2DY9A

Crystal structure of nucleoside diphosphate kinase in complex with adp
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
154
structure length
154
Chain Sequence
SETERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIWIDRELAEKHYEEHREKPFFKALIDYITKTPVVVMVLEGRYAVEVVRKMAGATDPKDAAPGTIRGDFGLEVSDAICNVIHASDSKESAEREISLFFKPEELFEYPRAADWFYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of nucleoside diphosphate kinase in complex with ADP
rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 53
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2dy9A00
4UOGA 4S0MA 2DXFA 2HURA 3VGUA 3DKDA 4FKYA 3EE3A 3L7UA 1HIYA 3VGVA 4KPCA 3B54A 3R9LA 3DDIA 1BE4A 1W7WA 1UCNA 2HVDA 3VGSA 3GPAA 4W98A 2DXEA 4F36A 1WKJA 2B8PA 1KDNA 2DY9A 1NDPA 3Q8VA 3ZTQA 5IOLA 3PJ9A 3EJMA 1WKKA 1S57A 1WKLA 4CP5A 3NGSA 3EVMA 1NDLA 1LEOA 3PRVA 1BUXA 4ANDA 3Q86A 3ZTOA 3G2XA 4WBFA 1MN9A 1NSKL 1NDCA 1NHKL 3BBFA 3BBCA 3FBBA 3WX8A 1NDKA 4DUTA 3FBEA 4FKXA 1XIQA 2AZ3A 1NSQA 1BHNA 1F6TA 1B99A 3FKBA 5C7PA 3ENAA 3VVUA 4O0NA 3VGTA 3FCWA 1EHWA 3Q89A 3BH6B 1LWXA 3Q83A 4HR2A 1HHQA 2ZUAA 4ANEA 3ZTSA 3FCVA 3FBFA 3ZTPA 4F4AA 1K44A 3EMTA 4DZ6A 3Q8UA 3NGRA 1HLWA 1S5ZA 3GP9A 1B4SA 3ZTRA 3BH7B 1U8WA 4ENOA 3EM1A 3FC9A 2DYAA 1ZS6A 3BBBA 4EK2A 3MPDA 4ANCA 1S59A 2CWKA 3NGTA 1PKUA 1NSPA 3ELHA 2AZ1A 3NGUA 2B8QA 2BEFA 2BX6A 2HVEA 3VVTA 4C6AA 3EVWA 1NB2A 3EVOA 3FBCA 1NLKL 3ETMA 2NCKL 1PAEX 1NCLA 4UOHA 1JXVA 1F3FA 5CAAA 3B6BA 1NUEA 1VYAA 1NPKA 4UOFA 5CABA 3EICA 3JS9A 4DI6A 1XQIA 5BXIA 2VU5A 3Q8YA 1MN7A 2DXDA
chains in the Genus database with same CATH superfamily
