5L6UA 3Q2DA 5FEXA 2NV1A 2NUWA 3WL0A 2IPWA 4QHRA 2INFA 1A5SA 4DJED 1RV8A 1XFBA 3BV7A 2C19A 3ITCA 4FZIA 3TVAA 1SW0A 3AYTA 2C18A 2PRMA 2ZDRA 4V28A 1PPIA 3TP4A 3GFZA 1YHTA 3C3NA 2ISSA 4DZ5A 3DFNA 2Z4GA 3VD9A 8XIAA 1YQ2A 1TWSA 2BVWA 2GOUA 5FI8A 2WCGA 3MMTA 3UJ2A 1GTEA 1R30A 3BDKA 2GOKA 5HQMA 1LP6A 4BWLC 2D3LA 1YW1A 3E0WA 3WUEA 3WH9A 4G56A 3UT0A 1DBTA 1KM6A 1X6LA 2ZX8A 5CJMA 5GNXA 2Z28A 1UR9A 1XIDA 2BWGA 3FHAA 3S1VA 3VD5A 4FLOA 4W93A 2PZNA 4P8VA 4NNCA 1E56A 3NQ8A 3CTLA 4O11A 3S1GA 4HYVA 1JZ5A 3CUZA 3LEPA 1U22A 5BWFA 3CV2A 3OVRA 3EPMA 4EE9A 3UG8A 5I3HA 4ZOCA 3EMQA 2XVGA 1TX2A 1IEQA 4DELA 3M7WA 3NL6A 3N15A 3CZ8A 1SSGA 1T99A 1VJZA 2GVEA 3KBWA 2BV9A 1JZ8A 2V3EA 1UWRA 5A6KA 1QK2A 2B0MA 2WK2A 2DSWA 3S0CA 2ZX7A 1TQJA 3PTMA 5DXXA 2YL5A 4DRSA 3WNLA 4L9YA 3UZJA 1P0BA 3S9YA 3DENA 3F2CA 1WDSA 3NQVA 3IJ9A 1OZMA 1LWHA 3TLLA 4JTSA 2WV8A 1ZAHA 3K4WA 3MUZ1 4M3PA 2OG9A 3LTSA 2GJPA 4B90A 2G95A 5IBXA 3VOIA 4KWUA 4D72A 2YYTA 4ADSA 4V33A 2AGKA 3S2JA 1IIHA 4D1IA 2DEPA 1VFFA 3AIWA 2HVMA 2XU2A 3S9IA 2C1GA 4OV4A 4GXPA 1F4HA 4I6KA 3CUXA 4NU7A 3M46A 3T9PA 3HBLA 4JN8A 1GOIA 1IIGA 3IV8A 2FH8A 2G5WA 3GXNA 3CUFA 4Z2HA 2CLOA 3AU2A 3R0UA 4GNJA 3W27A 4LYRA 1A0EA 3A12A 1GG0A 5FAJA 3ZT6A 2ZICA 3I68A 2Y4SA 4FX6M 3UJFA 2HS8A 4DXXA 4PH6A 4MB3A 4Y8FA 4PYSA 1YX1A 1I2PA 4CU7A 2PS2A 3QM3A 3GW3A 4MHBA 2VFDA 3RO6A 2CBIA 3DEQA 5G2WA 2VVSA 1BVZA 1AMKA 4P7NA 5CGMA 1LBFA 3GVRA 1BYDA 1K8YA 1PJ9A 2XIMA 2XSXA 3UZ5A 4XBKA 3CMFA 1O7AA 4WR3A 2ZOXA 4TVCA 2XVPA 3SIMA 2QJIA 1I8JA 2XIIA 3U2OA 2X30A 2B7PA 1ZY9A 1U5VA 2PWDA 1OX4A 2Q3RA 1X8CA 4DJEC 2W63A 2J75A 4ES4A 5CAKA 4O16A 3ARPA 2D0GA 2ZQ0A 3HZ3A 4ZQPA 4QISA 1YXYA 2A7NA 2QXWA 4ZXOA 5CH9A 1TMHA 3G3DA 3MY9A 2ZVIA 3TKFA 4MUZA 3R58A 3TFXA 3K30A 4OE7A 4F40A 2QUNA 2WKJA 2P76A 1M7JA 1TUFA 1O12A 4UTWC 3DYOA 2V38A 3EX2A 4G1NA 5AHEA 4J35A 2YDSA 2FGLA 1DQXA 3VOCA 1P0KA 3RRXA 4S3CA 4DJFC 3W7LA 3VGFA 3FA5A 1ML1A 2C8NA 1V0NA 3ALFA 1BWVA 1ME8A 2RDXA 1S3HA 3H70A 1K7FA 3PP7A 3W26A 4LRSA 1LRQA 1E55A 1PIIA 1Q6QA 3ME3A 2ACUA 1F7BA 2YLLA 3FV9A 2YDAA 4IJBA 1EFZA 3NDZA 3LV6A 1YNYA 3ZVIA 3GH4A 4CD4A 5CLWA 3TK7A 1JG9A 4RE3A 3S5ZA 2V5DA 1H51A 3N34A 3WLRA 4Z0SA 2HJPA 3OVQA 3T8QA 4IG2A 1HT6A 3G1VA 1OCNA 4J3ZA 1TTJA 2PTWA 4FNTA 1FWJC 3GXPA 3DDMA 3CQIA 1S2WA 2FGBA 5TQLA 2XSBA 3TV8A 4O10A 3S46A 1HIZA 2ACQA 4O12A 1G4SA 4W9TA 2PTYA 1KGWA 4E5TA 1TX0A 4R85A 1FHLA 2H3DA 3GNNA 1QNVA 1NH6A 3QV9A 4W84A 3PTKA 4Z1DA 4OWGA 3WJSA 2H9AB 1PS9A 1KXQA 3MWCA 3BQ6A 2PAJA 3ZT7A 4N4QA 2IW0A 1J93A 1ZAIA 5H6HA 3W84A 1FCUA 3GB6A 3TTSA 2VC5A 3CC1A 2P3ZA 1SFLA 1UD2A 3WX7A 2GVLA 3D0CA 2CXEA 6ALDA 4GOAA 5HNNA 4IX0A 4RXFA 1L2QA 2DIJA 3ANVA 2YSWA 4WDUA 2DQXA 4JQ2A 1W31A 4XTIA 3PUDA 2J8TA 2FPTA 2YFNA 4HNUA 4PGLA 4L6DA 1YXCA 2I14A 1UA3A 3MI2A 1MXDA 3F7JA 3GZAA 5JXQA 3WQEA 3U8GA 2VRKA 1EHAA 3OJGA 3C56A 3SN4A 4C1NA 3BLOA 3BH4A 1JD7A 5H8MA 4MIMA 1Y65A 2WHMA 1J0JA 2WVVB 1AZ2A 5A8QA 3LMZA 1ZFJA 2FJKA 1EDTA 1KLZA 3VZYA 3CIWA 1U5JA 1TCMA 3IK4A 4F2UA 2DDXA 1C7TA 2PF8A 4UFJA 3BW3A 3L7RA 1AA1B 3UZXA 1J2BA 4ZZ9A 4LAOA 1PEZA 3FSTA 1QT1A 3KS5A 3BLEA 1RPKA 4O54A 3T2OA 4GZIA 3N04A 4GFIA 3GNRA 3GFYA 2DZBA 5DLCA 1TWZA 1QW8A 4H9VA 1XIMA 3VMOA 1M01A 1LBMA 4HHLA 5BRBA 3O16A 3VINA 1RQEA 1F4AA 3MI3A 4KFNA 2R1NA 4DWSC 1VGAA 4CEUC 1V3JA 1V6VA 1DJHA 4X2RA 2G0WA 1R86A 1Q63A 1I1WA 4BKNA 1VCFA 1BWLA 4WQ6A 4UTLA 5FD0A 4LWWA 2XFWA 1LOLA 3T0AA 2VI0A 1WZAA 4ONVA 1OB0A 2EPOA 1TPB1 3W85A 3GC4A 4ERIA 5LHFA 4LU0A 3DFQA 5G1TA 1FDYA 2Z00A 3BGGA 1HQTA 1W9PA 3N3TA 4GVGA 3CL8A 2FPYA 7ODCA 1EYEA 1ICPA 3HQPA 4QS5A 2CKRA 4MM1A 3TR2A 1XDJA 1ECQA 1EGMA 1TB3A 1U33A 3I3DA 4PSRA 5CGQA 2G3JA 2GVJA 2PTXA 3AHXA 3JRKA 3UPMA 5G4WA 2ODOA 3G1XA 1H1NA 4U28A 2EO7A 4CKQA 4AZGA 4AEOA 3PPHA 3BLLA 3M0IA 3RJYA 4JTCA 3KBVA 3XIMA 4HHMA 1KGUA 2FTPA 3PS7A 4TO8A 5HXMA 1X96A 3W38A 3B0VC 4Y2WA 4ORMA 4C6IA 1WUFA 4UB9A 1MO0A 3L68A 3CMGA 3GAYA 1FWRA 4AB4A 1MNZA 3WH7A 1V7AA 4HZ6A 2WKGA 1JCJA 3QZEA 5J5RA 1KFBA 3DGRA 1XLKA 4MZ1A 1R85A 2FTWA 1KM5A 3F5JA 2ZTKA 4UMBA 3VCCA 1K02A 1QNPA 2RJGA 3DECA 1MSSA 4N9CA 4DF0A 1HKWA 3EWXA 