2DY7A

Solution structure of the first chromodomain of yeast chd1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
81
structure length
81
Chain Sequence
QPEDFHGIDIVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHNTWETYESIGQVRGLKRLDNYCKQFIIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chromo domain protein 1
publication title Structural Polymorphism of Chromodomains in Chd1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 9
structure length 81
sequence length 81
ec nomenclature ec 3.6.1.-:
pdb deposition date 2006-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2dy7A00
2B2YC 2KECA 3TZDA 1NR4A 2D9UA 2XIWA 1VMCA 3G7LA 4UAIA 4CJ0B 2K04A 1ESRA 2B2UC 2MGSA 1O7YA 2HDLA 2L11A 2K28A 2RVLA 5T1GA 2HUGA 1F9PA 2KOLA 1MI2A 1HFGA 5CBEE 1DZ1A 5EKIA 4IUTA 3DEOA 1HUMA 1U4MA 1AZPA 2B2WA 1MSGA 1DONA 4X3UA 4IUVA 1O80A 4R8IA 2JYOA 2KEEA 1NCVA 2J7ZA 1XX8A 1RHPA 2L4NA 2CVRA 2L12A 1G2SA 3N52A 4IURA 1J8IA 1PFNA 2BDNA 1F2LA 2H1EA 2MJ8A 1B4OA 3FDTA 4ZLTF 2MP1A 4NW2A 5DNFA 2N88A 5EPJA 3I8ZA 4ZKBB 2M2LA 1Q3LA 4ZK9B 1JICA 3R93A 5EQ0A 3DM1A 2B2YA 3ONAB 4IUQA 2K1BA 4MN3A 1WVLA 1CA5A 2VXWA 2B2UA 2X6GA 4X3KA 4CJ2C 1EIHA 2DY7A 1MGSA 1IKMA 2Q8TA 1WTQA 1BBXC 1G91A 5E4WC 1F9SA 4X3TA 2FMMA 2NYZD 2NWGA 4RAUC 1A15A 1IL8A 2B2TC 1HA6A 1DOMA 1KNEA 1RTOA 1NR2A 5E4XA 1S4ZA 1CM9A 2KEDA 1X32A 1AZQA 3LWEA 2EPBA 2RSOA 1PFMA 1HFNA 5T1IA 4DN4M 2EOTA 3I3CA 1WTOA 1DOLA 5COYA 1EL0A 4O42A 1GUWA 1B3AA 1EOTA 2B2VC 4ZKCB 2SDFA 2K03A 5EPLA 4IUUA 4HAEA 1EQTA 1AP0A 3KUPA 1JE4A 1WTWA 1F9QA 4CJ1B 1M8AA 4IUPA 1C8CA 1WTXA 5D14A 1HHVA 2EE1A 2X69A 2Q8RE 4QUFA 1X3PA 1U4RA 1F9RA 2FFKB 5AFWA 2L9HA 2IL8A 1KNAA 2B2TA 1QNKA 4QUCA 4ZAIA 3UI2A 1EIGA 1B53A 4MHEA 2MPMA 1U4LA 4HEDA 2R3ZA 4RWSC 3D6WA 3I91A 4OIJA 5JJZA 1WTPA 1ML0D 3I90A 1G6ZA 1E0BA 2HCIA 4HSVA 3SVMA 2DY8A 4XDXA 2B2VA 1U4PA 2X6LA 3IL8A 1MSHA 5CBAE 5CORA 1ILPA 1NAPA 4XT3B 1WTVA 1VMPA 1RTNA 1LV9A 2K05A 1B50A 1SSOA 5EJWA 1RODA 1SAPA 2HDMA 2L1BA 2KUMA 1B2TA 5CMDA 1RJTA 1X3QA 1ZXTA 3GV6A 3KBXA 3TN2A 2K01A 3P7JA 4RA8A 1QG7A 4XT1B 2RA4A 1TVXA 5D65A 2JP1A 1BNZA 1BO0A 2FHTA 3FPUB 3F2UA 1DOKA 2HCCA 1IKLA 1PLFA 1WD0A 1HRJA 2FINB 1ICWA 2N55A 3HP3A 1BF4A 2B2WC 4LMQD 1QE6A 1ILQA 3IFDA 2NZ1D 3QO2A 1PDQA 1WD1A 1O7ZA 3Q6SA 2FJ2A 1XYIA 2KVMA 3H91A 4X3SA 1WTRA 1G2TA 1PFBA 3MWYW 2RSNA 3DEPA 3MTSA 1HUNA 4U68A 1J9OA 5EPKA 4HCSA 4OIKA 1CA6A 3GV3A 4R9WA 1SDFA
chains in the Genus database with same CATH superfamily
1JT8A 3K7UC 1LTTD 3KDFB 5GQOA 2HDLA 2WAQG 2NVTB 3CXCA 2E76C 1PA6A 5K36H 3QB3A 2DNEA 1JMCA 4NXML 2J7ZA 4HTHA 3KJOA 2CFMA 2GVBA 3GTOH 1J8IA 1AZQA 4ZLTF 5IE8A 2I07B 2RHSB 3K5OA 4OWWB 2R93G 2H4OA 4IPGA 4DFAA 2JA6G 5NUCA 5BN5A 1SN8A 4A3BG 4RGTA 3SR1A 2ZT9C 3BS1A 1CI3M 2A6HD 3OOCA 5FLXL 1IKMA 1J6QA 3R3OA 1STGA 3CCUA 4M1UB 1M4VA 3A8KE 1OTCA 2NYZD 4K8IA 1B9MA 1DOMA 3FEWX 1ENFA 2YTYA 3P1HA 3KFUA 3OMCA 4JI8L 4LFBQ 1L1OB 3CCJA 4A3MH 2MNAA 1PMRA 4EQOA 5C4JH 1PRTC 4XIGS 1T5EA 4HAEA 5KNDA 1I50B 2A68D 3K7AH 4IUPA 4G7ZC 2VW9A 1FYCA 4LF4L 3NUCA 5C44H 1Y1WH 1A3TA 4KY5A 2ZJPA 2L9HA 1K73C 4AYBB 2UUCQ 4DUYQ 4RMFA 5H1SE 3TEHB 2F0WA 3OHXC 5IYBH 5C0XI 3NEMA 4RGMA 3TP8A 1A62A 1E0BA 3T4AC 5IYDH 3T51B 3R2IA 5CORA 4QF4A 4JBMA 4JI3Q 3CPWA 2VZAA 1D7QA 1RTNA 4ABNA 3TP5A 2V1CC 4UDUC 2EVBA 3QIAA 5EJWA 4YWMA 1SAPA 3MC0B 1SE4A 1CK1A 5L37A 2IW3A 2LMCB 3FKIH 1HQRD 1Q8KA 1SEBD 3K58A 3RNUA 1W2BA 2UXCL 2FHTA 1B7YB 4OHJA 4A3LH 3C1EA 4DK0A 3KF6B 3N6RA 3GTQB 3QO2A 4DXFA 3M4QA 2VQEL 4MZ9A 1PZKD 1Z7TA 2JA5H 1WTRA 3BU2A 3NBHA 3HOUB 4Z9CB 4ODGA 4DV4Q 1G291 4IPHA 4HMIA 3GV3A 3BZDB 5FOBB 4DR3L 4EX5A 3BDLA 3IKJA 1SROA 1EY0A 2MGSA 5KEEA 2HHHL 1RF2D 2ES2A 4KHPL 4YCVA 1PH4A 2KCCA 4OWTB 3H15A 1RKNA 5IGDA 3S15H 2BCOA 2JA8B 5CV8A 4C2MB 1S5DD 1IZ6A 3S24A 1LLRD 2XN9C 1XTDA 4NW2A 4O0AA 2YTXA 2K1BA 4WJ3M 4NB3A 2XNAC 1SNOA 3CCQA 3D0FA 4X3KA 1HQMC 2K7VA 3EN2A 1MGSA 1HA5A 4JI5L 4RAUC 1VF7A 1IW7D 5C0XH 5GADC 5E4XA 4KJOA 2AHOB 5IT9L 1NTGA 2RDHA 3FHWA 2ZXOA 4JK1C 3TS0A 4IFDJ 1HFNA 2VB3X 3NHHA 2CW0C 4YY3Q 1N8RC 1I4PA 3P75A 4C3JH 5COYA 2NN6G 2SOBA 1V1PB 4RG1A 1SFOB 1EOTA 4GOPB 1A3VA 2ICIA 1WTWA 1HNXQ 1JB7A 4YCUA 4Q0FA 4DK6C 4OO1H 3CQZH 1HHVA 4ULLA 1SR3A 4QUFA 1C0AA 2RCNA 5HURA 1KNAA 3OIPA 4QUCA 4DV5L 3UI2A 4TRDA 4OL7A 4KKSA 4MHEA 4ZRZA 1U4LA 4A3CH 4XQNA 4K14A 1WTPA 1PH6A 2B29A 2SNMA 1D2BA 4LF9Q 3AMUA 1HR0W 1JOKA 1LT3D 4B3ML 1SBBB 3T1HL 1PV4A 3HOZH 1NAPA 1B1ZA 1GKHA 3SK5A 2VUMH 5C3WA 3BG3A 4B3TQ 2EYHA 1K0RA 1BNZA 4BBSH 1FGBD 1N32Q 1KQSA 3NBIA 4LW1A 4DU9A 1TQOA 4Y52H 2FINB 3GTLH 1XMOL 4IFDG 1ILQA 2WIIB 4Y7NB 1EOVA 1O7ZA 1WD1A 1WCMH 3A5ZB 1H9JA 4X3SA 3O13A 1G2TA 3C1FA 2EJGC 4IO9A 4U673 3PO2H 3NK9A 2B2YC 4NXMQ 1EYGA 2OWOA 2Z6KC 1JE5A 5T1GA 1TWGB 2VB2X 1TXYA 4DGZA 5IYCG 5ELEA 4MTNA 1V1OA 5CV5A 4F88A 4L8JA 1DONA 4C3IB 3K59A 4BY7H 2BA1A 2QW7A 3VYUA 2G5DA 2RDFA 2H1EA 4DR5Q 2UXBL 3DM3A 2QGQA 4ZKBB 1Q86C 1N36L 2B8GA 4HMJA 2IHFA 5LMUL 2O4XA 2Q8IB 4I7AA 4JI7L 3S2HH 1I3QH 4JI8Q 1YHAA 4JBJA 3PF5A 2HQLA 1LTGD 4L6TB 2NVQH 1Q46A 5DLQE 4C1NI 3H94A 2NWGA 4B3SL 1EY8A 3CCSA 2ID0A 2IWHA 3U4ZA 3HFZB 1CM9A 2BE5C 4B08A 4B9WA 5EKKA 4A3FB 1AFPA 3T13A 1EFWA 4LF4Q 1D1IA 3I3CA 1CSQA 2E2JH 3HKZE 2QDBA 3S1RB 4KN4C 2ENBA 2UU9Q 4WJWA 1JORA 1M8AA 2QF7A 1OXXK 1RDPD 1YI2A 1HNZL 2IL8A 1PRTD 1H9MA 1EIGA 3UDIA 2RQXA 2MPMA 1I6HH 1H9SA 1SJHD 2NUCA 5IGGA 1TT2A 2L55A 2VQFL 2R93H 4X64L 2QILA 3ER0A 2EQSA 4KKTA 4XDXA 2JA6H 1BCPF 2WINB 2UXCQ 2F1MA 4A3BH 4DNTB 2IT1A 1LV9A 3A7AB 4JOIC 4XYQA 2KCNA 4R4QA 2JE6I 2JA9A 2VQEQ 2Z9HA 1HR0L 3MHBA 1BO0A 1JC7A 1BUVT 1GHJA 3FPUB 4JG2A 1IKLA 1WD0A 3K5LA 1HCZA 1HRJA 5IGFA 2N55A 4H02A 1YVCA 2RDGA 5M3FB 4PZ8A 4DXGA 2HHHQ 4HJAA 4KHPQ 2EY6A 2EYMA 2JN4A 1ASYA 1B3QA 3S1MH 2RF4A 4DV3L 4LFAL 2YV5A 4N9TA 4XTCS 3U58A 3A0JA 1HNWL 4PMBA 2B2WA 1WFQA 3I70A 2PW5A 4JI2L 1CQVA 3F1ZA 1JJ2A 1TY2A 2CVRA 1G2SA 2GN5A 2VY3A 4K2KA 4JI5Q 1AN8A 2EJFC 1JICA 5GAHC 3DM1A 1D6EC 4ZYSA 3R8BA 1YNXA 1R4PB 1T9HA 4G4KA 5EBCA 1XTCD 2GVAA 1A0IA 2N49A 4A3GB 1WTQA 3S1QH 3TP7A 5D3DA 5E4WC 2EIFA 1VQ8A 3UDGA 4GLAC 4CDDC 3M4OB 1TWHH 2EXDA 2UUAL 5C3XA 1UE7A 1PTOB 4DR1Q 1JOQA 4DV5Q 2F0DA 4ZUJA 3S14B 3K0XA 3GP7A 1CKNB 3HOUG 1EEFD 1CQFA 4MNOA 5F2DA 1Q8IA 2O2LD 1HZBA 2EY1A 5IP7G 4B3MQ 3GTGB 1TS4A 4JPBW 4GKKQ 2K4KA 3H0GB 3T1HQ 4HN7A 4RGOS 4HSPA 4KI0A 1UWVA 3OW7A 3QOJA 5I6YA 1V1QA 1ML0D 4HJ7A 1EY7A 3BVZA 1R9TB 3M3YH 3GTJH 3LGJA 4JW0A 3ERQA 4FYDA 1WTVA 1P16A 1XMOQ 4YHHL 1E1TA 4R1JA 3QWNA 4NXNL 1VQMA 1YBYA 3DWAA 3L7ZC 1CFMA 4YCWA 4XT1B 5ELCA 1TR5A 2K52A 3OTOL 3RZDB 3J81j 5CC4A 2HIXA 1UE6A 1A63A 1H95A 5FLMG 2E2HB 2NN6H 3I4NB 4A3JB 1CHPD 3Q6SA 2QA4A 1YHQA 1S5CD 1HH2P 4K8JA 3HOXB 3AB9A 4U68A 3RD4A 2R7FA 3E6ZX 2KECA 1VMCA 5M5WH 2MQHA 3H6MA 2UXBQ 4WJ4A 1L0WA 1WTHA 3MXNA 1YIJA 4IUTA 3DEOA 4ZQ3A 5LMUQ 2XTIA 4JI7Q 1L0XB 1NY4A 1V8QA 2F0FA 2L4NA 2BA0A 1D8LA 3EA6A 4YWLA 5FJ8G 3C2PA 2BDNA 3CMAA 5I9OA 1AW7A 5CR3A 3GD7A 5M5YB 5CV6A 2HQEA 2A8VA 4DNRB 5M5XH 2LSSA 3FPPA 2X6GA 4AQYL 2E2IB 1G91A 1EWIA 1STBA 2B2TC 2QDLA 3E9HA 3OWFA 5E3FA 1HA6A 4IFDH 2F0EA 4LK1C 1S4ZA 3HG9A 1X65A 2RSOA 4K5WA 1TWFH 1E22A 2CHBD 1HNZQ 1B44D 1Z9FA 5BR8Q 1BKBA 2KQ3A 4CDEC 3EROA 2BE5D 1F9QA 4PZ6A 3CKIB 3L2PA 4AIMA 4RHSA 2OTJA 2VQFQ 2YU9B 3T56B 2A69D 4A3DG 1FR3A 1SE3A 3AEVA 3HOVB 3Q23A 1SYEA 1IXRA 2F0GA 2C9OA 4LF8L 2HCIA 3AFPA 2JK8A 3BJUA 3W3AA 1X3EA 1HR0Q 2L5TA 4OEMB 2F4VQ 3HZXA 4C3HG 4J1MA 3KLRA 1PTOD 2E74C 4S3SA 1S5BD 4PG3A 2PQAA 1XMQQ 1DJRD 2IJ0A 1GD7A 4JV5L 1PYBA 2F0HA 3J7A5 2CCZA 1J5EL 4DV3Q 5CV4A 3MXGA 2XWBB 1ET6A 1UEBA 1PDQA 2CWPA 3CW2C 1CKMA 1W3SA 2L15A 1YNJD 2EJMA 1ZYRC 4LF6L 1X9NA 2DJGC 3MTSA 5JVH3 4IALA 5KYLA 2F52A 2D9UA 1TS5A 2PMZB 3VR2A 2B2UC 1JJGA 3C46A 5JAVA 2NVTH 1UUPA 1F9PA 1Y8NB 1DCZA 1JOOA 3I55A 4IUVA 4Q5VA 1SYBA 2GA4B 3NP8A 1CKOA 1OXTA 5BN3A 1FJGQ 2KHIA 2I5MX 1PH1A 5IIFA 3I4OA 2ATWA 1BCPC 3R93A 1H9KA 2CH4A 5FO8B 2B2YA 4IOCA 4HIMA 3NXWA 5JEAG 2A6EC 1VQ5A 3M4PA 1EQRA 1XPUA 2O5IC 1FD7D 2Z6KA 3H3VI 4A3EB 4L5SA 1VQJA 3S17B 3A56A 1WJJA 4DNIA 1IBLQ 2KCMA 1RCVD 3PCOB 1C4QA 1G8ZD 1H9SB 1Y1VB 1LUZA 3GO5A 1KIXA 1RD9D 4X6AH 1JQYD 1JR0D 5IGCA 1WTXA 2EE1A 1OO9B 4DR4L 4HR7B 2ZJRA 2K5QA 1PH5A 3HEJA 3K57A 2F3WA 1WYDA 4FNFA 1U4PA 2BDOA 4GZYC 3MXPA 3OPOA 5C4XB 3VR4A 3TP6A 4DUZL 1K8MA 1B50A 4APVA 4OX9Q 2L1BA 2KHSA 3ERSX 3NTKA 4DK1A 2RCFA 4IJHA 1JCKB 1EUJA 4GNXB 2ZM6Q 4JI4Q 3GTQH 1KTKA 1QE6A 2F03A 3SK8A 4RKBA 3GTOB 2NBFA 1FL0A 1XNRQ 3HOUH 2KVMA 1PH7A 3P20A 3ICEA 1EYDA 2QEJC 3LNNA 4JOIA 4KY7A 4ME5A 3HOWG 5IP7H 2OQ0A 4FDBA 3G7LA 2AMCB 2JSOA 2K32A 2UUBL 1YJWA 4DV2L 2PI2E 