2DY7A

Solution structure of the first chromodomain of yeast chd1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
81
structure length
81
Chain Sequence
QPEDFHGIDIVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHNTWETYESIGQVRGLKRLDNYCKQFIIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chromo domain protein 1
publication title Structural Polymorphism of Chromodomains in Chd1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 9
structure length 81
sequence length 81
ec nomenclature ec 3.6.1.-:
pdb deposition date 2006-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2dy7A00
1A15A 2D9UA 1B2TA 3DM1A 1JICA 3QO2A 1SDFA 2FJ2A 4X3KA 1EOTA 3FDTA 4R8IA 1S4ZA 2MPMA 1G6ZA 5CBAE 2IL8A 3KUPA 4OIKA 2VXWA 1SAPA 2L4NA 4UAIA 2EPBA 1DOMA 5COYA 2L9HA 1U4PA 1U4LA 1X32A 5E4XA 2L12A 4X3SA 2HUGA 4IUQA 1TVXA 3ONAB 1ILPA 1QNKA 1G2TA 2X69A 1F9RA 2N88A 1BNZA 1WTPA 1ESRA 4ZLTF 2FHTA 1QG7A 2KUMA 3Q6SA 2NYZD 4XDXA 1X3QA 2HCCA 4X3TA 1WTOA 4R9WA 4CJ0B 1RODA 2KEEA 3DEOA 4ZK9B 5T1IA 1AP0A 5CBEE 3GV3A 1ILQA 2K05A 4MN3A 3DEPA 1F2LA 5CORA 4IUPA 1ZXTA 1C8CA 2L11A 1KNEA 2B2UA 3IL8A 1HUNA 1BBXC 5D14A 1IKLA 1B4OA 1J9OA 1U4RA 2B2VC 3R93A 5EQ0A 1AZPA 4DN4M 1RHPA 1RTOA 2B2TC 1RJTA 4RAUC 5D65A 5CMDA 2HCIA 1B50A 1G2SA 2B2WC 2DY8A 2EE1A 1M8AA 4HCSA 4RWSC 1J8IA 1VMCA 2M2LA 3G7LA 4IUVA 5EJWA 1NCVA 1HRJA 1IL8A 3LWEA 1WVLA 1VMPA 1DONA 1MSHA 2JYOA 2XIWA 5EPLA 1PFMA 1AZQA 2NZ1D 1F9PA 1XX8A 1ML0D 2KVMA 1GUWA 1HHVA 2X6LA 1RTNA 4ZAIA 1NR4A 4RA8A 4OIJA 5E4WC 3I8ZA 1EIHA 1LV9A 1E0BA 2FMMA 2K03A 2X6GA 5EPJA 4CJ2C 1EQTA 5AFWA 1F9SA 1ICWA 4X3UA 2RSNA 4HSVA 4HAEA 2Q8TA 1JE4A 4CJ1B 1NAPA 2B2YC 1B3AA 2BDNA 4QUFA 2JP1A 2RA4A 3KBXA 4IURA 1DOLA 3TZDA 1KNAA 2NWGA 1MGSA 4IUUA 1XYIA 1X3PA 1DZ1A 1MI2A 4HEDA 5T1GA 1PDQA 3GV6A 1NR2A 1Q3LA 3MWYW 3F2UA 1MSGA 2HDMA 2SDFA 2L1BA 2DY7A 2H1EA 1EIGA 1O7YA 1PFNA 2KECA 2R3ZA 1IKMA 1CA6A 1WTQA 1HA6A 1HUMA 4ZKCB 2K04A 4IUTA 4LMQD 2B2VA 2RVLA 3I91A 2Q8RE 3SVMA 2KOLA 3HP3A 2K28A 2B2TA 2MP1A 1CM9A 4MHEA 3MTSA 3TN2A 3H91A 4ZKBB 3P7JA 1WTVA 2B2WA 1BF4A 1U4MA 2FFKB 3I90A 4QUCA 1WTRA 2FINB 1F9QA 2HDLA 4U68A 4XT3B 2KEDA 2N55A 2K01A 2K1BA 3UI2A 3FPUB 1G91A 2J7ZA 3D6WA 1SSOA 5DNFA 1O7ZA 4O42A 3I3CA 4NW2A 1BO0A 2B2UC 4XT1B 1WD1A 1HFGA 1WTXA 2EOTA 1O80A 1PFBA 2CVRA 1WD0A 3IFDA 1CA5A 3N52A 5EPKA 1EL0A 2B2YA 2MJ8A 1HFNA 1WTWA 5EKIA 2RSOA 1DOKA 2MGSA 1B53A 5JJZA 1PLFA 1QE6A
chains in the Genus database with same CATH superfamily
4X3KA 2J0TD 5IT9L 2GN5A 2PZTA 1E22A 3MVVA 3BJUA 1JORA 3TDQA 1K8OA 4HTHA 3KF8A 5HGTA 3HOUB 2A69D 1IXRA 1G2TA 5IP9H 1OXVA 5C0XH 1X3QA 2CH4W 5BN4A 2BDOA 3DXJC 3FEWX 4DV7L 1G6PA 1ZYRD 1ZKOA 1SE2A 1WCMG 2SOBA 3K80C 2JSOA 1AW7A 1HNWL 5ISRA 1JJ2A 4F8MA 4M1UB 1B4OA 1J9OA 1V1OA 1B44D 2HD3A 3MZ5A 2CW0D 4R4QA 2RCFA 4LF6Q 1K3BC 4JI5L 2LKVA 4RGOS 2UUBL 1CI3M 1DXMA 1STEA 2SNMA 3BVGA 2RQXA 5JEAJ 3E9IA 3FMCA 4ZAIA 1NR4A 1PHJA 3M4QA 1HZAA 2E2IH 4C56C 1E3PA 3CF5A 4K8IA 1S5BD 2UU9L 5I9PA 3I56A 3JC66 2NWGA 4YCVA 4H13C 4IPDA 4RG1A 4UP7A 5KYLA 3PV0A 1DJRD 1MIUA 2F0WA 2VUMB 1Y1WB 4JI4Q 5KNBA 4RHRA 1Y1VB 4QL5A 5J22A 4LF8Q 5C0XG 4TRDA 1DCZA 4LFCL 1IYUA 4KHPL 1GO3E 5C44H 2SNSA 4JI3L 5A2QL 2PQAA 2CHBD 4U68A 4XT3B 2KEDA 4PMWA 4X62Q 4C2MH 2E75C 3I4NB 3KDFA 1PZID 3VA7A 2EZVA 4JV5Q 3NTIA 1MJCA 4A3EG 1WTXA 3AB9A 4DV5Q 1PFBA 4A3KB 1CA5A 3SDZA 1UEAB 1S5FD 3A8JE 4J6HA 4GNXB 1HR0W 4DR4L 4HR7B 1DGSA 2FJ2A 2K50A 3CQZB 1I4QA 2AUJD 3GTOB 5CBAE 2RCNA 3DUZA 3Q0AA 4CKBA 1PH7A 1SYEA 1PZJD 2AMCB 1LTRD 2AHOB 1Q7YC 1SMYC 3RLFA 4V0BA 2EXDA 4ZLTF 2FHTA 3C3LA 5F2DA 2F0FA 3J81i 4OXPA 3HOXH 2WAQG 3RLOA 3T1YL 2B63G 5C4HA 3K58A 2AKWB 5G3LD 3OTOQ 1EQRA 5CYUA 2IX0A 4U673 3GTMH 1Q90A 1KTKA 1S3OA 3HOYH 1I4RA 2EYHA 1J8IA 2HCIA 3E6ZX 4HCSA 4RWSC 5JEAG 2VQFL 1J5EQ 3CCSA 1XNQL 1CHQD 3BU2A 4P71A 2H4OA 1PH9A 2OQKA 4FF1A 3GTQH 1RTNA 1R4PB 3K7UC 4RA8A 1ASYA 3I8ZA 3NE5B 1EIHA 5EPJA 5IGBA 4A93B 1WFQA 3WOFA 4S3SA 2BDNA 2RA4A 4KLKA 1TWGB 1ET6A 2EYJA 2Q2UA 2ZXRA 1QZGA 2PCFB 1O7YA 1PFNA 4P72A 3TS2A 2R3ZA 3H0GH 1CZGA 1PRTB 1N32L 5C3WA 5KEEA 5DM63 3I91A 2KCCA 3TN2A 1WTVA 5C3EB 4KY7A 1VS0A 1NE3A 4YCUA 1H9SB 3S15B 3MHBA 4OL7A 3E9HA 1GOZA 3X3NA 2NVYH 3E3XA 1PV4A 1NNXA 5I4DA 4NW2A 4JI8Q 4A3GG 1VQPA 1HZBA 1HFGA 1C4QA 1WD0A 2OTLA 5IYDG 4A3MH 5CV9A 3D31A 1Y8NB 2NN6I 2EYFA 3AEVA 4IPHA 3I70A 1BXTA 4KK7A 1IW7D 3QO2A 2F0HA 3KF6A 1GHJA 4I7AA 3MAQA 4RGMA 2O4XA 4HJAA 3H3VC 3CU7A 1SAPA 5K5PA 1EYAA 5BN5A 4B3MQ 5A2QE 2L9HA 1U4PA 1U4LA 4HSPA 3FP9A 3NBHB 2ICEC 4X3SA 3TSSA 3HFZB 1BNZA 1T5XD 4WFN3 5I2XA 2NVTB 1D5XC 3H0GG 2VY3A 4L63B 4BA1I 1TWCB 2B29A 4LAAA 3PO2H 1PTOF 3IAYA 5C4XB 1PH5A 4MN3A 4C3IB 4OELB 3PUVA 4A3CH 1EY6A 1U9RA 3KLSA 1JJCB 4UPAA 3PCOB 1Q82C 4P74A 3QWNA 5FKAC 3ZYYX 2NTSA 4V190 2JA5G 4LUVA 5K36H 4IJLA 5M3MH 4BY1B 4IUVA 4JOIA 4P73A 2CFMA 1KRSA 1TWFB 1TKWB 4NB3A 4OHJA 4DGZA 2OTJA 1GUNA 2Z1CA 3AFPA 1LABA 1RKNA 1YNJD 5M3FH 2OQ0A 3S16B 2F0SA 3STBD 2LMCB 2K52A 1XYIA 1PTOB 4PV1C 1VQAA 2LSSA 4CBVA 2A69C 3PUWA 2Z9HA 1GVPA 4GOPC 1N34Q 1Y8PB 5IWAQ 1MSGA 1VQLA 4DV2L 3FKIB 4K6LA 1IKMA 5HGQA 3S1QH 4PZ7A 1DD2A 1XMQQ 3M3YH 1ZYRC 2B2VA 1EY4A 1NTGA 1STNA 4A3DG 3K7AB 4X65Q 4GLXA 4ZKBB 2B2WA 1PRTD 4GKJQ 4JI8L 2EYMA 4EGVA 4A3CG 1CKNB 2K33A 2LXJA 1BUVT 3KLWA 1I50B 3CC7A 3ERQA 1O7ZA 5M5XB 5K36G 1CK1A 3HZXA 3BDOA 4QJFA 1SNQA 5FJ8H 2WIIB 3NTHA 3DLLA 2JA7B 4DV6Q 1OXUA 2PQEA 4FNFA 2RSOA 3H3VH 4KN4C 2CH4A 1N36L 2YU9H 3PUYA 4BY7H 3HOVH 4B3ML 4DKAC 4EX5A 4N8FA 1SDFA 1I94L 3RZOB 2F3WA 2XRQD 4PZ6A 4NXMQ 1N33L 1I3QB 4OO1H 1DOMA 5JPMC 4DR3Q 4DK0A 4DR2Q 1B9NA 3A54A 3Q23A 4JK1C 2NVXB 4XDXA 4DV1Q 4X3TA 4FF3A 1E1OA 2K6AA 5T1IA 4DNRB 3S2DB 1VQ6A 3F2CA 2MQHA 1C8CA 2ICIA 3BZCA 3JAMi 5I6YA 2JA8H 3NEMA 3F1ZA 2VNUD 2JQOA 2O5JC 3VYUA 4J15A 5JVH3 1C7YA 4LF4L 1G2SA 1SYCA 4JYAQ 1EY5A 2WP8J 1G291 5FJ8G 1MSHA 2JYOA 2KHJA 1A0IA 2RHSB 2QA4A 3MEHA 4C3JH 1EIFA 3R8BA 3PUZA 2EY6A 5E1FA 4BWGB 1IBMQ 1CTMA 3HOWG 4Y52H 4BY7G 5H1SE 3GTLB 1E0BA 2RDHA 5IGCA 4K14A 4YCWA 5IGEA 1RL2A 4FP5D 1YIJA 4A3BH 3M7NA 1K8AC 2UXDL 4IN3A 1ONLA 1DZ1A 4OO1G 1GUTA 5IYBH 1TY0A 3D4RA 4CHTB 4KI0A 3D4WA 3HKZE 2Z4HA 2KQ3A 3OYYA 4MIUA 4B3RQ 1HJPA 2JA6H 2N8NA 4L5TA 2KOLA 2BH2A 2R92B 3VA5A 1EYGA 1VQ8A 1E2WA 3ERSX 4AYBG 2YV5A 1RIPA 5AJ3Q 4A3IB 2J7ZA 2Y0SG 4DV6L 4BXXG 1B1ZA 1QCBD 1WD1A 3IFDA 1N9WA 2RHQB 5CV4A 2MJ8A 1LT6D 4ILWA 3V05A 1L1OB 1WYDA 2VXWA 1QE6A 2A1AA 1OO9B 2OEOA 4JOIC 3A55A 3T56B 4ULLA 1JICA 3A5ZB 1X3GA 1PH4A 1NMFA 3Q8DA 5DEHA 1CQFA 1HR0Q 5JAVA 4GKKL 4DV1L 2EXZA 4DV4Q 2R93H 1S5CD 3P1HA 2N88A 1H9MA 5BR8Q 5FLXL 4JI7Q 3K5LA 3E0EA 4LF7L 2FXQA 4BBRB 4JBMA 4L6TB 1TXYA 2IX3A 2JA6G 3GV3A 4DR7Q 4A3FH 1SYFA 4KY5A 3HOZH 1HPCA 4JYAL 3OW7A 1HNZQ 2K7VA 5D14A 2B2VC 1I5FA 3V96A 1DYQA 5I2YA 4A3LH 4H7BA 1F2MA 2B2WC 1KRTA 5KGUA 4HJ9A 1HRJA 1ASZA 1PFMA 3GTPH 1X55A 2EJMA 1IW7C 2E8GA 2R7ZB 1HA5A 2G9DA 4B3TQ 1V8QA 4JPBW 1JE4A 1B3AA 4GNXC 2QGQA 2J4XA 2JXMB 4IFDJ 1Z47A 4X64Q 4B3RL 1AEXA 1KLUD 1L2FA 1BOSA 4GLVB 4DUYQ 1EIGA 3HKZB 1JWMD 4Y7NB 2UUAL 4GLAC 2K04A 1HNXL 4H0LC 4L5QA 4XXEA 2QEJC 1HQMC 4MHEA 2K28A 5AJ3L 1JOOA 1CM9A 4BS9A 2E2HH 1U4MA 3SK6A 1A8VA 2XVSA 1STHA 4F7XA 2IW3A 3NTKA 1LLRD 1YHBA 4ABNA 4C3HB 1N8RC 1HXYD 4ME3A 3A8IE 1CSPA 1X3FA 3SR1A 4DK1A 1K8MA 1YBYA 2AWOA 3J7AF 4A76A 3KFUA 2DJFC 5ELDA 3I4MG 2PPBC 1EEID 3N52A 4JI6L 3EA6A 4IFDH 1BR9A 4DU9A 3GO5A 3DM1A 3SGIA 1WCMH 1GJXA 3NENA 1K0RA 1LTTD 1ENFA 3STBC 4CDDC 3RZDH 3BDCA 1Q46A 1XNRQ 3TQYA 2VUMH 3HOUG 1QILA 5EBCA 3N6RA 4DF7A 2ZTCA 1F9RA 3TZUA 4CDCC 1QUQB 2HCCA 1A3VA 4DUZQ 3T4AC 5KNCA 4KY6A 1X9NA 1PRTC 4F87A 1VQHA 5LL6X 4FXGC 2KCNA 1V9PA 1SBBB 2L5TA 1BBXC 1STYA 1IKLA 4G7HC 4RGTA 3FRPB 3I4NH 1VQEA 3KK7A 1RHPA 4DN4M 1VQ4A 2F1MA 4A3KH 4R8NA 5C0XI 1S40A 1DONA 1KDAA 1JB3A 1EEFD 3RMHA 5FLXc 1SMXA 5IYCG 1Z7TA 1EWIA 4CDEC 1TU2B 2PO4A 3VYTA 5FLXE 1SR3A 3D8GA 3CC2A 3MFYA 1NMGA 2X6LA 5LMUL 1LO5D 4L5RC 4IFDG 4CKEA 1QVFA 3S1RB 3GTOH 1VQFA 5GAGC 4FYDA 2D0PA 4Z9CB 1A2TA 2F4VL 5ELBA 4GN3B 2A68D 4HJ5A 1VQNA 3EVQA 2WB1E 4LFBQ 1CZWA 4A3EH 3TP8A 3UE1A 1Y1WG 1IBLQ 3C2PA 2VUMG 2A5HA 3CCVA 1YNXA 1Y1VG 1HZCA 3IFTA 1LTLA 3K6OA 4R4IA 1HA6A 1FNVA 3GD7A 1IHZA 1GD7A 3U4ZA 3PF4A 2MO0A 3T1HL 1D1IA 2B2TA 3Q22A 4DR1Q 3K5OA 3MTSA 2EY1A 5M5YH 4QQBX 1JC7A 4G4KA 3VR3A 3UDIA 4LFAQ 1BVSA 1JOQA 3MXNB 3BZKA 2H5XA 3PSIA 3I4NG 3S1NB 1LUZA 1PYBA 2VB2X 4G57A 3M4PA 4I65A 4MNOA 4A3KG 2CVRA 4FXDA 1RF2D 2NVQB 1BCPD 1CT1D 4WRDA 5GROA 1XMOQ 3Q24A 4A93H 2QDLA 1B2TA 2B63H 4ZUJA 5LMNL 1BKBA 1K3RA 1X54A 1TWAB 1IBKL 1GM5A 2F0DA 3DHQA 3DWPA 1KHIA 1R4QB 4APVA 3CCMA 3I73A 2IJ0A 