3SCRA 3S2NA 4IM4A 5CEWA 5F1VA 3EX4A 4IG2B 3HG4A 1XC4A 1BPLB 3UWVA 1JUKA 1HXJA 1W1VA 1HZYA 1FWEC 3I6RA 2PTZA 4IFOA 2TMDA 2VZTA 4P7QA 2VEKA 3K1GA 4IXHA 3ARWA 4GO8A 4Z2JA 5ECVA 1UC4A 3T81A 2XSAA 2GZXA 4DJDC 4IFKA 3LN3A 3VGHA 3HO8A 4BY3A 4LVDA 1PTDA 4NZ5A 5CZJA 3IRSA 2G3NA 1Z32X 1XLCA 1XYLA 2G4JA 4A29A 3K5XA 4NKCA 1DKWA 2A21A 2XVKA 9XIMA 3GG1A 5D33A 1GWJA 1X7IA 5C2XA 3DN5A 5FA5A 3CNYA 4CQDA 1TJ0A 4MPKA 1LOQA 2J7GA 1G94A 4GRSA 7TIMA 3B3DA 3PZMA 1AODA 4O52A 4JICA 5C71A 5JVLA 1JPDX 3RM9A 2F6UA 1NWUA 3WF3A 3TYBA 3MI6A 2OZTA 3A23A 3EXRA 3AO0A 2WSPA 1I60A 5EL1A 3SY8A 4AZ5A 4AD0A 4CNSA 3PY2A 3SCUA 3WLJA 1F9CA 1WP6A 2G3MA 5M17A 2X0YA 2E6FA 3H2EA 1HP4A 3IWPA 2VR2A 3WQ4A 2V68A 3WD1A 3CH0A 3KRUA 2JGQA 1D7KA 3M0ZA 4E4UA 1A0DA 3ABOA 3GNDA 3WDRA 1OFAA 3NXLA 4JKKA 1JF5A 4V15A 3PWGA 3IARA 1XLLA 3H2CA 1S2TA 1LQAA 3G1AA 1FCVA 2W79A 2VL4A 1VH7A 1J79A 4GBDA 4XD3A 2P8CA 2GDVA 3HF3A 4N2YA 3VDAA 1E3XA 5K3VA 3OG2A 1KFJA 2I9UA 1VAHA 1W5NA 1C8YA 4KEVA 5HJYA 3S2CA 5DRIA 5DY2A 3ZR6A 3UA3A 3REQA 1HTIA 1KTBA 4HSHA 1FWSA 4RW5A 3S1UA 3GKAA 5H2ZA 2CETA 3AALA 3W1PA 1PWLA 1X6UA 5KSWA 1EZWA 3F2BA 3VPLA 3NXFA 1P6WA 3THCA 4DYKA 4HNOA 1W3LA 1P6CA 2V81A 1HP5A 3PAJA 3R5EA 1KV5A 3L67A 2BHYA 2NZLA 2ZADA 1G7UA 2ABBA 1ZQ5A 4IJCA 2QJNA 2Z26A 1NM9A 3JR2A 2P50A 4G9PA 1NP2A 3DBPA 1R3YA 4ZQMA 5HJLA 3AQUA 2PDFA 1HO1A 1ZAJA 4IL0A 3N6QA 4XX6A 2ISWA 4Y7EA 2QCCA 2J27A 1H3GA 3C8NA 4NZCA 4PC8A 3Q65A 3WNPA 3E74A 5HUPA 3VVGA 3RJXA 5D9NA 4M0XA 1RZMA 1H1YA 3SBFA 1R5YA 1F6PA 4AG0A 4F9JA 3N9KA 3TA6A 2ZZ2A 1TTIA 3FYYA 1J5TA 1FWDC 3WMLA 2J78A 4WF7A 2C13A 1ZGDA 5I2UA 3VIHA 1ADSA 2J24A 4QLJA 1FDJA 1M7PA 5A2CA 3ARVA 2WAGA 1J6PA 1N8IA 4AYGA 1DTUA 3BOFA 2HXUA 2OELA 1E15A 4MZ8A 4HA0A 3OU8A 1US3A 4U2YA 1S2VA 1AVAA 3KVJA 2OYKA 2MUCA 4YN5A 3LCHA 4PTDA 4DZHA 3H23A 2CLMA 4CVUA 3ARSA 5K9CA 1TKKA 4FMVA 5J8LA 1GHSA 1W9XA 2IKIA 4CD8A 4TVDA 3O6YX 1JZ2A 4POCA 3UG4A 2DQWA 1XBZA 1A50A 3UZZA 4IMAA 2Y8VA 2Y85A 2Y0FA 2DSUA 3TDFA 2Y88A 3HTWA 5BW6A 2CBVA 1WDQA 5CPOA 4HNCA 3UU0A 3N3MA 1ELSA 1XIJA 2IPGA 3CUHA 1DJQA 3SQMA 1BVNP 1EH9A 4XTDA 1J18A 4K38A 1NQ6A 3V35A 3P61A 4O50A 4W8AA 2JE8A 4NYYA 2ZCGA 2J7DA 1MQRA 2OXNA 4KWOA 4AIEA 3BAJA 3SQLA 1OFDA 3TUUA 1HJQA 5CLTA 2HK1A 4LC6A 4H3DA 1ZPTA 5C6MA 2WZIA 1UZ4A 4ATWA 3A22A 3WBYA 5HDRA 2X0HA 2DW6A 3UG3A 4NAFB 4GVFA 4IGMA 4NXKA 2ATMA 4IFKB 4UZSA 1O1HA 2FIQA 1CGVA 1TV8A 2ANUA 1BYAA 1EUAA 4RNIA 2FVLA 3W3OA 1QDSA 2Z0IA 1HJXA 3OHMB 1XD0A 4NNBA 3KP1A 1XI3A 1D3HA 4R5EA 4H9UA 1MEHA 1RVKA 3MYPA 4JNMA 4P2VA 3SECA 3C2OA 4IF2A 1W91A 2CCRA 3NM1A 5G4EA 1ZZMA 2HE5A 3G0XA 1J8VA 3EXSA 4S2CA 4JIPA 4RPPA 3QLDA 2V3FA 4GFSA 4GHRA 4DZAA 3UWQA 4UIOA 4DAIA 3QOMA 2QUTA 3H54A 3CXOA 4QSHA 4HPHA 1W3NA 3V7PA 4IWWA 4B5VA 3EDEA 3HG2A 3TQPA 4XISA 1DXIA 1V3LA 4GUGA 1E6NA 4JTKA 4UTTC 3TTOA 3VM5A 3A4WA 3K8MA 3ONCA 4QX4A 1PXGA 4ZO6A 3GS6A 4WZHA 1KQZA 3O15A 2WZHA 3WLSA 3H24A 3DIPA 3CLMA 2WSYA 2JKPA 3REQB 1KRAC 1C9WA 4OECA 1PZ2A 4MWAD 4NI8A 1KA9F 3TW7A 4HQVA 4UFIA 5LXEA 3KW3A 3BGJA 1LWJA 3MCOA 2A0NA 4WSJA 2P8BA 3WO8A 3BXWA 4DEFA 2D2GA 3THUA 4RJEA 2HZGA 3QOKA 2JFEX 4OT7A 3K8LA 1EEPA 4QE5A 1YNQA 3TU9A 5LGZA 2E9BA 3VD3A 3G3MA 4HBKA 1O68A 2Y5EA 3WQ6A 4NL1A 5FJRA 4C1LA 3KVLA 1VRXA 1YXDA 4YTUA 4WLCA 1BTMA 1XP3A 3TCEA 3URBA 3HPSA 5AN7A 1KBJA 2CNCA 5G1MA 4KW2A 2OOFA 3PZIA 1FWNA 4ICNA 4QEHA 3TH6A 4LUSA 4WSHA 3MDUA 3S1XA 4NI3A 2YXGA 4ICCX 3GDBA 3CQKA 1VHCA 1WNOA 1OFQA 3EWDA 2TODA 1J96A 5HANA 1TRIA 4KWWA 5LIXX 2GK1A 2QQ6A 4NUWA 1V5XA 3SDOA 3PB0A 2ZXQA 4J7RA 3HOJA 3DX5A 4RDVA 4O0ZA 3NR0A 2W3ZA 4XBJA 1UR0A 1B3YA 1KLYA 3SN1A 3WLPA 1FQ0A 1H7OA 4RCXA 4F66A 3HQNA 4MGGA 4H2CA 1GVQA 4S23A 3RR4A 4N6EA 3LXBA 2WM1A 4CQCA 3UYIA 3QQ1A 1XYBA 5CZSA 2DT1A 4OKDA 1KFKA 1JAEA 3B04A 1E1FA 4JOMA 3AS3A 3NZPA 2Y7DA 4C6MA 4XZLX 4RNJA 2QCDA 3KBMA 4M5PA 3AXHA 3L4UA 2XIBA 4ZCWA 2WW5A 3ITGA 1OD8A 2VCAA 3MP3A 1MMFA 3KTSA 1WV2A 1PYMA 5KZEA 2VMFA 3RNDA 4G6CA 4MJZA 1P0DA 4J28A 2B7NA 4Q32A 2PGEA 3BMWA 5M5DA 4MWAA 4IISA 4RE4A 1HGWA 2DIKA 1EEXA 2FPVA 2Z7GA 3KX6A 3GKFA 4CCCA 4DPPA 3SRHA 3QZ6A 5AHLA 2HS6A 2OZ0A 