4AL5A 2P8IA 2ZKUA 4L72B 4URGA 2DO4A 3L7UA 4ELUA 4LBIA 2PI5A 3G82A 2AMCB 4Y65A 1HNZJ 4USWA 1SIZA 1UCNA 3M32B 1Y5NB 1N56A 3I5CA 2W4DA 5FLXY 4OHWA 1RBLA 1O8BA 1SPBP 4KSEB 4O3OA 3NAHA 4J9LA 3NMRA 5KFSA 3MXHP 3VQSA 3QPIA 1KDNA 2OD6A 1RHJB 3GIRA 3TANA 2FVPA 4NLGA 3MMCA 4EO6A 2UVRA 1FERA 4C0BA 2ZZNA 2HMIA 1N36J 4A8XA 2D7SA 3HVAA 4ILLA 4MYUA 3PIOQ 1J5OB 4ITSA 2LXFA 3W66A 4XDDA 3KG0A 1RGVA 4NLRA 1LW0A 3N6MA 5KFTA 4CYUA 1VC5A 2AJFE 1HNXF 5AE2A 2DISA 3MFIA 1FXDA 1H6KX 3FMWA 4CO2A 1RT1B 3QLHA 4BDPA 3HT3A 1IJFB 1S9EA 2DNPA 3MMAB 4K4WA 4OJ1A 1APSA 4PG6A 1NHVA 1YQHA 2BVZA 4I68A 2ZVIA 2A1BA 7FD1A 1JLAB 5DM6Q 3EPGA 1Q53A 5SUHA 1WEZA 1UJ6A 3AB2B 3C6UB 4J9UE 1YX2A 3VV2B 3ZFVA 4LF4F 5HMZA 3OFHA 5L39A 5HLFA 3G96A 3I4PA 5EDWA 1PIEA 1OY9A 4X62J 4IRKA 4UZCA 1R31A 4LFCJ 3QZ8A 3T5KA 1S0OA 2FHOB 3JQMA 1XMOF 3ENVA 3D6TB 3TAQA 4RWXA 2Y9HA 3BGFA 3FCWA 2Z0GA 4Y6IA 3NKYA 1LW0B 4RBVA 2ZH1A 2UUAF 2HIQA 1X9WA 3ENQA 2J0XA 3MMCB 2H54B 1VC0A 4CQ1A 5F8MA 3T3FA 3PKMA 1QD1A 4OZNA 4QIEA 2ZD1A 2XZDB 1AZSB 4FNHA 3RYLA 3PV8A 4M95A 1WC4A 4TY8B 4ANEA 2IA0A 3JB9k 1I94J 1TKXA 4J9MA 4ZKAA 1DRZA 1YJ7A 4JV0A 1RKIA 2W9BA 1FCAA 3KLEB 5GAGI 1FKPB 4K0KF 2W01A 4P73A 1T9XA 1M5KC 1JLQA 1S6OA 3DI6B 1KTVA 4NLYA 1IBLJ 2NZCA 2L3MA 1M5OC 4LF9J 4DFKA 4IFVB 3DLEB 4DV6F 1ZS6A 2WONA 1SXLA 2CPJA 2ZHBA 1M5SA 1TVRA 4XIUA 1RCOB 3OSPA 2VH7A 2DGXA 1S59A 2VFTA 3OR2B 5AXLA 4RWWA 2WVCA 1H74A 1HBMB 2CAJA 3GJRB 4U6PA 4O23A 4DFMA 2O1PA 1LW2A 3NGUA 3OL6A 4WXWA 3TZZA 2AGOA 1SKSA 3N5FA 4K50A 2ZH9A 4X4TA 4O4GB 1R0BG 1ZM4A 2EXUA 5I42B 2ASDA 1N52B 4I7FA 4PZVA 3NOCA 3R5BA 1F0XA 3T1YJ 2RD5C 3FBCA 5KT7A 1KLMB 4Z7YA 1QLNA 4Z7CA 1U6BA 1LKZA 1S4FA 2NCKL 8RUCA 3EGVA 3TUIC 2W9CA 1P9QC 4WFAQ 2VV5A 3C6TA 2ATLA 3E8OA 2XB2D 4ZLLA 2F7VA 1HKAA 2KN4A 3CJ3A 4FS1A 5C24A 2KL8A 1LOUA 2QMXA 3D4JA 1TMJA 4HACA 4X4QA 2DHGA 1HPZB 1RT5A 2OTLS 4UOFA 4DR6F 2HNZB 5CABA 3TARA 4KV8A 4FN5A 2YNFA 2O3DA 4Y0FA 2DNRA 3W5XA 2FJAB 2ZOMA 3MEGA 3NWRA 3BEGB 1LWEA 4LF2A 3AXKA 3QJJA 5F9LA 4DSEA 1PGZA 5KFAA 4USMA 1N54B 2UXBJ 2XMWA 2CQIA 1JLCB 3MTJA 2BJ3A 3TA2A 4NLTA 2R7OA 4QPTA 4EU0A 2HFOA 3V6KA 5DRKA 1S99A 4I2QA 