1V1PA 4JI2L 1RDPD 4BBSB 3SEBA 3TP5A 1I6HB 5JEAH 1BBWA 1Q8IA 1ILPA 2VQEL 1VQMA 2VW9A 1Z6HA 3H09A 1FD7D 3GTGH 1AH9A 3UDXA 2MNAA 3GDEA 2BE5D 1M90C 5JOBA 2JEAI 2CCZA 2Q2TA 1LT5D 3CPFA 1EYCA 3QR8A 5CBEE 4DAPA 4GOPA 1Q8KA 2L11A 3TP6A 3M4YA 5FO9B 2C35B 1V43A 1TS4A 2A74C 3I55A 1FL0A 4H02A 5D3IB 4RAUC 2N78A 5CR3A 2EE1A 1VMCA 4GZYC 1NCVA 2GVBA 2F0OA 1FNUA 2FMCA 3AMUA 4FO2A 2EYLA 4BA2I 1MJEA 1GUWA 2KENA 5FO7B 1EY7A 5ELOA 4CJ2C 4A93G 4LF6L 4QUFA 3A5UA 3U9SA 4C1NI 1YEZA 2G5DA 3A8KE 4OWXB 3ND8A 4OWTB 4IUUA 2M9VA 2WB1B 3J7ZC 3NSWA 4A3GH 1B3QA 2NVTH 2K5VA 5IYDH 3KJPA 1TWCH 4KMUC 1EY8A 3J7AV 2OCEA 1EFID 4LFAL 3CCLA 1BDOA 2Q8IB 1PH6A 5C3EG 2MUYA 1HTPA 1C9OA 4QUCA 3RR5A 1EFWA 1E2VA 3LX0A 3I72A 1M4VA 4GS3A 1VF7A 1WOCA 1O78A 1QNUA 2ZJRA 4JI4L 4DAMA 1IL2A 5EKKA 1Q1BA 4BY1H 4LF8L 4KKUA 2PW7A 3PIPA 5C3XA 1XMOL 3NELA 2YYZA 3D3RA 4DV3Q 1ET9A 4IZ8A 4ZQ3A 2B2YA 1YJNA 1F77A 2XWBB 3URYA 2IHEA 4PNYA 1L0XB 4X62L 2Z8LA 1EOTA 1A6XA 1FGBD 1F2YA 4JCVE 5C44B 4JV5L 4IUNA 1VQKA 1CHPD 2GVAA 4DV5L 2JA5H 2UXCQ 4RCOA 1XTDA 1TVXA 2E5LQ 3OIPA 3FKIH 1QUQA 2F0LA 2EDGA 4C1NK 2A73B 3S14H 1X3EA 5DLQE 1LT4D 2M00A 3K7AH 4ODGA 5C4XG 3OIQA 4DNTB 3M7GA 4YWKA 3G6EA 2B2UA 2HT1A 1LYLA 1I50H 4M8AA 2A6ED 4DXFA 5IODA 4YHHQ 2B2TC 3NP8A 4NXNQ 4DPGA 4WORA 2PZUA 4BY1G 2E2JH 3NBIA 3S1MB 1SJHD 4DR6Q 1PYWD 4A3JB 3AYHB 2E74C 2KVMA 4XQNA 4HJ8A 3IRBA 3T51B 3B6YA 5HURA 3OTOL 3EJIA 3HOXB 2DUDA 4A3DH 2Z6BA 1A2UA 1ICWA 4NPSA 4RKLA 1L1OC 1UNSA 3UE0A 1J5EL 2EY5A 1KNAA 2Z6KC 1V1QA 3DMUA 3HOYB 2A19A 3VR5A 4R4OA 1NR2A 1YHAA 3FKIG 1PA6A 3KJOA 1VQ7A 1CA6A 3K5NA 1VF5C 1B70B 2K5NA 3GTQB 2RVLA 3SVMA 5GQOA 4RGNA 2B8GA 2QCPX 1YHQA 4HCEA 3SHLA 2N49A 2I07B 2AQ2B 1P16A 4L5SA 2LY7A 5EKLA 4DNIA 3GTKH 4LF5Q 2HIXA 4KJOA 2JA7G 1K83H 5EKIA 1Q86C 3NWTA 2XRSD 1OXSC 3P75A 1KD1C 2VZAA 3BZDB 2ZTEA 1S5DD 1AE3A 5NUCA 3F8TA 5JVG3 1S4ZA 2E5LL 2IL8A 3FPPA 3KUPA 2A68C 1S72A 4K2KA 2EPBA 3ER0A 3W5OA 2NVYB 3S17B 2KUMA 4IALA 4A3MB 3H3VI 3OMGA 3K57A 1WTOA 2ZTDA 1TWHH 1SYBA 4GNXA 3HOWH 5CV6A 1ILQA 3EQLC 3BYTB 3S24A 4JG2A 4YY3Q 3NQTA 1QJOA 3IL8A 1HUNA 3NXWA 1FYCA 4OO1I 2O5IC 4K2LA 4A3IH 1U4RA 2RBMA 4IPGA 2BCOA 1JB7A 3J80i 4DV0Q 4N9PA 1IYJB 1K8GA 1IL8A 1LM0A 5C6AA 3FHWA 3U9OA 2F0KA 2F0UA 3BYYB 1AZQA 1BCPC 4IQZA 1UAPA 3PO2B 1B9MA 4OIJA 1ENCA 2CQAA 4JI0Q 3AQQA 2TMPA 3CAMA 3A7AB 4TKOB 5CGKA 3RN2A 2YTYA 2UUCQ 2RSNA 2IHFA 2B2YC 1SXTA 2JP1A 1Q81C 1QB5D 3QIAA 4O1NA 3KOJA 1DOLA 1TY2A 1K9MC 2Y0SE 4HN7A 4BXXH 2KHSA 2DN8A 2HQLA 5M3MB 2F4IA 2H1EA 1PYSB 3TREA 4DFAA 5IGDA 4RFBA 2BE5C 4ZKCB 3I2ZA 3S9WA 4DAYB 4MTKA 2Q8RE 2R92G 1UWVA 3H91A 5ELFA 5M3FB 3CP0A 3MC0B 4YIJA 2G9HD 2R7DA 1GUGA 2K32A 4EQ5A 1EQVA 1F9QA 3F2DA 1N34L 2EJFC 5IWAL 5JJKA 4MZ9A 2WINB 4CDFC 2HQEA 3UDGA 1W2BA 1JWSD 1TR5A 4A3IG 3PIOA 3KF8B 1GKHA 5GAHC 1XMQL 1TS2A 3CPWA 1W6KA 2B2UC 2KJXA 3L9AX 3QB3A 4X65L 2L15A 1PTOD 3D0FA 3QJYA 4GKJL 3M3YB 2ID0A 4IPCA 4QCLA 5JJZA 4ALPA 2QEXA 2D9UA 2ES2A 4NP5A 1I6VC 1L0WA 4NMZA 2NZHA 3C1FA 1H9SA 1BQQT 3A74A 3S2HH 1WI5A 2PI2A 1SROA 2DGYA 1QNKA 2QF7A 3CHBD 2DNEA 4KKSA 1WTPA 4Y7NH 2NYZD 4BBRG 3CXCA 4YY3L 2OXPA 3I4LA 4R9WA 1VQBA 3T13A 4NXML 3DEOA 4OX9Q 2YU9B 4JI1Q 3HOVB 1S5ED 4I7ZC 1F2LA 4HIKA 1SLJA 3ICEA 1KNEA 4TSSA 4DR3L 1SE4A 1EZ6A 4DR2L 5M5WB 1D1KA 1QVCA 3J81c 5CMDA 3NBHA 1RJTA 1C48A 1D5ZC 1EYDA 2AWNA 3RN5A 3J81E 4HJ7A 1M8AA 1WVLA 1STBA 1QWYA 2UUCL 5LL6S 1XX8A 4FF4A 2CKZB 4KHZA 2R7ZG 5KRUA 1LV9A 1OTCA 3BS1A 1F9SA 3KYHC 1MD2D 4HAEA 4CJ1B 2ZM6Q 1NAPA 3CW2C 2UXBQ 2PQAB 2ZJPA 2JA8B 2KCTA 1WTHA 2F0NA 3TZDA 5GAEC 3FVQA 5T1GA 3EIVA 3BDLA 4K5VA 3KDFB 3H94A 2BH8A 4UHVA 2F0GA 4E6IA 1IBML 3HKZG 4RH6A 3I4MH 3M4OH 2F3VA 1MHWC 1TQOA 4FDBA 4C3JB 1KABA 4LWCA 1FJGQ 3HP3A 3VYSA 3AFQA 4XYOA 3L7ZC 3MFGA 1NSNS 2ALYB 2HDLA 4HMJA 4K6DA 4C3HG 2A6EC 1VQJA 1SYDA 4A3BB 3F2BA 2K1BA 1BBUA 3FPUB 2JA9A 1AE2A 1G91A 2NTTA 1W3SA 3J7YW 3HOUH 4FVMA 2SEBD 3M9BA 4Q5VA 3HG9A 1EY9A 2DNCA 1STGA 1WTWA 5C4JB 1G51A 4K8JA 5J1ZA 5IP7G 3I90A 2JA6B 1XPRA 3S1RH 3W2DA 3J81j 2BA1A 1XPOA 2F0TA 4DV7Q 2BOSA 3R3OA 4OIKA 1G6ZA 1CKNA 1H9RA 4QGUA 3U4VA 3CD6A 1PH2A 3QOJA 1K73C 5E4XA 2L12A 1A3UA 1STAA 1HNWQ 5BN3A 3CMEA 1KDBA 3GTJB 2P5ZX 1D2BA 4JC0A 1LACA 3QG1A 1JR0D 5IYCH 4IFDI 4JI5Q 4CJ0B 1RODA 2KEEA 1HZ9A 1UUPA 1HR0L 1D6EC 2BA0A 2LFNA 2QW7A 3PO3B 2UUBQ 4XQJA 1E1TA 1ZXTA 4DV4L 1II3A 2VS1A 1UE7A 5BR8L 4JI7L 2RKSA 1SEBD 2R93B 1TS3A 2UU9Q 1Y1WH 1WJJA 1LTID 1Y1VH 2XIWA 1M1KC 4DR7L 1XJVA 1EWHA 3MXPA 3J7A5 3PIP3 2JEBI 3CMAA 2NZOA 1HNZL 1TWAH 4A3FB 3TBIB 2AQ3B 1I4PA 3ND9A 3H6MA 3HOZB 4JVZA 2YTXA 4LFCQ 5G3LF 3RUZA 2WKDA 4IURA 4BBSH 5FLMH 4UP9A 1YI2A 3C46A 4IOAA 5DM73 2WACA 3MWYW 1CUKA 3F2UA 1FJGL 4KN7C 3M85A 2KA7A 4B3TL 1JJGA 1O7LA 1EY0A 1O7IA 2C5CA 2OF1A 4KTAA 1CQVA 1BF4A 2ASBA 4LJZC 2K5DA 3CQZH 3KF6B 2FINB 1CSQA 4X64L 4DR4Q 4K0KQ 4DUYL 2MFIA 3UI2A 4JBKA 1E2ZA 1QZHA 1BO0A 1AN8A 1IZ6A 1SNDA 1JWUD 4G7OC 4KD3A 3SE0A 1OXTA 2MHVA 3OPOA 4ME5A 3I4OA 2LXKA 3G6JB 4QF4A 2F0JA 2E2HB 3RD4A 4P75A 2MPMA 3T16A 5KIXA 1PH1A 4YWLA 2L4NA 3T1YQ 1KQSA 1H95A 2EVBA 4BBSG 4DAVA 5C5MA 1X32A 1SFOB 3L0OA 5FLMG 3ONAB 2DJGC 4RMFA 2X69A 4X66Q 1GHKA 5E7NA 3SK4A 2HIVA 2VQFQ 1R9TB 3J80c 1XNQQ 1L1OA 3DWAA 2F0QA 3CRLC 4B08A 5JJLA 1CKOA 1YJWA 1D5MC 3J80E 3K0XA 2WAQE 3W1BA 1AP0A 2Z6KA 1WCMB 5D3DA 5JJIA 4IUPA 3O13A 2YTVA 1XNRL 2O2LD 2NUCA 1TWGH 4R4TA 3RZDB 5EQ0A 1RTOA 5CV7A 4LUZA 1X6OA 1SNCA 1E7ZA 2NB0A 4DUZL 3HKSA 1VMPA 2KCMA 4H44C 4PQXA 5E3FA 5EPLA 5TSSA 3V2TA 5IP9G 3JAMc 2Q2IA 3KLSX 1CKMA 1PTOC 1QOHA 3OWFA 3JAME 3CC4A 1A63A 5IGFA 1PH3A 3HS0C 5C3EH 2FMMA 2PNRC 1EQTA 1N32Q 2PMZE 1KLGD 2F0IA 4MTNA 4TVAB 4PG3A 3S15H 1FNWA 1SE8A 2Z4IA 5LHY1 1X3PA 2WB1G 1MI2A 2PI2E 3GV6A 5J39A 3RLNA 5C4ZA 1TS5A 2HDMA 1LTBD 1WTQA 2EY2A 3U58A 4LNQA 1T9HA 3UDFA 1E24A 4XIGS 2PW5A 1D8LA 3BVMA 4K0KL 3D4DA 4LF9Q 2AUKA 1HTLD 2C9OA 4OEMB 4J8QA 3CCUA 4FXKC 4LFBL 1PVOA 1IBLL 2PNHA 1JQYD 3PGZA 3EN2A 2A6HD 4N8X1 4X6AH 3OWEB 1SSOA 3I3CA 5FK9C 2OT2A 3S1MH 4A3EB 2K75A 3K81C 3VR6A 2EOTA 4TQUS 4A3JH 2EQSA 3ZJYC 1VDZA 4NKLA 4DR1L 1EL0A 1P8LA 5ELEA 3G71A 4J1MA 1PLFA 5C4XH 4QIWE 5M5YB 4C3IH 4R8IA 3CKIB 5C44G 2E2IB 2E2DC 5IT9c 2V1CC 4X66L 4OGQC 1PRTF 4OWWB 1EIYB 5IT9E 1YJ9A 5COYA 3OW2A 3A56A 1YNND 3WOEA 2ENBA 4IUQA 3EROA 2HHHQ 1Q12A 3A0JA 4DXGA 1K28A 1PZKD 1TWFH 4HIOA 2XNAC 3WWVA 1PMRA 3CCRA 1Q1EA 2WAQB 4EQNA 2B63B 3L2PA 2RF4A 4QMGA 3S16H 5CORA 1FR3A 1T5EA 1ESFA 4KD4A 4ZRZA 1PTOH 1A62A 2N3SA 4C2MB 2M2LA 3G7LA 4DR5Q 3PIO3 3TRZA 3GTGB 4A3JG 1F9PA 5GADC 1SYGA 4K5XA 3BG3A 3CRKC 4DV2Q 5IGGA 1HHVA 3HOXG 4XTCS 5AFWA 1TIID 4DA2A 1I4HA 2PMZB 4X3UA 4HSVA 4C3IG 2R7FA 2XTIA 1C0AA 3D6CA 1EUJA 5L37A 3HOYG 1NBWA 5M5XH 3S17H 3C1EA 4R1JA 1Q3LA 2L55A 1J6QA 3U50C 2L1BA 2QILA 4LF9L 4LUOA 5IY0A 1KAWA 1RD9D 3CCJA 2JA7H 4UDUC 2F3IA 4JW0A 1QVGA 3CCQA 4Q0FA 2ATWA 2NN6H 2ZT9C 1Y8OB 4HIMA 3RZOH 3WDNA 3P7JA 5LMNW 1B7YB 1HH2P 2FFKB 1F2ZA 1WTRA 1N36Q 1I3QH 3TMEA 2K5HA 3T53B 3NHHA 2K01A 1I94Q 3GTMB 3D6WA 5ELCA 1YITA 2I5LX 4A75A 2WFWA 1N33Q 4A3GB 1LT3D 2NVXH 2IY5B 4O0AA 1GUOA 2JK8A 1JOKA 1XXGA 5CC4A 2RDGA 3ULLA 1GUSA 1B53A 5CV8A 3S2DH 1LTGD 3KBGA 2I5HA 3SK8A 4QIWB 4RCNA 3OHXC 5IE8A 1MKHA 1U0LA 3FDTA 2IPKD 2PZWA 3MXNA 1EOVA 5EGTA 2HHHL 3H15A 1DM0B 4DV3L 1KC8C 4LK1C 3PQIA 1ICFB 1VQGA 4ZYSA 4LF4Q 4A3MG 1EQQA 3H0GB 4KKTA 2JN4A 4ZK9B 1SNOA 3GTLH 2NN6G 2CWAA 1W6JA 3R2TA 2K05A 1SJED 4B9XA 2UXCL 3E5SA 3TP7A 1JT8A 4F88A 2LS01 4DR5L 1VQOA 3R93A 3J81L 4DK3C 1ENAA 1LTAD 1AZPA 3QOLA 2JA5B 4UY8C 2XSCA 2D2CC 2UXDQ 2K14A 3PF5A 1NJIC 4QB4A 3I7FA 3S14B 1I4XA 1ML0D 4LW1A 3X3MA 3PO2G 2R92H 5E4WC 1G8ZD 1FGUA 3NWSA 5CV5A 2K03A 4EQOA 4YHHL 2EYPA 4NXNL 3VYRA 2B3GA 1UE6A 1K0SA 4WJ3M 2CW0C 4B9WA 1JCKB 2V4DA 4HEDA 4DR6L 1SE3A 5M3MG 4ZCKA 1H9KA 4B3SQ 1I4GA 3W3AA 3VDYA 2E2JB 4WJWA 1HUMA 1VQ9A 4IUTA 2L0CA 3NUCA 2D62A 3TS0A 5EAYA 2F0PA 4YWMA 4A3DB 1H9JA 5M3FG 5M5WH 3L3OC 4L8JA 5JPNC 1GXDC 2N55A 4AYBE 3CCEA 3G4SA 1UEBA 5DNFA 2F0EA 4IO9A 1YVCA 3ULPA 1SNPA 4GKKQ 2IX1A 3MA2B 1O80A 2A8VA 3EBEA 2NBFA 4BBRH 1HFNA 1MBYA 4P2CB 4O2DA 2WV6D 5EBDA 1A15A 1YZ6A 4HMIA 4LF7Q 2TSSA 3RNUA 2KHIA 1JE5A 3MEFA 4AH6A 4LF5L 4UAIA 4WJ4A 3P20A 2K5WA 1KDCA 4KHVA 4ZUIA 3GTKB 4XYQA 3HGBA 3K59A 2XN9C 1K83B 3S1QB 1L0YB 1SN8A 3TEHB 2R7ZH 2ZXOA 5KYIA 4UP8A 3HOVG 1FVIA 1PH8A 1NY4A 3DM3A 4PZ8A 2A6HC 3HEJA 4GN4B 4GN5A 1EZ8A 1LTSD 2GA4B 5D65A 1Z9FA 1CFMA 3OOCA 1NUCA 2CQOA 2RDFA 3OSOA 5I9OA 5C4JH 2NZ1D 5FOBB 2Z0SA 4RKBA 1OXXK 2D0OA 1TWHB 4JBWA 3HOWB 4BY7B 2UUAQ 5DAUA 4ID6A 2Q8TA 1HNXQ 3VR4A 4C3HH 4B3SL 4DV0L 1Y14B 3BVZA 5M9OA 2JA8G 3KBXA 2VB3X 3K0YA 3E0JA 2I46A 