5BOEA 2NQJA 4XAFA 2CESA 1C8XA 2CKSA 1C9DA 1OC5A 4K8GA 4AW7A 1EHNA 2VFIA 2E9MA 3LK6A 1TREA 4QE1A 2P1FA 5D9OA 3U57A 1B31A 4RV3A 3LCLA 5AVNA 1EL3A 1H7NA 3TC3A 3O6AA 1B4EA 1SSDA 3CYJA 4JFWA 2P88A 2PMQA 3FEQA 4M82A 5HNRA 1Z48A 3DFTA 3WLIA 1QPNA 1OABA 5LIWX 2HV5A 1XCWA 3Q37A 4AWSA 1CB2A 3LCWA 4K3ZA 2R24A 3ZVHA 4GI6A 5BU9A 3P80A 4UZUA 3B8UA 1CYGA 2NUXA 1EQPA 4MB1A 1ZP4A 1W0MA 3TWAA 1GKRA 3EB4A 6XIMA 4EANA 4W8BA 2F2KA 4PBEA 2C0HA 4P8WA 5KZ6A 1I6NA 3GXMA 1XPGA 1YYAA 1XD1A 2QJMA 4HU8A 3I4KA 4XIAA 3CU2A 3HPZA 5C2GA 2WMIA 1C90A 2EPKX 4NG3A 2Z2AA 2QHAA 3GXIA 4QBXA 1JFXA 4O0KA 2BOGX 3QHMA 1IT7A 2WCAA 1G69A 3L5MA 5IBXC 1OX6A 1K1DA 3KE0A 5EKYA 4B3LA 3MA8A 3GG8A 1OC7A 2Q3OA 4BJHA 3OBEA 3N4AA 4WDWA 3PUEA 1KBBA 3KBJA 4M81A 3WMCA 3GWQA 3AOFA 1PL9A 3CZGA 2OODA 4WEVX 2H90A 3DC0A 2Z1SA 3H12A 4H7VA 2J7HA 1Z3NA 3ARUA 3FA3A 2D0HA 5FIPA 3TJIA 4GYPA 5C9XA 4W7VA 5CC5A 3MANA 5FJJA 1VCGA 4S3AA 3AHZA 3UESA 2IPFA 1H62A 3OTRA 4BF7A 1UD8A 1DL3A 3DHUA 4HPXA 2YFOA 2V30A 4H8VA 4WXZA 1ZBWA 3EYPA 3GK0A 2WJFA 2BSLA 4JIIX 2V2DA 1LL4A 1FP8A 2VFGA 1EP3A 3HMJG 2QT3A 3STCA 1UJQA 5HATA 4LS2A 2C16A 1OCQA 2WZTA 3BOLA 1OCBA 3R0DA 3VKDA 2PZ0A 2HCVA 4LUSB 3BGAA 4LTSA 2ZC8A 1MWOA 2PLCA 4PFMA 3NVTA 2VO5A 4REQA 2GWGA 3UY7A 1JCYA 1CWYA 4ADUA 2DVUA 1OIFA 1X1OA 2CBUA 3MO4A 2E4TA 1K4HA 3W74A 2GK1B 3MCMA 4PN2A 3DG6A 4TTUA 4ZB2A 4NXSA 1UH2A 2FVKA 1UYQA 1HN1A 4GACA 3SUUA 5HMEA 4CCDA 5D2XA 4AC1X 3IJQA 3QGKC 2FKPA 5BXSA 1N8WA 3LRKA 2ZRUA 1LDCA 2VDHA 4W5UA 1G6CA 4YL2A 1RUSA 4GKTA 4EX4A 1FP9A 3B06A 3MDWA 2C14A 1RCXB 4D6EA 3B8VA 2DZSA 4O19A 4MNLA 3CQJA 2CHOA 1OINA 2XH0A 3QMSA 1ONRA 2QCEA 5GJMA 3UEQA 3WBAA 1V6WA 3ZJKA 4YYFA 3M47A 2VKZG 2QCDB 1E6QM 4TUFA 3VNIA 3KVKA 2BMBA 2VVNA 2W61A 3L21A 3G8RA 1JUBA 1JCNA 4JCLA 4OBRA 4YMZA 4DUVA 1VBUA 1XLFA 1WE5A 1EJVC 3WJZA 1CGUA 3U0HA 4DBDA 3GE7A 3GDMA 2E6YA 1ITUA 1IT0A 2BG5A 3ARRA 3WZ0E 3OO2A 1KRCC 2QGYA 3G2GA 4FALA 1EBHA 4JTFA 4A22A 4J4KA 2JKEA 2WO5A 3PWAA 3M6DA 2VGFA 1SR9A 3W71A 4LVBA 5BMWA 3VMPA 1ZBCA 5KETA 5A6BA 4XAYA 3FAWA 5CPLA 3T05A 1IZCA 1SO4A 1UR3M 4V1XA 3SSJA 3VU2A 3UD6A 1R7AA 3BICA 4JN7A 4D2JA 4M6UA 1H5YA 2O9OA 3ABXA 2QDDA 3W7IA 7XIMA 4DZIA 2UBPC 3UPBA 2GSHA 5DEZA 1ZU8A 2F6KA 4U5KA 3SGUA 1JXKA 3TJ4A 5DBTA 2CZEA 3VFCA 3ZVHB 2WB5A 4H8NA 3SFKA 2DJXA 1BGGA 2I16A 2PBGA 4IIDA 1XUUA 4YTTA 2NQ9A 2GUUA 4O1AA 2P0OA 4ZR8A 3NYZA 4PMRA 1F2JA 2QMJA 4HNLA 3E2VA 1JPHA 5I03A 3DCPA 3G22A 4CQ9A 1TELA 4EXQA 3W2KA 3TOYA 5AZ1A 1U1JA 1Q65A 4XV0A 5DY3A 4NSBA 3GXDA 2NVCA 4FOKA 3EA2A 2I1OA 4GXWA 1V7YA 2C0AA 3FKKA 4PRWA 4MWAE 3MVIA 3LNMA 4M29A 4QG8A 4QFUA 5G2IA 2PDXA 3HMCA 1TSIA 4B3ZA 1PIFA 3O63A 4KGJA 3A4JA 1P7TA 4GD0A 1GGOA 4Z42C 1SJDA 4LT9A 5HULA 2E68A 1XWYA 2VENA 4J27A 1AH3A 1JZ6A 4V27A 4ALDA 4A2SA 3RR1A 1C8QA 3NIYA 3L4YA 4C7DA 2YBTA 5CJNA 1HKKA 4B9ZA 5FEZA 1Y5WA 4AVNA 3A3WA 4M6QA 5F2GA 1YRRA 3CHVA 4WDTA 2F6XA 1T0OA 4PMQA 4KEMA 3E2SA 2GQ9A 1R2RA 1BGAA 3OYXA 1J0YA 1W17A 2GDUA 3HFYA 4RX0A 3L0GA 3EGJA 2R14A 3IUHA 3V4BA 5BRQA 2EAWA 2PDQA 1BRLA 4EPKA 2WNZA 6ENLA 4DO7A 3R8HA 3QBUA 1BXBA 4L1WA 4C7GA 5GQBA 1YPIA 4XB3A 3R8RA 1V3HA 3LBMA 2PWHA 1TR1A 3THDA 1XLGA 2VFHA 5TNVA 1CENA 1XSIA 3PPGA 3SGZA 4K1WA 3TLQA 2YW3A 4ZFMA 3NAVA 5LSMA 3S5OA 5EMYA 3W1XA 3HV8A 4X0NA 3RAOA 2OB3A 3P6LA 5LIUX 4WVXA 5CG7A 1OK6A 3ZS4A 4I9JA 3MS8A 3EWWA 2A5HA 4YXGA 4J2MA 3GVQA 4JTIA 4JL2A 1OF8A 1RR2A 3PK7A 2FDMA 2R91A 5BROA 3SZ8A 1I2OA 3BCJA 3QPEA 2E9LA 4ZB0A 4AD1A 1ZP3A 4DUOA 4HYWA 2YDRA 3P82A 2IUZA 4P7RA 3VAVA 3VIKA 3NNTA 2DZPA 5CPQA 3BV4A 2GDQA 4W87A 3IANA 2POTA 2OKTA 4QNWA 1LZOA 1UWQA 4HYRA 4GUJA 3NO3A 1IT8A 4D6JA 3Q58A 1XRFA 3M0KA 4EPEC 4UOJA 2A7RA 2IQDA 3E49A 1K9TA 1I0BA 4Q4SA 4C1KA 1BLIA 1J5SA 3RLHA 4QJ3B 2IMRA 4TU1A 1R87A 1TZZA 2CLEA 3QYSA 4RDWA 4RZBA 3R4IA 3KCOA 1LLOA 3ABRA 2VCCA 5I7GA 4LB3A 3HPXA 4TV6A 3ID7A 2YA1A 1C29A 1SFJA 1S3TC 5FL0A 3WH6A 5JIPA 3FCPA 4H9TA 1OD0A 1ADDA 3M1ZA 1WO2A 4K6AA 4MKNA 3QZAA 5JU6A 1JQXA 5ABFA 1PX4A 3BAWA 1AUSL 4HD5A 3DGBA 1E5NA 3LYEA 3WBEA 4PL2A 3QY6A 3PR2A 3QFWA 4C6NA 3QN3A 3GBDA 4GYJA 3NQ7A 4D6CA 1GEQA 5LYRA 1E4MM 