3TSSA 1VQOA 5C4ZA 4UHVA 3TDQA 1IYUA 3F2CA 4C2MH 3A74A 3ULJA 2EYPA 4JCVE 1LTLA 3GTMH 2F0VA 5IGBA 1JWUD 1PFNA 1F2LA 3NWTA 2MP1A 3ND9A 1PHJA 3S16B 4DF7A 2B63B 4LNQA 5EQ0A 1XWEA 3K7AB 3GTPB 3FP9A 4MN3A 4FF3A 1Q90A 5E7NA 2I0QA 3JAMc 1EIHA 1E24A 1G6PA 1LYLA 2OQKA 1IBKQ 4DAMA 1MKHA 2D2CC 1QNUA 3BVGA 5FLMH 1K3RA 3J80i 2EYLA 2F3VA 2R6GA 4GLXA 3TBIB 2NVXB 1NE3A 1SYFA 4DV6L 4P71A 3CP0A 4DN4M 1VS0A 1WTOA 3F2DA 3I4NG 4A3JG 3CCMA 1SFOH 4O42A 1GUWA 2NTSA 1U5KA 2SDFA 2A5HA 1HZAA 4NP5A 3HOXG 1XNQL 1PRTB 3X3NA 3KK7A 2Z6BA 2PMZE 3RLFA 1U4RA 1FNUA 3NSWA 3FKIB 2MHVA 1LTRD 3S1NH 1AE2A 1TWCH 3CU7A 3FRPB 5FO7B 3SE0A 4WORA 1QILA 5ELOA 5FJ8H 1XJVA 1G6ZA 3V2TA 3EIVA 3M7GA 4QL5A 2XSCA 4A3IB 4DR7L 3ITPA 3VR6A 2IX3A 4G7HC 1ICFB 4A3KB 1M1KC 2N78A 4DV7L 5HY6A 2K5DA 1VQAA 2C35B 3KJPA 1J5EQ 2PZWA 1GVPA 4NDXA 1TVXA 1VQCA 3I4MB 3SXHA 3C3LA 3J80E 3CC2A 3IFDA 3MXNB 4Y7NH 1X3FA 3QJYA 1PFBA 3S2DB 3PSIA 2J0TD 4X65Q 5CV9A 3R2TA 5KRUA 3SEBA 1QVCA 4A3DH 4CJ0B 2K33A 3CAMA 3U9OA 2L11A 1ZYRD 3CC7A 1PH2A 4A93G 2KOLA 2NVYB 4JI1L 4L5QA 4JYAL 5EAYA 4C3IH 3HOVG 1GXDC 1U9RA 4PNYA 4R8IA 1IBML 3BVMA 3OMGA 5DAUA 4C3HH 1UE1A 1LTID 1VF5C 3GDEA 1K0SA 1EY9A 3J81c 1VQFA 2K5WA 2JJQA 3SDZA 1AEXA 1FVIA 3KLSX 2VXWA 3VR5A 1EFID 1L0YB 4CJ2C 3K0YA 4X66L 3V96A 3EQLC 3LX0A 3STBC 4JVZA 1A15A 1ZKOA 1KLGD 2A19A 1RTOA 1KNEA 4AYBE 3AFQA 4BBRG 2NTTA 3L9AX 2NZOA 2A6ED 4DAVA 1KD1C 3MAQA 5D3IB 2R7DA 3I72A 4DR4Q 3SGIA 3KLWA 2N8NA 1VQ4A 4X62L 3S1RH 1I94L 1JE4A 3UE1A 5K5PA 2VUMB 2AUKA 2MO1A 3QOLA 3PMFA 4IZ8A 2F0QA 4KLKA 3B6YA 2BOSA 4KTAA 4BBSB 2B2TA 3MA2B 3NELA 4KV6A 1SYCA 4PQXA 4DR2L 1F2YA 2VL6A 3A8JE 1GUTA 1TWAB 3CRLC 2DN8A 2X6LA 1BOSA 5JEAH 4GN3B 3OIQA 1X3GA 4DPGA 5BN4A 3CCLA 4JBWA 3CD6A 1KDCA 2ALYB 4LFCL 2Z4IA 4RA8A 3L0OA 5G3LD 1TS2A 3MFGA 2Z0SA 3D4WA 4DV0L 2R92B 4QB4A 2PZTA 4LMQD 1MIUA 1VQKA 4BY7B 1QCBD 3NPPA 1OXUA 4OELB 5FLXc 2EYJA 3PGZA 3A5UA 4DV2Q 3MWYW 3G6EA 2LY7A 3PO3B 3KDFA 4K5XA 1BBUA 3CCVA 1CA6A 2F0MA 2G9DA 4QCLA 2RVLA 2P5ZX 1VQGA 2NVQB 5JJIA 1EZ8A 4JI6L 1CHQD 4C1NK 1MSGA 3IAYA 4P72A 2XVSA 4DR3Q 4IJLA 1N9WA 4LF5L 2KEEA 3OW2A 3E0JA 1B4OA 1QUQA 4IUNA 2E2JB 1XXGA 2LXKA 1PZID 2N3SA 1CA5A 2Z4HA 2WAQB 1KRTA 1II3A 3G4SA 1QWYA 2B2UA 4KK7A 5EBDA 4DV6Q 2UXDL 1K28A 2DY7A 2PW7A 1DYQA 1BBXC 3RLNA 3J81i 1P8LA 4UP9A 1S5FD 4IPDA 3J80L 4L5RC 4AYBG 4DAYA 5IGEA 1XNQQ 1PFSA 3M4OH 3ULPA 1N34L 4DAPA 1PTOH 1OXSC 2OTLA 1QJOA 3S14H 1EL0A 1A2TA 4DK3C 1STHA 3I7FA 3HOWH 5EPLA 1F2ZA 2B3GA 5J22A 3PIP3 4G57A 4LJZC 3H09A 4N8FA 1EIYB 3W2DA 1K8OA 2Q8RE 1AE3A 1X3PA 3EVQA 3GTGH 3HGBA 1Y8PB 4DR7Q 1ENAA 1SMYC 4HEDA 3IRBA 3D6WA 4DV7Q 3S9WA 2KA7A 2OT2A 1SMXA 1B9NA 1R9TH 1LT4D 4ME3A 1QZGA 1VDZA 2DY8A 3W5OA 1WI5A 1QVFA 3Q24A 1IYVA 1MJCA 1C9OA 2KENA 2B63G 3WDNA 2KCTA 2EXZA 1RODA 2FXQA 2CW0D 1X3QA 1DXMA 5D65A 3J81E 2CKZB 2IX0A 1PLFA 5IODA 4FVMA 2E2HH 4AH6A 3I4NH 4A3JH 1YJNA 1TS3A 2A6HC 2JA8G 4KMUC 2KJXA 1PVOA 3HOXH 2EYFA 3NQIA 4JYAQ 4OIKA 2LKVA 1E2ZA 2Q2HA 3TS2A 1DGSA 1SDFA 3L3OC 5IT9c 3RZOB 4UAIA 3NBHB 4NKLA 3DWPA 1K83H 4YIJA 2ZTCA 2KHJA 2F0SA 1Y69U 4BA2I 2AWOA 5EKIA 2B39A 3VA7A 4B3RL 3FVQA 3D8GA 2A68C 3K81C 2OXPA 5ELFA 4V190 4X66Q 1KDAA 4L63B 5HGTA 1RL2A 4I65A 5JJLA 1L2FA 4A3IG 5M5YH 2M2LA 4A3KG 1GO3E 1WVLA 4LFBL 1CZGA 4KHVA 1QOHA 3GTKB 4X3TA 2FMMA 2F0TA 4X62Q 2EDGA 2QKIC 2XWJB 3I4MG 2D62A 1N36Q 5C3EB 1PH3A 1EEID 5J3BA 1NMGA 2D0OA 1GJXA 1TKWB 2EOTA 2CWAA 1YJ9A 1GM5A 4DUYL 4C56C 4B3SQ 2K03A 4BY1B 1VQ6A 4WRDA 1X54A 1EY4A 2Q2IA 3PUYA 5C4HA 2X69A 2YU9H 4A93H 1S3OA 4H0LC 1F9RA 5DM63 4GN5A 4BS9A 3I56A 3J7AF 1B53A 3HOVH 2JEAI 2R3ZA 3HKSA 4I7ZC 2VNUD 2D5DA 3J7YW 4P75A 1VQ9A 2A73B 3TQYA 3NTHA 4DKAC 3TZUA 1SNPA 4FF1A 1KAWA 2ICEC 1KDBA 4F8MA 4DV0Q 3M85A 2QEXA 4QGUA 1X56A 3DHQA 4BBRH 4X64Q 4H44C 4DV4L 3F2UA 2VS1A 2WB1B 4KY6A 3W1BA 4KKUA 2R7ZB 1Q1EA 4C3IG 2EYOA 4N8X1 1VQNA 2HT1A 1EQVA 2RSNA 2QCPX 1IW7C 4TSSA 2D0PA 3HOYB 4LAAA 4CGYB 1LT6D 1EY6A 3PIOA 4GS3A 1LT5D 1O7IA 2F0OA 3MXUA 2F0LA 4QJFA 4UP7A 1HUMA 1U4MA 2ZTEA 4B9XA 4EGVA 2IPKD 2K75A 4LFAQ 4IURA 4QIWB 3ZJYC 4A3FG 4LUOA 5IP9G 1A3UA 3SK6A 3I8ZA 2E2DC 1HNWQ 2AWNA 5EKLA 1N34Q 1GOZA 2JA7B 4JI2Q 4YY3L 4XXEA 2IX1A 3PQIA 3WOEA 3J81L 4R4OA 3S17H 2WV6D 5M3MB 4FXDA 1K9MC 1L1OC 4RKLA 2JXMB 2AQ3B 3LWEA 1EYCA 2R92G 5T1IA 3EJIA 1SYGA 4TQUS 1EU3A 2XRSD 5KNCA 4A75A 3PO3G 1A6XA 4CJ1B 3K8AA 5A2QE 3PIPA 2Z1CA 2UUAQ 4GNXC 4NPSA 3OYYA 4OONA 4XYOA 2E5LL 4P74A 4RCNA 5CV7A 3I91A 4OIJA 3PV0A 4MIUA 2HD3A 4HJ5A 1BR9A 4HSVA 1C7YA 2I5LX 5M3FG 1SMYD 1VCIA 4POGA 2PYKA 5C4XH 5IWAL 4LF7L 1I50H 4HCEA 4L5TA 4PMWA 4IOAA 3MZ5A 2DUDA 2IY5B 3GV6A 1PTOF 1KHIA 3KOJA 3VYTA 1Z47A 2PO4A 3HP3A 1WOCA 4YHHQ 1E3PA 1RIPA 3NENA 3KBGA 3RLOA 2PNRC 3Q8DA 4NXNQ 3T16A 1PYWD 2FJ2A 1N33L 1SRUA 1XYIA 3UE0A 2AKWB 4KHZA 4GLVB 3OTOQ 3H3VC 5GAGC 1JWMD 2NZHA 4B3RQ 1HJPA 2K5HA 1QUQB 1GUSA 3TZDA 1PYSB 1MJEA 1O7LA 1ESRA 4DR5L 2K28A 1UNSA 3EBEA 1EQQA 3BDCA 2OCEA 2HUGA 1EZ6A 5CBEE 4A3GG 2F3IA 4H7BA 3D4RA 1UEAB 1K8AC 3VR3A 2G9HD 4DAYB 1E2VA 2MJ8A 3S16H 2Q2UA 2B63H 1Q3LA 3AYHB 1SE8A 2A74C 3A55A 3GTPH 2WACA 4MTKA 5I9PA 2K50A 4UPAA 4E6IA 3H3VH 1EWHA 3A54A 1BCPB 4KN7C 2Q8TA 2CQOA 4CKCA 1HUNA 1VQHA 1DD2A 2UU9L 3PUVA 2NVXH 5IY0A 3H0GG 1SE2A 1LABA 2DGYA 2JQOA 2WB1E 2EPBA 4QY7A 2JA8H 1CKNA 4GOPC 4AQYQ 1HTLD 3Q0AA 3A8IE 1E2WA 4A3MB 2B2VC 1QVGA 5C4JB 4IUUA 2EY2A 1EQTA 3K80C 1EYAA 1VQIA 5FKAC 1KAAA 4OO1I 4N9PA 5C44B 1Y1WB 3K5MA 1SNCA 4CHTB 3EFXD 4F7XA 5JJZA 4UP8A 1F2MA 1LACA 2Y0SB 2AQ1B 5LL6X 4A3IH 3JC66 3HKZB 4QIWE 3BYTB 1I4RA 1ESFA 1MSHA 4A3KH 1VMPA 1T5XD 2HDMA 4LF8Q 5I4DA 1STYA 4IPCA 3TN2A 1VQBA 1QG7A 4FXGC 2RA4A 3I4MH 4YWKA 2AUJD 3G71A 2YTVA 1SJED 5ELBA 2NZ1D 1IYJB 5C3EG 4PMCA 1TY0A 2I46A 3RUZA 1QZHA 4EQNA 3GTMB 1BQQT 4DV1L 3S2DH 4JV5Q 2O5JC 3WOFA 2JA5B 4QQBX 2K5VA 5FO9B 5A2QL 4BY1G 5JJKA 4R4TA 1VQEA 3DMUA 2XIWA 2K04A 1EWCA 1O7YA 3CHBD 3TREA 1SNQA 3U9SA 2NVYH 4ALPA 4ZUIA 4EQPA 5LMNW 1SXTA 1XPOA 1MI2A 1BVSA 4LF6Q 4EVOA 4CKEA 2F0UA 3MEFA 3RN2A 3DXJC 2HIVA 3NE5B 5FK9C 2E75C 5JPMC 3S15B 1PH8A 2LFNA 1NCVA 2ZXRA 1RHPA 4HJ8A 3VYSA 5DNFA 1U0LA 4HIDA 3ONAB 3ZYYX 4DR1L 3AU7A 5KNBA 1GUOA 4FF2A 3S1NB 2ASBA 5AJ3L 1TWGH 1TWCB 1IL8A 3NWSA 1NSNS 4DR6L 2F4IA 2F0KA 1SNDA 2OF1A 1W6JA 5KIXA 2WB1G 2RKSA 3I73A 4GKKL 4C3JB 2R7ZG 2E5LQ 3E3XA 1BXTA 2PZUA 1QB5D 1AP0A 2K6AA 2PI2A 5J1ZA 2PPBC 4TKOB 3HOYG 2EY5A 3OSOA 3D4DA 3CQZB 2FFKB 1NNXA 1W6KA 5KYIA 3Q22A 4ZAIA 3J7ZC 4RWSC 1BCPD 5IWAQ 4LF7Q 4LUZA 5DEHA 3D31A 1IL2A 4GKJL 4A3FH 5IP9H 3JAMi 4UY8C 1UAPA 2PQEA 1FGUA 3OWEB 1TWAH 1V43A 1GUNA 1SLJA 5CBAE 1KC8C 3HOZB 3UDFA 3PUWA 4WFN3 1Y14B 4P73A 1CTMA 4A3DB 2R61A 2KUMA 3W1GA 1ZXTA 2JA7G 5I6WA 4HJ9A 1N33Q 2JP1A 3KF8A 2C5CA 2PQAB 3RMHA 2R92H 3GQBA 5M3MG 3CCEA 3GTLB 4DUZQ 1BBWA 1Q12A 4POFA 3CF5A 4C3HB 5JOBA 3PO3H 1WCMB 2MFIA 2BH8A 2A1AA 4G7OC 4O2DA 3I2ZA 2F0JA 4HCSA 3PO2B 2IHEA 1NR4A 2M00A 3D6CA 2WKCA 4NMZA 1YNNC 3UDXA 1X55A 4P2CB 3T53B 5ISRA 4A3EG 2BH2A 3AQQA 2ZTDA 5M3FH 1KL9A 2Y0SE 1CUKA 1XX8A 3BZCA 3N52A 4K6DA 2L12A 3JAME 3FDTA 2A69C 2UUBQ 2N88A 4IQZA 5LMNL 1Y1VG 4ZK9B 1PZJD 1VQLA 4RHRA 3V05A 1S5ED 2AQ2B 3PIO3 1I3QB 1ZEQX 4JI0L 3S2HB 4FXKC 3T1YL 2CQAA 1GUGA 5BR8L 4J6HA 2J4XA 4FP5D 1KXLA 3E0EA 1KLUD 4RGNA 1I4HA 3ULLA 1PTOC 2SEBD 1X32A 1PFMA 3KLSA 1XPRA 3BYYB 5CGKA 3D3RA 4ZKCB 4BXXG 2F0IA 3KUPA 1HPCA 3DUZA 5D14A 2TMPA 3K6OA 1ET9A 5C5MA 1GHKA 5AFWA 4A3GH 1YNJC 4R8NA 1QNKA 2F4VL 5I2XA 5DM73 5TSSA 1L1OA 1I6HB 1HZCA 1CZWA 3X3MA 3VYRA 1XMQL 4J8QA 5LHY1 5K36G 3KYHC 1KRSA 3DWQA 3E5SA 4ID6A 2R93B 2JA6B 3IL8A 2YYZA 4XT3B 4A3BB 4QMGA 3URYA 1A8VA 1B2TA 4GNXA 1PXUA 3VDYA 4DV1Q 3P7JA 4RH6A 4OGQC 4RFBA 2SNSA 2XGTA 3H0GH 1VQPA 3WWVA 1B70B 4CDFC 2L0CA 3SHLA 3G6JB 5A35A 2DJFC 5G3LF 1PRTF 2NN6I 1C48A 3DEPA 2OEOA 4A3MG 3I4LA 1YEZA 3RZOH 1H9RA 4LWCA 4CBVA 1STEA 3S1MB 4RCOA 1FJGL 1LTSD 4K0KL 2JEBI 4GN4B 3CCRA 2XRQD 3KF6A 3BDOA 5C44G 3RZDH 1Y1WG 1JB3A 1K3BC 1MBYA 2FMCA 1HXYD 1AZPA 4ILWA 3MVVA 1UE5A 4X3UA 3IFTA 1D5ZC 1O80A 3QG1A 2JYOA 1LO5D 5IYBG 2Y0SG 3U4VA 4F87A 5J39A 5AJ3Q 3HKZG 5EPJA 4EQ5A 2TSSA 1X6OA 1IBLL 3HOWB 4JI1Q 4DR6Q 5IYDG 4JBKA 1FNVA 1JWSD 1EIFA 4O1NA 1I4XA 3TMEA 1IBMQ 3GTKH 5ELDA 2WP8J 2RBMA 3F2BA 3S1QB 5KGUA 4CKBA 3E9IA 3FKIG 1G51A 1DM0B 5C3EH 4A3LG 1Z6HA 3MEHA 3MFYA 5C0XJ 4IFDI 1SYDA 1TWHB 4BWGB 4K6LA 5GROA 1BDOA 5JVG3 1S40A 1B3AA 4BY1H 5GAEC 2E8GA 2JA5G 3HRZC 4GKJQ 2WKDA 4JC0A 2Q2TA 1LTAD 5EGTA 2E2IH 1CT1D 3M9BA 4A76A 5C4XG 1NJIC 2H5XA 4PV1C 1I94Q 4R4CA 1VQDA 4FO2A 1I6VC 1V1PA 5M9OA 4OX9L 3I90A 3QR8A 3F8TA 5HGQA 3JAML 4GOPA 1VQ7A 4FF4A 3SVMA 3RR5A 1FNWA 4IN3A 3STBD 1ONLA 