1MGSA 1YNNC 3HRZC 1PDQA 3GTJH 2EYOA 3NQIA 1SMYD 2SDFA 3PUXA 4POFA 2CWPA 2DY7A 3AU7A 1Y69U 5IIFA 2B39A 4JI0L 2KBNA 4FF2A 4C3JG 2QDBA 3K8AA 4LMQD 3PO3H 1JMCA 2EJGC 5IP7H 1EU3A 2XGTA 2F0VA 1D7QA 4R4CA 4JI6Q 3W1GA 3OMCA 4A3BG 1XWEA 2E76C 3PMFA 4AYBB 3MXUA 3R2IA 1V1PB 2Y0SB 4G7ZC 5IYBG 2F52A 2I0QA 1UE1A 4XT1B 2Q2HA 3G48A 3K5MA 4EVOA 4AQYQ 4OONA 4A4IA 1SRUA 1DOKA 2MGSA 2MO1A 5J3BA 4AIMA 3NK9A 3ITPA 4RHSA 4JBJA 4GOPB 2OWOA 3LNNA 1B8AA 2EIFA 1VQDA 2D5DA 4KJNA 2HUGA 1ESRA 3Q6SA 1QG7A 3SK5A 2F03A 5KNDA 1UE5A 3J80L 3KLRA 3IKJA 3A7LA 1ZEQX 1VCIA 4NDXA 3PO3G 1BCPF 3ULJA 5A35A 3DEPA 2AQ1B 1TT2A 1XPUA 5LMUQ 5HY6A 3S2HB 1IYVA 2ZJQA 3LGJA 1B50A 2DY8A 2R93G 2F4VQ 5EJWA 2R61A 4PMBA 1KIXA 3LWEA 4OX9L 1U5KA 3JAML 1PXUA 2JE6I 4JI1L 2VL6A 5ELNA 1A3TA 4IOCA 4IJHA 2WKCA 1KAAA 2JJQA 2K5QA 2X6GA 4A3FG 4EQPA 3HOZG 4K5WA 4POGA 2ZXPA 1EU4A 3SXHA 3MXGA 1RCVD 3NPPA 3T1HQ 2R6GA 1SFOH 2I5MX 1VQCA 1BCPB 3S1NH 2F0MA 4A3LG 1KL9A 2IWHA 4KV6A 5C5LA 2XWJB 3DWQA 2K4KA 4DK6C 4CGYB 2KECA 1AFPA 2NVQH 1R9TH 4HIDA 1HQRD 2ZM6L 1HCZA 1XTCD 2UXBL 1YNJC 3VR2A 3GQBA 2MP1A 5IOCA 1KXLA 1PFSA 2B8FA 5C0XJ 3GP7A 3EFXD 2PYKA 5LMNQ 1X65A 2QKIC 4KHPQ 5I6WA 4AQYL 1SNMA 2IT1A 1I6HH 1IBKQ 1EWCA 4O42A 4JI3Q 4CKCA 5FO8B 4QY7A 4N9TA 1X56A 3I4MB 4JI2Q 3M4OB 5EPKA 4XQQA 3LWUA 1VQIA 2VQEQ 1VQ5A 4DAYA 3GTPB 4PMCA
chains in the Genus database with same CATH topology
4X3KA 2J0TD 5IT9L 2PZTA 3MVVA 1JORA 3TDQA 1K8OA 4HTHA 3KF8A 5HGTA 3HOUB 2A69D 1G2TA 1OXVA 5C0XH 1X3QA 5BN4A 2BDOA 3DXJC 3FEWX 1ZYRD 1ZKOA 1SE2A 2SOBA 2JSOA 1AW7A 5ISRA 4F8MA 4M1UB 1B4OA 1J9OA 1V1OA 1B44D 3MZ5A 2CW0D 2LKVA 4RGOS 1CI3M 1DXMA 1STEA 2SNMA 3BVGA 2RQXA 5JEAJ 3FMCA 4ZAIA 1NR4A 4C56C 4K8IA 1S5BD 5I9PA 2NWGA 4H13C 5KYLA 3PV0A 1DJRD 2F0WA 2VUMB 1Y1WB 5KNBA 4RHRA 1Y1VB 5J22A 5C0XG 4TRDA 1DCZA 1IYUA 2SNSA 5A2QL 2CHBD 4U68A 4XT3B 2KEDA 4PMWA 2E75C 3I4NB 1PZID 3VA7A 2EZVA 3NTIA 1WTXA 3AB9A 1PFBA 4A3KB 1CA5A 3SDZA 1UEAB 1S5FD 3A8JE 4J6HA 4HR7B 2FJ2A 3CQZB 1I4QA 2AUJD 3GTOB 5CBAE 3DUZA 3Q0AA 4CKBA 1SYEA 1PZJD 1LTRD 1SMYC 3RLFA 4V0BA 4ZLTF 2FHTA 3C3LA 5F2DA 2F0FA 5C4HA 3K58A 5G3LD 5CYUA 2IX0A 4U673 1Q90A 1KTKA 1I4RA 2EYHA 1J8IA 2HCIA 3E6ZX 4HCSA 4RWSC 5JEAG 1CHQD 2H4OA 4FF1A 1RTNA 1R4PB 4RA8A 3I8ZA 3NE5B 1EIHA 5EPJA 5IGBA 4A93B 3WOFA 4S3SA 2BDNA 2RA4A 1TWGB 1ET6A 2EYJA 2ZXRA 2PCFB 1O7YA 1PFNA 2R3ZA 1CZGA 1PRTB 5C3WA 5KEEA 5DM63 3I91A 2KCCA 3TN2A 1WTVA 5C3EB 4KY7A 1H9SB 3S15B 3MHBA 4OL7A 1GOZA 3X3NA 5I4DA 4NW2A 1HFGA 1C4QA 1WD0A 5CV9A 3D31A 1Y8NB 2NN6I 2EYFA 3I70A 1BXTA 4KK7A 1IW7D 3QO2A 2F0HA 1GHJA 3MAQA 4RGMA 2O4XA 3H3VC 3CU7A 1SAPA 5K5PA 1EYAA 5BN5A 5A2QE 2L9HA 1U4PA 1U4LA 4HSPA 2ICEC 4X3SA 3TSSA 1BNZA 1T5XD 4WFN3 5I2XA 2NVTB 1D5XC 4L63B 4BA1I 1TWCB 4LAAA 1PTOF 3IAYA 5C4XB 4MN3A 4C3IB 3PUVA 1EY6A 1U9RA 3KLSA 3QWNA 5FKAC 3ZYYX 2NTSA 4V190 5K36H 4BY1B 4IUVA 1TWFB 1TKWB 4OHJA 4DGZA 1GUNA 2Z1CA 1LABA 1RKNA 1YNJD 3S16B 2F0SA 2LMCB 1XYIA 1PTOB 4PV1C 4CBVA 2A69C 3PUWA 1Y8PB 1MSGA 3FKIB 4K6LA 1IKMA 1DD2A 1ZYRC 2B2VA 1EY4A 1STNA 3K7AB 4ZKBB 2B2WA 1PRTD 2EYMA 4EGVA 2K33A 1BUVT 1I50B 3ERQA 1O7ZA 5M5XB 5K36G 1CK1A 3HZXA 3BDOA 1SNQA 2WIIB 3NTHA 2JA7B 1OXUA 2PQEA 4FNFA 2RSOA 4KN4C 3PUYA 1SDFA 3RZOB 2F3WA 2XRQD 1I3QB 4OO1H 1DOMA 5JPMC 4DK0A 1B9NA 3A54A 3Q23A 4JK1C 2NVXB 4XDXA 4X3TA 4FF3A 2K6AA 5T1IA 4DNRB 3S2DB 1C8CA 2ICIA 5I6YA 2VNUD 2O5JC 3VYUA 5JVH3 1G2SA 1SYCA 1EY5A 2WP8J 1G291 1MSHA 2JYOA 3MEHA 3R8BA 3PUZA 2EY6A 5E1FA 4BWGB 1CTMA 3GTLB 1E0BA 2RDHA 5IGCA 4K14A 5IGEA 4FP5D 3M7NA 4IN3A 1ONLA 1DZ1A 4OO1G 1GUTA 1TY0A 3D4RA 4CHTB 4KI0A 3D4WA 2Z4HA 2KQ3A 4MIUA 2KOLA 2R92B 3VA5A 1E2WA 4A3IB 2J7ZA 1B1ZA 1QCBD 1WD1A 3IFDA 5CV4A 2MJ8A 1LT6D 4ILWA 3V05A 2VXWA 1QE6A 1OO9B 2OEOA 3A55A 3T56B 4ULLA 1JICA 5DEHA 1CQFA 5JAVA 2EXZA 1S5CD 3P1HA 2N88A 1H9MA 5FLXL 3K5LA 4BBRB 4L6TB 2IX3A 3GV3A 1SYFA 4KY5A 1HPCA 3OW7A 2K7VA 5D14A 2B2VC 3V96A 1DYQA 5I2YA 4H7BA 1F2MA 2B2WC 5KGUA 1HRJA 1PFMA 2EJMA 1IW7C 2R7ZB 1HA5A 2G9DA 1V8QA 1JE4A 1B3AA 2J4XA 2JXMB 4IFDJ 1Z47A 1AEXA 1KLUD 1BOSA 1EIGA 3HKZB 1JWMD 4Y7NB 2K04A 4H0LC 4XXEA 2QEJC 1HQMC 4MHEA 2K28A 1JOOA 1CM9A 4BS9A 1U4MA 3SK6A 2XVSA 1STHA 4F7XA 2IW3A 3NTKA 1LLRD 4C3HB 4ABNA 1HXYD 3A8IE 3SR1A 4DK1A 1K8MA 3J7AF 2AWOA 5ELDA 2PPBC 1EEID 3N52A 3EA6A 4IFDH 1BR9A 4DU9A 3GO5A 3DM1A 1GJXA 1LTTD 1ENFA 3BDCA 1QILA 5EBCA 3N6RA 4DF7A 1F9RA 3TZUA 2HCCA 1A3VA 3T4AC 5KNCA 4KY6A 1PRTC 4F87A 5LL6X 4FXGC 2KCNA 1SBBB 2L5TA 1BBXC 1STYA 1IKLA 4G7HC 4RGTA 3FRPB 3KK7A 1RHPA 4DN4M 2F1MA 4R8NA 5C0XI 1DONA 1KDAA 1JB3A 1EEFD 3RMHA 1Z7TA 5FLXE 1TU2B 2PO4A 3VYTA 3D8GA 3MFYA 2X6LA 1LO5D 4IFDG 4CKEA 3S1RB 4FYDA 4Z9CB 1A2TA 5ELBA 2A68D 3EVQA 1CZWA 3TP8A 3C2PA 2A5HA 3IFTA 3K6OA 1HA6A 1FNVA 3GD7A 1IHZA 1D1IA 2B2TA 3Q22A 3K5OA 3MTSA 2EY1A 1JC7A 4G4KA 3VR3A 1JOQA 3S1NB 2VB2X 4G57A 4I65A 2CVRA 4FXDA 1RF2D 2NVQB 1BCPD 1CT1D 4WRDA 3Q24A 1B2TA 4ZUJA 1TWAB 2F0DA 3DHQA 3DWPA 1R4QB 3I73A 2IJ0A 1V1PA 1RDPD 4BBSB 3TP5A 3SEBA 1I6HB 5JEAH 1Q8IA 1ILPA 1Z6HA 3H09A 1FD7D 2BE5D 2JEAI 5JOBA 1LT5D 1EYCA 5CBEE 4DAPA 2L11A 3TP6A 3M4YA 5FO9B 1V43A 1TS4A 2A74C 5D3IB 4RAUC 5CR3A 2EE1A 1VMCA 4GZYC 1NCVA 2F0OA 1FNUA 2FMCA 3AMUA 4FO2A 2EYLA 4BA2I 1GUWA 5FO7B 1EY7A 4CJ2C 4QUFA 3U9SA 4C1NI 3A8KE 3ND8A 4IUUA 2M9VA 2WB1B 3NSWA 4KMUC 1EY8A 3J7AV 1EFID 1BDOA 2Q8IB 2MUYA 1HTPA 4QUCA 1E2VA 3LX0A 3I72A 1M4VA 1VF7A 1O78A 1QNUA 5EKKA 1Q1BA 4KKUA 2PW7A 5C3XA 2YYZA 3D3RA 1ET9A 4IZ8A 4ZQ3A 2B2YA 1F77A 2XWBB 3URYA 4PNYA 1L0XB 2Z8LA 1EOTA 1A6XA 1FGBD 1F2YA 5C44B 4IUNA 1CHPD 4RCOA 1TVXA 3OIPA 2F0LA 2EDGA 4C1NK 2A73B 1LT4D 2M00A 4ODGA 3OIQA 4DNTB 3M7GA 2B2UA 4M8AA 2A6ED 4DXFA 5IODA 2B2TC 3NP8A 4WORA 2PZUA 3NBIA 3S1MB 1SJHD 1PYWD 4A3JB 2E74C 2KVMA 4XQNA 3T51B 5HURA 3EJIA 3HOXB 1A2UA 1ICWA 4RKLA 1UNSA 2EY5A 1KNAA 3DMUA 3HOYB 3VR5A 1NR2A 1CA6A 3K5NA 1VF5C 3GTQB 2RVLA 3SVMA 4RGNA 2B8GA 2QCPX 4HCEA 3SHLA 2I07B 2AQ2B 2LY7A 5EKLA 4KJOA 5EKIA 3NWTA 2XRSD 1OXSC 3P75A 3BZDB 1S5DD 5NUCA 5JVG3 1S4ZA 2IL8A 3FPPA 3KUPA 2A68C 4K2KA 2EPBA 2NVYB 3S17B 2KUMA 4IALA 4A3MB 3OMGA 3K57A 1WTOA 1SYBA 5CV6A 1ILQA 3EQLC 3BYTB 3NQTA 1QJOA 3IL8A 1HUNA 3NXWA 1FYCA 4OO1I 2O5IC 4K2LA 1U4RA 2RBMA 2BCOA 4N9PA 1IL8A 5C6AA 3U9OA 2F0KA 2F0UA 3BYYB 1AZQA 1BCPC 4IQZA 1UAPA 3PO2B 1B9MA 4OIJA 1ENCA 2CQAA 2TMPA 4TKOB 3A7AB 5CGKA 2RSNA 2B2YC 1SXTA 2JP1A 1QB5D 3QIAA 4O1NA 1DOLA 1TY2A 4HN7A 2KHSA 2DN8A 5M3MB 2F4IA 2H1EA 4DFAA 5IGDA 4RFBA 2BE5C 4ZKCB 3S9WA 2Q8RE 3H91A 5ELFA 5M3FB 3MC0B 4YIJA 2G9HD 1GUGA 2K32A 1EQVA 1F9QA 2EJFC 2WINB 2HQEA 1JWSD 1TR5A 1TS2A 1W6KA 2B2UC 2KJXA 3L9AX 3QB3A 1PTOD 3QJYA 3M3YB 2ID0A 4QCLA 5JJZA 2D9UA 4NP5A 1I6VC 4NMZA 3C1FA 1H9SA 1BQQT 1QNKA 2QF7A 3CHBD 2DNEA 4KKSA 1WTPA 2NYZD 2OXPA 3I4LA 4R9WA 3T13A 3DEOA 2YU9B 3HOVB 1S5ED 4I7ZC 1F2LA 1KNEA 4TSSA 1SE4A 1EZ6A 5M5WB 1D1KA 5CMDA 3NBHA 1RJTA 1C48A 1D5ZC 1EYDA 2AWNA 3J81E 1M8AA 1WVLA 1STBA 1QWYA 5LL6S 1XX8A 4FF4A 4KHZA 5KRUA 1LV9A 3BS1A 1F9SA 1MD2D 4HAEA 4CJ1B 1NAPA 2JA8B 2F0NA 3TZDA 3FVQA 5T1GA 3BDLA 4K5VA 3H94A 4E6IA 2F0GA 4RH6A 2F3VA 1TQOA 4C3JB 1KABA 3HP3A 3VYSA 4XYOA 3L7ZC 3MFGA 1NSNS 4HMJA 2HDLA 4C3HG 4K6DA 4A3BB 2A6EC 1SYDA 2K1BA 3FPUB 1G91A 2NTTA 3J7YW 4FVMA 2SEBD 4Q5VA 3HG9A 1EY9A 2DNCA 1STGA 1WTWA 5C4JB 4K8JA 5J1ZA 2JA6B 3I90A 3W2DA 2BA1A 2F0TA 2BOSA 3R3OA 4OIKA 1G6ZA 1H9RA 3QOJA 5E4XA 2L12A 1A3UA 1STAA 5BN3A 1KDBA 3GTJB 1D2BA 1LACA 3QG1A 1JR0D 4IFDI 4CJ0B 1RODA 2KEEA 1UUPA 1D6EC 2BA0A 2LFNA 3PO3B 4XQJA 1ZXTA 1II3A 2RKSA 1SEBD 2R93B 1TS3A 1LTID 2XIWA 1EWHA 3MXPA 3PIP3 2JEBI 4A3FB 3TBIB 2AQ3B 1I4PA 3ND9A 3H6MA 3HOZB 5G3LF 3RUZA 2WKDA 4IURA 3C46A 5DM73 2WACA 3MWYW 3F2UA 4KN7C 3M85A 2KA7A 1O7LA 1EY0A 2C5CA 2OF1A 4KTAA 1CQVA 1BF4A 4LJZC 2K5DA 2FINB 3UI2A 1E2ZA 1BO0A 1AN8A 1SNDA 1JWUD 4G7OC 4KD3A 3SE0A 1OXTA 2MHVA 3OPOA 4ME5A 4QF4A 3G6JB 2F0JA 2E2HB 3RD4A 2MPMA 3T16A 5KIXA 2L4NA 2EVBA 4DAVA 5C5MA 1X32A 1SFOB 3ONAB 1GHKA 2X69A 3SK4A 1R9TB 3DWAA 2F0QA 3CRLC 4B08A 1D5MC 3J80E 1AP0A 1WCMB 5D3DA 4IUPA 3O13A 2O2LD 2NUCA 3RZDB 5EQ0A 1RTOA 5CV7A 1SNCA 2NB0A 5TSSA 1VMPA 4H44C 4PQXA 3V2TA 5E3FA 5EPLA 3KLSX 1QOHA 1PTOC 3OWFA 3JAME 5IGFA 3HS0C 2FMMA 2PNRC 1EQTA 1KLGD 2F0IA 1FNWA 2Z4IA 5LHY1 1X3PA 1MI2A 3GV6A 5J39A 5C4ZA 1TS5A 2HDMA 1LTBD 1WTQA 2EY2A 4XIGS 2PW5A 3BVMA 3D4DA 2AUKA 1HTLD 2C9OA 4J8QA 4FXKC 1JQYD 2A6HD 3OWEB 1SSOA 3I3CA 5FK9C 2OT2A 4A3EB 3VR6A 2EOTA 4TQUS 1VDZA 4NKLA 1EL0A 5ELEA 4J1MA 1PLFA 5M5YB 4R8IA 3CKIB 2E2IB 2E2DC 4OGQC 1PRTF 5IT9E 5COYA 3A56A 1YNND 3WOEA 2ENBA 4IUQA 3EROA 1Q12A 4DXGA 1PZKD 2XNAC 1PMRA 1Q1EA 2WAQB 4EQNA 2B63B 