4RKAA 4XUYA 5ABEA 3I10A 2YLAA 1LG1A 4QGCA 1ZBVA 4NYUA 4MNKA 5A8OA 1AQ0A 1H49A 2X41A 1NDYA 1W3JA 4DNHA 3W0KA 2WZEA 4ZVJA 3WG6A 5E93A 4PFHA 3S83A 1UUQA 1J12A 1VZWA 4GWEA 5EGRA 3N2BA 2XWDA 3NQGA 1UD6A 2PC8A 4JXCA 1XQKA 3SADA 4HJFA 5FESA 5CG0A 3I6EA 2GGEA 3AXMA 3WDJA 4FNQA 2D73A 3VZXA 3IAPA 5CPSA 4KWSA 1VYPX 3E38A 2E77A 5FJIA 1Z7AA 4GG9A 2WCSA 4ZO8A 4KIRA 4LW7A 4F0MA 1DP0A 3H6OA 3W7OA 3SRFA 4C91A 2PP1A 2QPSA 1RLDA 5DCEA 2HQAA 2QCGA 1E6RA 1WDPA 1FWBC 1PDZA 1WXJA 5LNUA 1OADA 4FIRA 3CQHA 1ISVA 5F2IA 3W00A 5D8ZA 1TPUA 1DJZA 3WF1A 3GC2A 3SJNA 4UNIA 1DWIM 4PMVA 3ENLA 5CZ0A 4TV5A 1XJBA 4C6PA 3N2XA 4JZ5A 3TW6A 3R6IA 4XD4A 2E25A 3BVJA 4KBXA 2V67A 4UUIA 3CV7A 3AYSA 1NDVA 3MHGA 1JDEA 2XFRA 2X05A 2CITA 4AZCA 5I3DA 1BRLB 3KDOA 5BXPA 3L2LA 4I5XA 4MADA 1HL2A 1MEIA 2J13A 4DF2A 1XL9A 4V1YA 2PDYA 3PSWA 4Q6XA 4HA1A 4IX2A 3IVUA 1Z41A 1L6GA 4JTRA 2HE8A 5D9MA 3W88A 2YJQA 4ZQRA 1P0NA 1MXSA 3BURA 3OVGA 2PCQA 2ZUSA 3MSGA 3P8JA 1MYRA 1J6OA 4NASA 2VOTA 3W24A 3LCGA 2XPKA 3OA5A 2X2GA 1V0LA 3LG3A 4IPIA 3AJ7A 4PUEA 1VJSA 3NL5A 1IEIA 3QY7A 4I7UA 4O13A 1BSIA 1NOUA 1OT2A 2PSNA 4PA8A 3N19B 1UWSA 1A4MA 1W3HA 3H26A 1R6WA 3PJWA 2WVUA 4MNMA 2VR5A 1QOXA 1GG1A 4XZWA 4IMGA 3QC0A 3W1NA 1ONWA 4TVUA 3B9DA 1HVXA 3MC5A 4BF9A 1OEPA 3CEUA 4BEUA 1WKDA 1SJCA 4HIBA 2NT0A 3PBYA 1GZJA 5DANA 2YDQA 5D05A 3GUWA 2ZTJA 1K8XA 5I6SA 3J7HA 3ITOA 1HJWA 1CCWB 1K3UA 3GYEA 5B7ZA 3N2OA 2ISVA 3W7HA 4LRTA 4OBTA 3PTDA 1A53A 2QVHA 4O8AA 2VZOA 1XLEA 1E6SM 3EDJA 4AF0B 4F0RA 4HPJA 2PDGA 3CIVA 3IEBA 4LGXA 1EXBA 4LC8A 3VOHA 1W5OA 1IGSA 3AUOA 1SO5A 4W89A 3VKKA 1JDCA 1F6YA 3RIKA 4BF5A 1M68A 4CVWA 3NVDA 5EB8A 1V8EA 3VDCA 5I77A 1ENUA 4QCEA 3WIJA 1JPKA 3QFEA 2C79A 3MQTA 5KZDA 4MZYA 3RLUA 3VKBA 1A47A 2VEMA 1S1RA 4Y8EA 5E5CA 2Q01A 2NXIA 1FCQA 3BG3A 4A8IA 1G5AA 4MNJA 1VFLA 1NU5A 1EDQA 4R88A 4HMEA 4DHGA 1PV8A 1JPIA 1LCOA 3GRIA 4GIYA 2W67A 3QPZA 4AZHA 4UC5A 3KRSA 4DNMA 4PMOA 1RK5A 4RR4A 2KAUC 3I3EA 1WAUA 3NJ3A 3HM7A 2Y7GA 3BO9A 2Y1HA 3KOYA 4XVDA 3LCIA 3TZNA 1YADA 4XKYA 2PP3A 1VEOA 3LQLA 4OQVA 4QCFA 3HG3A 1SO3A 3C4UA 1HNYA 4XKMA 1R9YA 4XZNX 4PE8A 2RKXA 1T8QA 1W1TA 1F74A 4PRRA 3M5YA 4A3UA 4PCTA 1PKLA 1DXFA 2BODX 3IIOA 4L61A 1CLVA 4LBSA 3PBUA 3QH2A 3VX0A 2FHCA 1YBQB 3T55A 3W23A 2F9RA 1FWGC 1TVLA 3FAXA 3V1HA 3TNOA 4LCSA 5HR6A 5H91A 2DJLA 3GSMA 3TQVA 2YYUA 3L4VA 1JI1A 4D71A 1L0PA 1WDRA 2BHUA 3FDKA 1LUCA 4A2RA 1EGZA 3PTQA 1FKWA 4GGHA 2QZRA 4N6FA 3UQNA 3KWXA 3CB3A 1FY6A 3TZFA 4NQ1A 3E5BA 4IGNA 5GJPA 2J8FA 3N2CA 4ACYA 1WBJA 3CBWA 5ENLA 4JFVA 3TN4A 1H61A 4HN4A 1ZTVA 1QTWA 1ZS2A 4JS3A 1VFHA 1T41A 1X38A 3HGSA 2G4FA 2X40A 1E1EA 2UZ9A 3S8HA 3TXZA 1S2AA 4AD2A 5C7VA 4F0SA 1UKQA 2A3BA 2A4AA 1CXIA 2J4GA 2UY4A 1R9XA 2UY2A 1M1BA 4GIEA 1MDLA 3KZPA 5LA1A 1PKMA 1H41A 4FLQA 2AMXA 2RHGA 3GU1A 5ABHA 2EJ1A 1A5NC 3FIGA 4H9YA 1A5OC 3R2GA 4DB7A 1TPWA 4N4PA 5K4XA 3BLFA 2AOSA 3BAIA 5A6SA 3LZ3A 2QCMA 4EF9A 1Q4NX 4E3VA 1QHZA 1CZ1A 3CV1A 2YL8A 2IQ0A 1JUEA 3MP5A 4EPDC 2G3IA 3LXAA 1CXKA 3PFRA 4HTYA 1H11A 4F9DA 3GTFA 2NXHA 4R53A 4NJIA 1A5UA 1L6YA 4QJ4B 4IHCA 3DFOA 1QATA 3VIOA 1KWGA 3W76A 3DG3A 3U9IA 1IV8A 1J01A 3ABSA 3OGSA 1TVNA 3NA8A 3A6OA 4ZOEA 1I2QA 2QW5A 5I3KA 3T2QA 1GQLA 4URIA 4IQDA 1N2VA 2NT1A 4B9YA 4GQ0A 4CNNA 4GI9A 2PA6A 2OEKA 1GVFA 2V6AA 2V3GA 2W66A 3B0PA 1F3TA 1UJPA 3N2TA 1ITXA 1IXPA 3EXTA 3BLDA 3KZSA 4F2BA 1VPQA 1H7WA 1I45A 1KFCA 4JEQA 4FX7A 3PZOA 3AMDA 2JBMA 3SFWA 3WSUA 2AKMA 2FYMA 3HFTA 3JUGA 1A5LC 1KBKA 4FK9A 3QMTA 3GYCA 3LHTA 3RO8A 4H4IA 3W1RA 3AFBA 4HMNA 4UBPC 2BS9A 2E40A 8RUCA 4UTIA 5D2TA 2QJJA 2SFPA 1GYLA 1X8FA 5CPNA 1LBLA 3R94A 4GE8A 2HRWA 1OCJA 3O06A 3LY0A 1PWMA 5REQA 3W87A 3UZWA 4B4FA 3ARYA 4GO9A 4Q4QA 2YPIA 3W6LA 3GR4A 3ZR4A 3PG9A 4B2DD 4Z2LA 2ZWYA 5M2FX 1XV8A 4MJ2A 5IDIA 4XKYB 4LANA 5CZKA 2I9EA 3AMLA 2FFCA 3FYOA 1XFCA 1H60A 3P93A 4LBRA 2X7VA 3PUOA 1P48A 1OC6A 3W7JA 1OG6A 2F7FA 2IQTA 4M1RA 4Y90A 2BY3A 2XIOA 2E5CA 2NV2A 4J3VA 1O5RA 4OU1A 3LCXA 3EOLA 1UZ1A 2EBNA 1JZ4A 1L6SA 4KF1A 2EEXA 1P6BA 4KCTA 4YWIA 4EOUA 1JPMA 1RD5A 4GQBA 3MCNA 2XGIA 1Q2SA 2GWNA 1YDYA 1W1B1 3JU2A 2V2HA 3KOFA 