2MUYA 2B2VA 2UUCL 3CMEA 5CYUA 3M3YB 4HIOA 3GTJB 2ZM6L 4JI4L 1E7ZA 1I5FA 4XQQA 1AH9A 4DR2Q 3CC4A 1SSOA 1S72A 5CMDA 1K83B 1IHZA 3KBXA 1XNRL 4R4IA 5FLXE 4JI3L 1STAA 2HCCA 4OXPA 3RN5A 3A7LA 3DLLA 1ICWA 1STNA 3NQTA 5C0XG 4KD3A 3FMCA 2ZJQA 2R7ZH 4K5VA 4LFCQ 1D5XC 3SK4A 1MHWC 3H91A 1PH9A 4A4IA 4C3JG 3HOYH 1J9OA 5I2YA 1LTBD 1CSPA 1EY5A 4XQJA 5C5LA 2WAQE 1OXVA 2PNHA 3U50C 5M5WB 4OO1G 1Y8OB 1NMFA 4ZCKA 5LMNQ 1DZ1A 1HFGA 4TVAB 3G48A 1JJCB 1ENCA 3PUZA 2KBNA 3NTIA 4A3CG 1F77A 2F0PA 4KJNA 3HS0C 3TRZA 2K14A 4JI0Q 1YNND 2CH4W 3T1YQ 4PZ7A 1A2UA 1IBKL 1YITA 1NUCA 2RHQB 4JI6Q 1NBWA 4V0BA 4LUVA 5JPNC 1Q81C 4IUQA 2JA7H 5M5XB 3HOZG 1TIID 2WFWA 1I4QA 2V4DA 4A93B 4BA1I 4LF5Q 1O78A 3PUXA 5IYCH 1D1KA 1HTPA 3K5NA 2VUMG 4KD4A 1EU4A 1F9SA 5M3MH 1MD2D 5LL6S 1NR2A 1YHBA 4BBSG 2KEDA 2LXJA 5E1FA 1V9PA 4HIKA 4M8AA 2UXDQ 3M7NA 1M90C 1TWFB 1DOLA 1LM0A 1D5MC 1E1OA 1WCMG 3J7AV 2PCFB 1B8AA 1C8CA 5JEAJ 4K2LA 1Q1BA 2ZXPA 3PO2G 5C6AA 4BBRB 4OWXB 1Q82C 1TU2B 4A3EH 2EZVA 3VA5A 4J15A 3M4YA 1K8GA 1HNXL 4DA2A 3PF4A 3KF8B 1ASZA 1Y1VH 1I4GA 1KABA 4BY7G 2LS01 3BZKA 1ILPA 2F0NA 2B8FA 3LWUA 1Q7YC 2K05A 3CRKC 4LF9L 2Z8LA 1R4QB 1RJTA 1SNMA 2K01A 1YZ6A 4CDCC 2MO0A 4X65L 1DOKA 2DNCA 2I5HA 1BF4A 5IT9E 2B2WC 5IOCA 4K0KQ 4B3TL 4H13C 1HZ9A 3ND8A 2K5NA 3CPFA 4BXXH 1N32L 2NB0A 2M9VA 5EPKA 5ELNA 3J80c 4R9WA
chains in the Genus database with same CATH topology
1LTTD 2HDLA 2NVTB 2E76C 5K36H 3QB3A 2DNEA 2J7ZA 4HTHA 1J8IA 1AZQA 4ZLTF 2I07B 3K5OA 2H4OA 4DFAA 5NUCA 5BN5A 4RGTA 3SR1A 2ZT9C 3BS1A 1CI3M 2A6HD 3OOCA 5FLXL 1IKMA 3R3OA 1STGA 4M1UB 1M4VA 3A8KE 2NYZD 4K8IA 1B9MA 1DOMA 3FEWX 1ENFA 3P1HA 3OMCA 1PMRA 4EQOA 1PRTC 4XIGS 1T5EA 4HAEA 5KNDA 1I50B 2A68D 4G7ZC 4IUPA 1FYCA 3NUCA 1A3TA 4KY5A 2L9HA 4AYBB 2F0WA 3OHXC 5C0XI 4RGMA 3TP8A 1E0BA 3T4AC 3T51B 3R2IA 5CORA 4QF4A 1RTNA 4ABNA 3TP5A 4UDUC 2EVBA 3QIAA 5EJWA 1SAPA 3MC0B 1SE4A 1CK1A 2IW3A 2LMCB 1HQRD 1SEBD 3K58A 2FHTA 4OHJA 3C1EA 4DK0A 3N6RA 3GTQB 3QO2A 4DXFA 1PZKD 1Z7TA 1WTRA 3NBHA 3HOUB 4Z9CB 4ODGA 1G291 4HMIA 3GV3A 3BZDB 5FOBB 3BDLA 3IKJA 1EY0A 2MGSA 5KEEA 1RF2D 2KCCA 1RKNA 5IGDA 2BCOA 2JA8B 5CV8A 4C2MB 1S5DD 1LLRD 2XN9C 4NW2A 2K1BA 2XNAC 1SNOA 4X3KA 1HQMC 2K7VA 1MGSA 1HA5A 4RAUC 1VF7A 1IW7D 5C0XH 5E4XA 4KJOA 5IT9L 2RDHA 4JK1C 2ZXOA 4IFDJ 1HFNA 2VB3X 3NHHA 2CW0C 1I4PA 3P75A 5COYA 2NN6G 2SOBA 1V1PB 1SFOB 1EOTA 1A3VA 2ICIA 1WTWA 4Q0FA 4OO1H 1HHVA 4ULLA 4QUFA 5HURA 1KNAA 3OIPA 4QUCA 3UI2A 4TRDA 4OL7A 4KKSA 4MHEA 4ZRZA 1U4LA 4XQNA 4K14A 1WTPA 2SNMA 1D2BA 3AMUA 1JOKA 1LT3D 1SBBB 1NAPA 1B1ZA 3SK5A 5C3WA 3BG3A 2EYHA 1BNZA 1FGBD 3NBIA 4DU9A 1TQOA 2FINB 4IFDG 1ILQA 2WIIB 4Y7NB 1WD1A 1O7ZA 1H9JA 4X3SA 3O13A 1G2TA 3C1FA 2EJGC 4U673 3NK9A 2B2YC 5T1GA 1TWGB 2VB2X 4DGZA 5ELEA 1V1OA 5CV5A 4F88A 4L8JA 1DONA 4C3IB 3K59A 2BA1A 3VYUA 2RDFA 2H1EA 4ZKBB 2B8GA 4HMJA 2O4XA 2Q8IB 1LTGD 4L6TB 4C1NI 3H94A 2NWGA 1EY8A 2ID0A 2IWHA 1CM9A 2BE5C 4B08A 4B9WA 5EKKA 4A3FB 1AFPA 3T13A 1D1IA 3I3CA 2QDBA 3S1RB 4KN4C 2ENBA 4WJWA 1JORA 1M8AA 2QF7A 1OXXK 1RDPD 2IL8A 1PRTD 1H9MA 1EIGA 2RQXA 2MPMA 1H9SA 1SJHD 2NUCA 5IGGA 1TT2A 2L55A 2QILA 4XDXA 4KKTA 1BCPF 2WINB 2F1MA 4DNTB 2IT1A 1LV9A 3A7AB 4XYQA 2KCNA 2JE6I 3MHBA 1BO0A 1JC7A 1BUVT 1GHJA 3FPUB 1IKLA 1WD0A 3K5LA 1HCZA 1HRJA 5IGFA 2N55A 5M3FB 2RDGA 4DXGA 2EY6A 2EYMA 4N9TA 4XTCS 4PMBA 2B2WA 3I70A 2PW5A 1CQVA 1TY2A 2CVRA 1G2SA 4K2KA 1AN8A 2EJFC 1JICA 3DM1A 1D6EC 4ZYSA 3R8BA 1R4PB 5EBCA 4G4KA 1XTCD 4A3GB 1WTQA 3TP7A 5D3DA 5E4WC 3M4OB 5C3XA 1PTOB 1JOQA 2F0DA 4ZUJA 3S14B 3GP7A 1EEFD 1CQFA 5F2DA 1Q8IA 2O2LD 2EY1A 3GTGB 1TS4A 3H0GB 4HN7A 4RGOS 4HSPA 4KI0A 3OW7A 3QOJA 5I6YA 1ML0D 1EY7A 3BVZA 1R9TB 3ERQA 4FYDA 1WTVA 3QWNA 3DWAA 3L7ZC 1CFMA 4XT1B 5ELCA 1TR5A 3RZDB 5CC4A 2E2HB 2NN6H 3I4NB 4A3JB 1CHPD 3Q6SA 1S5CD 4K8JA 3HOXB 3AB9A 4U68A 3RD4A 3E6ZX 2KECA 1VMCA 3H6MA 3MXNA 4IUTA 3DEOA 4ZQ3A 1L0XB 1V8QA 2F0FA 2L4NA 2BA0A 3EA6A 3C2PA 2BDNA 5I9OA 1AW7A 5CR3A 3GD7A 5M5YB 5CV6A 2HQEA 4DNRB 3FPPA 2X6GA 2E2IB 1G91A 1STBA 2B2TC 3OWFA 1HA6A 5E3FA 4IFDH 2F0EA 4LK1C 1S4ZA 3HG9A 2RSOA 4K5WA 2CHBD 1B44D 2KQ3A 3EROA 2BE5D 1F9QA 3CKIB 4RHSA 2YU9B 3T56B 2A69D 1FR3A 1SE3A 3HOVB 3Q23A 1SYEA 2F0GA 2C9OA 2HCIA 3W3AA 2L5TA 3HZXA 4C3HG 4J1MA 3KLRA 1PTOD 2E74C 4S3SA 1S5BD 1DJRD 2IJ0A 2F0HA 5CV4A 3MXGA 2XWBB 1ET6A 1PDQA 1YNJD 2EJMA 1ZYRC 3MTSA 5JVH3 4IALA 5KYLA 2D9UA 1TS5A 2PMZB 3VR2A 2B2UC 3C46A 5JAVA 1UUPA 1F9PA 1Y8NB 1DCZA 1JOOA 4IUVA 4Q5VA 1SYBA 2GA4B 3NP8A 1OXTA 5BN3A 5IIFA 1BCPC 3R93A 1H9KA 5FO8B 2B2YA 3NXWA 5JEAG 2A6EC 2O5IC 1FD7D 4A3EB 3S17B 3A56A 1RCVD 1C4QA 1G8ZD 1H9SB 1Y1VB 3GO5A 1RD9D 1JQYD 1JR0D 5IGCA 1WTXA 2EE1A 1OO9B 4HR7B 2K5QA 3HEJA 3K57A 2F3WA 4FNFA 1U4PA 2BDOA 4GZYC 3MXPA 3OPOA 5C4XB 3VR4A 3TP6A 1K8MA 1B50A 2L1BA 2KHSA 3NTKA 4DK1A 1JCKB 1KTKA 1QE6A 2F03A 3SK8A 4RKBA 3GTOB 2NBFA 2KVMA 3P20A 1EYDA 2QEJC 3LNNA 4KY7A 4ME5A 3G7LA 2JSOA 2K32A 3TSSA 5C4ZA 3TDQA 1IYUA 2EYPA 2F0VA 5IGBA 1PFNA 1JWUD 1F2LA 3NWTA 2MP1A 3ND9A 3S16B 4DF7A 2B63B 5EQ0A 1XWEA 3K7AB 3GTPB 4MN3A 4FF3A 1Q90A 1EIHA 2D2CC 1QNUA 3BVGA 2EYLA 2F3VA 2R6GA 3TBIB 2NVXB 1SYFA 4DN4M 1WTOA 4O42A 1GUWA 2NTSA 2SDFA 2A5HA 4NP5A 1PRTB 3X3NA 3KK7A 3RLFA 1U4RA 1FNUA 3NSWA 3FKIB 2MHVA 1LTRD 3CU7A 5FO7B 3SE0A 3FRPB 4WORA 1QILA 1G6ZA 3V2TA 3M7GA 2XSCA 4A3IB 3ITPA 3VR6A 2IX3A 4G7HC 4A3KB 2K5DA 2PZWA 4NDXA 1TVXA 3I4MB 3SXHA 3C3LA 3J80E 3IFDA 3QJYA 1PFBA 3S2DB 2J0TD 5CV9A 3R2TA 5KRUA 3SEBA 4CJ0B 2K33A 3U9OA 2L11A 1ZYRD 2KOLA 2NVYB 1GXDC 1U9RA 4PNYA 4R8IA 3BVMA 3OMGA 5DAUA 1LTID 1VF5C 1EY9A 2K5WA 3SDZA 1AEXA 3KLSX 3VR5A 2VXWA 1EFID 1L0YB 4CJ2C 3K0YA 3V96A 3EQLC 3LX0A 1A15A 1ZKOA 1KLGD 1RTOA 1KNEA 2NTTA 3L9AX 2A6ED 4DAVA 3MAQA 5D3IB 3I72A 1JE4A 5K5PA 2VUMB 2AUKA 3QOLA 3PMFA 4IZ8A 2F0QA 2BOSA 4KTAA 4BBSB 2B2TA 3MA2B 4KV6A 1SYCA 4PQXA 1F2YA 3A8JE 1GUTA 1TWAB 3CRLC 2DN8A 2X6LA 1BOSA 5JEAH 3OIQA 5BN4A 4JBWA 1KDCA 2Z4IA 4RA8A 5G3LD 1TS2A 3MFGA 3D4WA 2R92B 4QB4A 2PZTA 4LMQD 4BY7B 1QCBD 3NPPA 1OXUA 2EYJA 3PO3B 3MWYW 2LY7A 4K5XA 1CA6A 2F0MA 2G9DA 4QCLA 2RVLA 2NVQB 1EZ8A 1CHQD 4C1NK 1MSGA 3IAYA 2XVSA 2KEEA 3E0JA 1B4OA 2E2JB 4IUNA 1XXGA 1PZID 1CA5A 2Z4HA 2WAQB 1II3A 1QWYA 2B2UA 4KK7A 5EBDA 2DY7A 2PW7A 1DYQA 1BBXC 1S5FD 3J80L 4DAYA 5IGEA 4DAPA 1PTOH 1OXSC 1QJOA 1EL0A 1A2TA 1STHA 5EPLA 1F2ZA 5J22A 3PIP3 4G57A 4LJZC 3H09A 1K8OA 3W2DA 2Q8RE 1X3PA 3EVQA 3HGBA 1Y8PB 1ENAA 1SMYC 4HEDA 3D6WA 3S9WA 2KA7A 2OT2A 1B9NA 1LT4D 1VDZA 2DY8A 3Q24A 1IYVA 3WDNA 2EXZA 1RODA 2CW0D 1X3QA 1DXMA 5D65A 3J81E 2IX0A 1PLFA 5IODA 4FVMA 1TS3A 2A6HC 4KMUC 2KJXA 2EYFA 3NQIA 4OIKA 2LKVA 1E2ZA 3RZOB 1SDFA 3L3OC 4UAIA 4NKLA 3DWPA 4YIJA 2F0SA 1Y69U 4BA2I 2AWOA 5EKIA 2B39A 3VA7A 3FVQA 3D8GA 2A68C 2OXPA 5ELFA 4V190 1KDAA 4L63B 5HGTA 4I65A 2M2LA 1WVLA 1CZGA 4KHVA 1QOHA 3GTKB 4X3TA 2FMMA 2F0TA 2EDGA 2QKIC 2XWJB 2D62A 5C3EB 1EEID 1GJXA 1TKWB 2EOTA 4C56C 2K03A 4BY1B 4WRDA 1EY4A 3PUYA 5C4HA 2X69A 4H0LC 1F9RA 5DM63 4BS9A 3J7AF 1B53A 2JEAI 2R3ZA 4I7ZC 2VNUD 2D5DA 3J7YW 2A73B 3NTHA 3TZUA 1SNPA 4FF1A 2ICEC 1KDBA 4F8MA 3M85A 3DHQA 4H44C 3F2UA 2WB1B 4KY6A 4KKUA 2R7ZB 1Q1EA 4C3IG 2EYOA 1EQVA 2RSNA 2QCPX 1IW7C 4TSSA 3HOYB 4LAAA 4CGYB 1LT6D 1EY6A 1LT5D 2F0OA 3MXUA 2F0LA 1HUMA 1U4MA 4B9XA 4EGVA 2IPKD 4IURA 4QIWB 1A3UA 3SK6A 3I8ZA 2E2DC 2AWNA 5EKLA 1GOZA 2JA7B 4XXEA 2IX1A 3WOEA 3J81L 2WV6D 5M3MB 4FXDA 4RKLA 2JXMB 2AQ3B 3LWEA 1EYCA 5T1IA 3EJIA 1SYGA 4TQUS 1EU3A 2XRSD 5KNCA 1A6XA 4CJ1B 5A2QE 2Z1CA 4XYOA 4RCNA 5CV7A 3I91A 4OIJA 3PV0A 4MIUA 1BR9A 4HSVA 1SMYD 1VCIA 2PYKA 4HCEA 4PMWA 3MZ5A 3GV6A 1PTOF 3VYTA 1Z47A 2PO4A 3HP3A 3KBGA 2PNRC 3T16A 1PYWD 2FJ2A 1XYIA 4KHZA 3H3VC 1JWMD 1GUSA 3TZDA 1O7LA 1ESRA 2K28A 1UNSA 3BDCA 2HUGA 1EZ6A 5CBEE 4H7BA 3D4RA 1UEAB 3VR3A 2G9HD 1E2VA 2MJ8A 1Q3LA 2A74C 3A55A 2WACA 5I9PA 4E6IA 1EWHA 3A54A 1BCPB 4KN7C 2Q8TA 4CKCA 1HUNA 1DD2A 3PUVA 1SE2A 1LABA 2EPBA 1HTLD 3Q0AA 3A8IE 1E2WA 4A3MB 2B2VC 5C4JB 4IUUA 2EY2A 1EQTA 1EYAA 5FKAC 1KAAA 4OO1I 4N9PA 5C44B 1Y1WB 3K5MA 1SNCA 4CHTB 3EFXD 4F7XA 5JJZA 1F2MA 1LACA 2Y0SB 2AQ1B 5LL6X 3HKZB 3BYTB 1I4RA 1ESFA 1MSHA 1VMPA 1T5XD 2HDMA 5I4DA 1STYA 3TN2A 4FXGC 1QG7A 2RA4A 2AUJD 1SJED 5ELBA 2NZ1D 4PMCA 1TY0A 2I46A 3RUZA 3GTMB 4EQNA 1BQQT 2O5JC 3WOFA 2JA5B 5FO9B 5A2QL 3DMUA 2XIWA 2K04A 1EWCA 1O7YA 3CHBD 1SNQA 3U9SA 4ZUIA 4EQPA 1SXTA 1MI2A 4EVOA 4CKEA 2F0UA 3DXJC 3NE5B 5FK9C 2E75C 5JPMC 3S15B 2LFNA 1NCVA 2ZXRA 1RHPA 3VYSA 5DNFA 3ONAB 3ZYYX 3AU7A 5KNBA 1GUOA 4FF2A 3S1NB 1TWCB 3NWSA 1IL8A 1NSNS 2F4IA 2F0KA 1SNDA 2OF1A 1W6JA 5KIXA 2RKSA 3I73A 4C3JB 1BXTA 2PZUA 1QB5D 1AP0A 2K6AA 5J1ZA 2PPBC 4TKOB 