4QMGA 5CORA 1FR3A 1T5EA 1ESFA 4KD4A 4ZRZA 1PTOH 4C2MB 2M2LA 3G7LA 3PIO3 3GTGB 1F9PA 1SYGA 4K5XA 3BG3A 3CRKC 5IGGA 1HHVA 4XTCS 5AFWA 1TIID 4DA2A 1I4HA 2PMZB 4X3UA 4HSVA 4C3IG 3D6CA 3C1EA 1Q3LA 2L55A 2L1BA 2QILA 1RD9D 4UDUC 4Q0FA 2NN6H 2ZT9C 1Y8OB 3WDNA 3P7JA 2FFKB 1F2ZA 1WTRA 3TMEA 3T53B 3NHHA 2K01A 3GTMB 3D6WA 5ELCA 4A3GB 1LT3D 1GUOA 1JOKA 1XXGA 5CC4A 2RDGA 1GUSA 1B53A 5CV8A 1LTGD 3KBGA 3SK8A 4QIWB 4RCNA 3OHXC 3FDTA 2IPKD 2PZWA 3MXNA 5EGTA 1DM0B 4LK1C 4ZYSA 3H0GB 4KKTA 4ZK9B 1SNOA 2NN6G 1W6JA 3R2TA 2K05A 1SJED 4B9XA 3E5SA 3TP7A 4F88A 2LS01 3R93A 3J81L 1ENAA 1LTAD 1AZPA 3QOLA 2JA5B 2XSCA 2D2CC 4QB4A 3S14B 1I4XA 1ML0D 3X3MA 5E4WC 1G8ZD 3NWSA 5CV5A 2K03A 4EQOA 2EYPA 3VYRA 2CW0C 4B9WA 1JCKB 2V4DA 4HEDA 1SE3A 1H9KA 1I4GA 3W3AA 2E2JB 4WJWA 1HUMA 4IUTA 2L0CA 3NUCA 2D62A 2F0PA 4A3DB 1H9JA 3L3OC 4L8JA 5JPNC 1GXDC 2N55A 5DNFA 2F0EA 1SNPA 2IX1A 3MA2B 1O80A 2NBFA 1HFNA 1MBYA 4P2CB 2WV6D 5EBDA 1A15A 4HMIA 2TSSA 4UAIA 3P20A 2K5WA 1KDCA 4KHVA 4ZUIA 3GTKB 4XYQA 3HGBA 3K59A 2XN9C 1K83B 3S1QB 1L0YB 2ZXOA 5KYIA 2A6HC 3HEJA 1EZ8A 1LTSD 2GA4B 5D65A 1CFMA 3OOCA 1NUCA 2RDFA 3OSOA 5I9OA 2NZ1D 5FOBB 4RKBA 1OXXK 1TWHB 4JBWA 3HOWB 4BY7B 5DAUA 4ID6A 2Q8TA 3VR4A 3BVZA 5M9OA 3KBXA 2VB3X 3K0YA 3E0JA 2I46A 1MGSA 1YNNC 3HRZC 1PDQA 2EYOA 3NQIA 1SMYD 2SDFA 3PUXA 2DY7A 3AU7A 1Y69U 5IIFA 2B39A 4FF2A 4C3JG 2QDBA 4LMQD 2EJGC 1EU3A 2F0VA 3OMCA 1XWEA 2E76C 3PMFA 4AYBB 3MXUA 3R2IA 1V1PB 2Y0SB 4G7ZC 4XT1B 3K5MA 4EVOA 1DOKA 2MGSA 3NK9A 3ITPA 4RHSA 3LNNA 2D5DA 4KJNA 2HUGA 1ESRA 3Q6SA 1QG7A 3SK5A 2F03A 5KNDA 3J80L 3KLRA 3IKJA 3A7LA 1ZEQX 1VCIA 4NDXA 1BCPF 5A35A 3DEPA 2AQ1B 1TT2A 3S2HB 1IYVA 1B50A 2DY8A 5EJWA 2R61A 4PMBA 3LWEA 3JAML 1PXUA 2JE6I 1A3TA 2WKCA 1KAAA 2K5QA 2X6GA 4EQPA 4K5WA 2ZXPA 1EU4A 3SXHA 3MXGA 1RCVD 3NPPA 2R6GA 1BCPB 2F0MA 2IWHA 4KV6A 5C5LA 2XWJB 3DWQA 4CGYB 2KECA 1AFPA 1HQRD 1HCZA 1XTCD 1YNJC 3VR2A 3GQBA 2MP1A 5IOCA 2B8FA 5C0XJ 3GP7A 3EFXD 2PYKA 2QKIC 5I6WA 1SNMA 2IT1A 1EWCA 4O42A 4CKCA 5FO8B 4N9TA 3I4MB 3M4OB 5EPKA 4XQQA 3LWUA 4DAYA 3GTPB 4PMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A15 A;  2D9U A;  1B2T A;  3DM1 A;  1JIC A;  3QO2 A;  1SDF A;  2FJ2 A;  4X3K A;  1EOT A;  3FDT A;  4R8I A;  1S4Z A;  2MPM A;  1G6Z A;  5CBA E;  2IL8 A;  3KUP A;  4OIK A;  2VXW A;  1SAP A;  2L4N A;  4UAI A;  2EPB A;  1DOM A;  5COY A;  2L9H A;  1U4P A;  1U4L A;  1X32 A;  5E4X A;  2L12 A;  4X3S A;  2HUG A;  4IUQ A;  1TVX A;  3ONA B;  1ILP A;  1QNK A;  1G2T A;  2X69 A;  1F9R A;  2N88 A;  1BNZ A;  1WTP A;  1ESR A;  4ZLT F;  2FHT A;  1QG7 A;  2KUM A;  3Q6S A;  2NYZ D;  4XDX A;  1X3Q A;  2HCC A;  4X3T A;  1WTO A;  4R9W A;  4CJ0 B;  1ROD A;  2KEE A;  3DEO A;  4ZK9 B;  5T1I A;  1AP0 A;  5CBE E;  3GV3 A;  1ILQ A;  2K05 A;  4MN3 A;  3DEP A;  1F2L A;  5COR A;  4IUP A;  1ZXT A;  1C8C A;  2L11 A;  1KNE A;  2B2U A;  3IL8 A;  1HUN A;  1BBX C;  5D14 A;  1IKL A;  1B4O A;  1J9O A;  1U4R A;  2B2V C;  3R93 A;  5EQ0 A;  1AZP A;  4DN4 M;  1RHP A;  1RTO A;  2B2T C;  1RJT A;  4RAU C;  5D65 A;  5CMD A;  2HCI A;  1B50 A;  1G2S A;  2B2W C;  2DY8 A;  2EE1 A;  1M8A A;  4HCS A;  4RWS C;  1J8I A;  1VMC A;  2M2L A;  3G7L A;  4IUV A;  5EJW A;  1NCV A;  1HRJ A;  1IL8 A;  3LWE A;  1WVL A;  1VMP A;  1DON A;  1MSH A;  2JYO A;  2XIW A;  5EPL A;  1PFM A;  1AZQ A;  2NZ1 D;  1F9P A;  1XX8 A;  1ML0 D;  2KVM A;  1GUW A;  1HHV A;  2X6L A;  1RTN A;  4ZAI A;  1NR4 A;  4RA8 A;  4OIJ A;  5E4W C;  3I8Z A;  1EIH A;  1LV9 A;  1E0B A;  2FMM A;  2K03 A;  2X6G A;  5EPJ A;  4CJ2 C;  1EQT A;  5AFW A;  1F9S A;  1ICW A;  4X3U A;  2RSN A;  4HSV A;  4HAE A;  2Q8T A;  1JE4 A;  4CJ1 B;  1NAP A;  2B2Y C;  1B3A A;  2BDN A;  4QUF A;  2JP1 A;  2RA4 A;  3KBX A;  4IUR A;  1DOL A;  3TZD A;  1KNA A;  2NWG A;  1MGS A;  4IUU A;  1XYI A;  1X3P A;  1DZ1 A;  1MI2 A;  4HED A;  5T1G A;  1PDQ A;  3GV6 A;  1NR2 A;  1Q3L A;  3MWY W;  3F2U A;  1MSG A;  2HDM A;  2SDF A;  2L1B A;  2DY7 A;  2H1E A;  1EIG A;  1O7Y A;  1PFN A;  2KEC A;  2R3Z A;  1IKM A;  1CA6 A;  1WTQ A;  1HA6 A;  1HUM A;  4ZKC B;  2K04 A;  4IUT A;  4LMQ D;  2B2V A;  2RVL A;  3I91 A;  2Q8R E;  3SVM A;  2KOL A;  3HP3 A;  2K28 A;  2B2T A;  2MP1 A;  1CM9 A;  4MHE A;  3MTS A;  3TN2 A;  3H91 A;  4ZKB B;  3P7J A;  1WTV A;  2B2W A;  1BF4 A;  1U4M A;  2FFK B;  3I90 A;  4QUC A;  1WTR A;  2FIN B;  1F9Q A;  2HDL A;  4U68 A;  4XT3 B;  2KED A;  2N55 A;  2K01 A;  2K1B A;  3UI2 A;  3FPU B;  1G91 A;  2J7Z A;  3D6W A;  1SSO A;  5DNF A;  1O7Z A;  4O42 A;  3I3C A;  4NW2 A;  1BO0 A;  2B2U C;  4XT1 B;  1WD1 A;  1HFG A;  1WTX A;  2EOT A;  1O80 A;  1PFB A;  2CVR A;  1WD0 A;  3IFD A;  1CA5 A;  3N52 A;  5EPK A;  1EL0 A;  2B2Y A;  2MJ8 A;  1HFN A;  1WTW A;  5EKI A;  2RSO A;  1DOK A;  2MGS A;  1B53 A;  5JJZ A;  1PLF A;  1QE6 A; 
#chains in the Genus database with same CATH topology
 4X3K A;  2J0T D;  5IT9 L;  2GN5 A;  2PZT A;  1E22 A;  3MVV A;  3BJU A;  1JOR A;  3TDQ A;  1K8O A;  4HTH A;  3KF8 A;  5HGT A;  3HOU B;  2A69 D;  1IXR A;  1G2T A;  5IP9 H;  1OXV A;  5C0X H;  1X3Q A;  2CH4 W;  5BN4 A;  2BDO A;  3DXJ C;  3FEW X;  4DV7 L;  1G6P A;  1ZYR D;  1ZKO A;  1SE2 A;  1WCM G;  2SOB A;  3K80 C;  2JSO A;  1AW7 A;  1HNW L;  5ISR A;  1JJ2 A;  4F8M A;  4M1U B;  1B4O A;  1J9O A;  1V1O A;  1B44 D;  2HD3 A;  3MZ5 A;  2CW0 D;  4R4Q A;  2RCF A;  4LF6 Q;  1K3B C;  4JI5 L;  2LKV A;  4RGO S;  2UUB L;  1CI3 M;  1DXM A;  1STE A;  2SNM A;  3BVG A;  2RQX A;  5JEA J;  3E9I A;  3FMC A;  4ZAI A;  1NR4 A;  1PHJ A;  3M4Q A;  1HZA A;  2E2I H;  4C56 C;  1E3P A;  3CF5 A;  4K8I A;  1S5B D;  2UU9 L;  5I9P A;  3I56 A;  3JC6 6;  2NWG A;  4YCV A;  4H13 C;  4IPD A;  4RG1 A;  4UP7 A;  5KYL A;  3PV0 A;  1DJR D;  1MIU A;  2F0W A;  2VUM B;  1Y1W B;  4JI4 Q;  5KNB A;  4RHR A;  1Y1V B;  4QL5 A;  5J22 A;  4LF8 Q;  5C0X G;  4TRD A;  1DCZ A;  4LFC L;  1IYU A;  4KHP L;  1GO3 E;  5C44 H;  2SNS A;  4JI3 L;  5A2Q L;  2PQA A;  2CHB D;  4U68 A;  4XT3 B;  2KED A;  4PMW A;  4X62 Q;  4C2M H;  2E75 C;  3I4N B;  3KDF A;  1PZI D;  3VA7 A;  2EZV A;  4JV5 Q;  3NTI A;  1MJC A;  4A3E G;  1WTX A;  3AB9 A;  4DV5 Q;  1PFB A;  4A3K B;  1CA5 A;  3SDZ A;  1UEA B;  1S5F D;  3A8J E;  4J6H A;  4GNX B;  1HR0 W;  4DR4 L;  4HR7 B;  1DGS A;  2FJ2 A;  2K50 A;  3CQZ B;  1I4Q A;  2AUJ D;  3GTO B;  5CBA E;  2RCN A;  3DUZ A;  3Q0A A;  4CKB A;  1PH7 A;  1SYE A;  1PZJ D;  2AMC B;  1LTR D;  2AHO B;  1Q7Y C;  1SMY C;  3RLF A;  4V0B A;  2EXD A;  4ZLT F;  2FHT A;  3C3L A;  5F2D A;  2F0F A;  3J81 i;  4OXP A;  3HOX H;  2WAQ G;  3RLO A;  3T1Y L;  2B63 G;  5C4H A;  3K58 A;  2AKW B;  5G3L D;  3OTO Q;  1EQR A;  5CYU A;  2IX0 A;  4U67 3;  3GTM H;  1Q90 A;  1KTK A;  1S3O A;  3HOY H;  1I4R A;  2EYH A;  1J8I A;  2HCI A;  3E6Z X;  4HCS A;  4RWS C;  5JEA G;  2VQF L;  1J5E Q;  3CCS A;  1XNQ L;  1CHQ D;  3BU2 A;  4P71 A;  2H4O A;  1PH9 A;  2OQK A;  4FF1 A;  3GTQ H;  1RTN A;  1R4P B;  3K7U C;  4RA8 A;  1ASY A;  3I8Z A;  3NE5 B;  1EIH A;  5EPJ A;  5IGB A;  4A93 B;  1WFQ A;  3WOF A;  4S3S A;  2BDN A;  2RA4 A;  4KLK A;  1TWG B;  1ET6 A;  2EYJ A;  2Q2U A;  2ZXR A;  1QZG A;  2PCF B;  1O7Y A;  1PFN A;  4P72 A;  3TS2 A;  2R3Z A;  3H0G H;  1CZG A;  1PRT B;  1N32 L;  5C3W A;  5KEE A;  5DM6 3;  3I91 A;  2KCC A;  3TN2 A;  1WTV A;  5C3E B;  4KY7 A;  1VS0 A;  1NE3 A;  4YCU A;  1H9S B;  3S15 B;  3MHB A;  4OL7 A;  3E9H A;  1GOZ A;  3X3N A;  2NVY H;  3E3X A;  1PV4 A;  1NNX A;  5I4D A;  4NW2 A;  4JI8 Q;  4A3G G;  1VQP A;  1HZB A;  1HFG A;  1C4Q A;  1WD0 A;  2OTL A;  5IYD G;  4A3M H;  5CV9 A;  3D31 A;  1Y8N B;  2NN6 I;  2EYF A;  3AEV A;  4IPH A;  3I70 A;  1BXT A;  4KK7 A;  1IW7 D;  3QO2 A;  2F0H A;  3KF6 A;  1GHJ A;  4I7A A;  3MAQ A;  4RGM A;  2O4X A;  4HJA A;  3H3V C;  3CU7 A;  1SAP A;  5K5P A;  1EYA A;  5BN5 A;  4B3M Q;  5A2Q E;  2L9H A;  1U4P A;  1U4L A;  4HSP A;  3FP9 A;  3NBH B;  2ICE C;  4X3S A;  3TSS A;  3HFZ B;  1BNZ A;  1T5X D;  4WFN 3;  5I2X A;  2NVT B;  1D5X C;  3H0G G;  2VY3 A;  4L63 B;  4BA1 I;  1TWC B;  2B29 A;  4LAA A;  3PO2 H;  1PTO F;  3IAY A;  5C4X B;  1PH5 A;  4MN3 A;  4C3I B;  4OEL B;  3PUV A;  4A3C H;  1EY6 A;  1U9R A;  3KLS A;  1JJC B;  4UPA A;  3PCO B;  1Q82 C;  4P74 A;  3QWN A;  5FKA C;  3ZYY X;  2NTS A;  4V19 0;  2JA5 G;  4LUV A;  5K36 H;  4IJL A;  5M3M H;  4BY1 B;  4IUV A;  4JOI A;  4P73 A;  2CFM A;  1KRS A;  1TWF B;  1TKW B;  4NB3 A;  4OHJ A;  4DGZ A;  2OTJ A;  1GUN A;  2Z1C A;  3AFP A;  1LAB A;  1RKN A;  1YNJ D;  5M3F H;  2OQ0 A;  3S16 B;  2F0S A;  3STB D;  