5IM51 2OT0A 1TV4A 4BQ2A 4Y9PA 1JAKA 5LIKX 5E0FA 1LUCB 5T91A 3TOPA 1EZ2A 4QRNA 1XBYA 1AJZA 3ORWA 3W83A 1K6AA 3TFCA 3AMCA 4ZQOA 3IJDA 4JYEA 3VILA 4ZODA 3LHVA 2OLSA 4GVIA 3B05A 4LOCA 4TXEA 1XLBA 4MUPA 1REQB 3LA4A 4GINA 4KKXA 2OO6A 3WUGA 3MW7A 4Q7IA 1FX6A 2QAFA 3LI0A 4P8UA 1Q13A 1S39A 3OIXA 3ISIX 1O5QA 1I1XA 3NPXA 1ESWA 2J6XA 1XH2A 2VELA 2QPUA 4EF8A 4JKMA 4QG9A 3MV01 4FXRA 3UVIA 5FF7A 4KWVA 4QITA 3V0UA 5IHRA 4LH8A 5AHFA 4PTNA 5IHSA 4WY0B 2WLYA 4QSFA 1E70M 4L4MA 5CQ1A 3NO5A 4PBGA 1SMDA 1EIBA 1KFEA 4NF7A 3ARXA 5J04A 4ZA0A 3W7EA 4KPLA 4LFYA 3UWYA 4I3GA 1VB9A 2F2HA 4JR5A 4C6OA 1UR2A 3BK0A 3WN6A 4ML4A 5D03A 1YDNA 3C2YA 2A3AA 4G7FA 2PWFA 1ZLPA 3VFLA 4GXMA 2OCZA 2HVOA 1NELA 3WQGA 1GVIA 1LT7A 3M0LA 2QCFA 4Y9MA 1EF2A 1H09A 4PUWA 3CUGA 5CAHA 1V3KA 2J7BA 2XTKA 3GIPA 1KO0A 3EX1A 3W2NA 4IH3A 1JQVA 4PEKA 3WQFA 1VYSX 4JYFA 3W2MA 1TMQA 4X60A 1VD6A 4JD4A 1LF1A 1Q6FA 3LOTA 3VKCA 3QGAC 3CV6A 8CGTA 4Q8NA 1B30A 1GORA 2J66A 2OLHA 3EKGA 3RMEA 4NAEA 9XIAA 3PC0A 1S1PA 2CBJA 3IACA 2J79A 3C61A 4B91A 1V79A 1UZHA 2ZUTA 1RJPA 1OGGA 1Q6CA 1VIWA 3LI1A 9RUBA 4GQGA 2VT0A 4F0HA 5D8WA 4E0CA 3VDBA 1YTDA 2V5JA 3CEPA 1VQTA 1D7FA 1HUVA 2Z1XA 3G5EA 1RA0A 1CPUA 2DZTA 3SIZA 2XIQA 2Q8LA 4D6FA 4IIGA 1YE4A 4HA4A 2VX5A 1EQCA 4B3KA 1GJWA 4NHVA 3G8EA 2W5FA 4BWLA 1BYBA 4N9EA 1EC8A 1JCTA 3L66A 1EA9C 3EWYA 5AHNA 3THQA 2W6RA 2DFAA 1XKJA 1NQKA 1QUMA 4P61A 2GJXA 3DG7A 3MMWA 2HTMA 1GUVA 3WL1A 3F4DA 4B15A 4QE4A 3GTHA 4US5D 5LA2A 2XM1A 1P1XA 1VF8A 4HZ8A 2PLJA 4RZ4A 4E4PA 3AICA 2WNWA 4GUFA 4HHPA 2ZUMA 1LRTA 3M5ZA 4MDOA 2J25A 1YDVA 4AXNA 3ABZA 2BGQA 2VC7A 1XG4A 3WJYA 3LHZA 2GQ8A 1JCXA 4Z2KA 4QEEA 1W1IE 1XRSA 2D1ZA 3L9CA 2WMFA 4LQ1A 2OQLA 2FMNA 1ZSXA 3T4CA 4GKLA 3QXBA 3ARZA 1XCXA 2OTDA 4LUYA 1UKPA 3H7UA 4Q4MA 4J40A 1JI2A 3U2CA 2C1HA 4UR9A 5M1TA 2CU0A 3LD5A 2CLIA 3AZTA 3SCNA 4W4QA 4AY1A 2YXOA 4DJFD 3CWOX 4KEUA 5HPOA 1KM0A 2BZNA 4UCGA 2DIEA 3JVAA 3COTA 2WSKA 2ZE0A 2TYSA 4JHZA 1YPFA 1SFTA 4ERGA 3B0XA 1NOFA 3N9SA 4NT0A 3VZZA 3I7SA 1PUDA 2X1SA 2AL2A 5DMLA 3U48A 3GTIA 4A4AA 4DBUA 3W1AA 4OTKA 4NZ1A 1W9VA 1L6WA 3SRDA 4FR6A 1B9BA 1UKTA 2I57A 4K8EA 4UTFA 1VHNA 3MVTA 4D8ZA 3B8TA 3S2LA 1KXVA 1UR1A 2VEFA 3ZSSA 1KM3A 3QQ0A 2D3NA 3WD3A 1V6TA 5C9WA 1JRBA 4BQ5A 2FZBA 2ALRA 1VC4A 4OV9A 2O9RA 1A5KC 4Q4KA 3TMLA 3TQKA 2WBKA 2BY1A 2VX6A 3IPWA 1UH4A 4AISA 2OJPA 3T0DA 4NJHA 1WOAA 4BI6A 2Z6JA 4GQRA 1H0GA 4QLKA 5EU9A 2CEQA 1QI2A 5FACA 1J10A 2ZX5A 1E9LA 3FK4A 4YLWA 1XLHA 4Q8TA 1K9EA 3W1TA 5AC6A 1DWFM 1KFLA 1XYFA 2P53A 1MQPA 4GJJA 2BGNE 3B9OA 4XD5A 1IF2A 4YTQA 2G97A 3QV7A 1MW3A 2W9MA 5JBFA 4J3SA 2PUZA 1IEVA 2AQWA 1ITQA 1TQXA 5G1YA 1EWEA 4HOWA 1MQQA 5A8PA 3KTCA 4LYQA 1HL8A 3CT2A 2JF6A 4IPNB 3A4XA 3ECQA 2ZZ6A 2NW0A 3VYLA 3NDOA 4DJEA 1E9IA 1WXZA 2ZUWA 2CZ5A 4LS1A 3W81A 4IMDA 4PUKA 1Q7MA 4C6DA 3GQYA 3RUBL 2V63A 2XJ7A 1JL8A 3IGUA 3WMBA 2VQTA 5K9DA 4L9XA 3APGA 1EJ7L 4JDYA 3VE9A 5C55A 1TPFA 1Q8JA 2FB2A 4X0VA 2HXTA 1JRCA 1UQYA 2WMHA 4PBFA 4NAEB 4H00A 2IKJA 5BYWA 3PAOA 1EOKA 4UTWA 2E09A 3P3BA 4X2PA 2O56A 2YBVA 3GVWA 1KWKA 3RM4A 4FOJA 2VEPA 4IUOA 2AAMA 1OFRA 3N29A 3LCFA 3UNTA 4AZ6A 3QSRA 2QV4A 5FKYA 2YZ5A 4XQ6A 2VGIA 2HBXA 1VFUA 2Y70A 1UA7A 3CHDA 4HT3A 5K9XA 2VC6A 1CT5A 1WDDA 5C70A 3IJIA 1R0MA 2PU1A 4B5SA 2BB0A 2KX9A 4DWSD 1OFBA 3URAA 1G4PA 2PB1A 3KHJA 4UQBA 5D32A 3WLMA 4UWMA 1A5CA 2RUSA 1TV3A 4HK5A 3DYPA 4HJWA 4HN8A 3Q67A 4W86A 5HMSA 5E1QA 3TYDA 4U31A 5CJ5A 1K7XA 3MUCA 1HKVA 2GJXB 4UNLA 2VFEA 3MTWA 3G1FA 4ZGYA 4WCJA 1DE5A 3LGDA 4ZFCA 4HMDA 1J4EA 8A3HA 1EYWA 1TV7A 3NSNA 2FZ9A 4A8RA 2P0IA 3W28A 1ISYA 3BMVA 3A9BA 4S3DA 3WDQA 2YIHA 3UJRA 4IUGA 3HJEA 2CHRA 4TOQA 4M8UA 3MJMA 5GNYA 3H2MA 1J2WA 1CBGA 1W1PA 1OGSA 3SY1A 2ZE3A 1H63A 4YCOA 3IVTA 1D2KA 3AIRA 1XH0A 1QNQA 4JQ3A 5ABTA 5U4NA 2DUZA 4WGHA 3L23A 1DWJM 3WJWA 1S5WA 3VGGA 3GH5A 1TTPA 1VBJA 4MY1A 3BZJA 3OLIA 4HB7A 1TWIA 1DORA 4U3AA 1VKFA 1Q6RA 2WYSA 2ASHA 4Q8MA 2XG9A 3KXQA 3B8WA 4I5RA 3R25A 2QUUA 3H2NA 3T42A 7A3HA 1E0UA 4D6GA 2ZRXA 4JTHA 2HROA 4S3GA 1EOMA 4IOTA 3OOQA 3A3HA 4L1GA 1QK0A 3GY1A 5I0DA 3UXAA 3GBEA 4QJ1A 1PTGA 4IPPA 4L4PA 