2PEHA 4I7FB 3IG1B 1IQTA 2XS2A 3EGZA 1T9WA 2YPYA 2I1RA 1KQSR 2KYZA 3DRPA 3R5CA 3PJWA 1WHXA 2QA2A 3HJVA 2XMUA 3MM7A 5E3RA 3G8SA 4DV4F 1RSCA 1YIJS 5D0RA 2XHCA 1C4AA 1SUQA 2MY8A 2V69A 3BPDA 5L8RC 1VHFA 3ULHA 3EYZA 5LMNF 1FFWB 3UE2A 2FJXA 4J9PA 2DH8A 1EZZB 4DU8A 1JLFB 4X62F 2ZH7A 5A8KB 4XPEA 2N7YA 2G13A 1WOSA 2EWHA 5CYQB 2UUTA 3AOAA 6AT1B 5KG2A 5CH7B 1HBNA 1BD6A 3I0RB 2OELA 3KLHB 1SKRA 4QIVA 2XHWA 1OQ6A 3DRSB 1FEHA 1PBUA 3DU5A 3FK4A 3MCSA 4WCEQ 2W8LA 4OYBA 2QL7B 4I1TA 4IYQA 4N77A 2ALZA 1AT1B 4MK9A 4DV1F 2Q79A 3LUYA 4IQMA 5D77A 1FRJA 4JI6F 2B43A 4TYBA 2UXCF 1VRUB 2M0GB 2J8AA 2V68A 4IG3B 1IKVB 4HACB 4JBCA 5HJXA 1Y5LB 1B0PA 2LQ9A 2IRUA 3VZHA 2NLWA 4ZP9A 5G0RA 3KTQA 3BKTA 2UUWA 5HVGA 5AJ3J 3FSIA 1S72S 4F3OA 1FO1A 2D9OA 1C2PA 5A8RA 1VRQC 5BYRA 1FRHA 4WIQA 4K7QA 4B9MA 3SCLE 3NLCA 1GXUA 1YDLA 5DZ7A 4DQSA 1CULB 4DZDA 4F2RA 1N34J 2BOPA 2V0NA 3HDSA 4LIRA 2AJ4A 3GMGA 4PXBA 2R8KA 2C2EA 2G0CA 2MGZA 4KHRA 1EKRA 5K8PA 3CD7A 3TRGA 4MH8A 2LQ8A 4J9QA 3L9ZA 4DR3J 1PYTA 3Q89A 5E7OB 4UY8T 4J7CA 3KLFB 4X64F 3MM6B 2G2YA 2HBZB 2ZUAA 1TAUA 2EBGA 3SYZA 2D3ZA 1U1MA 2DPIA 1WC1A 1QAYA 3LGMA 3MPUB 3M9MB 1L3UA 5ETKA 3JAMU 3PZPA 1K44A 3IBCB 1H2VZ 4JI1F 1SIWB 1HLWA 2VICA 1NJZA 1SJRA 3MM5A 4R25A 1CJKA 5LMUF 5EWFA 4ZVSB 1X5SA 2IYIA 1BGXT 2CFXA 2VG5B 3LP2A 2GMJA 4CNYA 3Q8QB 3JYTA 1FJEB 1CJTA 2F3JA 1DFDA 4MFBA 4ID8A 2KDOA 3BQ0A 2J76E 3NGKA 4B3TF 5B08A 1KSPA 4GKJF 2C1EB 3H7HB 2QO3A 4HLBA 1U25A 4ZVUB 2B6AA 4OI2A 5AE3A 3R5JB 3THPA 3RB6A 2GW8A 5BYQA 5KG6A 2OPSB 2IYGA 2MQPA 3ZXWA 1NK7A 2B5JA 5JUMA 5DG8A 4I64A 4KAIA 4Y2CA 2MJUA 4RBUA 4KFBB 3D6MB 3I9V9 3GIMA 5DG7A 2MKIA 3KJNB 1WG5A 1EETA 2YXLA 4ATNA 2JHEA 2LXIA 1GXTA 2JRSA 2BQ3A 2KI2A 4OYOA 4LSZB 4DF8A 3I55S 5ADZA 1MWQA 1NPRA 2Y1RI 3Q2TC 2J7UA 3OHBA 1S1UB 1RAHB 1TKZB 1T9UA 2E29A 3CJ4A 1EIYB 4J5OA 2V94A 4B17A 3BM7A 2LXUA 2F4FA 2A3JA 2DNLA 