2LMC B;  2K52 A;  1XYI A;  1PTO B;  4PV1 C;  1VQA A;  2LSS A;  4CBV A;  2A69 C;  3PUW A;  2Z9H A;  1GVP A;  4GOP C;  1N34 Q;  1Y8P B;  5IWA Q;  1MSG A;  1VQL A;  4DV2 L;  3FKI B;  4K6L A;  1IKM A;  5HGQ A;  3S1Q H;  4PZ7 A;  1DD2 A;  1XMQ Q;  3M3Y H;  1ZYR C;  2B2V A;  1EY4 A;  1NTG A;  1STN A;  4A3D G;  3K7A B;  4X65 Q;  4GLX A;  4ZKB B;  2B2W A;  1PRT D;  4GKJ Q;  4JI8 L;  2EYM A;  4EGV A;  4A3C G;  1CKN B;  2K33 A;  2LXJ A;  1BUV T;  3KLW A;  1I50 B;  3CC7 A;  3ERQ A;  1O7Z A;  5M5X B;  5K36 G;  1CK1 A;  3HZX A;  3BDO A;  4QJF A;  1SNQ A;  5FJ8 H;  2WII B;  3NTH A;  3DLL A;  2JA7 B;  4DV6 Q;  1OXU A;  2PQE A;  4FNF A;  2RSO A;  3H3V H;  4KN4 C;  2CH4 A;  1N36 L;  2YU9 H;  3PUY A;  4BY7 H;  3HOV H;  4B3M L;  4DKA C;  4EX5 A;  4N8F A;  1SDF A;  1I94 L;  3RZO B;  2F3W A;  2XRQ D;  4PZ6 A;  4NXM Q;  1N33 L;  1I3Q B;  4OO1 H;  1DOM A;  5JPM C;  4DR3 Q;  4DK0 A;  4DR2 Q;  1B9N A;  3A54 A;  3Q23 A;  4JK1 C;  2NVX B;  4XDX A;  4DV1 Q;  4X3T A;  4FF3 A;  1E1O A;  2K6A A;  5T1I A;  4DNR B;  3S2D B;  1VQ6 A;  3F2C A;  2MQH A;  1C8C A;  2ICI A;  3BZC A;  3JAM i;  5I6Y A;  2JA8 H;  3NEM A;  3F1Z A;  2VNU D;  2JQO A;  2O5J C;  3VYU A;  4J15 A;  5JVH 3;  1C7Y A;  4LF4 L;  1G2S A;  1SYC A;  4JYA Q;  1EY5 A;  2WP8 J;  1G29 1;  5FJ8 G;  1MSH A;  2JYO A;  2KHJ A;  1A0I A;  2RHS B;  2QA4 A;  3MEH A;  4C3J H;  1EIF A;  3R8B A;  3PUZ A;  2EY6 A;  5E1F A;  4BWG B;  1IBM Q;  1CTM A;  3HOW G;  4Y52 H;  4BY7 G;  5H1S E;  3GTL B;  1E0B A;  2RDH A;  5IGC A;  4K14 A;  4YCW A;  5IGE A;  1RL2 A;  4FP5 D;  1YIJ A;  4A3B H;  3M7N A;  1K8A C;  2UXD L;  4IN3 A;  1ONL A;  1DZ1 A;  4OO1 G;  1GUT A;  5IYB H;  1TY0 A;  3D4R A;  4CHT B;  4KI0 A;  3D4W A;  3HKZ E;  2Z4H A;  2KQ3 A;  3OYY A;  4MIU A;  4B3R Q;  1HJP A;  2JA6 H;  2N8N A;  4L5T A;  2KOL A;  2BH2 A;  2R92 B;  3VA5 A;  1EYG A;  1VQ8 A;  1E2W A;  3ERS X;  4AYB G;  2YV5 A;  1RIP A;  5AJ3 Q;  4A3I B;  2J7Z A;  2Y0S G;  4DV6 L;  4BXX G;  1B1Z A;  1QCB D;  1WD1 A;  3IFD A;  1N9W A;  2RHQ B;  5CV4 A;  2MJ8 A;  1LT6 D;  4ILW A;  3V05 A;  1L1O B;  1WYD A;  2VXW A;  1QE6 A;  2A1A A;  1OO9 B;  2OEO A;  4JOI C;  3A55 A;  3T56 B;  4ULL A;  1JIC A;  3A5Z B;  1X3G A;  1PH4 A;  1NMF A;  3Q8D A;  5DEH A;  1CQF A;  1HR0 Q;  5JAV A;  4GKK L;  4DV1 L;  2EXZ A;  4DV4 Q;  2R93 H;  1S5C D;  3P1H A;  2N88 A;  1H9M A;  5BR8 Q;  5FLX L;  4JI7 Q;  3K5L A;  3E0E A;  4LF7 L;  2FXQ A;  4BBR B;  4JBM A;  4L6T B;  1TXY A;  2IX3 A;  2JA6 G;  3GV3 A;  4DR7 Q;  4A3F H;  1SYF A;  4KY5 A;  3HOZ H;  1HPC A;  4JYA L;  3OW7 A;  1HNZ Q;  2K7V A;  5D14 A;  2B2V C;  1I5F A;  3V96 A;  1DYQ A;  5I2Y A;  4A3L H;  4H7B A;  1F2M A;  2B2W C;  1KRT A;  5KGU A;  4HJ9 A;  1HRJ A;  1ASZ A;  1PFM A;  3GTP H;  1X55 A;  2EJM A;  1IW7 C;  2E8G A;  2R7Z B;  1HA5 A;  2G9D A;  4B3T Q;  1V8Q A;  4JPB W;  1JE4 A;  1B3A A;  4GNX C;  2QGQ A;  2J4X A;  2JXM B;  4IFD J;  1Z47 A;  4X64 Q;  4B3R L;  1AEX A;  1KLU D;  1L2F A;  1BOS A;  4GLV B;  4DUY Q;  1EIG A;  3HKZ B;  1JWM D;  4Y7N B;  2UUA L;  4GLA C;  2K04 A;  1HNX L;  4H0L C;  4L5Q A;  4XXE A;  2QEJ C;  1HQM C;  4MHE A;  2K28 A;  5AJ3 L;  1JOO A;  1CM9 A;  4BS9 A;  2E2H H;  1U4M A;  3SK6 A;  1A8V A;  2XVS A;  1STH A;  4F7X A;  2IW3 A;  3NTK A;  1LLR D;  1YHB A;  4ABN A;  4C3H B;  1N8R C;  1HXY D;  4ME3 A;  3A8I E;  1CSP A;  1X3F A;  3SR1 A;  4DK1 A;  1K8M A;  1YBY A;  2AWO A;  3J7A F;  4A76 A;  3KFU A;  2DJF C;  5ELD A;  3I4M G;  2PPB C;  1EEI D;  3N52 A;  4JI6 L;  3EA6 A;  4IFD H;  1BR9 A;  4DU9 A;  3GO5 A;  3DM1 A;  3SGI A;  1WCM H;  1GJX A;  3NEN A;  1K0R A;  1LTT D;  1ENF A;  3STB C;  4CDD C;  3RZD H;  3BDC A;  1Q46 A;  1XNR Q;  3TQY A;  2VUM H;  3HOU G;  1QIL A;  5EBC A;  3N6R A;  4DF7 A;  2ZTC A;  1F9R A;  3TZU A;  4CDC C;  1QUQ B;  2HCC A;  1A3V A;  4DUZ Q;  3T4A C;  5KNC A;  4KY6 A;  1X9N A;  1PRT C;  4F87 A;  1VQH A;  5LL6 X;  4FXG C;  2KCN A;  1V9P A;  1SBB B;  2L5T A;  1BBX C;  1STY A;  1IKL A;  4G7H C;  4RGT A;  3FRP B;  3I4N H;  1VQE A;  3KK7 A;  1RHP A;  4DN4 M;  1VQ4 A;  2F1M A;  4A3K H;  4R8N A;  5C0X I;  1S40 A;  1DON A;  1KDA A;  1JB3 A;  1EEF D;  3RMH A;  5FLX c;  1SMX A;  5IYC G;  1Z7T A;  1EWI A;  4CDE C;  1TU2 B;  2PO4 A;  3VYT A;  5FLX E;  1SR3 A;  3D8G A;  3CC2 A;  3MFY A;  1NMG A;  2X6L A;  5LMU L;  1LO5 D;  4L5R C;  4IFD G;  4CKE A;  1QVF A;  3S1R B;  3GTO H;  1VQF A;  5GAG C;  4FYD A;  2D0P A;  4Z9C B;  1A2T A;  2F4V L;  5ELB A;  4GN3 B;  2A68 D;  4HJ5 A;  1VQN A;  3EVQ A;  2WB1 E;  4LFB Q;  1CZW A;  4A3E H;  3TP8 A;  3UE1 A;  1Y1W G;  1IBL Q;  3C2P A;  2VUM G;  2A5H A;  3CCV A;  1YNX A;  1Y1V G;  1HZC A;  3IFT A;  1LTL A;  3K6O A;  4R4I A;  1HA6 A;  1FNV A;  3GD7 A;  1IHZ A;  1GD7 A;  3U4Z A;  3PF4 A;  2MO0 A;  3T1H L;  1D1I A;  2B2T A;  3Q22 A;  4DR1 Q;  3K5O A;  3MTS A;  2EY1 A;  5M5Y H;  4QQB X;  1JC7 A;  4G4K A;  3VR3 A;  3UDI A;  4LFA Q;  1BVS A;  1JOQ A;  3MXN B;  3BZK A;  2H5X A;  3PSI A;  3I4N G;  3S1N B;  1LUZ A;  1PYB A;  2VB2 X;  4G57 A;  3M4P A;  4I65 A;  4MNO A;  4A3K G;  2CVR A;  4FXD A;  1RF2 D;  2NVQ B;  1BCP D;  1CT1 D;  4WRD A;  5GRO A;  1XMO Q;  3Q24 A;  4A93 H;  2QDL A;  1B2T A;  2B63 H;  4ZUJ A;  5LMN L;  1BKB A;  1K3R A;  1X54 A;  1TWA B;  1IBK L;  1GM5 A;  2F0D A;  3DHQ A;  3DWP A;  1KHI A;  1R4Q B;  4APV A;  3CCM A;  3I73 A;  2IJ0 A;  1V1P A;  4JI2 L;  1RDP D;  4BBS B;  3SEB A;  3TP5 A;  1I6H B;  5JEA H;  1BBW A;  1Q8I A;  1ILP A;  2VQE L;  1VQM A;  2VW9 A;  1Z6H A;  3H09 A;  1FD7 D;  3GTG H;  1AH9 A;  3UDX A;  2MNA A;  3GDE A;  2BE5 D;  1M90 C;  5JOB A;  2JEA I;  2CCZ A;  2Q2T A;  1LT5 D;  3CPF A;  1EYC A;  3QR8 A;  5CBE E;  4DAP A;  4GOP A;  1Q8K A;  2L11 A;  3TP6 A;  3M4Y A;  5FO9 B;  2C35 B;  1V43 A;  1TS4 A;  2A74 C;  3I55 A;  1FL0 A;  4H02 A;  5D3I B;  4RAU C;  2N78 A;  5CR3 A;  2EE1 A;  1VMC A;  4GZY C;  1NCV A;  2GVB A;  2F0O A;  1FNU A;  2FMC A;  3AMU A;  4FO2 A;  2EYL A;  4BA2 I;  1MJE A;  1GUW A;  2KEN A;  5FO7 B;  1EY7 A;  5ELO A;  4CJ2 C;  4A93 G;  4LF6 L;  4QUF A;  3A5U A;  3U9S A;  4C1N I;  1YEZ A;  2G5D A;  3A8K E;  4OWX B;  3ND8 A;  4OWT B;  4IUU A;  2M9V A;  2WB1 B;  3J7Z C;  3NSW A;  4A3G H;  1B3Q A;  2NVT H;  2K5V A;  5IYD H;  3KJP A;  1TWC H;  4KMU C;  1EY8 A;  3J7A V;  2OCE A;  1EFI D;  4LFA L;  3CCL A;  1BDO A;  2Q8I B;  1PH6 A;  5C3E G;  2MUY A;  1HTP A;  1C9O A;  4QUC A;  3RR5 A;  1EFW A;  1E2V A;  3LX0 A;  3I72 A;  1M4V A;  4GS3 A;  1VF7 A;  1WOC A;  1O78 A;  1QNU A;  2ZJR A;  4JI4 L;  4DAM A;  1IL2 A;  5EKK A;  1Q1B A;  4BY1 H;  4LF8 L;  4KKU A;  2PW7 A;  3PIP A;  5C3X A;  1XMO L;  3NEL A;  2YYZ A;  3D3R A;  4DV3 Q;  1ET9 A;  4IZ8 A;  4ZQ3 A;  2B2Y A;  1YJN A;  1F77 A;  2XWB B;  3URY A;  2IHE A;  4PNY A;  1L0X B;  4X62 L;  2Z8L A;  1EOT A;  1A6X A;  1FGB D;  1F2Y A;  4JCV E;  5C44 B;  4JV5 L;  4IUN A;  1VQK A;  1CHP D;  2GVA A;  4DV5 L;  2JA5 H;  2UXC Q;  4RCO A;  1XTD A;  1TVX A;  2E5L Q;  3OIP A;  3FKI H;  1QUQ A;  2F0L A;  2EDG A;  4C1N K;  2A73 B;  3S14 H;  1X3E A;  5DLQ E;  1LT4 D;  2M00 A;  3K7A H;  4ODG A;  5C4X G;  3OIQ A;  4DNT B;  3M7G A;  4YWK A;  3G6E A;  2B2U A;  2HT1 A;  1LYL A;  1I50 H;  4M8A A;  2A6E D;  4DXF A;  5IOD A;  4YHH Q;  2B2T C;  3NP8 A;  4NXN Q;  4DPG A;  4WOR A;  2PZU A;  4BY1 G;  2E2J H;  3NBI A;  3S1M B;  1SJH D;  4DR6 Q;  1PYW D;  4A3J B;  3AYH B;  2E74 C;  2KVM A;  4XQN A;  4HJ8 A;  3IRB A;  3T51 B;  3B6Y A;  5HUR A;  3OTO L;  3EJI A;  3HOX B;  2DUD A;  4A3D H;  2Z6B A;  1A2U A;  1ICW A;  4NPS A;  4RKL A;  1L1O C;  1UNS A;  3UE0 A;  1J5E L;  2EY5 A;  1KNA A;  2Z6K C;  1V1Q A;  3DMU A;  3HOY B;  2A19 A;  3VR5 A;  4R4O A;  1NR2 A;  1YHA A;  3FKI G;  1PA6 A;  3KJO A;  1VQ7 A;  1CA6 A;  3K5N A;  1VF5 C;  1B70 B;  2K5N A;  3GTQ B;  2RVL A;  3SVM A;  5GQO A;  4RGN A;  2B8G A;  2QCP X;  1YHQ A;  4HCE A;  3SHL A;  2N49 A;  2I07 B;  2AQ2 B;  1P16 A;  4L5S A;  2LY7 A;  5EKL A;  4DNI A;  3GTK H;  4LF5 Q;  2HIX A;  4KJO A;  2JA7 G;  1K83 H;  5EKI A;  1Q86 C;  3NWT A;  2XRS D;  1OXS C;  3P75 A;  1KD1 C;  2VZA A;  3BZD B;  2ZTE A;  1S5D D;  1AE3 A;  5NUC A;  3F8T A;  5JVG 3;  1S4Z A;  2E5L L;  2IL8 A;  3FPP A;  3KUP A;  2A68 C;  1S72 A;  4K2K A;  2EPB A;  3ER0 A;  3W5O A;  2NVY B;  3S17 B;  2KUM A;  4IAL A;  4A3M B;  3H3V I;  3OMG A;  3K57 A;  1WTO A;  2ZTD A;  1TWH H;  1SYB A;  4GNX A;  3HOW H;  5CV6 A;  1ILQ A;  3EQL C;  3BYT B;  3S24 A;  4JG2 A;  4YY3 Q;  3NQT A;  1QJO A;  3IL8 A;  