2EY5A 3OSOA 3D4DA 3CQZB 2FFKB 1W6KA 5KYIA 3Q22A 4ZAIA 4RWSC 1BCPD 5DEHA 3D31A 1UAPA 2PQEA 3OWEB 1V43A 1GUNA 5CBAE 3HOZB 3PUWA 4WFN3 1CTMA 4A3DB 2R61A 2KUMA 1ZXTA 5I6WA 2JP1A 3KF8A 2C5CA 3RMHA 3GQBA 3GTLB 1Q12A 4C3HB 5JOBA 1WCMB 4G7OC 4HCSA 2F0JA 3PO2B 1NR4A 2M00A 3D6CA 2WKCA 4NMZA 1YNNC 4P2CB 3T53B 5ISRA 1XX8A 3N52A 4K6DA 3JAME 2L12A 3FDTA 2A69C 2N88A 4IQZA 4ZK9B 1PZJD 4RHRA 3V05A 1S5ED 2AQ2B 3PIO3 1I3QB 1ZEQX 3S2HB 4FXKC 2CQAA 1GUGA 4J6HA 2J4XA 4FP5D 1KLUD 4RGNA 1I4HA 1PTOC 2SEBD 1X32A 1PFMA 3KLSA 3BYYB 5CGKA 3D3RA 4ZKCB 2F0IA 3KUPA 1HPCA 3DUZA 5D14A 2TMPA 3K6OA 1ET9A 5C5MA 1GHKA 5AFWA 1YNJC 4R8NA 1QNKA 5I2XA 5DM73 5TSSA 1I6HB 1CZWA 3X3MA 3VYRA 4J8QA 5LHY1 5K36G 3DWQA 3E5SA 4ID6A 2R93B 2JA6B 3IL8A 2YYZA 4XT3B 4A3BB 4QMGA 3URYA 1B2TA 1PXUA 3P7JA 4RH6A 4OGQC 4RFBA 2SNSA 2L0CA 3SHLA 3G6JB 5A35A 5G3LF 1PRTF 2NN6I 1C48A 3DEPA 2OEOA 3I4LA 1H9RA 4CBVA 1STEA 3S1MB 4RCOA 1LTSD 2JEBI 2XRQD 3BDOA 1JB3A 1MBYA 2FMCA 1HXYD 1AZPA 4ILWA 3MVVA 4X3UA 3IFTA 1D5ZC 1O80A 3QG1A 2JYOA 1LO5D 4F87A 5J39A 5EPJA 2TSSA 3HOWB 1FNVA 1JWSD 4O1NA 1I4XA 3TMEA 5ELDA 2WP8J 2RBMA 3S1QB 5KGUA 4CKBA 1DM0B 1Z6HA 3MEHA 3MFYA 5C0XJ 4IFDI 1SYDA 1TWHB 4BWGB 4K6LA 1BDOA 5JVG3 1B3AA 3HRZC 2WKDA 1LTAD 5EGTA 1CT1D 4PV1C 4FO2A 1I6VC 1V1PA 5M9OA 3I90A 3JAML 4FF4A 3SVMA 1FNWA 4IN3A 1ONLA 2MUYA 2B2VA 5CYUA 3M3YB 3GTJB 4XQQA 1SSOA 5CMDA 1K83B 1IHZA 3KBXA 5FLXE 1STAA 2HCCA 3A7LA 1ICWA 1STNA 3NQTA 5C0XG 4KD3A 3FMCA 4K5VA 1D5XC 3SK4A 3H91A 4C3JG 1J9OA 5I2YA 1LTBD 1EY5A 4XQJA 5C5LA 1OXVA 4OO1G 5M5WB 1Y8OB 1DZ1A 1HFGA 1ENCA 3PUZA 3NTIA 1F77A 2F0PA 4KJNA 3HS0C 1YNND 1A2UA 1NUCA 4V0BA 5JPNC 4IUQA 5M5XB 1TIID 1I4QA 2V4DA 4A93B 4BA1I 1O78A 3PUXA 1D1KA 1HTPA 3K5NA 4KD4A 1EU4A 1F9SA 1MD2D 5LL6S 1NR2A 2KEDA 5E1FA 4M8AA 3M7NA 1TWFB 1DOLA 1D5MC 3J7AV 2PCFB 1C8CA 5JEAJ 4K2LA 1Q1BA 2ZXPA 5C6AA 4BBRB 1TU2B 2EZVA 3VA5A 3M4YA 4DA2A 1I4GA 1KABA 2LS01 1ILPA 2F0NA 2B8FA 3LWUA 2K05A 3CRKC 2Z8LA 1R4QB 1RJTA 1SNMA 2K01A 1DOKA 2DNCA 1BF4A 5IT9E 2B2WC 5IOCA 4H13C 3ND8A 2NB0A 2M9VA 5EPKA 4R9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2Y C;  2KEC A;  3TZD A;  1NR4 A;  2D9U A;  2XIW A;  1VMC A;  3G7L A;  4UAI A;  4CJ0 B;  2K04 A;  1ESR A;  2B2U C;  2MGS A;  1O7Y A;  2HDL A;  2L11 A;  2K28 A;  2RVL A;  5T1G A;  2HUG A;  1F9P A;  2KOL A;  1MI2 A;  1HFG A;  5CBE E;  1DZ1 A;  5EKI A;  4IUT A;  3DEO A;  1HUM A;  1U4M A;  1AZP A;  2B2W A;  1MSG A;  1DON A;  4X3U A;  4IUV A;  1O80 A;  4R8I A;  2JYO A;  2KEE A;  1NCV A;  2J7Z A;  1XX8 A;  1RHP A;  2L4N A;  2CVR A;  2L12 A;  1G2S A;  3N52 A;  4IUR A;  1J8I A;  1PFN A;  2BDN A;  1F2L A;  2H1E A;  2MJ8 A;  1B4O A;  3FDT A;  4ZLT F;  2MP1 A;  4NW2 A;  5DNF A;  2N88 A;  5EPJ A;  3I8Z A;  4ZKB B;  2M2L A;  1Q3L A;  4ZK9 B;  1JIC A;  3R93 A;  5EQ0 A;  3DM1 A;  2B2Y A;  3ONA B;  4IUQ A;  2K1B A;  4MN3 A;  1WVL A;  1CA5 A;  2VXW A;  2B2U A;  2X6G A;  4X3K A;  4CJ2 C;  1EIH A;  2DY7 A;  1MGS A;  1IKM A;  2Q8T A;  1WTQ A;  1BBX C;  1G91 A;  5E4W C;  1F9S A;  4X3T A;  2FMM A;  2NYZ D;  2NWG A;  4RAU C;  1A15 A;  1IL8 A;  2B2T C;  1HA6 A;  1DOM A;  1KNE A;  1RTO A;  1NR2 A;  5E4X A;  1S4Z A;  1CM9 A;  2KED A;  1X32 A;  1AZQ A;  3LWE A;  2EPB A;  2RSO A;  1PFM A;  1HFN A;  5T1I A;  4DN4 M;  2EOT A;  3I3C A;  1WTO A;  1DOL A;  5COY A;  1EL0 A;  4O42 A;  1GUW A;  1B3A A;  1EOT A;  2B2V C;  4ZKC B;  2SDF A;  2K03 A;  5EPL A;  4IUU A;  4HAE A;  1EQT A;  1AP0 A;  3KUP A;  1JE4 A;  1WTW A;  1F9Q A;  4CJ1 B;  1M8A A;  4IUP A;  1C8C A;  1WTX A;  5D14 A;  1HHV A;  2EE1 A;  2X69 A;  2Q8R E;  4QUF A;  1X3P A;  1U4R A;  1F9R A;  2FFK B;  5AFW A;  2L9H A;  2IL8 A;  1KNA A;  2B2T A;  1QNK A;  4QUC A;  4ZAI A;  3UI2 A;  1EIG A;  1B53 A;  4MHE A;  2MPM A;  1U4L A;  4HED A;  2R3Z A;  4RWS C;  3D6W A;  3I91 A;  4OIJ A;  5JJZ A;  1WTP A;  1ML0 D;  3I90 A;  1G6Z A;  1E0B A;  2HCI A;  4HSV A;  3SVM A;  2DY8 A;  4XDX A;  2B2V A;  1U4P A;  2X6L A;  3IL8 A;  1MSH A;  5CBA E;  5COR A;  1ILP A;  1NAP A;  4XT3 B;  1WTV A;  1VMP A;  1RTN A;  1LV9 A;  2K05 A;  1B50 A;  1SSO A;  5EJW A;  1ROD A;  1SAP A;  2HDM A;  2L1B A;  2KUM A;  1B2T A;  5CMD A;  1RJT A;  1X3Q A;  1ZXT A;  3GV6 A;  3KBX A;  3TN2 A;  2K01 A;  3P7J A;  4RA8 A;  1QG7 A;  4XT1 B;  2RA4 A;  1TVX A;  5D65 A;  2JP1 A;  1BNZ A;  1BO0 A;  2FHT A;  3FPU B;  3F2U A;  1DOK A;  2HCC A;  1IKL A;  1PLF A;  1WD0 A;  1HRJ A;  2FIN B;  1ICW A;  2N55 A;  3HP3 A;  1BF4 A;  2B2W C;  4LMQ D;  1QE6 A;  1ILQ A;  3IFD A;  2NZ1 D;  3QO2 A;  1PDQ A;  1WD1 A;  1O7Z A;  3Q6S A;  2FJ2 A;  1XYI A;  2KVM A;  3H91 A;  4X3S A;  1WTR A;  1G2T A;  1PFB A;  3MWY W;  2RSN A;  3DEP A;  3MTS A;  1HUN A;  4U68 A;  1J9O A;  5EPK A;  4HCS A;  4OIK A;  1CA6 A;  3GV3 A;  4R9W A;  1SDF A; 
#chains in the Genus database with same CATH topology
 1JT8 A;  3K7U C;  1LTT D;  3KDF B;  5GQO A;  2HDL A;  2WAQ G;  2NVT B;  3CXC A;  2E76 C;  1PA6 A;  5K36 H;  3QB3 A;  2DNE A;  1JMC A;  4NXM L;  2J7Z A;  4HTH A;  3KJO A;  2CFM A;  2GVB A;  3GTO H;  1J8I A;  1AZQ A;  4ZLT F;  5IE8 A;  2I07 B;  2RHS B;  3K5O A;  4OWW B;  2R93 G;  2H4O A;  4IPG A;  4DFA A;  2JA6 G;  5NUC A;  5BN5 A;  1SN8 A;  4A3B G;  4RGT A;  3SR1 A;  2ZT9 C;  3BS1 A;  1CI3 M;  2A6H D;  3OOC A;  5FLX L;  1IKM A;  1J6Q A;  3R3O A;  1STG A;  3CCU A;  4M1U B;  1M4V A;  3A8K E;  1OTC A;  2NYZ D;  4K8I A;  1B9M A;  1DOM A;  3FEW X;  1ENF A;  2YTY A;  3P1H A;  3KFU A;  3OMC A;  4JI8 L;  4LFB Q;  1L1O B;  3CCJ A;  4A3M H;  2MNA A;  1PMR A;  4EQO A;  5C4J H;  1PRT C;  4XIG S;  1T5E A;  4HAE A;  5KND A;  1I50 B;  2A68 D;  3K7A H;  4IUP A;  4G7Z C;  2VW9 A;  1FYC A;  4LF4 L;  3NUC A;  5C44 H;  1Y1W H;  1A3T A;  4KY5 A;  2ZJP A;  2L9H A;  1K73 C;  4AYB B;  2UUC Q;  4DUY Q;  4RMF A;  5H1S E;  3TEH B;  2F0W A;  3OHX C;  5IYB H;  5C0X I;  3NEM A;  4RGM A;  3TP8 A;  1A62 A;  1E0B A;  3T4A C;  5IYD H;  3T51 B;  3R2I A;  5COR A;  4QF4 A;  4JBM A;  4JI3 Q;  3CPW A;  2VZA A;  1D7Q A;  1RTN A;  4ABN A;  3TP5 A;  2V1C C;  4UDU C;  2EVB A;  3QIA A;  5EJW A;  4YWM A;  1SAP A;  3MC0 B;  1SE4 A;  1CK1 A;  5L37 A;  2IW3 A;  2LMC B;  3FKI H;  1HQR D;  1Q8K A;  1SEB D;  3K58 A;  3RNU A;  1W2B A;  2UXC L;  2FHT A;  1B7Y B;  4OHJ A;  4A3L H;  3C1E A;  4DK0 A;  3KF6 B;  3N6R A;  3GTQ B;  3QO2 A;  4DXF A;  3M4Q A;  2VQE L;  4MZ9 A;  1PZK D;  1Z7T A;  2JA5 H;  1WTR A;  3BU2 A;  3NBH A;  3HOU B;  4Z9C B;  4ODG A;  4DV4 Q;  1G29 1;  4IPH A;  4HMI A;  3GV3 A;  3BZD B;  5FOB B;  4DR3 L;  4EX5 A;  3BDL A;  3IKJ A;  1SRO A;  1EY0 A;  2MGS A;  5KEE A;  2HHH L;  1RF2 D;  2ES2 A;  4KHP L;  4YCV A;  1PH4 A;  2KCC A;  4OWT B;  3H15 A;  1RKN A;  5IGD A;  3S15 H;  2BCO A;  2JA8 B;  5CV8 A;  4C2M B;  1S5D D;  1IZ6 A;  3S24 A;  1LLR D;  2XN9 C;  1XTD A;  4NW2 A;  4O0A A;  2YTX A;  2K1B A;  4WJ3 M;  4NB3 A;  2XNA C;  1SNO A;  3CCQ A;  3D0F A;  4X3K A;  1HQM C;  2K7V A;  3EN2 A;  1MGS A;  1HA5 A;  4JI5 L;  4RAU C;  1VF7 A;  1IW7 D;  5C0X H;  5GAD C;  5E4X A;  4KJO A;  2AHO B;  5IT9 L;  1NTG A;  2RDH A;  3FHW A;  2ZXO A;  4JK1 C;  3TS0 A;  4IFD J;  1HFN A;  2VB3 X;  3NHH A;  2CW0 C;  4YY3 Q;  1N8R C;  1I4P A;  3P75 A;  4C3J H;  5COY A;  2NN6 G;  2SOB A;  1V1P B;  4RG1 A;  1SFO B;  1EOT A;  4GOP B;  1A3V A;  2ICI A;  1WTW A;  1HNX Q;  1JB7 A;  4YCU A;  4Q0F A;  4DK6 C;  4OO1 H;  3CQZ H;  1HHV A;  4ULL A;  1SR3 A;  4QUF A;  1C0A A;  2RCN A;  5HUR A;  1KNA A;  3OIP A;  4QUC A;  4DV5 L;  3UI2 A;  4TRD A;  4OL7 A;  4KKS A;  4MHE A;  4ZRZ A;  1U4L A;  4A3C H;  4XQN A;  4K14 A;  1WTP A;  1PH6 A;  2B29 A;  2SNM A;  1D2B A;  4LF9 Q;  3AMU A;  1HR0 W;  1JOK A;  1LT3 D;  4B3M L;  1SBB B;  3T1H L;  1PV4 A;  3HOZ H;  1NAP A;  1B1Z A;  1GKH A;  3SK5 A;  2VUM H;  5C3W A;  3BG3 A;  4B3T Q;  2EYH A;  1K0R A;  1BNZ A;  4BBS H;  1FGB D;  1N32 Q;  1KQS A;  3NBI A;  4LW1 A;  4DU9 A;  1TQO A;  4Y52 H;  2FIN B;  3GTL H;  1XMO L;  4IFD G;  1ILQ A;  2WII B;  4Y7N B;  1EOV A;  1O7Z A;  1WD1 A;  1WCM H;  3A5Z B;  1H9J A;  4X3S A;  3O13 A;  1G2T A;  3C1F A;  2EJG C;  4IO9 A;  4U67 3;  3PO2 H;  3NK9 A;  2B2Y C;  4NXM Q;  1EYG A;  2OWO A;  2Z6K C;  1JE5 A;  5T1G A;  1TWG B;  2VB2 X;  1TXY A;  4DGZ A;  5IYC G;  5ELE A;  4MTN A;  1V1O A;  5CV5 A;  4F88 A;  4L8J A;  1DON A;  4C3I B;  3K59 A;  4BY7 H;  2BA1 A;  2QW7 A;  3VYU A;  2G5D A;  2RDF A;  2H1E A;  4DR5 Q;  2UXB L;  3DM3 A;  2QGQ A;  4ZKB B;  1Q86 C;  1N36 L;  2B8G A;  4HMJ A;  2IHF A;  5LMU L;  2O4X A;  2Q8I