5CPTA 3VXGA 4PUNA 2J6VA 1T5AA 1XCFA 4ROPA 4UFKA 3CAWA 4HPNA 3M44A 5D04C 3I65A 3NPWA 3P60A 3STEA 3GTXA 3I7RA 2WWCA 3AWNA 3APYA 2GYIA 3L4TA 3RLGA 1JR1A 4WKAA 5BXRA 3VIPA 1QNSA 3T08A 2O9TA 3UXKA 2PCEA 3BCDA 1YDOA 1FKXA 4L6OA 4DUWA 4DJDD 5D09A 3VCRA 1AFSA 3B40A 3LTYA 1LJYA 2WOQA 3PNUA 3GH7A 1MUMA 2V5CA 1WAWA 4DWSA 4Q7NA 1ME9A 2E6AA 3NWRA 1EGVA 3KDNA 1PTAA 4UQ9A 1XLMA 4L7ZA 1W3IA 3RGTA 4CEXC 1JGIA 3MUXA 4UTHA 1UPPA 2YOCA 4ZE4A 3W2JA 4UQDA 3PB2A 4PMDA 3ZIZA 2XM2A 4RK8A 3GVVA 2AQOA 1DV7A 3VNJA 3UBPC 2HISA 1WX0A 1XG3A 4JEJA 4K68A 4NZ3A 1BTCA 1CXHA 5FSEC 5E70A 4LAZA 4O15A 3WQ8A 1V77A 4R7WA 2J7CA 5FF2A 3HJZA 3EB3A 4IFRA 1Q3NA 3CZKA 4Y9NA 4W85A 1Z9AA 4LV9A 4Z1AA 2OPJA 4HK6A 3LU2A 1IXQA 2QYGA 5E6YA 3MWAA 3W6YA 4F48A 7ENLA 2O7SA 4AXKA 1K70A 4PMYA 2ESCA 3UETA 2JGYA 4N7QA 1QI0A 3GDKA 4ACZA 3LSCA 2Z1BA 1I9CB 2GSEA 3DI1A 1CXLA 4PCPA 2LLEA 1RPXA 3CO4A 4ILSA 3GIYA 4GYFA 4ROQA 3L2IA 1GKPA 4AHOA 3KFTA 3RU8X 3EX6A 3WK2A 3OODA 1FH7A 1ZHAA 3W7RA 4H2HA 3NQ6A 1PAMA 5T26A 4LALA 2RH9A 1UBSA 2UWFA 3F5KA 4RPQA 3WQWA 2PDWA 4BA0A 3B4UA 2NQHA 4L5ZA 2XFFA 1OX4B 3A47A 1TJ1A 1GJUA 3CHCA 2PC4A 3UNDA 3A9IA 3GG0A 3QV8A 1TJ2A 2HNHA 3T07A 4JHMA 4WJ8A 1DIDA 4O17A 4NX0A 3VUPA 3S9ZA 1W8SA 2PODA 4H6KA 4DI8A 1GEHA 1EPXA 5D38A 2WC7A 2QJGA 4J9JA 1NJJA 2WHJA 1MI3A 3INPA 4ZQCA 4AU0A 1EPVA 2DUAA 3O3RA 3B8SA 1JFHA 4YHEA 3SM0A 2XN1A 1S2UA 3DBNA 4EIVA 5E9AA 2CPUA 2WLZA 1US0A 1SGJA 2GVYA 5H8UA 1QVBA 4Q4PA 1IXOA 4IIHA 1UB3A 3GO2A 3UCDA 5JQ9A 4S39A 2BLEA 1F8MA 2F38A 4PZVA 3UYCA 4FI4A 1DHPA 1ZJBA 4R3UA 3IK2A 3P74A 2ISDA 1FRBA 3OZOA 4NJKA 1DQWA 3JZUA 1TUXA 2P5NA 5LNRA 3W7MA 9CGTA 1SO6A 3VIGA 1OK4A 3QGVA 1UWAA 3LGEA 2Q71A 1XLAA 3UGRA 1T8XA 1KKRA 3RN6A 5AC4A 4N9DA 2PGFA 4NILA 2ZXAA 1GPWA 3FOKA 3N4EA 4N0RA 3OZMA 1CGWA 3KUMA 1QRQA 1JCLA 3FN9A 1NARA 3RFAA 2J9XA 1CB7B 3A21A 1T96A 2OOGA 2GL5A 4AWTA 3HQ1A 3UG5A 1B3VA 1E40A 3WF0A 1W1YA 2X1RA 3W86A 3N6JA 3TJXA 4L9ZA 4XO6A 3WDPP 4F3HA 1R7OA 3WMSA 3CPUA 3R43A 1WBHA 3SB0A 1RBAA 2ZUNA 4EACA 3YPIA 1DOSA 3L4XA 4ORIA 1QWGA 2EPLX 3LMYA 4MDPA 1DJIA 3TSMA 1J9YA 4MPQA 2QCHA 4KCUA 1UWTA 3F03K 3E9AA 3DAQA 1YTEA 4R33A 1NEYA 3TSBA 6TAAA 4TMBA 5TAOA 3GFXA 3WUBA 1W9DM 3ZJ6A 4C1NB 4KFOA 4CQAA 2V5BA 3PPCA 1GYMA 5FAGA 2QAPA 4GABA 3LS9A 1EJXC 4JBRA 2WMGA 1XPYA 1RY0A 3RCYA 1UIPA 4BEQA 3IAQA 4NX5A 1O1ZA 3T7VA 2OYMA 4S3BA 4B5TA 4GH1A 3S6TA 2O92A 4DF1A 3TN3A 2DZXA 3W25A 1PE1A 1QPRA 4KQNA 1GOQA 3UXIA 2VEIA 1MFUA 4MLJA 1Q6LA 3EPNA 4LAMA 1Y5XA 3AROA 1AL8A 5DMNA 2R94A 3M41A 3H55A 1YTKA 3GC5A 1LL7A 3AYVA 4IJRA 3ABQA 4ZOAA 5I79A 3NEVA 1B3ZA 1Q4WA 1K9DA 3FYPA 3LHWA 3WFAA 3MU7A 4ZSUA 2NV9A 3FFSA 3LPPA 1R2TA 3NEHA 3UY8A 1AQMA 5JBEA 3UXLA 4E2BA 4JYDA 1MW0A 4GZ7A 3RK8A 1M5WA 3LPOA 4Q22A 1I2NA 2YBUA 3CHEA 3O6DA 3AYRA 4ZTYA 3TAKA 2V3DA 1NAL1 5FJOA 1FA2A 2HBVA 1K7EA 1EWDA 3LM7A 1LTDA 2A6NA 2FDSA 2XZ9A 3TX9A 1U2YA 3UWEA 4DBSA 3R8GA 1S2CA 4JY8A 1N55A 2ALDA 3USZA 3B03A 3BW4A 4B16A 2P3EA 3G0SA 4LYKA 1O4UA 4XWUA 3GHRA 4WKFA 3R1ZA 3W2UA 2QF7A 4WOQA 1IEXA 1TRDA 1V93A 3O9NA 2Y24A 5MKGA 3LBOA 3JW7A 4LBUA 3ZM8A 4CLMA 1KNWA 2ZWZA 3CZLA 3R10A 2IKGA 2B31A 3L4ZA 3AHYA 3C0SA 4ZXLA 3NZQA 4O4WA 2YCJA 4J3WA 5K2ZA 4QQUA 2DZUA 3IJ7A 3WQPA 1VRDA 4E2VA 3VNLA 3IIXA 1KBLA 5FF4A 3EOUA 7CGTA 2NWRA 2Q6ZA 2G50A 1K6WA 4MF4A 2PRHA 2CWXA 2PDMA 2A3EA 1CIUA 1F3EA 1H4PA 3VNYA 3ZSTA 1JZ7A 2XVNA 2GGHA 2NLIA 4IXXA 4DO6A 3C0LA 3ZMRA 2W27A 3LHUA 3V36A 4FLRA 3B8IA 1Z69A 1WKEA 2J9ZA 4JIEA 3KLKA 4UTTA 1TFVA 3SCWA 4Z1YA 3CUJA 3MBFA 5AC5A 2ON3A 3KAOA 1KCXA 1V02A 3EEGA 3FS2A 3II1A 3MYOA 1VEPA 3V3WA 3UR8A 1HGYA 4LCQA 4RE2A 3KTXA 2OO0A 1XBXA 3B0YA 1IEWA 3HPFA 1V0KA 3GM8A 2FMOA 4AX6A 4EKJA 3H2FA 1GTHA 3CLWA 4R9OA 2XHYA 6CGTA 4OZOA 3E3HA 5BNKA 1PKNA 1Z44A 3WCZA 1XF0A 2EPMX 3RMJA 4PMNA 3QRHA 2RGLA 2VHLA 4XZMX 5I78A 1IGWA 4ZE5A 1MRQA 3KBNA 2X1TA 4X61A 1OVDA 1VEMA 1XRVA 4PB3A 2A3HA 1B54A 1B5TA 2PP0A 1BQGA 2OYLA 2EG7A 4H7CA 1CEOA 1VYRA 1V6XA 1FDZA 4AEEA 5AKQA 3ITVA 3ITTA 1AK5A 2JF7A 2CHNA 4LUTA 2VDIA 3BE7A 4H8UA 1RH9A 4UTMA 4WGXA 1O94A 2DSZA 4Y96A 3LRLA 4Q3MA 4PB4A 2FJUB 4NY2A 1VPYA 