1HUN A;  3NXW A;  1FYC A;  4OO1 I;  2O5I C;  4K2L A;  4A3I H;  1U4R A;  2RBM A;  4IPG A;  2BCO A;  1JB7 A;  3J80 i;  4DV0 Q;  4N9P A;  1IYJ B;  1K8G A;  1IL8 A;  1LM0 A;  5C6A A;  3FHW A;  3U9O A;  2F0K A;  2F0U A;  3BYY B;  1AZQ A;  1BCP C;  4IQZ A;  1UAP A;  3PO2 B;  1B9M A;  4OIJ A;  1ENC A;  2CQA A;  4JI0 Q;  3AQQ A;  2TMP A;  3CAM A;  3A7A B;  4TKO B;  5CGK A;  3RN2 A;  2YTY A;  2UUC Q;  2RSN A;  2IHF A;  2B2Y C;  1SXT A;  2JP1 A;  1Q81 C;  1QB5 D;  3QIA A;  4O1N A;  3KOJ A;  1DOL A;  1TY2 A;  1K9M C;  2Y0S E;  4HN7 A;  4BXX H;  2KHS A;  2DN8 A;  2HQL A;  5M3M B;  2F4I A;  2H1E A;  1PYS B;  3TRE A;  4DFA A;  5IGD A;  4RFB A;  2BE5 C;  4ZKC B;  3I2Z A;  3S9W A;  4DAY B;  4MTK A;  2Q8R E;  2R92 G;  1UWV A;  3H91 A;  5ELF A;  5M3F B;  3CP0 A;  3MC0 B;  4YIJ A;  2G9H D;  2R7D A;  1GUG A;  2K32 A;  4EQ5 A;  1EQV A;  1F9Q A;  3F2D A;  1N34 L;  2EJF C;  5IWA L;  5JJK A;  4MZ9 A;  2WIN B;  4CDF C;  2HQE A;  3UDG A;  1W2B A;  1JWS D;  1TR5 A;  4A3I G;  3PIO A;  3KF8 B;  1GKH A;  5GAH C;  1XMQ L;  1TS2 A;  3CPW A;  1W6K A;  2B2U C;  2KJX A;  3L9A X;  3QB3 A;  4X65 L;  2L15 A;  1PTO D;  3D0F A;  3QJY A;  4GKJ L;  3M3Y B;  2ID0 A;  4IPC A;  4QCL A;  5JJZ A;  4ALP A;  2QEX A;  2D9U A;  2ES2 A;  4NP5 A;  1I6V C;  1L0W A;  4NMZ A;  2NZH A;  3C1F A;  1H9S A;  1BQQ T;  3A74 A;  3S2H H;  1WI5 A;  2PI2 A;  1SRO A;  2DGY A;  1QNK A;  2QF7 A;  3CHB D;  2DNE A;  4KKS A;  1WTP A;  4Y7N H;  2NYZ D;  4BBR G;  3CXC A;  4YY3 L;  2OXP A;  3I4L A;  4R9W A;  1VQB A;  3T13 A;  4NXM L;  3DEO A;  4OX9 Q;  2YU9 B;  4JI1 Q;  3HOV B;  1S5E D;  4I7Z C;  1F2L A;  4HIK A;  1SLJ A;  3ICE A;  1KNE A;  4TSS A;  4DR3 L;  1SE4 A;  1EZ6 A;  4DR2 L;  5M5W B;  1D1K A;  1QVC A;  3J81 c;  5CMD A;  3NBH A;  1RJT A;  1C48 A;  1D5Z C;  1EYD A;  2AWN A;  3RN5 A;  3J81 E;  4HJ7 A;  1M8A A;  1WVL A;  1STB A;  1QWY A;  2UUC L;  5LL6 S;  1XX8 A;  4FF4 A;  2CKZ B;  4KHZ A;  2R7Z G;  5KRU A;  1LV9 A;  1OTC A;  3BS1 A;  1F9S A;  3KYH C;  1MD2 D;  4HAE A;  4CJ1 B;  2ZM6 Q;  1NAP A;  3CW2 C;  2UXB Q;  2PQA B;  2ZJP A;  2JA8 B;  2KCT A;  1WTH A;  2F0N A;  3TZD A;  5GAE C;  3FVQ A;  5T1G A;  3EIV A;  3BDL A;  4K5V A;  3KDF B;  3H94 A;  2BH8 A;  4UHV A;  2F0G A;  4E6I A;  1IBM L;  3HKZ G;  4RH6 A;  3I4M H;  3M4O H;  2F3V A;  1MHW C;  1TQO A;  4FDB A;  4C3J B;  1KAB A;  4LWC A;  1FJG Q;  3HP3 A;  3VYS A;  3AFQ A;  4XYO A;  3L7Z C;  3MFG A;  1NSN S;  2ALY B;  2HDL A;  4HMJ A;  4K6D A;  4C3H G;  2A6E C;  1VQJ A;  1SYD A;  4A3B B;  3F2B A;  2K1B A;  1BBU A;  3FPU B;  2JA9 A;  1AE2 A;  1G91 A;  2NTT A;  1W3S A;  3J7Y W;  3HOU H;  4FVM A;  2SEB D;  3M9B A;  4Q5V A;  3HG9 A;  1EY9 A;  2DNC A;  1STG A;  1WTW A;  5C4J B;  1G51 A;  4K8J A;  5J1Z A;  5IP7 G;  3I90 A;  2JA6 B;  1XPR A;  3S1R H;  3W2D A;  3J81 j;  2BA1 A;  1XPO A;  2F0T A;  4DV7 Q;  2BOS A;  3R3O A;  4OIK A;  1G6Z A;  1CKN A;  1H9R A;  4QGU A;  3U4V A;  3CD6 A;  1PH2 A;  3QOJ A;  1K73 C;  5E4X A;  2L12 A;  1A3U A;  1STA A;  1HNW Q;  5BN3 A;  3CME A;  1KDB A;  3GTJ B;  2P5Z X;  1D2B A;  4JC0 A;  1LAC A;  3QG1 A;  1JR0 D;  5IYC H;  4IFD I;  4JI5 Q;  4CJ0 B;  1ROD A;  2KEE A;  1HZ9 A;  1UUP A;  1HR0 L;  1D6E C;  2BA0 A;  2LFN A;  2QW7 A;  3PO3 B;  2UUB Q;  4XQJ A;  1E1T A;  1ZXT A;  4DV4 L;  1II3 A;  2VS1 A;  1UE7 A;  5BR8 L;  4JI7 L;  2RKS A;  1SEB D;  2R93 B;  1TS3 A;  2UU9 Q;  1Y1W H;  1WJJ A;  1LTI D;  1Y1V H;  2XIW A;  1M1K C;  4DR7 L;  1XJV A;  1EWH A;  3MXP A;  3J7A 5;  3PIP 3;  2JEB I;  3CMA A;  2NZO A;  1HNZ L;  1TWA H;  4A3F B;  3TBI B;  2AQ3 B;  1I4P A;  3ND9 A;  3H6M A;  3HOZ B;  4JVZ A;  2YTX A;  4LFC Q;  5G3L F;  3RUZ A;  2WKD A;  4IUR A;  4BBS H;  5FLM H;  4UP9 A;  1YI2 A;  3C46 A;  4IOA A;  5DM7 3;  2WAC A;  3MWY W;  1CUK A;  3F2U A;  1FJG L;  4KN7 C;  3M85 A;  2KA7 A;  4B3T L;  1JJG A;  1O7L A;  1EY0 A;  1O7I A;  2C5C A;  2OF1 A;  4KTA A;  1CQV A;  1BF4 A;  2ASB A;  4LJZ C;  2K5D A;  3CQZ H;  3KF6 B;  2FIN B;  1CSQ A;  4X64 L;  4DR4 Q;  4K0K Q;  4DUY L;  2MFI A;  3UI2 A;  4JBK A;  1E2Z A;  1QZH A;  1BO0 A;  1AN8 A;  1IZ6 A;  1SND A;  1JWU D;  4G7O C;  4KD3 A;  3SE0 A;  1OXT A;  2MHV A;  3OPO A;  4ME5 A;  3I4O A;  2LXK A;  3G6J B;  4QF4 A;  2F0J A;  2E2H B;  3RD4 A;  4P75 A;  2MPM A;  3T16 A;  5KIX A;  1PH1 A;  4YWL A;  2L4N A;  3T1Y Q;  1KQS A;  1H95 A;  2EVB A;  4BBS G;  4DAV A;  5C5M A;  1X32 A;  1SFO B;  3L0O A;  5FLM G;  3ONA B;  2DJG C;  4RMF A;  2X69 A;  4X66 Q;  1GHK A;  5E7N A;  3SK4 A;  2HIV A;  2VQF Q;  1R9T B;  3J80 c;  1XNQ Q;  1L1O A;  3DWA A;  2F0Q A;  3CRL C;  4B08 A;  5JJL A;  1CKO A;  1YJW A;  1D5M C;  3J80 E;  3K0X A;  2WAQ E;  3W1B A;  1AP0 A;  2Z6K A;  1WCM B;  5D3D A;  5JJI A;  4IUP A;  3O13 A;  2YTV A;  1XNR L;  2O2L D;  2NUC A;  1TWG H;  4R4T A;  3RZD B;  5EQ0 A;  1RTO A;  5CV7 A;  4LUZ A;  1X6O A;  1SNC A;  1E7Z A;  2NB0 A;  4DUZ L;  3HKS A;  1VMP A;  2KCM A;  4H44 C;  4PQX A;  5E3F A;  5EPL A;  5TSS A;  3V2T A;  5IP9 G;  3JAM c;  2Q2I A;  3KLS X;  1CKM A;  1PTO C;  1QOH A;  3OWF A;  3JAM E;  3CC4 A;  1A63 A;  5IGF A;  1PH3 A;  3HS0 C;  5C3E H;  2FMM A;  2PNR C;  1EQT A;  1N32 Q;  2PMZ E;  1KLG D;  2F0I A;  4MTN A;  4TVA B;  4PG3 A;  3S15 H;  1FNW A;  1SE8 A;  2Z4I A;  5LHY 1;  1X3P A;  2WB1 G;  1MI2 A;  2PI2 E;  3GV6 A;  5J39 A;  3RLN A;  5C4Z A;  1TS5 A;  2HDM A;  1LTB D;  1WTQ A;  2EY2 A;  3U58 A;  4LNQ A;  1T9H A;  3UDF A;  1E24 A;  4XIG S;  2PW5 A;  1D8L A;  3BVM A;  4K0K L;  3D4D A;  4LF9 Q;  2AUK A;  1HTL D;  2C9O A;  4OEM B;  4J8Q A;  3CCU A;  4FXK C;  4LFB L;  1PVO A;  1IBL L;  2PNH A;  1JQY D;  3PGZ A;  3EN2 A;  2A6H D;  4N8X 1;  4X6A H;  3OWE B;  1SSO A;  3I3C A;  5FK9 C;  2OT2 A;  3S1M H;  4A3E B;  2K75 A;  3K81 C;  3VR6 A;  2EOT A;  4TQU S;  4A3J H;  2EQS A;  3ZJY C;  1VDZ A;  4NKL A;  4DR1 L;  1EL0 A;  1P8L A;  5ELE A;  3G71 A;  4J1M A;  1PLF A;  5C4X H;  4QIW E;  5M5Y B;  4C3I H;  4R8I A;  3CKI B;  5C44 G;  2E2I B;  2E2D C;  5IT9 c;  2V1C C;  4X66 L;  4OGQ C;  1PRT F;  4OWW B;  1EIY B;  5IT9 E;  1YJ9 A;  5COY A;  3OW2 A;  3A56 A;  1YNN D;  3WOE A;  2ENB A;  4IUQ A;  3ERO A;  2HHH Q;  1Q12 A;  3A0J A;  4DXG A;  1K28 A;  1PZK D;  1TWF H;  4HIO A;  2XNA C;  3WWV A;  1PMR A;  3CCR A;  1Q1E A;  2WAQ B;  4EQN A;  2B63 B;  3L2P A;  2RF4 A;  4QMG A;  3S16 H;  5COR A;  1FR3 A;  1T5E A;  1ESF A;  4KD4 A;  4ZRZ A;  1PTO H;  1A62 A;  2N3S A;  4C2M B;  2M2L A;  3G7L A;  4DR5 Q;  3PIO 3;  3TRZ A;  3GTG B;  4A3J G;  1F9P A;  5GAD C;  1SYG A;  4K5X A;  3BG3 A;  3CRK C;  4DV2 Q;  5IGG A;  1HHV A;  3HOX G;  4XTC S;  5AFW A;  1TII D;  4DA2 A;  1I4H A;  2PMZ B;  4X3U A;  4HSV A;  4C3I G;  2R7F A;  2XTI A;  1C0A A;  3D6C A;  1EUJ A;  5L37 A;  3HOY G;  1NBW A;  5M5X H;  3S17 H;  3C1E A;  4R1J A;  1Q3L A;  2L55 A;  1J6Q A;  3U50 C;  2L1B A;  2QIL A;  4LF9 L;  4LUO A;  5IY0 A;  1KAW A;  1RD9 D;  3CCJ A;  2JA7 H;  4UDU C;  2F3I A;  4JW0 A;  1QVG A;  3CCQ A;  4Q0F A;  2ATW A;  2NN6 H;  2ZT9 C;  1Y8O B;  4HIM A;  3RZO H;  3WDN A;  3P7J A;  5LMN W;  1B7Y B;  1HH2 P;  2FFK B;  1F2Z A;  1WTR A;  1N36 Q;  1I3Q H;  3TME A;  2K5H A;  3T53 B;  3NHH A;  2K01 A;  1I94 Q;  3GTM B;  3D6W A;  5ELC A;  1YIT A;  2I5L X;  4A75 A;  2WFW A;  1N33 Q;  4A3G B;  1LT3 D;  2NVX H;  2IY5 B;  4O0A A;  1GUO A;  2JK8 A;  1JOK A;  1XXG A;  5CC4 A;  2RDG A;  3ULL A;  1GUS A;  1B53 A;  5CV8 A;  3S2D H;  1LTG D;  3KBG A;  2I5H A;  3SK8 A;  4QIW B;  4RCN A;  3OHX C;  5IE8 A;  1MKH A;  1U0L A;  3FDT A;  2IPK D;  2PZW A;  3MXN A;  1EOV A;  5EGT A;  2HHH L;  3H15 A;  1DM0 B;  4DV3 L;  1KC8 C;  4LK1 C;  3PQI A;  1ICF B;  1VQG A;  4ZYS A;  4LF4 Q;  4A3M G;  1EQQ A;  3H0G B;  4KKT A;  2JN4 A;  4ZK9 B;  1SNO A;  3GTL H;  2NN6 G;  2CWA A;  1W6J A;  3R2T A;  2K05 A;  1SJE D;  4B9X A;  2UXC L;  3E5S A;  3TP7 A;  1JT8 A;  4F88 A;  2LS0 1;  4DR5 L;  1VQO A;  3R93 A;  3J81 L;  4DK3 C;  1ENA A;  1LTA D;  1AZP A;  3QOL A;  2JA5 B;  4UY8 C;  2XSC A;  2D2C C;  2UXD Q;  2K14 A;  3PF5 A;  1NJI C;  4QB4 A;  3I7F A;  3S14 B;  1I4X A;  1ML0 D;  4LW1 A;  3X3M A;  3PO2 G;  2R92 H;  5E4W C;  1G8Z D;  1FGU A;  3NWS A;  5CV5 A;  2K03 A;  4EQO A;  4YHH L;  2EYP A;  4NXN L;  3VYR A;  2B3G A;  1UE6 A;  1K0S A;  4WJ3 M;  2CW0 C;  4B9W A;  1JCK B;  2V4D A;  4HED A;  4DR6 L;  1SE3 A;  5M3M G;  4ZCK A;  1H9K A;  4B3S Q;  1I4G A;  3W3A A;  3VDY A;  2E2J B;  4WJW A;  1HUM A;  1VQ9 A;  4IUT A;  2L0C A;  3NUC A;  2D62 A;  3TS0 A;  5EAY