B;  4I7A A;  4JI7 L;  3S2H H;  1I3Q H;  4JI8 Q;  1YHA A;  4JBJ A;  3PF5 A;  2HQL A;  1LTG D;  4L6T B;  2NVQ H;  1Q46 A;  5DLQ E;  4C1N I;  3H94 A;  2NWG A;  4B3S L;  1EY8 A;  3CCS A;  2ID0 A;  2IWH A;  3U4Z A;  3HFZ B;  1CM9 A;  2BE5 C;  4B08 A;  4B9W A;  5EKK A;  4A3F B;  1AFP A;  3T13 A;  1EFW A;  4LF4 Q;  1D1I A;  3I3C A;  1CSQ A;  2E2J H;  3HKZ E;  2QDB A;  3S1R B;  4KN4 C;  2ENB A;  2UU9 Q;  4WJW A;  1JOR A;  1M8A A;  2QF7 A;  1OXX K;  1RDP D;  1YI2 A;  1HNZ L;  2IL8 A;  1PRT D;  1H9M A;  1EIG A;  3UDI A;  2RQX A;  2MPM A;  1I6H H;  1H9S A;  1SJH D;  2NUC A;  5IGG A;  1TT2 A;  2L55 A;  2VQF L;  2R93 H;  4X64 L;  2QIL A;  3ER0 A;  2EQS A;  4KKT A;  4XDX A;  2JA6 H;  1BCP F;  2WIN B;  2UXC Q;  2F1M A;  4A3B H;  4DNT B;  2IT1 A;  1LV9 A;  3A7A B;  4JOI C;  4XYQ A;  2KCN A;  4R4Q A;  2JE6 I;  2JA9 A;  2VQE Q;  2Z9H A;  1HR0 L;  3MHB A;  1BO0 A;  1JC7 A;  1BUV T;  1GHJ A;  3FPU B;  4JG2 A;  1IKL A;  1WD0 A;  3K5L A;  1HCZ A;  1HRJ A;  5IGF A;  2N55 A;  4H02 A;  1YVC A;  2RDG A;  5M3F B;  4PZ8 A;  4DXG A;  2HHH Q;  4HJA A;  4KHP Q;  2EY6 A;  2EYM A;  2JN4 A;  1ASY A;  1B3Q A;  3S1M H;  2RF4 A;  4DV3 L;  4LFA L;  2YV5 A;  4N9T A;  4XTC S;  3U58 A;  3A0J A;  1HNW L;  4PMB A;  2B2W A;  1WFQ A;  3I70 A;  2PW5 A;  4JI2 L;  1CQV A;  3F1Z A;  1JJ2 A;  1TY2 A;  2CVR A;  1G2S A;  2GN5 A;  2VY3 A;  4K2K A;  4JI5 Q;  1AN8 A;  2EJF C;  1JIC A;  5GAH C;  3DM1 A;  1D6E C;  4ZYS A;  3R8B A;  1YNX A;  1R4P B;  1T9H A;  4G4K A;  5EBC A;  1XTC D;  2GVA A;  1A0I A;  2N49 A;  4A3G B;  1WTQ A;  3S1Q H;  3TP7 A;  5D3D A;  5E4W C;  2EIF A;  1VQ8 A;  3UDG A;  4GLA C;  4CDD C;  3M4O B;  1TWH H;  2EXD A;  2UUA L;  5C3X A;  1UE7 A;  1PTO B;  4DR1 Q;  1JOQ A;  4DV5 Q;  2F0D A;  4ZUJ A;  3S14 B;  3K0X A;  3GP7 A;  1CKN B;  3HOU G;  1EEF D;  1CQF A;  4MNO A;  5F2D A;  1Q8I A;  2O2L D;  1HZB A;  2EY1 A;  5IP7 G;  4B3M Q;  3GTG B;  1TS4 A;  4JPB W;  4GKK Q;  2K4K A;  3H0G B;  3T1H Q;  4HN7 A;  4RGO S;  4HSP A;  4KI0 A;  1UWV A;  3OW7 A;  3QOJ A;  5I6Y A;  1V1Q A;  1ML0 D;  4HJ7 A;  1EY7 A;  3BVZ A;  1R9T B;  3M3Y H;  3GTJ H;  3LGJ A;  4JW0 A;  3ERQ A;  4FYD A;  1WTV A;  1P16 A;  1XMO Q;  4YHH L;  1E1T A;  4R1J A;  3QWN A;  4NXN L;  1VQM A;  1YBY A;  3DWA A;  3L7Z C;  1CFM A;  4YCW A;  4XT1 B;  5ELC A;  1TR5 A;  2K52 A;  3OTO L;  3RZD B;  3J81 j;  5CC4 A;  2HIX A;  1UE6 A;  1A63 A;  1H95 A;  5FLM G;  2E2H B;  2NN6 H;  3I4N B;  4A3J B;  1CHP D;  3Q6S A;  2QA4 A;  1YHQ A;  1S5C D;  1HH2 P;  4K8J A;  3HOX B;  3AB9 A;  4U68 A;  3RD4 A;  2R7F A;  3E6Z X;  2KEC A;  1VMC A;  5M5W H;  2MQH A;  3H6M A;  2UXB Q;  4WJ4 A;  1L0W A;  1WTH A;  3MXN A;  1YIJ A;  4IUT A;  3DEO A;  4ZQ3 A;  5LMU Q;  2XTI A;  4JI7 Q;  1L0X B;  1NY4 A;  1V8Q A;  2F0F A;  2L4N A;  2BA0 A;  1D8L A;  3EA6 A;  4YWL A;  5FJ8 G;  3C2P A;  2BDN A;  3CMA A;  5I9O A;  1AW7 A;  5CR3 A;  3GD7 A;  5M5Y B;  5CV6 A;  2HQE A;  2A8V A;  4DNR B;  5M5X H;  2LSS A;  3FPP A;  2X6G A;  4AQY L;  2E2I B;  1G91 A;  1EWI A;  1STB A;  2B2T C;  2QDL A;  3E9H A;  3OWF A;  5E3F A;  1HA6 A;  4IFD H;  2F0E A;  4LK1 C;  1S4Z A;  3HG9 A;  1X65 A;  2RSO A;  4K5W A;  1TWF H;  1E22 A;  2CHB D;  1HNZ Q;  1B44 D;  1Z9F A;  5BR8 Q;  1BKB A;  2KQ3 A;  4CDE C;  3ERO A;  2BE5 D;  1F9Q A;  4PZ6 A;  3CKI B;  3L2P A;  4AIM A;  4RHS A;  2OTJ A;  2VQF Q;  2YU9 B;  3T56 B;  2A69 D;  4A3D G;  1FR3 A;  1SE3 A;  3AEV A;  3HOV B;  3Q23 A;  1SYE A;  1IXR A;  2F0G A;  2C9O A;  4LF8 L;  2HCI A;  3AFP A;  2JK8 A;  3BJU A;  3W3A A;  1X3E A;  1HR0 Q;  2L5T A;  4OEM B;  2F4V Q;  3HZX A;  4C3H G;  4J1M A;  3KLR A;  1PTO D;  2E74 C;  4S3S A;  1S5B D;  4PG3 A;  2PQA A;  1XMQ Q;  1DJR D;  2IJ0 A;  1GD7 A;  4JV5 L;  1PYB A;  2F0H A;  3J7A 5;  2CCZ A;  1J5E L;  4DV3 Q;  5CV4 A;  3MXG A;  2XWB B;  1ET6 A;  1UEB A;  1PDQ A;  2CWP A;  3CW2 C;  1CKM A;  1W3S A;  2L15 A;  1YNJ D;  2EJM A;  1ZYR C;  4LF6 L;  1X9N A;  2DJG C;  3MTS A;  5JVH 3;  4IAL A;  5KYL A;  2F52 A;  2D9U A;  1TS5 A;  2PMZ B;  3VR2 A;  2B2U C;  1JJG A;  3C46 A;  5JAV A;  2NVT H;  1UUP A;  1F9P A;  1Y8N B;  1DCZ A;  1JOO A;  3I55 A;  4IUV A;  4Q5V A;  1SYB A;  2GA4 B;  3NP8 A;  1CKO A;  1OXT A;  5BN3 A;  1FJG Q;  2KHI A;  2I5M X;  1PH1 A;  5IIF A;  3I4O A;  2ATW A;  1BCP C;  3R93 A;  1H9K A;  2CH4 A;  5FO8 B;  2B2Y A;  4IOC A;  4HIM A;  3NXW A;  5JEA G;  2A6E C;  1VQ5 A;  3M4P A;  1EQR A;  1XPU A;  2O5I C;  1FD7 D;  2Z6K A;  3H3V I;  4A3E B;  4L5S A;  1VQJ A;  3S17 B;  3A56 A;  1WJJ A;  4DNI A;  1IBL Q;  2KCM A;  1RCV D;  3PCO B;  1C4Q A;  1G8Z D;  1H9S B;  1Y1V B;  1LUZ A;  3GO5 A;  1KIX A;  1RD9 D;  4X6A H;  1JQY D;  1JR0 D;  5IGC A;  1WTX A;  2EE1 A;  1OO9 B;  4DR4 L;  4HR7 B;  2ZJR A;  2K5Q A;  1PH5 A;  3HEJ A;  3K57 A;  2F3W A;  1WYD A;  4FNF A;  1U4P A;  2BDO A;  4GZY C;  3MXP A;  3OPO A;  5C4X B;  3VR4 A;  3TP6 A;  4DUZ L;  1K8M A;  1B50 A;  4APV A;  4OX9 Q;  2L1B A;  2KHS A;  3ERS X;  3NTK A;  4DK1 A;  2RCF A;  4IJH A;  1JCK B;  1EUJ A;  4GNX B;  2ZM6 Q;  4JI4 Q;  3GTQ H;  1KTK A;  1QE6 A;  2F03 A;  3SK8 A;  4RKB A;  3GTO B;  2NBF A;  1FL0 A;  1XNR Q;  3HOU H;  2KVM A;  1PH7 A;  3P20 A;  3ICE A;  1EYD A;  2QEJ C;  3LNN A;  4JOI A;  4KY7 A;  4ME5 A;  3HOW G;  5IP7 H;  2OQ0 A;  4FDB A;  3G7L A;  2AMC B;  2JSO A;  2K32 A;  2UUB L;  1YJW A;  4DV2 L;  2PI2 E;  3TSS A;  1VQO A;  5C4Z A;  4UHV A;  3TDQ A;  1IYU A;  3F2C A;  4C2M H;  3A74 A;  3ULJ A;  2EYP A;  4JCV E;  1LTL A;  3GTM H;  2F0V A;  5IGB A;  1JWU D;  1PFN A;  1F2L A;  3NWT A;  2MP1 A;  3ND9 A;  1PHJ A;  3S16 B;  4DF7 A;  2B63 B;  4LNQ A;  5EQ0 A;  1XWE A;  3K7A B;  3GTP B;  3FP9 A;  4MN3 A;  4FF3 A;  1Q90 A;  5E7N A;  2I0Q A;  3JAM c;  1EIH A;  1E24 A;  1G6P A;  1LYL A;  2OQK A;  1IBK Q;  4DAM A;  1MKH A;  2D2C C;  1QNU A;  3BVG A;  5FLM H;  1K3R A;  3J80 i;  2EYL A;  2F3V A;  2R6G A;  4GLX A;  3TBI B;  2NVX B;  1NE3 A;  1SYF A;  4DV6 L;  4P71 A;  3CP0 A;  4DN4 M;  1VS0 A;  1WTO A;  3F2D A;  3I4N G;  4A3J G;  3CCM A;  1SFO H;  4O42 A;  1GUW A;  2NTS A;  1U5K A;  2SDF A;  2A5H A;  1HZA A;  4NP5 A;  3HOX G;  1XNQ L;  1PRT B;  3X3N A;  3KK7 A;  2Z6B A;  2PMZ E;  3RLF A;  1U4R A;  1FNU A;  3NSW A;  3FKI B;  2MHV A;  1LTR D;  3S1N H;  1AE2 A;  1TWC H;  3CU7 A;  3FRP B;  5FO7 B;  3SE0 A;  4WOR A;  1QIL A;  5ELO A;  5FJ8 H;  1XJV A;  1G6Z A;  3V2T A;  3EIV A;  3M7G A;  4QL5 A;  2XSC A;  4A3I B;  4DR7 L;  3ITP A;  3VR6 A;  2IX3 A;  4G7H C;  1ICF B;  4A3K B;  1M1K C;  2N78 A;  4DV7 L;  5HY6 A;  2K5D A;  1VQA A;  2C35 B;  3KJP A;  1J5E Q;  2PZW A;  1GVP A;  4NDX A;  1TVX A;  1VQC A;  3I4M B;  3SXH A;  3C3L A;  3J80 E;  3CC2 A;  3IFD A;  3MXN B;  4Y7N H;  1X3F A;  3QJY A;  1PFB A;  3S2D B;  3PSI A;  2J0T D;  4X65 Q;  5CV9 A;  3R2T A;  5KRU A;  3SEB A;  1QVC A;  4A3D H;  4CJ0 B;  2K33 A;  3CAM A;  3U9O A;  2L11 A;  1ZYR D;  3CC7 A;  1PH2 A;  4A93 G;  2KOL A;  2NVY B;  4JI1 L;  4L5Q A;  4JYA L;  5EAY A;  4C3I H;  3HOV G;  1GXD C;  1U9R A;  4PNY A;  4R8I A;  1IBM L;  3BVM A;  3OMG A;  5DAU A;  4C3H H;  1UE1 A;  1LTI D;  1VF5 C;  3GDE A;  1K0S A;  1EY9 A;  3J81 c;  1VQF A;  2K5W A;  2JJQ A;  3SDZ A;  1AEX A;  1FVI A;  3KLS X;  2VXW A;  3VR5 A;  1EFI D;  1L0Y B;  4CJ2 C;  3K0Y A;  4X66 L;  3V96 A;  3EQL C;  3LX0 A;  3STB C;  4JVZ A;  1A15 A;  1ZKO A;  1KLG D;  2A19 A;  1RTO A;  1KNE A;  4AYB E;  3AFQ A;  4BBR G;  2NTT A;  3L9A X;  2NZO A;  2A6E D;  4DAV A;  1KD1 C;  3MAQ A;  5D3I B;  2R7D A;  3I72 A;  4DR4 Q;  3SGI A;  3KLW A;  2N8N A;  1VQ4 A;  4X62 L;  3S1R H;  1I94 L;  1JE4 A;  3UE1 A;  5K5P A;  2VUM B;  2AUK A;  2MO1 A;  3QOL A;  3PMF A;  4IZ8 A;  2F0Q A;  4KLK A;  3B6Y A;  2BOS A;  4KTA A;  4BBS B;  2B2T A;  3MA2 B;  3NEL A;  4KV6 A;  1SYC A;  4PQX A;  4DR2 L;  1F2Y A;  2VL6 A;  3A8J E;  1GUT A;  1TWA B;  3CRL C;  2DN8 A;  2X6L A;  1BOS A;  5JEA H;  4GN3 B;  3OIQ A;  1X3G A;  4DPG A;  5BN4 A;  3CCL A;  4JBW A;  3CD6 A;  1KDC A;  2ALY B;  4LFC L;  2Z4I A;  4RA8 A;  3L0O A;  5G3L D;  1TS2 A;  3MFG A;  2Z0S A;  3D4W A;  4DV0 L;  2R92 B;  4QB4 A;  2PZT A;  4LMQ D;  1MIU A;  1VQK A;  4BY7 B;  1QCB D;  3NPP A;  1OXU A;  4OEL B;  5FLX c;  2EYJ A;  3PGZ A;  3A5U A;  4DV2 Q;  3MWY W;  3G6E A;  2LY7 A;  3PO3 B;  3KDF A;  4K5X A;  1BBU A;  3CCV A;  1CA6 A;  2F0M A;  2G9D A;  4QCL A;  2RVL A;  2P5Z X;  1VQG A;  2NVQ B;  5JJI A;  1EZ8 A;  4JI6 L;  1CHQ D;  4C1N K;  1MSG A;  3IAY A;  4P72 A;  2XVS A;  4DR3 Q;  4IJL A;  