5EYWA 4UFHA 3UR5A 5SWUA 2EJAA 3CPGA 1PHQA 1BKSA 2PDLA 5I5RA 4OGZA 5BWAA 2BVDA 2WMJA 5F4WA 3GX9A 5D9PA 3UW6A 4UNKA 2OGYA 3Q45A 1KQYA 1FUYA 2ZZ3A 1XC6A 3R89A 4PUDA 4MJ4A 3ANUA 1E72M 3E1F1 1GQIA 5A2BA 1S38A 3SEPA 1I4NA 2J9YA 1MXGA 1WKFA 3WEMA 5JMUA 3PPFA 3MBDA 4DO4A 3NURA 1AJ2A 2X0SA 3WBWA 3M0VA 4IMEA 5D2YA 4JX5A 3VIJA 1UASA 1DE6A 4GY1A 4PTXA 2QGHA 2B7OA 5D30A 1RQBA 4RDYA 5D4YA 1XR2A 2Z1KA 3TN5A 2CZVA 4IIBA 4I9MA 1QI4A 3AHVA 3STGA 4B4HA 1Q8AA 3H7VA 4UQAA 3QQWA 3N9RA 1VBGA 4KRUA 1SW3A 4JTAA 3KLLA 1POKA 2NX9A 4LEQA 3TC7A 5IFTA 3WLHA 3QF0A 1PB0A 3BJSA 1TPH1 3N17A 2OX1A 3BAXA 3U5YA 4HTBA 1ZNNA 4JY9A 1PX8A 3GTNA 1GVOA 2FZMA 4EWJA 2WVTA 2XYLA 2ZXDA 4QDPA 3ATZA 1XHGA 2XINA 5C7HA 3WNNA 1U5HA 1J0ZA 3ITYA 4JKLA 5AHIA 3NSXA 3OZYA 3PJUA 2E8YA 1W5MA 3B4YA 3NZRA 2OZ3A 4DXVA 3VDGA 1E5JA 5LNVA 1C3FA 4IP5A 3W1QA 5MKGB 1H0IA 3E2RA 4I6VA 5CC3A 4GVHA 1OF6A 1Q6EA 1QFEA 5HWMA 1IYXA 2DPEA 3WEZA 4C5ZA 5CC6A 2EHHA 3P2VA 3C0JA 4AHPA 4AD5A 2FLIA 1F6KA 2H9AA 4P8XA 1CECA 1KR1A 5G4HC 1WZKA 2QUMA 2UY5A 4J3XA 3H8AA 3KP0A 4IZGA 4U5IA 2FGZA 1PZ0A 2Y5SA 3BW2A 3GUGA 4IMFA 5EMLA 2W91A 1G7VA 2EKGA 2RFGA 2AQVA 4I9TA 2NX3A 2CC0A 1TR9A 5CSRA 4PB5A 1BHGA 2H3BA 4HNNA 2HWGA 1XDMA 4JIQA 2QMKA 3DH7A 1JYXA 2DY3A 2Z29A 1S5TA 2Z2BA 1H7RA 3DXIA 4HZ7A 5LA0A 1NOWA 4AY7A 1A5AA 4WJXA 2FZDA 3M0HA 3KOWA 2WVVA 1X98A 2X16A 1BEUA 3WY1A 3DHDA 3ZWTA 2X2YA 3N1AA 4QS6A 4R27A 3C6CA 2PDBA 3WF2A 1NWSA 1YKWA 5M3WA 4CGTA 1JDAA 1EJWC 1TTQA 4U2ZA 4GC3A 1UHVA 1LT8A 4OBSA 5E9XA 4QR6A 5CSYA 5I3FA 3S6DA 3E0FA 4F8XA 4NRSA 1E73M 3CUIA 1B90A 1EJSC 5A8MA 1FH9A 2GUYA 4EWND 5E09A 4UR8A 4GMEA 3G24A 2ZFAA 1FWHC 4AX7A 4HOXA 5L9FA 4CU6A 3LLXA 4AWEA 5DXYA 4I90A 1G9HA 3NL3A 4HSOA 3H2AA 3WD2A 1CI1A 3ES8A 3KOZA 4O1DA 1WXYA 3H4XA 5HQLA 3GHUA 2ICSA 1O95A 3V16A 3WDHA 3AUJA 3H53A 4LUTB 3CO8A 3G0UA 4IMCA 3CH9A 3O8AA 2JALA 3WEOA 3W07A 3SGGA 4WY0F 2PLMA 3KCLA 4N42A 2V5LA 3W1MA 1UMLA 4Z2GA 1GNXA 3T1GA 1IZKA 3NQBA 4D6IA 3RX4A 4DXKA 5TF0A 1N8FA 1E9YB 2BXVA 2QIWA 2R6OA 3N2MA 4NNAA 1BF6A 1UD5A 1V03A 1RLCL 3OHIA 1V02E 2MANA 4DWDA 4FNUA 5DO8A 2OSWA 4B5XA 1XICA 1HVQA 5A6LA 1NFPA 5EMMA 5XIMA 1CGTA 1SZGA 1O5XA 1RBOB 1K77A 5C8BB 4C6FA 1MRAA 4HU3A 3ERPA 1O60A 4NIRA 3NOYA 2BOEX 4FO4A 4E3TA 3WFZA 1XIHA 1THFD 3KOXA 1WYIA 3WQ5A 3FY1A 1EJRC 3DHFA 4FNRA 3RRAA 4LVFA 3AMGA 4LNYA 1RXOB 1EF3A 2QLYA 5A2AA 1PVNA 3CWNA 5GNZA 4BK9A 3UCCA 3LPGA 3C0QA 3U7BA 3LBCA 4JDBA 4PTVA 4AHQA 4DLFA 2W92A 3URNA 2V0TA 4M51A 1A4LA 1LLWA 3KEHA 2J74A 2D22A 3D6NA 1MFVA 5AYZA 4XSMA 2CXGA 1UBPC 2E6DA 2PWGA 4E2DA 3SN0A 3HV9A 1SZNA 2A2IA 1SM9A 3T0TA 4FNSA 1E4NA 2J7EA 5I3GA 3VGDA 3PANA 3UJEA 3NL2A 2VUNA 2JQXA 4YS1A 5G2HA 3RCNA 4D6HA 2DZVA 3DKJA 1GYNA 2TRSA 1FFRA 1FCBA 4RW3A 4JL1A 2YW4A 1HJSA 4D6DA 4Y6GA 1GZGA 3L4WA 3FVDA 4MFEA 3NDYA 2J47A 2YXXA 4LY8A 3CTTA 1H2JA 3T78A 4TQTA 1AQFA 2FVMA 1GW9A 3CAVA 4DPQA 5FJTA 3OVPA 1MUWA 1X39A 4H9XA 2OVLA 3U7VA 1EC7A 5E0KA 4BHYA 2J62A 1KM1A 3T6CA 2DGAA 1N82A 4RV8A 3AZSA 1PZ1A 2PE4A 1S5VA 3WH5A 1RP8A 3BSMA 2DT0A 5AYIA 3PZNA 4GIRA 2DZWA 4O1BA 3MO7A 4Q7BA 3T8LA 3IV3A 4MWAB 4ERAA 2Y2WA 4C7FA 5AYBA 1DTNA 2ZX6A 3D3AA 3LERA 3AAMA 2OQHA 2RGMA 1KCZA 3VABA 1PCWA 1R38A 4MAZA 1DHKA 1KM4A 1M04A 1NF0A 4RL3A 3V18A 3BCFA 1TE6A 4JCMA 1WKYA 1JZ3A 3BPWA 1UKSA 3VO0A 2IKHA 3O07A 1A5BA 4ECLA 4ADTA 4LV4A 3IGHX 1KGXA 1GW1A 5EY5A 3VA8A 4KFPA 1VBRA 3EDKA 1BQCA 4PEEA 1P1MA 1ZRQA 5MHBA 3E02A 4GI4A 3TN6A 3FX4A 2ZZ4A 1ITCA 3WQOA 3LUTA 4G1KA 2R1PA 1OBAA 3U4FA 2WSQA 2EG8A 3E0LA 3ZT5A 4C5YA 4P7LA 1I2RA 1XYZA 3SUSA 4EXAA 1L9WA 4V2XA 1KR0A 3F4NA 3KL3A 3CL7A 2BTMA 3K1DA 2WMIB 3CJPA 6REQA 3GVGA 3OLDA 4YVPA 4YYCA 4BQ4A 1KKOA 2HSAA 2FB3A 3QEZA 3FLUA 4I8YA 1JVNA 3G1DA 4QAWA 4YU1A 5LNWA 3R11A 4B5UA 3POHA 1W54A 3V5OA 5DCDA 3GDTA 2G96A 3K4DA 3MV11 4JFTA 3U6WA 1B1YA 4JPGA 3NPVA 4PSPA 4L4OA 5C54A 1HF6A 1GHRA 3TIMA 1W1A1 2WSRA 1Q6DA 2ZUUA 4FIQA 2FHFA 2C15A 4GNVA 4FHAA 4XAPA 1KFWA 2BX7A 2HVNA 3U2ZA 4GGBA 1CGYA 3OG3A 3N4FA 2PI6A 3BLPX 4ZTXA 1UG6A 1DWAM 1XYAA 4L6HA 5A5WA 4DBEA 4X9YA 1Q5MA 4LUIA 1K03A 4YJ5A 4AD4A 2VZVA 1E51A 1JXJA 2D24A 