A;  2F0P A;  4YWM A;  4A3D B;  1H9J A;  5M3F G;  5M5W H;  3L3O C;  4L8J A;  5JPN C;  1GXD C;  2N55 A;  4AYB E;  3CCE A;  3G4S A;  1UEB A;  5DNF A;  2F0E A;  4IO9 A;  1YVC A;  3ULP A;  1SNP A;  4GKK Q;  2IX1 A;  3MA2 B;  1O80 A;  2A8V A;  3EBE A;  2NBF A;  4BBR H;  1HFN A;  1MBY A;  4P2C B;  4O2D A;  2WV6 D;  5EBD A;  1A15 A;  1YZ6 A;  4HMI A;  4LF7 Q;  2TSS A;  3RNU A;  2KHI A;  1JE5 A;  3MEF A;  4AH6 A;  4LF5 L;  4UAI A;  4WJ4 A;  3P20 A;  2K5W A;  1KDC A;  4KHV A;  4ZUI A;  3GTK B;  4XYQ A;  3HGB A;  3K59 A;  2XN9 C;  1K83 B;  3S1Q B;  1L0Y B;  1SN8 A;  3TEH B;  2R7Z H;  2ZXO A;  5KYI A;  4UP8 A;  3HOV G;  1FVI A;  1PH8 A;  1NY4 A;  3DM3 A;  4PZ8 A;  2A6H C;  3HEJ A;  4GN4 B;  4GN5 A;  1EZ8 A;  1LTS D;  2GA4 B;  5D65 A;  1Z9F A;  1CFM A;  3OOC A;  1NUC A;  2CQO A;  2RDF A;  3OSO A;  5I9O A;  5C4J H;  2NZ1 D;  5FOB B;  2Z0S A;  4RKB A;  1OXX K;  2D0O A;  1TWH B;  4JBW A;  3HOW B;  4BY7 B;  2UUA Q;  5DAU A;  4ID6 A;  2Q8T A;  1HNX Q;  3VR4 A;  4C3H H;  4B3S L;  4DV0 L;  1Y14 B;  3BVZ A;  5M9O A;  2JA8 G;  3KBX A;  2VB3 X;  3K0Y A;  3E0J A;  2I46 A;  1MGS A;  1YNN C;  3HRZ C;  1PDQ A;  3GTJ H;  2EYO A;  3NQI A;  1SMY D;  2SDF A;  3PUX A;  4POF A;  2CWP A;  2DY7 A;  3AU7 A;  1Y69 U;  5IIF A;  2B39 A;  4JI0 L;  2KBN A;  4FF2 A;  4C3J G;  2QDB A;  3K8A A;  4LMQ D;  3PO3 H;  1JMC A;  2EJG C;  5IP7 H;  1EU3 A;  2XGT A;  2F0V A;  1D7Q A;  4R4C A;  4JI6 Q;  3W1G A;  3OMC A;  4A3B G;  1XWE A;  2E76 C;  3PMF A;  4AYB B;  3MXU A;  3R2I A;  1V1P B;  2Y0S B;  4G7Z C;  5IYB G;  2F52 A;  2I0Q A;  1UE1 A;  4XT1 B;  2Q2H A;  3G48 A;  3K5M A;  4EVO A;  4AQY Q;  4OON A;  4A4I A;  1SRU A;  1DOK A;  2MGS A;  2MO1 A;  5J3B A;  4AIM A;  3NK9 A;  3ITP A;  4RHS A;  4JBJ A;  4GOP B;  2OWO A;  3LNN A;  1B8A A;  2EIF A;  1VQD A;  2D5D A;  4KJN A;  2HUG A;  1ESR A;  3Q6S A;  1QG7 A;  3SK5 A;  2F03 A;  5KND A;  1UE5 A;  3J80 L;  3KLR A;  3IKJ A;  3A7L A;  1ZEQ X;  1VCI A;  4NDX A;  3PO3 G;  1BCP F;  3ULJ A;  5A35 A;  3DEP A;  2AQ1 B;  1TT2 A;  1XPU A;  5LMU Q;  5HY6 A;  3S2H B;  1IYV A;  2ZJQ A;  3LGJ A;  1B50 A;  2DY8 A;  2R93 G;  2F4V Q;  5EJW A;  2R61 A;  4PMB A;  1KIX A;  3LWE A;  4OX9 L;  1U5K A;  3JAM L;  1PXU A;  2JE6 I;  4JI1 L;  2VL6 A;  5ELN A;  1A3T A;  4IOC A;  4IJH A;  2WKC A;  1KAA A;  2JJQ A;  2K5Q A;  2X6G A;  4A3F G;  4EQP A;  3HOZ G;  4K5W A;  4POG A;  2ZXP A;  1EU4 A;  3SXH A;  3MXG A;  1RCV D;  3NPP A;  3T1H Q;  2R6G A;  1SFO H;  2I5M X;  1VQC A;  1BCP B;  3S1N H;  2F0M A;  4A3L G;  1KL9 A;  2IWH A;  4KV6 A;  5C5L A;  2XWJ B;  3DWQ A;  2K4K A;  4DK6 C;  4CGY B;  2KEC A;  1AFP A;  2NVQ H;  1R9T H;  4HID A;  1HQR D;  2ZM6 L;  1HCZ A;  1XTC D;  2UXB L;  1YNJ C;  3VR2 A;  3GQB A;  2MP1 A;  5IOC A;  1KXL A;  1PFS A;  2B8F A;  5C0X J;  3GP7 A;  3EFX D;  2PYK A;  5LMN Q;  1X65 A;  2QKI C;  4KHP Q;  5I6W A;  4AQY L;  1SNM A;  2IT1 A;  1I6H H;  1IBK Q;  1EWC A;  4O42 A;  4JI3 Q;  4CKC A;  5FO8 B;  4QY7 A;  4N9T A;  1X56 A;  3I4M B;  4JI2 Q;  3M4O B;  5EPK A;  4XQQ A;  3LWU A;  1VQI A;  2VQE Q;  1VQ5 A;  4DAY A;  3GTP B;  4PMC A; 
#chains in the Genus database with same CATH homology
 4X3K A;  2J0T D;  5IT9 L;  2PZT A;  3MVV A;  1JOR A;  3TDQ A;  1K8O A;  4HTH A;  3KF8 A;  5HGT A;  3HOU B;  2A69 D;  1G2T A;  1OXV A;  5C0X H;  1X3Q A;  5BN4 A;  2BDO A;  3DXJ C;  3FEW X;  1ZYR D;  1ZKO A;  1SE2 A;  2SOB A;  2JSO A;  1AW7 A;  5ISR A;  4F8M A;  4M1U B;  1B4O A;  1J9O A;  1V1O A;  1B44 D;  3MZ5 A;  2CW0 D;  2LKV A;  4RGO S;  1CI3 M;  1DXM A;  1STE A;  2SNM A;  3BVG A;  2RQX A;  5JEA J;  3FMC A;  4ZAI A;  1NR4 A;  4C56 C;  4K8I A;  1S5B D;  5I9P A;  2NWG A;  4H13 C;  5KYL A;  3PV0 A;  1DJR D;  2F0W A;  2VUM B;  1Y1W B;  5KNB A;  4RHR A;  1Y1V B;  5J22 A;  5C0X G;  4TRD A;  1DCZ A;  1IYU A;  2SNS A;  5A2Q L;  2CHB D;  4U68 A;  4XT3 B;  2KED A;  4PMW A;  2E75 C;  3I4N B;  1PZI D;  3VA7 A;  2EZV A;  3NTI A;  1WTX A;  3AB9 A;  1PFB A;  4A3K B;  1CA5 A;  3SDZ A;  1UEA B;  1S5F D;  3A8J E;  4J6H A;  4HR7 B;  2FJ2 A;  3CQZ B;  1I4Q A;  2AUJ D;  3GTO B;  5CBA E;  3DUZ A;  3Q0A A;  4CKB A;  1SYE A;  1PZJ D;  1LTR D;  1SMY C;  3RLF A;  4V0B A;  4ZLT F;  2FHT A;  3C3L A;  5F2D A;  2F0F A;  5C4H A;  3K58 A;  5G3L D;  5CYU A;  2IX0 A;  4U67 3;  1Q90 A;  1KTK A;  1I4R A;  2EYH A;  1J8I A;  2HCI A;  3E6Z X;  4HCS A;  4RWS C;  5JEA G;  1CHQ D;  2H4O A;  4FF1 A;  1RTN A;  1R4P B;  4RA8 A;  3I8Z A;  3NE5 B;  1EIH A;  5EPJ A;  5IGB A;  4A93 B;  3WOF A;  4S3S A;  2BDN A;  2RA4 A;  1TWG B;  1ET6 A;  2EYJ A;  2ZXR A;  2PCF B;  1O7Y A;  1PFN A;  2R3Z A;  1CZG A;  1PRT B;  5C3W A;  5KEE A;  5DM6 3;  3I91 A;  2KCC A;  3TN2 A;  1WTV A;  5C3E B;  4KY7 A;  1H9S B;  3S15 B;  3MHB A;  4OL7 A;  1GOZ A;  3X3N A;  5I4D A;  4NW2 A;  1HFG A;  1C4Q A;  1WD0 A;  5CV9 A;  3D31 A;  1Y8N B;  2NN6 I;  2EYF A;  3I70 A;  1BXT A;  4KK7 A;  1IW7 D;  3QO2 A;  2F0H A;  1GHJ A;  3MAQ A;  4RGM A;  2O4X A;  3H3V C;  3CU7 A;  1SAP A;  5K5P A;  1EYA A;  5BN5 A;  5A2Q E;  2L9H A;  1U4P A;  1U4L A;  4HSP A;  2ICE C;  4X3S A;  3TSS A;  1BNZ A;  1T5X D;  4WFN 3;  5I2X A;  2NVT B;  1D5X C;  4L63 B;  4BA1 I;  1TWC B;  4LAA A;  1PTO F;  3IAY A;  5C4X B;  4MN3 A;  4C3I B;  3PUV A;  1EY6 A;  1U9R A;  3KLS A;  3QWN A;  5FKA C;  3ZYY X;  2NTS A;  4V19 0;  5K36 H;  4BY1 B;  4IUV A;  1TWF B;  1TKW B;  4OHJ A;  4DGZ A;  1GUN A;  2Z1C A;  1LAB A;  1RKN A;  1YNJ D;  3S16 B;  2F0S A;  2LMC B;  1XYI A;  1PTO B;  4PV1 C;  4CBV A;  2A69 C;  3PUW A;  1Y8P B;  1MSG A;  3FKI B;  4K6L A;  1IKM A;  1DD2 A;  1ZYR C;  2B2V A;  1EY4 A;  1STN A;  3K7A B;  4ZKB B;  2B2W A;  1PRT D;  2EYM A;  4EGV A;  2K33 A;  1BUV T;  1I50 B;  3ERQ A;  1O7Z A;  5M5X B;  5K36 G;  1CK1 A;  3HZX A;  3BDO A;  1SNQ A;  2WII B;  3NTH A;  2JA7 B;  1OXU A;  2PQE A;  4FNF A;  2RSO A;  4KN4 C;  3PUY A;  1SDF A;  3RZO B;  2F3W A;  2XRQ D;  1I3Q B;  4OO1 H;  1DOM A;  5JPM C;  4DK0 A;  1B9N A;  3A54 A;  3Q23 A;  4JK1 C;  2NVX B;  4XDX A;  4X3T A;  4FF3 A;  2K6A A;  5T1I A;  4DNR B;  3S2D B;  1C8C A;  2ICI A;  5I6Y A;  2VNU D;  2O5J C;  3VYU A;  5JVH 3;  1G2S A;  1SYC A;  1EY5 A;  2WP8 J;  1G29 1;  1MSH A;  2JYO A;  3MEH A;  3R8B A;  3PUZ A;  2EY6 A;  5E1F A;  4BWG B;  1CTM A;  3GTL B;  1E0B A;  2RDH A;  5IGC A;  4K14 A;  5IGE A;  4FP5 D;  3M7N A;  4IN3 A;  1ONL A;  1DZ1 A;  4OO1 G;  1GUT A;  1TY0 A;  3D4R A;  4CHT B;  4KI0 A;  3D4W A;  2Z4H A;  2KQ3 A;  4MIU A;  2KOL A;  2R92 B;  3VA5 A;  1E2W A;  4A3I B;  2J7Z A;  1B1Z A;  1QCB D;  1WD1 A;  3IFD A;  5CV4 A;  2MJ8 A;  1LT6 D;  4ILW A;  3V05 A;  2VXW A;  1QE6 A;  1OO9 B;  2OEO A;  3A55 A;  3T56 B;  4ULL A;  1JIC A;  5DEH A;  1CQF A;  5JAV A;  2EXZ A;  1S5C D;  3P1H A;  2N88 A;  1H9M A;  5FLX L;  3K5L A;  4BBR B;  4L6T B;  2IX3 A;  3GV3 A;  1SYF A;  4KY5 A;  1HPC A;  3OW7 A;  2K7V A;  5D14 A;  2B2V C;  3V96 A;  1DYQ A;  5I2Y A;  4H7B A;  1F2M A;  2B2W C;  5KGU A;  1HRJ A;  1PFM A;  2EJM A;  1IW7 C;  2R7Z B;  1HA5 A;  2G9D A;  1V8Q A;  1JE4 A;  1B3A A;  2J4X A;  2JXM B;  4IFD J;  1Z47 A;  1AEX A;  1KLU D;  1BOS A;  1EIG A;  3HKZ B;  1JWM D;  4Y7N B;  2K04 A;  4H0L C;  4XXE A;  2QEJ C;  1HQM C;  4MHE A;  2K28 A;  1JOO A;  1CM9 A;  4BS9 A;  1U4M A;  3SK6 A;  2XVS A;  1STH A;  4F7X A;  2IW3 A;  3NTK A;  1LLR D;  4C3H B;  4ABN A;  1HXY D;  3A8I E;  3SR1 A;  4DK1 A;  1K8M A;  3J7A F;  2AWO A;  5ELD A;  2PPB C;  1EEI D;  3N52 A;  3EA6 A;  4IFD H;  1BR9 A;  4DU9 A;  3GO5 A;  3DM1 A;  1GJX A;  1LTT D;  1ENF A;  3BDC A;  1QIL A;  5EBC A;  3N6R A;  4DF7 A;  1F9R A;  3TZU A;  2HCC A;  1A3V A;  3T4A C;  5KNC A;  4KY6 A;  1PRT C;  4F87 A;  5LL6 X;  4FXG C;  2KCN A;  1SBB B;  2L5T A;  1BBX C;  1STY A;  1IKL A;  4G7H C;  4RGT A;  3FRP B;  3KK7 A;  1RHP A;  4DN4 M;  2F1M A;  4R8N A;  5C0X I;  1DON A;  1KDA A;  1JB3 A;  1EEF D;  3RMH A;  1Z7T A;  5FLX E;  1TU2 B;  2PO4 A;  3VYT A;  3D8G A;  3MFY A;  2X6L A;  1LO5 D;  4IFD G;  4CKE A;  3S1R B;  4FYD A;  4Z9C B;  1A2T A;  5ELB A;  2A68 D;  3EVQ A;  1CZW A;  3TP8 A;  3C2P A;  2A5H A;  3IFT A;  3K6O A;  1HA6 A;  1FNV A;  3GD7 A;  1IHZ A;  1D1I A;  2B2T A;  3Q22 A;  3K5O A;  3MTS A;  2EY1 A;  1JC7 A;  4G4K A;  3VR3 A;  1JOQ A;  3S1N B;  2VB2 X;  4G57 A;  4I65 A;  2CVR A;  4FXD A;  1RF2 D;  2NVQ B;  1BCP D;  1CT1 D;  4WRD A;  3Q24 A;  1B2T A;  4ZUJ A;  1TWA B;  2F0D A;  3DHQ A;  3DWP A;  1R4Q B;  3I73 A;  2IJ0 A;  1V1P A;  1RDP D;  4BBS B;  3TP5 A;  