1N9W A;  4LF5 L;  2KEE A;  3OW2 A;  3E0J A;  1B4O A;  1QUQ A;  4IUN A;  2E2J B;  1XXG A;  2LXK A;  1PZI D;  2N3S A;  1CA5 A;  2Z4H A;  2WAQ B;  1KRT A;  1II3 A;  3G4S A;  1QWY A;  2B2U A;  4KK7 A;  5EBD A;  4DV6 Q;  2UXD L;  1K28 A;  2DY7 A;  2PW7 A;  1DYQ A;  1BBX C;  3RLN A;  3J81 i;  1P8L A;  4UP9 A;  1S5F D;  4IPD A;  3J80 L;  4L5R C;  4AYB G;  4DAY A;  5IGE A;  1XNQ Q;  1PFS A;  3M4O H;  3ULP A;  1N34 L;  4DAP A;  1PTO H;  1OXS C;  2OTL A;  1QJO A;  3S14 H;  1EL0 A;  1A2T A;  4DK3 C;  1STH A;  3I7F A;  3HOW H;  5EPL A;  1F2Z A;  2B3G A;  5J22 A;  3PIP 3;  4G57 A;  4LJZ C;  3H09 A;  4N8F A;  1EIY B;  3W2D A;  1K8O A;  2Q8R E;  1AE3 A;  1X3P A;  3EVQ A;  3GTG H;  3HGB A;  1Y8P B;  4DR7 Q;  1ENA A;  1SMY C;  4HED A;  3IRB A;  3D6W A;  4DV7 Q;  3S9W A;  2KA7 A;  2OT2 A;  1SMX A;  1B9N A;  1R9T H;  1LT4 D;  4ME3 A;  1QZG A;  1VDZ A;  2DY8 A;  3W5O A;  1WI5 A;  1QVF A;  3Q24 A;  1IYV A;  1MJC A;  1C9O A;  2KEN A;  2B63 G;  3WDN A;  2KCT A;  2EXZ A;  1ROD A;  2FXQ A;  2CW0 D;  1X3Q A;  1DXM A;  5D65 A;  3J81 E;  2CKZ B;  2IX0 A;  1PLF A;  5IOD A;  4FVM A;  2E2H H;  4AH6 A;  3I4N H;  4A3J H;  1YJN A;  1TS3 A;  2A6H C;  2JA8 G;  4KMU C;  2KJX A;  1PVO A;  3HOX H;  2EYF A;  3NQI A;  4JYA Q;  4OIK A;  2LKV A;  1E2Z A;  2Q2H A;  3TS2 A;  1DGS A;  1SDF A;  3L3O C;  5IT9 c;  3RZO B;  4UAI A;  3NBH B;  4NKL A;  3DWP A;  1K83 H;  4YIJ A;  2ZTC A;  2KHJ A;  2F0S A;  1Y69 U;  4BA2 I;  2AWO A;  5EKI A;  2B39 A;  3VA7 A;  4B3R L;  3FVQ A;  3D8G A;  2A68 C;  3K81 C;  2OXP A;  5ELF A;  4V19 0;  4X66 Q;  1KDA A;  4L63 B;  5HGT A;  1RL2 A;  4I65 A;  5JJL A;  1L2F A;  4A3I G;  5M5Y H;  2M2L A;  4A3K G;  1GO3 E;  1WVL A;  4LFB L;  1CZG A;  4KHV A;  1QOH A;  3GTK B;  4X3T A;  2FMM A;  2F0T A;  4X62 Q;  2EDG A;  2QKI C;  2XWJ B;  3I4M G;  2D62 A;  1N36 Q;  5C3E B;  1PH3 A;  1EEI D;  5J3B A;  1NMG A;  2D0O A;  1GJX A;  1TKW B;  2EOT A;  2CWA A;  1YJ9 A;  1GM5 A;  4DUY L;  4C56 C;  4B3S Q;  2K03 A;  4BY1 B;  1VQ6 A;  4WRD A;  1X54 A;  1EY4 A;  2Q2I A;  3PUY A;  5C4H A;  2X69 A;  2YU9 H;  4A93 H;  1S3O A;  4H0L C;  1F9R A;  5DM6 3;  4GN5 A;  4BS9 A;  3I56 A;  3J7A F;  1B53 A;  3HOV H;  2JEA I;  2R3Z A;  3HKS A;  4I7Z C;  2VNU D;  2D5D A;  3J7Y W;  4P75 A;  1VQ9 A;  2A73 B;  3TQY A;  3NTH A;  4DKA C;  3TZU A;  1SNP A;  4FF1 A;  1KAW A;  2ICE C;  1KDB A;  4F8M A;  4DV0 Q;  3M85 A;  2QEX A;  4QGU A;  1X56 A;  3DHQ A;  4BBR H;  4X64 Q;  4H44 C;  4DV4 L;  3F2U A;  2VS1 A;  2WB1 B;  4KY6 A;  3W1B A;  4KKU A;  2R7Z B;  1Q1E A;  4C3I G;  2EYO A;  4N8X 1;  1VQN A;  2HT1 A;  1EQV A;  2RSN A;  2QCP X;  1IW7 C;  4TSS A;  2D0P A;  3HOY B;  4LAA A;  4CGY B;  1LT6 D;  1EY6 A;  3PIO A;  4GS3 A;  1LT5 D;  1O7I A;  2F0O A;  3MXU A;  2F0L A;  4QJF A;  4UP7 A;  1HUM A;  1U4M A;  2ZTE A;  4B9X A;  4EGV A;  2IPK D;  2K75 A;  4LFA Q;  4IUR A;  4QIW B;  3ZJY C;  4A3F G;  4LUO A;  5IP9 G;  1A3U A;  3SK6 A;  3I8Z A;  2E2D C;  1HNW Q;  2AWN A;  5EKL A;  1N34 Q;  1GOZ A;  2JA7 B;  4JI2 Q;  4YY3 L;  4XXE A;  2IX1 A;  3PQI A;  3WOE A;  3J81 L;  4R4O A;  3S17 H;  2WV6 D;  5M3M B;  4FXD A;  1K9M C;  1L1O C;  4RKL A;  2JXM B;  2AQ3 B;  3LWE A;  1EYC A;  2R92 G;  5T1I A;  3EJI A;  1SYG A;  4TQU S;  1EU3 A;  2XRS D;  5KNC A;  4A75 A;  3PO3 G;  1A6X A;  4CJ1 B;  3K8A A;  5A2Q E;  3PIP A;  2Z1C A;  2UUA Q;  4GNX C;  4NPS A;  3OYY A;  4OON A;  4XYO A;  2E5L L;  4P74 A;  4RCN A;  5CV7 A;  3I91 A;  4OIJ A;  3PV0 A;  4MIU A;  2HD3 A;  4HJ5 A;  1BR9 A;  4HSV A;  1C7Y A;  2I5L X;  5M3F G;  1SMY D;  1VCI A;  4POG A;  2PYK A;  5C4X H;  5IWA L;  4LF7 L;  1I50 H;  4HCE A;  4L5T A;  4PMW A;  4IOA A;  3MZ5 A;  2DUD A;  2IY5 B;  3GV6 A;  1PTO F;  1KHI A;  3KOJ A;  3VYT A;  1Z47 A;  2PO4 A;  3HP3 A;  1WOC A;  4YHH Q;  1E3P A;  1RIP A;  3NEN A;  3KBG A;  3RLO A;  2PNR C;  3Q8D A;  4NXN Q;  3T16 A;  1PYW D;  2FJ2 A;  1N33 L;  1SRU A;  1XYI A;  3UE0 A;  2AKW B;  4KHZ A;  4GLV B;  3OTO Q;  3H3V C;  5GAG C;  1JWM D;  2NZH A;  4B3R Q;  1HJP A;  2K5H A;  1QUQ B;  1GUS A;  3TZD A;  1PYS B;  1MJE A;  1O7L A;  1ESR A;  4DR5 L;  2K28 A;  1UNS A;  3EBE A;  1EQQ A;  3BDC A;  2OCE A;  2HUG A;  1EZ6 A;  5CBE E;  4A3G G;  2F3I A;  4H7B A;  3D4R A;  1UEA B;  1K8A C;  3VR3 A;  2G9H D;  4DAY B;  1E2V A;  2MJ8 A;  3S16 H;  2Q2U A;  2B63 H;  1Q3L A;  3AYH B;  1SE8 A;  2A74 C;  3A55 A;  3GTP H;  2WAC A;  4MTK A;  5I9P A;  2K50 A;  4UPA A;  4E6I A;  3H3V H;  1EWH A;  3A54 A;  1BCP B;  4KN7 C;  2Q8T A;  2CQO A;  4CKC A;  1HUN A;  1VQH A;  1DD2 A;  2UU9 L;  3PUV A;  2NVX H;  5IY0 A;  3H0G G;  1SE2 A;  1LAB A;  2DGY A;  2JQO A;  2WB1 E;  2EPB A;  4QY7 A;  2JA8 H;  1CKN A;  4GOP C;  4AQY Q;  1HTL D;  3Q0A A;  3A8I E;  1E2W A;  4A3M B;  2B2V C;  1QVG A;  5C4J B;  4IUU A;  2EY2 A;  1EQT A;  3K80 C;  1EYA A;  1VQI A;  5FKA C;  1KAA A;  4OO1 I;  4N9P A;  5C44 B;  1Y1W B;  3K5M A;  1SNC A;  4CHT B;  3EFX D;  4F7X A;  5JJZ A;  4UP8 A;  1F2M A;  1LAC A;  2Y0S B;  2AQ1 B;  5LL6 X;  4A3I H;  3JC6 6;  3HKZ B;  4QIW E;  3BYT B;  1I4R A;  1ESF A;  1MSH A;  4A3K H;  1VMP A;  1T5X D;  2HDM A;  4LF8 Q;  5I4D A;  1STY A;  4IPC A;  3TN2 A;  1VQB A;  1QG7 A;  4FXG C;  2RA4 A;  3I4M H;  4YWK A;  2AUJ D;  3G71 A;  2YTV A;  1SJE D;  5ELB A;  2NZ1 D;  1IYJ B;  5C3E G;  4PMC A;  1TY0 A;  2I46 A;  3RUZ A;  1QZH A;  4EQN A;  3GTM B;  1BQQ T;  4DV1 L;  3S2D H;  4JV5 Q;  2O5J C;  3WOF A;  2JA5 B;  4QQB X;  2K5V A;  5FO9 B;  5A2Q L;  4BY1 G;  5JJK A;  4R4T A;  1VQE A;  3DMU A;  2XIW A;  2K04 A;  1EWC A;  1O7Y A;  3CHB D;  3TRE A;  1SNQ A;  3U9S A;  2NVY H;  4ALP A;  4ZUI A;  4EQP A;  5LMN W;  1SXT A;  1XPO A;  1MI2 A;  1BVS A;  4LF6 Q;  4EVO A;  4CKE A;  2F0U A;  3MEF A;  3RN2 A;  3DXJ C;  2HIV A;  3NE5 B;  5FK9 C;  2E75 C;  5JPM C;  3S15 B;  1PH8 A;  2LFN A;  1NCV A;  2ZXR A;  1RHP A;  4HJ8 A;  3VYS A;  5DNF A;  1U0L A;  4HID A;  3ONA B;  3ZYY X;  4DR1 L;  3AU7 A;  5KNB A;  1GUO A;  4FF2 A;  3S1N B;  2ASB A;  5AJ3 L;  1TWG H;  1TWC B;  1IL8 A;  3NWS A;  1NSN S;  4DR6 L;  2F4I A;  2F0K A;  1SND A;  2OF1 A;  1W6J A;  5KIX A;  2WB1 G;  2RKS A;  3I73 A;  4GKK L;  4C3J B;  2R7Z G;  2E5L Q;  3E3X A;  1BXT A;  2PZU A;  1QB5 D;  1AP0 A;  2K6A A;  2PI2 A;  5J1Z A;  2PPB C;  4TKO B;  3HOY G;  2EY5 A;  3OSO A;  3D4D A;  3CQZ B;  2FFK B;  1NNX A;  1W6K A;  5KYI A;  3Q22 A;  4ZAI A;  3J7Z C;  4RWS C;  1BCP D;  5IWA Q;  4LF7 Q;  4LUZ A;  5DEH A;  3D31 A;  1IL2 A;  4GKJ L;  4A3F H;  5IP9 H;  3JAM i;  4UY8 C;  1UAP A;  2PQE A;  1FGU A;  3OWE B;  1TWA H;  1V43 A;  1GUN A;  1SLJ A;  5CBA E;  1KC8 C;  3HOZ B;  3UDF A;  3PUW A;  4WFN 3;  1Y14 B;  4P73 A;  1CTM A;  4A3D B;  2R61 A;  2KUM A;  3W1G A;  1ZXT A;  2JA7 G;  5I6W A;  4HJ9 A;  1N33 Q;  2JP1 A;  3KF8 A;  2C5C A;  2PQA B;  3RMH A;  2R92 H;  3GQB A;  5M3M G;  3CCE A;  3GTL B;  4DUZ Q;  1BBW A;  1Q12 A;  4POF A;  3CF5 A;  4C3H B;  5JOB A;  3PO3 H;  1WCM B;  2MFI A;  2BH8 A;  2A1A A;  4G7O C;  4O2D A;  3I2Z A;  2F0J A;  4HCS A;  3PO2 B;  2IHE A;  1NR4 A;  2M00 A;  3D6C A;  2WKC A;  4NMZ A;  1YNN C;  3UDX A;  1X55 A;  4P2C B;  3T53 B;  5ISR A;  4A3E G;  2BH2 A;  3AQQ A;  2ZTD A;  5M3F H;  1KL9 A;  2Y0S E;  1CUK A;  1XX8 A;  3BZC A;  3N52 A;  4K6D A;  2L12 A;  3JAM E;  3FDT A;  2A69 C;  2UUB Q;  2N88 A;  4IQZ A;  5LMN L;  1Y1V G;  4ZK9 B;  1PZJ D;  1VQL A;  4RHR A;  3V05 A;  1S5E D;  2AQ2 B;  3PIO 3;  1I3Q B;  1ZEQ X;  4JI0 L;  3S2H B;  4FXK C;  3T1Y L;  2CQA A;  1GUG A;  5BR8 L;  4J6H A;  2J4X A;  4FP5 D;  1KXL A;  3E0E A;  1KLU D;  4RGN A;  1I4H A;  3ULL A;  1PTO C;  2SEB D;  1X32 A;  1PFM A;  3KLS A;  1XPR A;  3BYY B;  5CGK A;  3D3R A;  4ZKC B;  4BXX G;  2F0I A;  3KUP A;  1HPC A;  3DUZ A;  5D14 A;  2TMP A;  3K6O A;  1ET9 A;  5C5M A;  1GHK A;  5AFW A;  4A3G H;  1YNJ C;  4R8N A;  1QNK A;  2F4V L;  5I2X A;  5DM7 3;  5TSS A;  1L1O A;  1I6H B;  1HZC A;  1CZW A;  3X3M A;  3VYR A;  1XMQ L;  4J8Q A;  5LHY 1;  5K36 G;  3KYH C;  1KRS A;  3DWQ A;  3E5S A;  4ID6 A;  2R93 B;  2JA6 B;  3IL8 A;  2YYZ A;  4XT3 B;  4A3B B;  4QMG A;  3URY A;  1A8V A;  1B2T A;  4GNX A;  1PXU A;  3VDY A;  4DV1 Q;  3P7J A;  4RH6 A;  4OGQ C;  4RFB A;  2SNS A;  2XGT A;  3H0G H;  1VQP A;  3WWV A;  1B70 B;  4CDF C;  2L0C A;  3SHL A;  3G6J B;  5A35 A;  2DJF C;  5G3L F;  1PRT F;  2NN6 I;  1C48 A;  3DEP A;  2OEO A;  4A3M G;  3I4L A;  1YEZ A;  3RZO H;  1H9R A;  4LWC A;  4CBV A;  1STE A;  3S1M B;  4RCO A;  1FJG L;  1LTS D;  4K0K