3FKRA 4Z1BA 3RU6A 2HDJA 4GCXA 4AVOA 5EBUA 1XIFA 4K8HA 4KIEA 3M9YA 4KRTA 1MDRA 3LENA 4UXDA 1OYCA 4DYJA 1HKJA 5C2CA 3ZJ7A 3HURA 3BUVA 2VR4A 1UW9A 1PHWA 3VUSA 4J5NA 4HZMA 3VC5A 4QDMA 4I9AA 5DCBA 1B3WA 3W7KA 3LLDA 2BHZA 4AEFA 1EIXA 1SMAA 6PTDA 4IQJA 1HJUA 2GGIA 2QJHA 2ZA2A 4REQB 1W2VA 3F4WA 3E0VA 1XGZA 3WELA 3T40A 1ZJHA 2YR1A 4GUIA 4HOZA 3NTYA 4BI7A 3VD7A 2YCLA 4CQBA 4HGXA 4RNHA 2ABAA 1XLDA 5AVHA 3AHTA 4X22A 4AD3A 2PDNA 2PPGA 5I09A 3FW6A 3K13A 3O1NA 1V4YA 3IJ8A 3ZZ1A 2Z27A 3MJYA 4JQ1A 4IP4A 3ICJA 1Y0EA 4D8LA 2WKLA 1LORA 2PLKA 4NAFA 2PF0A 3W1UA 3T0BA 5HR7A 2ZYFA 3RXZA 4H6QA 7TAAA 1Q6GA 3PSVA 1OYBA 5LZLA 1ME7A 2NSOA 1IXNA 2INZA 1B9ZA 2JIEA 4GX8A 1OGBA 1EP1A 5BOFA 3ARTA 4AWUA 4GI8A 1Q7QA 5CC7A 4H41A 3PJTA 5HQEA 1VLWA 3A5VA 4GPNA 4L4LA 3VGBA 2WC3A 5FEPA 2CERA 4RE0A 4JAWA 4QM1A 2Y8UA 4DBWA 1WPCA 3ZLFA 5XIAA 3QR3A 1TZ9A 1ZBKA 1V6UA 1UR8A 1QXLA 3OLGA 3NQMA 1U30A 5I00A 3VNZA 5F1UA 3BQ5A 1I75A 3CK5A 4MOZA 3TR9A 4CQ8A 3IUIA 2XZ7A 3AC0A 2C6QA 2E5DA 3AXKA 4UMCA 2A1YA 3AXXA 1S5MA 3EWUA 2BDQA 2OMAA 2O9PA 1X1ZA 2E67A 5U7SA 1IR2A 1LM1A 4S38A 2XN2A 4JTGA 2VZUA 3M7SA 1POJA 2BGSA 3CGTA 4WSKA 1EA0A 4JN6A 3IVSA 2WBGA 1YPXA 4JTUA 5I24A 3GLCA 3RLVA 1M6JA 3C5QA 1QJWA 1H1ZA 2OWXA 3ZLHA 4M80A 4KESA 3FXGA 4D8AA 2QUVA 3PBVA 4QAIA 1KCKA 1V0MA 4BCEA 3GIQA 2G41A 1JULA 3SRKA 1NP0A 5BOOA 4TR9A 3GU2A 5AHMA 2VD8A 1BKHA 3WLQA 3PJXA 1EUNA 3PF3A 1U1UA 3QR0A 5AECA 1KRMA 1W37A 1CXFA 2JKAA 1A3WA 1OFEA 3FGCA 3QMRA 1PCKA 2ZRZA 5AC8A 1LRNA 1HL9A 4H7ZA 3EOOA 3TJLA 1LL6A 5J5DA 4Q4RA 3PHAA 6REQB 1NY1A 4O4VA 3V75A 5DX7A 3STFA 1U83A 4HKPA 3V0TA 3WKZA 2I5GA 2V9DA 1QWKA 3WNKA 2Y62A 4H6RA 2O4QA 4XK2A 5IFPA 1HJVA 3QHNA 3UGVA 4GIAA 1F73A 3WD4A 3PG8A 4PULA 1KD0A 3P5ZA 4LJ3A 1M65A 1WA3A 3OGRA 2FFIA 2QNEA 1L8NA 3GG7A 1E0VA 1AZ1A 4WRHA 4PTMA 3B9NA 4WUIA 4DAFA 2ZZ1A 1JYNA 1PO9A 3UWZA 1P7TB 4AUBA 1SZEA 2V69A 4JTDA 1ZCCA 3WK0A 1R47A 3WF4A 1OIMA 5CSUA 4YWSA 3A3XA 3EPOA 2H8ZA 3HGRA 5HMDA 4AMAA 5MF5A 4X63A 4IIFA 2C91A 1PBGA 3FXYA 1OJXA 3XINA 3WNMA 2R1MA 1RD6A 3ONBA 3WK1A 4YTSA 1TV2A 2DT3A 4E38A 3NM3A 1S5NA 2ZKMX 3SUVA 4L65A 5KTLA 3UFYA 3O0FA 1A0CA 3APTA 3NPUA 4HP5A 2ZRYA 3GW0A 3V0SA 4C6LA 1W9UA 4BI5A 4GYKA 1VJIA 4C6CA 4YHGA 2B7QA 2ACRA 2PRLA 3G77A 6TIMA 2O0TA 2Z2UA 1SUXA 5DMMA 5JH1A 1FWCC 4O8RA 4JFUA 1ALDA 2DSVA 5H8PA 5GJNA 3IJLA 3LPFA 4LXFA 4UOQA 4MFDA 3L0KA 1AMYA 3OBAA 3FDGA 1AQHA 3W02A 1UOZA 3MSYA 3PZ9A 4XD6A 3OP2A 4FX8A 4NP7A 1G0CA 4F0LA 2YCLB 4J2PA 3G1HA 4XO7A 3WH8A 4JIHA 1E6PA 2O7QA 1M7XA 5LNSA 1JYWA 1PSCA 3UPWA 4FSAA 2ZZ5A 4TX8A 2VP8A 5I3JA 1HO4A 1WCGA 5DT5A 3WK3A 3R7MA 3VIMA 4IIEA 1W9BM 3THAA 4PODA 4ZBCA 4HK7A 1DWGM 2ZVRA 1Q2RA 4UFMA 3VCNA 3O0KA 1M3UA 4OIFA 4FP1A 3NQAA 1RP9A 1XGEA 1ICSA 3N11A 3C2RA 4DM2A 1QW9A 4FAMA 3W7DA 3KRBA 4GJ1A 4A3RA 5EMUA 2W0UA 3RM8A 3NZ1A 3DOPA 2HNEA 1SZFA 3C52A 2X42A 4OOZA 1G1YA 4XAZA 4US6A 5A1AA 2WJEA 2YL6A 2X1IA 1JDDA 4PMJA 5CSSA 3LLFA 1D8CA 4NRRA 4LYPA 3EAUA 1WB0A 4LF1A 1KB3A 2J88A 3L12A 1EBGA 4H83A 3V5CA 4ZEPA 3CHFA 2Z25A 3ATYA 3QV6A 5BMXA 5TIMA 1XQLA 3UA4A 1IWPA 3NSMA 1MZHA 2Q09A 3WLOA 2PD9A 1EDGA 4JGDA 3QC3A 2O55A 3FJ6A 3S5NA 3LQGA 4CD5A 1XIGA 1C8VA 2DVXA 3H2OA 4J1OA 2C71A 4HVXA 4ICMA 2GSJA 3GDLA 4ZOBA 5D2WA 2EPNA 2ONEA 1W8GA 5C9ZA 3BTNA 3E5PA 4HNTA 4HHHA 2V82A 3O6CA 4MG4A 5A94A 3OYZA 3N6HA 3PN8A 4IICA 1PIGA 1F07A 2A3LA 5ABFB 2DZAA 3IUDA 4M19A 3NGJA 4EAYA 3S6OA 2XWEA 1F3XA 3W53A 3ITXA 5I02A 1C93A 3TMQA 4IPLA 5BU6A 3RX2A 4C6EA 2WZMA 4WK9A 3W7GA 1DYSA 4GC4A 2Z24A 5ECUA 3SW6A 2A85A 2XH2A 1AH4A 2OWWA 1K4GA 3S42A 3CIXA 1GOMA 1GCYA 1JD9A 5K4ZA 3E0IA 2WVSA 4BS0A 4CNPA 1UWUA 1RA5A 3FGCB 4RUBA 2OT1A 1KXHA 1FWWA 3TSDA 3UERA 2ZIDA 1QO5A 1QCWA 3BJTA 1QOQA 2DVTA 3IGSA 1HX0A 3W7CA 2WNQA 1H7XA 4Q33A 2JK2A 4ZO7A 2Y8KA 4GH3A 3BAKA 3GNPA 1YIXA 3RG6A 5HJXA 1AW2A 1BYCA 5LIYX 1R8LA 2MNRA 4FR1A 5EMKA 3PVFA 3MMUA 3NQ2A 1R9ZA 3OZPA 3KVMA 5EFFA 3TTYA 4ZO9A 3MUY1 1QOPA 3SURA 2XDFA 1QHOA 3QY8A 1W5PA 1JDFA 1WUEA 2GJLA 3ZR5A 2PD5A 3MUIA 2XIJA 3O05A 2RJHA 4FB7A 1B0IA 3P7YA 2BNJA 2NVAA 3P8IA 2X1UA 2UY3A 1XBVA 3JS3A 4TIMA 3CZJA 1LROA