3SEB A;  1I6H B;  5JEA H;  1Q8I A;  1ILP A;  1Z6H A;  3H09 A;  1FD7 D;  2BE5 D;  2JEA I;  5JOB A;  1LT5 D;  1EYC A;  5CBE E;  4DAP A;  2L11 A;  3TP6 A;  3M4Y A;  5FO9 B;  1V43 A;  1TS4 A;  2A74 C;  5D3I B;  4RAU C;  5CR3 A;  2EE1 A;  1VMC A;  4GZY C;  1NCV A;  2F0O A;  1FNU A;  2FMC A;  3AMU A;  4FO2 A;  2EYL A;  4BA2 I;  1GUW A;  5FO7 B;  1EY7 A;  4CJ2 C;  4QUF A;  3U9S A;  4C1N I;  3A8K E;  3ND8 A;  4IUU A;  2M9V A;  2WB1 B;  3NSW A;  4KMU C;  1EY8 A;  3J7A V;  1EFI D;  1BDO A;  2Q8I B;  2MUY A;  1HTP A;  4QUC A;  1E2V A;  3LX0 A;  3I72 A;  1M4V A;  1VF7 A;  1O78 A;  1QNU A;  5EKK A;  1Q1B A;  4KKU A;  2PW7 A;  5C3X A;  2YYZ A;  3D3R A;  1ET9 A;  4IZ8 A;  4ZQ3 A;  2B2Y A;  1F77 A;  2XWB B;  3URY A;  4PNY A;  1L0X B;  2Z8L A;  1EOT A;  1A6X A;  1FGB D;  1F2Y A;  5C44 B;  4IUN A;  1CHP D;  4RCO A;  1TVX A;  3OIP A;  2F0L A;  2EDG A;  4C1N K;  2A73 B;  1LT4 D;  2M00 A;  4ODG A;  3OIQ A;  4DNT B;  3M7G A;  2B2U A;  4M8A A;  2A6E D;  4DXF A;  5IOD A;  2B2T C;  3NP8 A;  4WOR A;  2PZU A;  3NBI A;  3S1M B;  1SJH D;  1PYW D;  4A3J B;  2E74 C;  2KVM A;  4XQN A;  3T51 B;  5HUR A;  3EJI A;  3HOX B;  1A2U A;  1ICW A;  4RKL A;  1UNS A;  2EY5 A;  1KNA A;  3DMU A;  3HOY B;  3VR5 A;  1NR2 A;  1CA6 A;  3K5N A;  1VF5 C;  3GTQ B;  2RVL A;  3SVM A;  4RGN A;  2B8G A;  2QCP X;  4HCE A;  3SHL A;  2I07 B;  2AQ2 B;  2LY7 A;  5EKL A;  4KJO A;  5EKI A;  3NWT A;  2XRS D;  1OXS C;  3P75 A;  3BZD B;  1S5D D;  5NUC A;  5JVG 3;  1S4Z A;  2IL8 A;  3FPP A;  3KUP A;  2A68 C;  4K2K A;  2EPB A;  2NVY B;  3S17 B;  2KUM A;  4IAL A;  4A3M B;  3OMG A;  3K57 A;  1WTO A;  1SYB A;  5CV6 A;  1ILQ A;  3EQL C;  3BYT B;  3NQT A;  1QJO A;  3IL8 A;  1HUN A;  3NXW A;  1FYC A;  4OO1 I;  2O5I C;  4K2L A;  1U4R A;  2RBM A;  2BCO A;  4N9P A;  1IL8 A;  5C6A A;  3U9O A;  2F0K A;  2F0U A;  3BYY B;  1AZQ A;  1BCP C;  4IQZ A;  1UAP A;  3PO2 B;  1B9M A;  4OIJ A;  1ENC A;  2CQA A;  2TMP A;  4TKO B;  3A7A B;  5CGK A;  2RSN A;  2B2Y C;  1SXT A;  2JP1 A;  1QB5 D;  3QIA A;  4O1N A;  1DOL A;  1TY2 A;  4HN7 A;  2KHS A;  2DN8 A;  5M3M B;  2F4I A;  2H1E A;  4DFA A;  5IGD A;  4RFB A;  2BE5 C;  4ZKC B;  3S9W A;  2Q8R E;  3H91 A;  5ELF A;  5M3F B;  3MC0 B;  4YIJ A;  2G9H D;  1GUG A;  2K32 A;  1EQV A;  1F9Q A;  2EJF C;  2WIN B;  2HQE A;  1JWS D;  1TR5 A;  1TS2 A;  1W6K A;  2B2U C;  2KJX A;  3L9A X;  3QB3 A;  1PTO D;  3QJY A;  3M3Y B;  2ID0 A;  4QCL A;  5JJZ A;  2D9U A;  4NP5 A;  1I6V C;  4NMZ A;  3C1F A;  1H9S A;  1BQQ T;  1QNK A;  2QF7 A;  3CHB D;  2DNE A;  4KKS A;  1WTP A;  2NYZ D;  2OXP A;  3I4L A;  4R9W A;  3T13 A;  3DEO A;  2YU9 B;  3HOV B;  1S5E D;  4I7Z C;  1F2L A;  1KNE A;  4TSS A;  1SE4 A;  1EZ6 A;  5M5W B;  1D1K A;  5CMD A;  3NBH A;  1RJT A;  1C48 A;  1D5Z C;  1EYD A;  2AWN A;  3J81 E;  1M8A A;  1WVL A;  1STB A;  1QWY A;  5LL6 S;  1XX8 A;  4FF4 A;  4KHZ A;  5KRU A;  1LV9 A;  3BS1 A;  1F9S A;  1MD2 D;  4HAE A;  4CJ1 B;  1NAP A;  2JA8 B;  2F0N A;  3TZD A;  3FVQ A;  5T1G A;  3BDL A;  4K5V A;  3H94 A;  4E6I A;  2F0G A;  4RH6 A;  2F3V A;  1TQO A;  4C3J B;  1KAB A;  3HP3 A;  3VYS A;  4XYO A;  3L7Z C;  3MFG A;  1NSN S;  4HMJ A;  2HDL A;  4C3H G;  4K6D A;  4A3B B;  2A6E C;  1SYD A;  2K1B A;  3FPU B;  1G91 A;  2NTT A;  3J7Y W;  4FVM A;  2SEB D;  4Q5V A;  3HG9 A;  1EY9 A;  2DNC A;  1STG A;  1WTW A;  5C4J B;  4K8J A;  5J1Z A;  2JA6 B;  3I90 A;  3W2D A;  2BA1 A;  2F0T A;  2BOS A;  3R3O A;  4OIK A;  1G6Z A;  1H9R A;  3QOJ A;  5E4X A;  2L12 A;  1A3U A;  1STA A;  5BN3 A;  1KDB A;  3GTJ B;  1D2B A;  1LAC A;  3QG1 A;  1JR0 D;  4IFD I;  4CJ0 B;  1ROD A;  2KEE A;  1UUP A;  1D6E C;  2BA0 A;  2LFN A;  3PO3 B;  4XQJ A;  1ZXT A;  1II3 A;  2RKS A;  1SEB D;  2R93 B;  1TS3 A;  1LTI D;  2XIW A;  1EWH A;  3MXP A;  3PIP 3;  2JEB I;  4A3F B;  3TBI B;  2AQ3 B;  1I4P A;  3ND9 A;  3H6M A;  3HOZ B;  5G3L F;  3RUZ A;  2WKD A;  4IUR A;  3C46 A;  5DM7 3;  2WAC A;  3MWY W;  3F2U A;  4KN7 C;  3M85 A;  2KA7 A;  1O7L A;  1EY0 A;  2C5C A;  2OF1 A;  4KTA A;  1CQV A;  1BF4 A;  4LJZ C;  2K5D A;  2FIN B;  3UI2 A;  1E2Z A;  1BO0 A;  1AN8 A;  1SND A;  1JWU D;  4G7O C;  4KD3 A;  3SE0 A;  1OXT A;  2MHV A;  3OPO A;  4ME5 A;  4QF4 A;  3G6J B;  2F0J A;  2E2H B;  3RD4 A;  2MPM A;  3T16 A;  5KIX A;  2L4N A;  2EVB A;  4DAV A;  5C5M A;  1X32 A;  1SFO B;  3ONA B;  1GHK A;  2X69 A;  3SK4 A;  1R9T B;  3DWA A;  2F0Q A;  3CRL C;  4B08 A;  1D5M C;  3J80 E;  1AP0 A;  1WCM B;  5D3D A;  4IUP A;  3O13 A;  2O2L D;  2NUC A;  3RZD B;  5EQ0 A;  1RTO A;  5CV7 A;  1SNC A;  2NB0 A;  5TSS A;  1VMP A;  4H44 C;  4PQX A;  3V2T A;  5E3F A;  5EPL A;  3KLS X;  1QOH A;  1PTO C;  3OWF A;  3JAM E;  5IGF A;  3HS0 C;  2FMM A;  2PNR C;  1EQT A;  1KLG D;  2F0I A;  1FNW A;  2Z4I A;  5LHY 1;  1X3P A;  1MI2 A;  3GV6 A;  5J39 A;  5C4Z A;  1TS5 A;  2HDM A;  1LTB D;  1WTQ A;  2EY2 A;  4XIG S;  2PW5 A;  3BVM A;  3D4D A;  2AUK A;  1HTL D;  2C9O A;  4J8Q A;  4FXK C;  1JQY D;  2A6H D;  3OWE B;  1SSO A;  3I3C A;  5FK9 C;  2OT2 A;  4A3E B;  3VR6 A;  2EOT A;  4TQU S;  1VDZ A;  4NKL A;  1EL0 A;  5ELE A;  4J1M A;  1PLF A;  5M5Y B;  4R8I A;  3CKI B;  2E2I B;  2E2D C;  4OGQ C;  1PRT F;  5IT9 E;  5COY A;  3A56 A;  1YNN D;  3WOE A;  2ENB A;  4IUQ A;  3ERO A;  1Q12 A;  4DXG A;  1PZK D;  2XNA C;  1PMR A;  1Q1E A;  2WAQ B;  4EQN A;  2B63 B;  4QMG A;  5COR A;  1FR3 A;  1T5E A;  1ESF A;  4KD4 A;  4ZRZ A;  1PTO H;  4C2M B;  2M2L A;  3G7L A;  3PIO 3;  3GTG B;  1F9P A;  1SYG A;  4K5X A;  3BG3 A;  3CRK C;  5IGG A;  1HHV A;  4XTC S;  5AFW A;  1TII D;  4DA2 A;  1I4H A;  2PMZ B;  4X3U A;  4HSV A;  4C3I G;  3D6C A;  3C1E A;  1Q3L A;  2L55 A;  2L1B A;  2QIL A;  1RD9 D;  4UDU C;  4Q0F A;  2NN6 H;  2ZT9 C;  1Y8O B;  3WDN A;  3P7J A;  2FFK B;  1F2Z A;  1WTR A;  3TME A;  3T53 B;  3NHH A;  2K01 A;  3GTM B;  3D6W A;  5ELC A;  4A3G B;  1LT3 D;  1GUO A;  1JOK A;  1XXG A;  5CC4 A;  2RDG A;  1GUS A;  1B53 A;  5CV8 A;  1LTG D;  3KBG A;  3SK8 A;  4QIW B;  4RCN A;  3OHX C;  3FDT A;  2IPK D;  2PZW A;  3MXN A;  5EGT A;  1DM0 B;  4LK1 C;  4ZYS A;  3H0G B;  4KKT A;  4ZK9 B;  1SNO A;  2NN6 G;  1W6J A;  3R2T A;  2K05 A;  1SJE D;  4B9X A;  3E5S A;  3TP7 A;  4F88 A;  2LS0 1;  3R93 A;  3J81 L;  1ENA A;  1LTA D;  1AZP A;  3QOL A;  2JA5 B;  2XSC A;  2D2C C;  4QB4 A;  3S14 B;  1I4X A;  1ML0 D;  3X3M A;  5E4W C;  1G8Z D;  3NWS A;  5CV5 A;  2K03 A;  4EQO A;  2EYP A;  3VYR A;  2CW0 C;  4B9W A;  1JCK B;  2V4D A;  4HED A;  1SE3 A;  1H9K A;  1I4G A;  3W3A A;  2E2J B;  4WJW A;  1HUM A;  4IUT A;  2L0C A;  3NUC A;  2D62 A;  2F0P A;  4A3D B;  1H9J A;  3L3O C;  4L8J A;  5JPN C;  1GXD C;  2N55 A;  5DNF A;  2F0E A;  1SNP A;  2IX1 A;  3MA2 B;  1O80 A;  2NBF A;  1HFN A;  1MBY A;  4P2C B;  2WV6 D;  5EBD A;  1A15 A;  4HMI A;  2TSS A;  4UAI A;  3P20 A;  2K5W A;  1KDC A;  4KHV A;  4ZUI A;  3GTK B;  4XYQ A;  3HGB A;  3K59 A;  2XN9 C;  1K83 B;  3S1Q B;  1L0Y B;  2ZXO A;  5KYI A;  2A6H C;  3HEJ A;  1EZ8 A;  1LTS D;  2GA4 B;  5D65 A;  1CFM A;  3OOC A;  1NUC A;  2RDF A;  3OSO A;  5I9O A;  2NZ1 D;  5FOB B;  4RKB A;  1OXX K;  1TWH B;  4JBW A;  3HOW B;  4BY7 B;  5DAU A;  4ID6 A;  2Q8T A;  3VR4 A;  3BVZ A;  5M9O A;  3KBX A;  2VB3 X;  3K0Y A;  3E0J A;  2I46 A;  1MGS A;  1YNN C;  3HRZ C;  1PDQ A;  2EYO A;  3NQI A;  1SMY D;  2SDF A;  3PUX A;  2DY7 A;  3AU7 A;  1Y69 U;  5IIF A;  2B39 A;  4FF2 A;  4C3J G;  2QDB A;  4LMQ D;  2EJG C;  1EU3 A;  2F0V A;  3OMC A;  1XWE A;  2E76 C;  3PMF A;  4AYB B;  3MXU A;  3R2I A;  1V1P B;  2Y0S B;  4G7Z C;  4XT1 B;  3K5M A;  4EVO A;  1DOK A;  2MGS A;  3NK9 A;  3ITP A;  4RHS A;  3LNN A;  2D5D A;  4KJN A;  2HUG A;  1ESR A;  3Q6S A;  1QG7 A;  3SK5 A;  2F03 A;  5KND A;  3J80 L;  3KLR A;  3IKJ A;  3A7L A;  1ZEQ X;  1VCI A;  4NDX A;  1BCP F;  5A35 A;  3DEP A;  2AQ1 B;  1TT2 A;  3S2H B;  1IYV A;  1B50 A;  2DY8 A;  5EJW A;  2R61 A;  4PMB A;  3LWE A;  3JAM L;  1PXU A;  2JE6 I;  1A3T A;  2WKC A;  1KAA A;  2K5Q A;  2X6G A;  4EQP A;  4K5W A;  2ZXP A;  1EU4 A;  3SXH A;  3MXG A;  1RCV D;  3NPP A;  2R6G A;  1BCP B;  2F0M A;  2IWH A;  4KV6 A;  5C5L A;  2XWJ B;  3DWQ A;  4CGY B;  2KEC A;  1AFP A;  1HQR D;  1HCZ A;  1XTC D;  1YNJ C;  3VR2 A;  3GQB A;  2MP1 A;  5IOC A;  2B8F A;  5C0X J;  3GP7 A;  3EFX D;  2PYK A;  2QKI C;  5I6W A;  1SNM A;  2IT1 A;  1EWC A;  4O42 A;  4CKC A;  5FO8 B;  4N9T A;  3I4M B;  3M4O B;  5EPK A;  4XQQ A;  3LWU A;  4DAY A;  3GTP B;  4PMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...