L;  2JEB I;  4GN4 B;  3CCR A;  2XRQ D;  3KF6 A;  3BDO A;  5C44 G;  3RZD H;  1Y1W G;  1JB3 A;  1K3B C;  1MBY A;  2FMC A;  1HXY D;  1AZP A;  4ILW A;  3MVV A;  1UE5 A;  4X3U A;  3IFT A;  1D5Z C;  1O80 A;  3QG1 A;  2JYO A;  1LO5 D;  5IYB G;  2Y0S G;  3U4V A;  4F87 A;  5J39 A;  5AJ3 Q;  3HKZ G;  5EPJ A;  4EQ5 A;  2TSS A;  1X6O A;  1IBL L;  3HOW B;  4JI1 Q;  4DR6 Q;  5IYD G;  4JBK A;  1FNV A;  1JWS D;  1EIF A;  4O1N A;  1I4X A;  3TME A;  1IBM Q;  3GTK H;  5ELD A;  2WP8 J;  2RBM A;  3F2B A;  3S1Q B;  5KGU A;  4CKB A;  3E9I A;  3FKI G;  1G51 A;  1DM0 B;  5C3E H;  4A3L G;  1Z6H A;  3MEH A;  3MFY A;  5C0X J;  4IFD I;  1SYD A;  1TWH B;  4BWG B;  4K6L A;  5GRO A;  1BDO A;  5JVG 3;  1S40 A;  1B3A A;  4BY1 H;  5GAE C;  2E8G A;  2JA5 G;  3HRZ C;  4GKJ Q;  2WKD A;  4JC0 A;  2Q2T A;  1LTA D;  5EGT A;  2E2I H;  1CT1 D;  3M9B A;  4A76 A;  5C4X G;  1NJI C;  2H5X A;  4PV1 C;  1I94 Q;  4R4C A;  1VQD A;  4FO2 A;  1I6V C;  1V1P A;  5M9O A;  4OX9 L;  3I90 A;  3QR8 A;  3F8T A;  5HGQ A;  3JAM L;  4GOP A;  1VQ7 A;  4FF4 A;  3SVM A;  3RR5 A;  1FNW A;  4IN3 A;  3STB D;  1ONL A;  2MUY A;  2B2V A;  2UUC L;  3CME A;  5CYU A;  3M3Y B;  4HIO A;  3GTJ B;  2ZM6 L;  4JI4 L;  1E7Z A;  1I5F A;  4XQQ A;  1AH9 A;  4DR2 Q;  3CC4 A;  1SSO A;  1S72 A;  5CMD A;  1K83 B;  1IHZ A;  3KBX A;  1XNR L;  4R4I A;  5FLX E;  4JI3 L;  1STA A;  2HCC A;  4OXP A;  3RN5 A;  3A7L A;  3DLL A;  1ICW A;  1STN A;  3NQT A;  5C0X G;  4KD3 A;  3FMC A;  2ZJQ A;  2R7Z H;  4K5V A;  4LFC Q;  1D5X C;  3SK4 A;  1MHW C;  3H91 A;  1PH9 A;  4A4I A;  4C3J G;  3HOY H;  1J9O A;  5I2Y A;  1LTB D;  1CSP A;  1EY5 A;  4XQJ A;  5C5L A;  2WAQ E;  1OXV A;  2PNH A;  3U50 C;  5M5W B;  4OO1 G;  1Y8O B;  1NMF A;  4ZCK A;  5LMN Q;  1DZ1 A;  1HFG A;  4TVA B;  3G48 A;  1JJC B;  1ENC A;  3PUZ A;  2KBN A;  3NTI A;  4A3C G;  1F77 A;  2F0P A;  4KJN A;  3HS0 C;  3TRZ A;  2K14 A;  4JI0 Q;  1YNN D;  2CH4 W;  3T1Y Q;  4PZ7 A;  1A2U A;  1IBK L;  1YIT A;  1NUC A;  2RHQ B;  4JI6 Q;  1NBW A;  4V0B A;  4LUV A;  5JPN C;  1Q81 C;  4IUQ A;  2JA7 H;  5M5X B;  3HOZ G;  1TII D;  2WFW A;  1I4Q A;  2V4D A;  4A93 B;  4BA1 I;  4LF5 Q;  1O78 A;  3PUX A;  5IYC H;  1D1K A;  1HTP A;  3K5N A;  2VUM G;  4KD4 A;  1EU4 A;  1F9S A;  5M3M H;  1MD2 D;  5LL6 S;  1NR2 A;  1YHB A;  4BBS G;  2KED A;  2LXJ A;  5E1F A;  1V9P A;  4HIK A;  4M8A A;  2UXD Q;  3M7N A;  1M90 C;  1TWF B;  1DOL A;  1LM0 A;  1D5M C;  1E1O A;  1WCM G;  3J7A V;  2PCF B;  1B8A A;  1C8C A;  5JEA J;  4K2L A;  1Q1B A;  2ZXP A;  3PO2 G;  5C6A A;  4BBR B;  4OWX B;  1Q82 C;  1TU2 B;  4A3E H;  2EZV A;  3VA5 A;  4J15 A;  3M4Y A;  1K8G A;  1HNX L;  4DA2 A;  3PF4 A;  3KF8 B;  1ASZ A;  1Y1V H;  1I4G A;  1KAB A;  4BY7 G;  2LS0 1;  3BZK A;  1ILP A;  2F0N A;  2B8F A;  3LWU A;  1Q7Y C;  2K05 A;  3CRK C;  4LF9 L;  2Z8L A;  1R4Q B;  1RJT A;  1SNM A;  2K01 A;  1YZ6 A;  4CDC C;  2MO0 A;  4X65 L;  1DOK A;  2DNC A;  2I5H A;  1BF4 A;  5IT9 E;  2B2W C;  5IOC A;  4K0K Q;  4B3T L;  4H13 C;  1HZ9 A;  3ND8 A;  2K5N A;  3CPF A;  4BXX H;  1N32 L;  2NB0 A;  2M9V A;  5EPK A;  5ELN A;  3J80 c;  4R9W A; 
#chains in the Genus database with same CATH homology
 1LTT D;  2HDL A;  2NVT B;  2E76 C;  5K36 H;  3QB3 A;  2DNE A;  2J7Z A;  4HTH A;  1J8I A;  1AZQ A;  4ZLT F;  2I07 B;  3K5O A;  2H4O A;  4DFA A;  5NUC A;  5BN5 A;  4RGT A;  3SR1 A;  2ZT9 C;  3BS1 A;  1CI3 M;  2A6H D;  3OOC A;  5FLX L;  1IKM A;  3R3O A;  1STG A;  4M1U B;  1M4V A;  3A8K E;  2NYZ D;  4K8I A;  1B9M A;  1DOM A;  3FEW X;  1ENF A;  3P1H A;  3OMC A;  1PMR A;  4EQO A;  1PRT C;  4XIG S;  1T5E A;  4HAE A;  5KND A;  1I50 B;  2A68 D;  4G7Z C;  4IUP A;  1FYC A;  3NUC A;  1A3T A;  4KY5 A;  2L9H A;  4AYB B;  2F0W A;  3OHX C;  5C0X I;  4RGM A;  3TP8 A;  1E0B A;  3T4A C;  3T51 B;  3R2I A;  5COR A;  4QF4 A;  1RTN A;  4ABN A;  3TP5 A;  4UDU C;  2EVB A;  3QIA A;  5EJW A;  1SAP A;  3MC0 B;  1SE4 A;  1CK1 A;  2IW3 A;  2LMC B;  1HQR D;  1SEB D;  3K58 A;  2FHT A;  4OHJ A;  3C1E A;  4DK0 A;  3N6R A;  3GTQ B;  3QO2 A;  4DXF A;  1PZK D;  1Z7T A;  1WTR A;  3NBH A;  3HOU B;  4Z9C B;  4ODG A;  1G29 1;  4HMI A;  3GV3 A;  3BZD B;  5FOB B;  3BDL A;  3IKJ A;  1EY0 A;  2MGS A;  5KEE A;  1RF2 D;  2KCC A;  1RKN A;  5IGD A;  2BCO A;  2JA8 B;  5CV8 A;  4C2M B;  1S5D D;  1LLR D;  2XN9 C;  4NW2 A;  2K1B A;  2XNA C;  1SNO A;  4X3K A;  1HQM C;  2K7V A;  1MGS A;  1HA5 A;  4RAU C;  1VF7 A;  1IW7 D;  5C0X H;  5E4X A;  4KJO A;  5IT9 L;  2RDH A;  4JK1 C;  2ZXO A;  4IFD J;  1HFN A;  2VB3 X;  3NHH A;  2CW0 C;  1I4P A;  3P75 A;  5COY A;  2NN6 G;  2SOB A;  1V1P B;  1SFO B;  1EOT A;  1A3V A;  2ICI A;  1WTW A;  4Q0F A;  4OO1 H;  1HHV A;  4ULL A;  4QUF A;  5HUR A;  1KNA A;  3OIP A;  4QUC A;  3UI2 A;  4TRD A;  4OL7 A;  4KKS A;  4MHE A;  4ZRZ A;  1U4L A;  4XQN A;  4K14 A;  1WTP A;  2SNM A;  1D2B A;  3AMU A;  1JOK A;  1LT3 D;  1SBB B;  1NAP A;  1B1Z A;  3SK5 A;  5C3W A;  3BG3 A;  2EYH A;  1BNZ A;  1FGB D;  3NBI A;  4DU9 A;  1TQO A;  2FIN B;  4IFD G;  1ILQ A;  2WII B;  4Y7N B;  1WD1 A;  1O7Z A;  1H9J A;  4X3S A;  3O13 A;  1G2T A;  3C1F A;  2EJG C;  4U67 3;  3NK9 A;  2B2Y C;  5T1G A;  1TWG B;  2VB2 X;  4DGZ A;  5ELE A;  1V1O A;  5CV5 A;  4F88 A;  4L8J A;  1DON A;  4C3I B;  3K59 A;  2BA1 A;  3VYU A;  2RDF A;  2H1E A;  4ZKB B;  2B8G A;  4HMJ A;  2O4X A;  2Q8I B;  1LTG D;  4L6T B;  4C1N I;  3H94 A;  2NWG A;  1EY8 A;  2ID0 A;  2IWH A;  1CM9 A;  2BE5 C;  4B08 A;  4B9W A;  5EKK A;  4A3F B;  1AFP A;  3T13 A;  1D1I A;  3I3C A;  2QDB A;  3S1R B;  4KN4 C;  2ENB A;  4WJW A;  1JOR A;  1M8A A;  2QF7 A;  1OXX K;  1RDP D;  2IL8 A;  1PRT D;  1H9M A;  1EIG A;  2RQX A;  2MPM A;  1H9S A;  1SJH D;  2NUC A;  5IGG A;  1TT2 A;  2L55 A;  2QIL A;  4XDX A;  4KKT A;  1BCP F;  2WIN B;  2F1M A;  4DNT B;  2IT1 A;  1LV9 A;  3A7A B;  4XYQ A;  2KCN A;  2JE6 I;  3MHB A;  1BO0 A;  1JC7 A;  1BUV T;  1GHJ A;  3FPU B;  1IKL A;  1WD0 A;  3K5L A;  1HCZ A;  1HRJ A;  5IGF A;  2N55 A;  5M3F B;  2RDG A;  4DXG A;  2EY6 A;  2EYM A;  4N9T A;  4XTC S;  4PMB A;  2B2W A;  3I70 A;  2PW5 A;  1CQV A;  1TY2 A;  2CVR A;  1G2S A;  4K2K A;  1AN8 A;  2EJF C;  1JIC A;  3DM1 A;  1D6E C;  4ZYS A;  3R8B A;  1R4P B;  5EBC A;  4G4K A;  1XTC D;  4A3G B;  1WTQ A;  3TP7 A;  5D3D A;  5E4W C;  3M4O B;  5C3X A;  1PTO B;  1JOQ A;  2F0D A;  4ZUJ A;  3S14 B;  3GP7 A;  1EEF D;  1CQF A;  5F2D A;  1Q8I A;  2O2L D;  2EY1 A;  3GTG B;  1TS4 A;  3H0G B;  4HN7 A;  4RGO S;  4HSP A;  4KI0 A;  3OW7 A;  3QOJ A;  5I6Y A;  1ML0 D;  1EY7 A;  3BVZ A;  1R9T B;  3ERQ A;  4FYD A;  1WTV A;  3QWN A;  3DWA A;  3L7Z C;  1CFM A;  4XT1 B;  5ELC A;  1TR5 A;  3RZD B;  5CC4 A;  2E2H B;  2NN6 H;  3I4N B;  4A3J B;  1CHP D;  3Q6S A;  1S5C D;  4K8J A;  3HOX B;  3AB9 A;  4U68 A;  3RD4 A;  3E6Z X;  2KEC A;  1VMC A;  3H6M A;  3MXN A;  4IUT A;  3DEO A;  4ZQ3 A;  1L0X B;  1V8Q A;  2F0F A;  2L4N A;  2BA0 A;  3EA6 A;  3C2P A;  2BDN A;  5I9O A;  1AW7 A;  5CR3 A;  3GD7 A;  5M5Y B;  5CV6 A;  2HQE A;  4DNR B;  3FPP A;  2X6G A;  2E2I B;  1G91 A;  1STB A;  2B2T C;  3OWF A;  1HA6 A;  5E3F A;  4IFD H;  2F0E A;  4LK1 C;  1S4Z A;  3HG9 A;  2RSO A;  4K5W A;  2CHB D;  1B44 D;  2KQ3 A;  3ERO A;  2BE5 D;  1F9Q A;  3CKI B;  4RHS A;  2YU9 B;  3T56 B;  2A69 D;  1FR3 A;  1SE3 A;  3HOV B;  3Q23 A;  1SYE A;  2F0G A;  2C9O A;  2HCI A;  3W3A A;  2L5T A;  3HZX A;  4C3H G;  4J1M A;  3KLR A;  1PTO D;  2E74 C;  4S3S A;  1S5B D;  1DJR D;  2IJ0 A;  2F0H A;  5CV4 A;  3MXG A;  2XWB B;  1ET6 A;  1PDQ A;  1YNJ D;  2EJM A;  1ZYR C;  3MTS A;  5JVH 3;  4IAL A;  5KYL A;  2D9U A;  1TS5 A;  2PMZ B;  3VR2 A;  2B2U C;  3C46 A;  5JAV A;  1UUP A;  1F9P A;  1Y8N B;  1DCZ A;  1JOO A;  4IUV A;  4Q5V A;  1SYB A;  2GA4 B;  3NP8 A;  1OXT A;  5BN3 A;  5IIF A;  1BCP C;  3R93 A;  1H9K A;  5FO8 B;  2B2Y A;  3NXW A;  5JEA G;  2A6E C;  2O5I C;  1FD7 D;  4A3E B;  3S17 B;  3A56 A;  1RCV D;  1C4Q A;  1G8Z D;  1H9S B;  1Y1V B;  3GO5 A;  1RD9 D;  1JQY D;  1JR0 D;  5IGC A;  1WTX A;  2EE1 A;  1OO9 B;  4HR7 B;  2K5Q A;  3HEJ A;  3K57 A;  2F3W A;  4FNF A;  1U4P A;  2BDO A;  4GZY C;  3MXP A;  3OPO A;  5C4X B;  3VR4 A;  3TP6 A;  1K8M A;  1B50 A;  2L1B A;  2KHS A;  3NTK A;  4DK1 A;  1JCK B;  1KTK A;  1QE6 A;  2F03 A;  3SK8 A;  4RKB A;  3GTO B;  2NBF A;  2KVM A;  3P20 A;  1EYD A;  2QEJ C;  3LNN A;  4KY7 A;  4ME5 A;  3G7L A;  2JSO A;  2K32 A;  3TSS A;  5C4Z A;  3TDQ A;  1IYU A;  2EYP A;  2F0V A;  5IGB A;  1PFN A;  1JWU D;  1F2L A;  3NWT A;  2MP1 A;  3ND9 A;  3S16 B;  4DF7 A;  2B63 B;  5EQ0 A;  1XWE A;  3K7A B;  3GTP B;  4MN3 A;  4FF3 A;  1Q90 A;  1EIH A;  2D2C C;  1QNU A;  3BVG A;  2EYL A;  2F3V A;  2R6G A;  3TBI B;  2NVX B;  1SYF A;  4DN4 M;  1WTO A;  4O42 A;  1GUW A;  2NTS A;  2SDF A;  2A5H A;  4NP5 A;  1PRT B;  3X3N A;  3KK7 A;  3RLF A;  1U4R A;  1FNU A;  3NSW A;  3FKI B;  2MHV A;  1LTR D;  3CU7 A;  5FO7 B;  3SE0 A;  3FRP B;  4WOR A;  1QIL A;  1G6Z A;  3V2T A;  3M7G A;  2XSC A;  4A3I B;  3ITP A;  3VR6 A;  2IX3 A;  4G7H C;  4A3K B;  2K5D A;  2PZW A;  4NDX A;  1TVX A;  3I4M B;  3SXH A;  3C3L A;  3J80 E;  3IFD A;  3QJY A;  1PFB A;  3S2D B;  2J0T D;  5CV9 A;  3R2T A;  5KRU A;  3SEB A;  4CJ0 B;  2K33 A;  3U9O A;  2L11 A;  1ZYR D;  2KOL A;  2NVY B;  1GXD C;  1U9R A;  4PNY A;  4R8I A;  3BVM A;  3OMG A;  5DAU A;  1LTI D;  1VF5 C;  1EY9 A;  2K5W A;  3SDZ A;  1AEX A;  3KLS X;  3VR5 A;  2VXW A;  1EFI D;  1L0Y B;  4CJ2 C;  3K0Y A;  3V96 A;  3EQL C;  3LX0 A;  1A15 A;  1ZKO A;  1KLG D;  1RTO A;  1KNE A;  2NTT A;  3L9A X;  2A6E D;  4DAV A;  3MAQ A;  5D3I B;  3I72 A;  1JE4 A;  5K5P A;  2VUM B;  2AUK A;  3QOL A;  3PMF A;  4IZ8 A;  2F0Q A;  2BOS A;  4KTA A;  4BBS B;  2B2T A;  3MA2 B;  4KV6 A;  1SYC A;  4PQX A;  1F2Y A;  3A8J E;  1GUT A;  1TWA B;  3CRL C;  2DN8 A;  2X6L A;  1BOS A;  5JEA H;  3OIQ A;  5BN4 A;  4JBW A;  1KDC A;  2Z4I A;  4RA8 A;  5G3L D;  1TS2 A;  3MFG A;  3D4W A;  2R92 B;  4QB4 A;  2PZT A;  4LMQ D;  4BY7 B;  1QCB D;  3NPP A;  1OXU A;  2EYJ A;  3PO3 B;  3MWY W;  2LY7 A;  4K5X A;  1CA6 A;  2F0M A;  2G9D A;  4QCL A;  2RVL A;  2NVQ B;  1EZ8 A;  1CHQ D;  4C1N K;  1MSG A;  3IAY A;  2XVS A;  2KEE A;  3E0J A;  1B4O A;  2E2J B;  4IUN A;  1XXG A;  1PZI D;  1CA5 A;  2Z4H A;  2WAQ B;  1II3 A;  1QWY A;  2B2U A;  4KK7 A;  5EBD A;  2DY7 A;  2PW7 A;  1DYQ A;  1BBX C;  1S5F D;  3J80 L;  4DAY A;  5IGE A;  4DAP A;  1PTO H;  1OXS C;  1QJO A;  1EL0 A;  1A2T A;  1STH A;  5EPL A;  1F2Z A;  5J22 A;  3PIP 3;  4G57 A;  4LJZ C;  3H09 A;  1K8O A;  3W2D A;  2Q8R E;  1X3P A;  3EVQ A;  3HGB A;  1Y8P B;  1ENA A;  1SMY C;  4HED A;  3D6W A;  3S9W A;  2KA7 A;  2OT2 A;  1B9N A;  1LT4 D;  1VDZ A;  2DY8 A;  3Q24 A;  1IYV A;  3WDN A;  2EXZ A;  1ROD A;  2CW0 D;  1X3Q A;  1DXM A;  5D65 A;  3J81 E;  2IX0 A;  1PLF A;  5IOD A;  4FVM A;  1TS3 A;  2A6H C;  4KMU C;  2KJX A;  2EYF A;  3NQI A;  4OIK A;  2LKV A;  1E2Z A;  3RZO B;  1SDF A;  3L3O C;  4UAI A;  4NKL A;  3DWP A;  4YIJ A;  2F0S A;  1Y69 U;  4BA2 I;  2AWO A;  5EKI A;  2B39 A;  3VA7 A;  3FVQ A;  3D8G A;  2A68 C;  2OXP A;  5ELF A;  4V19 0;  1KDA A;  4L63 B;  5HGT A;  4I65 A;  2M2L A;  1WVL A;  1CZG A;  4KHV A;  1QOH A;  3GTK B;  4X3T A;  2FMM A;  2F0T A;  2EDG A;  2QKI C;  2XWJ B;  2D62 A;  5C3E B;  1EEI D;  1GJX A;  1TKW B;  2EOT A;  4C56 C;  2K03 A;  4BY1 B;  4WRD A;  1EY4 A;  3PUY A;  5C4H A;  2X69 A;  4H0L C;  1F9R A;  5DM6 3;  4BS9 A;  3J7A F;  1B53 A;  2JEA I;  2R3Z A;  4I7Z C;  2VNU D;  2D5D A;  3J7Y W;  2A73 B;  3NTH A;  3TZU A;  1SNP A;  4FF1 A;  2ICE C;  1KDB A;  4F8M A;  3M85 A;  3DHQ A;  4H44 C;  3F2U A;  2WB1 B;  4KY6 A;  4KKU A;  2R7Z B;  1Q1E A;  4C3I G;  2EYO A;  1EQV A;  2RSN A;  2QCP X;  1IW7 C;  4TSS A;  3HOY B;  4LAA A;  4CGY B;  1LT6 D;  1EY6 A;  1LT5 D;  2F0O A;  3MXU A;  2F0L A;  1HUM A;  1U4M A;  4B9X A;  4EGV A;  2IPK D;  4IUR A;  4QIW B;  1A3U A;  3SK6 A;  3I8Z A;  2E2D C;  2AWN A;  5EKL A;  1GOZ A;  2JA7 B;  4XXE A;  2IX1 A;  3WOE A;  3J81 L;  2WV6 D;  5M3M B;  4FXD A;  4RKL A;  2JXM B;  2AQ3 B;  3LWE A;  1EYC A;  5T1I A;  3EJI A;  1SYG A;  4TQU S;  1EU3 A;  2XRS D;  5KNC A;  1A6X A;  4CJ1 B;  5A2Q E;  2Z1C A;  4XYO A;  4RCN A;  5CV7 A;  3I91 A;  4OIJ A;  3PV0 A;  4MIU A;  1BR9 A;  4HSV A;  1SMY D;  1VCI A;  2PYK A;  4HCE A;  4PMW A;  3MZ5 A;  3GV6 A;  1PTO F;  3VYT A;  1Z47 A;  2PO4 A;  3HP3 A;  3KBG A;  2PNR C;  3T16 A;  1PYW D;  2FJ2 A;  1XYI A;  4KHZ A;  3H3V C;  1JWM D;  1GUS A;  3TZD A;  1O7L A;  1ESR A;  2K28 A;  1UNS A;  3BDC A;  2HUG A;  1EZ6 A;  5CBE E;  4H7B A;  3D4R A;  1UEA B;  3VR3 A;  2G9H D;  1E2V A;  2MJ8 A;  1Q3L A;  2A74 C;  3A55 A;  2WAC A;  5I9P A;  4E6I A;  1EWH A;  3A54 A;  1BCP B;  4KN7 C;  2Q8T A;  4CKC A;  1HUN A;  1DD2 A;  3PUV A;  1SE2 A;  1LAB A;  2EPB A;  1HTL D;  3Q0A A;  3A8I E;  1E2W A;  4A3M B;  2B2V C;  5C4J B;  4IUU A;  2EY2 A;  1EQT A;  1EYA A;  5FKA C;  1KAA A;  4OO1 I;  4N9P A;  5C44 B;  1Y1W B;  3K5M A;  1SNC A;  4CHT B;  3EFX D;  4F7X A;  5JJZ A;  1F2M A;  1LAC A;  2Y0S B;  2AQ1 B;  5LL6 X;  3HKZ B;  3BYT B;  1I4R A;  1ESF A;  1MSH A;  1VMP A;  1T5X D;  2HDM A;  5I4D A;  1STY A;  3TN2 A;  4FXG C;  1QG7 A;  2RA4 A;  2AUJ D;  1SJE D;  5ELB A;  2NZ1 D;  4PMC A;  1TY0 A;  2I46 A;  3RUZ A;  3GTM B;  4EQN A;  1BQQ T;  2O5J C;  3WOF A;  2JA5 B;  5FO9 B;  5A2Q L;  3DMU A;  2XIW A;  2K04 A;  1EWC A;  1O7Y A;  3CHB D;  1SNQ A;  3U9S A;  4ZUI A;  4EQP A;  1SXT A;  1MI2 A;  4EVO A;  4CKE A;  2F0U A;  3DXJ C;  3NE5 B;  5FK9 C;  2E75 C;  5JPM C;  3S15 B;  2LFN A;  1NCV A;  2ZXR A;  1RHP A;  3VYS A;  5DNF A;  3ONA B;  3ZYY X;  3AU7 A;  5KNB A;  1GUO A;  4FF2 A;  3S1N B;  1TWC B;  3NWS A;  1IL8 A;  1NSN S;  2F4I A;  2F0K A;  1SND A;  2OF1 A;  1W6J A;  5KIX A;  2RKS A;  3I73 A;  4C3J B;  1BXT A;  2PZU A;  1QB5 D;  1AP0 A;  2K6A A;  5J1Z A;  2PPB C;  4TKO B;  2EY5 A;  3OSO A;  3D4D A;  3CQZ B;  2FFK B;  1W6K A;  5KYI A;  3Q22 A;  4ZAI A;  4RWS C;  1BCP D;  5DEH A;  3D31 A;  1UAP A;  2PQE A;  3OWE B;  1V43 A;  1GUN A;  5CBA E;  3HOZ B;  3PUW A;  4WFN 3;  1CTM A;  4A3D B;  2R61 A;  2KUM A;  1ZXT A;  5I6W A;  2JP1 A;  3KF8 A;  2C5C A;  3RMH A;  3GQB A;  3GTL B;  1Q12 A;  4C3H B;  5JOB A;  1WCM B;  4G7O C;  4HCS A;  2F0J A;  3PO2 B;  1NR4 A;  2M00 A;  3D6C A;  2WKC A;  4NMZ A;  1YNN C;  4P2C B;  3T53 B;  5ISR A;  1XX8 A;  3N52 A;  4K6D A;  3JAM E;  2L12 A;  3FDT A;  2A69 C;  2N88 A;  4IQZ A;  4ZK9 B;  1PZJ D;  4RHR A;  3V05 A;  1S5E D;  2AQ2 B;  3PIO 3;  1I3Q B;  1ZEQ X;  3S2H B;  4FXK C;  2CQA A;  1GUG A;  4J6H A;  2J4X A;  4FP5 D;  1KLU D;  4RGN A;  1I4H A;  1PTO C;  2SEB D;  1X32 A;  1PFM A;  3KLS A;  3BYY B;  5CGK A;  3D3R A;  4ZKC B;  2F0I A;  3KUP A;  1HPC A;  3DUZ A;  5D14 A;  2TMP A;  3K6O A;  1ET9 A;  5C5M A;  1GHK A;  5AFW A;  1YNJ C;  4R8N A;  1QNK A;  5I2X A;  5DM7 3;  5TSS A;  1I6H B;  1CZW A;  3X3M A;  3VYR A;  4J8Q A;  5LHY 1;  5K36 G;  3DWQ A;  3E5S A;  4ID6 A;  2R93 B;  2JA6 B;  3IL8 A;  2YYZ A;  4XT3 B;  4A3B B;  4QMG A;  3URY A;  1B2T A;  1PXU A;  3P7J A;  4RH6 A;  4OGQ C;  4RFB A;  2SNS A;  2L0C A;  3SHL A;  3G6J B;  5A35 A;  5G3L F;  1PRT F;  2NN6 I;  1C48 A;  3DEP A;  2OEO A;  3I4L A;  1H9R A;  4CBV A;  1STE A;  3S1M B;  4RCO A;  1LTS D;  2JEB I;  2XRQ D;  3BDO A;  1JB3 A;  1MBY A;  2FMC A;  1HXY D;  1AZP A;  4ILW A;  3MVV A;  4X3U A;  3IFT A;  1D5Z C;  1O80 A;  3QG1 A;  2JYO A;  1LO5 D;  4F87 A;  5J39 A;  5EPJ A;  2TSS A;  3HOW B;  1FNV A;  1JWS D;  4O1N A;  1I4X A;  3TME A;  5ELD A;  2WP8 J;  2RBM A;  3S1Q B;  5KGU A;  4CKB A;  1DM0 B;  1Z6H A;  3MEH A;  3MFY A;  5C0X J;  4IFD I;  1SYD A;  1TWH B;  4BWG B;  4K6L A;  1BDO A;  5JVG 3;  1B3A A;  3HRZ C;  2WKD A;  1LTA D;  5EGT A;  1CT1 D;  4PV1 C;  4FO2 A;  1I6V C;  1V1P A;  5M9O A;  3I90 A;  3JAM L;  4FF4 A;  3SVM A;  1FNW A;  4IN3 A;  1ONL A;  2MUY A;  2B2V A;  5CYU A;  3M3Y B;  3GTJ B;  4XQQ A;  1SSO A;  5CMD A;  1K83 B;  1IHZ A;  3KBX A;  5FLX E;  1STA A;  2HCC A;  3A7L A;  1ICW A;  1STN A;  3NQT A;  5C0X G;  4KD3 A;  3FMC A;  4K5V A;  1D5X C;  3SK4 A;  3H91 A;  4C3J G;  1J9O A;  5I2Y A;  1LTB D;  1EY5 A;  4XQJ A;  5C5L A;  1OXV A;  4OO1 G;  5M5W B;  1Y8O B;  1DZ1 A;  1HFG A;  1ENC A;  3PUZ A;  3NTI A;  1F77 A;  2F0P A;  4KJN A;  3HS0 C;  1YNN D;  1A2U A;  1NUC A;  4V0B A;  5JPN C;  4IUQ A;  5M5X B;  1TII D;  1I4Q A;  2V4D A;  4A93 B;  4BA1 I;  1O78 A;  3PUX A;  1D1K A;  1HTP A;  3K5N A;  4KD4 A;  1EU4 A;  1F9S A;  1MD2 D;  5LL6 S;  1NR2 A;  2KED A;  5E1F A;  4M8A A;  3M7N A;  1TWF B;  1DOL A;  1D5M C;  3J7A V;  2PCF B;  1C8C A;  5JEA J;  4K2L A;  1Q1B A;  2ZXP A;  5C6A A;  4BBR B;  1TU2 B;  2EZV A;  3VA5 A;  3M4Y A;  4DA2 A;  1I4G A;  1KAB A;  2LS0 1;  1ILP A;  2F0N A;  2B8F A;  3LWU A;  2K05 A;  3CRK C;  2Z8L A;  1R4Q B;  1RJT A;  1SNM A;  2K01 A;  1DOK A;  2DNC A;  1BF4 A;  5IT9 E;  2B2W C;  5IOC A;  4H13 C;  3ND8 A;  2NB0 A;  2M9V A;  5EPK A;  4R9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...