3A12A 3N01A 4DI6A 4KGKA 3J7AN 2Z2MA 4WTOB 4DR2J 5L1JA 3V81A 2GIFA 5KT2A 2R2TA 3QAUA 3TZWA 2DXDA 2QL5B 3CCVS 4RLEA 4OJHA 3UDLA 4DV3F 1ZPVA 2I6WA 2FC9A 2ZJPQ 1HIYA 2O01C 3DYAB 4DX6A 3Q8SB 4C4WA 2IM0A 4ZN1A 4ID5A 3V4MA 1VOMA 4PG7A 1IM4A 2QEXS 2WB4A 3GZ7A 1U1KA 2BRLA 1VQSA 4K5SA 1Z4UA 3UD5A 4ZIVA 6FDRA 1H38A 1S77D 1NZAA 3HP6A 8ATCB 4R0EA 4RU9A 1JJ2R 3MUVP 3ADAC 2XSFA 4PWWA 1UPPA 4GC7A 4AQYJ 4ED6A 1HARA 2A2DA 2CA9A 4PUOB 4K4YA 1D0EA 2YQ3A 3DM2B 4ZN3A 1IBKF 3UVJA 1NDPA 3EPIA 1RWMB 1KC8T 2UZAA 2FDNA 2YWKA 1ZOTA 1V5VA 2RRBA 4P2XA 3K0JA 2VASA 4RUCA 2RVJA 1WEXA 3DOMA 2B4PA 1C0UB 4M5GA 4URSA 2YNIA 3BSOA 3MOJB 1FXLA 2DGWA 1KHVA 1LEOA 1EJ7L 1YK9A 2GMHA 3V6DA 2KO1A 4DL6A 4M94A 4PYDA 4X4UA 4LF7F 1RACB 1FVSA 1NHKL 2GIQA 2QN6B 4QW8A 4G6VB 3PJXA 3SFUA 3CCJS 4KY3A 3M7VA 3KMSA 2QLJB 1I5OB 2IJNA 2BDPA 3LTOA 1RAIB 4YFUA 2VUGA 2H51B 2HWIA 2Q43A 1WI6A 4DR1F 4DPOA 3OXFA 2N7CA 2AEJA 1ZZNA 2H48B 2FHKA 2I8EA 2ZEJA 3A8JA 4CM2A 3HLUA 1LFPA 3KHGA 1FA0A 4DQIA 2CG4A 4Q43A 4F0KA 3U7JA 2IJFA 1N6QA 1L5UA 2DGQA 2GHWA 3A1YG 1RLCL 4WFYA 2WOMA 4B3MJ 1SBRA 3D28A 4KHPJ 3ZZZA 3CJQA 4PG8A 2RU3A 1S9EB 4XTTA 4CLUA 1F2GA 1RLDA 4DU7A 3TAPA 4ZLJA 2BJ1A 4WXOA 2BV3A 2M9KA 2MLZA 1RAFB 2XG8A 4Q8EA 2HGMA 1FRIA 3OTBA 5IT4A 2KTQA 3NGRA 2FJEB 1PILA 2YNFB 3DGPA 1RU2A 3H20A 1RI7A 1NK5A 2N3OA 2XULA 3VAMA 3QGHA 2AGPA 3C16B 4CO1A 4AFFA 4B9LA 3I87A 3NXZA 3W9IA 1XNQJ 2DEIA 2AJ0A 3FCHA 1F2HA 5E0OA 3RR7A 4RW6A 4UQTA 4C8ZA 2GGPA 5J1NA 2FLNA 4W90B 4C9DA 4W4MA 4J9NA 2X3DA 4TYAA 3NY0A 1LXJA 5HMXA 2BANA 1MLAA 5HAOA 4RW4B 4FF4A 1W25A 3MECB 2KZMA 2C3OA 4GVLA 2I5JA 2HHSA 3M05A 4NASA 2F4VJ 4CT9A 2DT9A 2L9NA 1NSPA 1WC3A 1HFEL 2BRKA 3KLIB 4ILRA 5E2QA 1SJ3P 2AYBA 3KHRA 2V8DA 2FC8A 4ZITA 3D68A 4NZ7A 3G6VA 3JTPA 3SBMA 3T5JA 3RW6A 3MI7X 3SDEB 4CCHA 4QIFA 3W9HA 5KT5A 1NLKL 3FMBA 4L6V3 2RAQA 2B9YA 4HH1A 3CJ8A 2H5EA 4OLOA 2Y8WA 1TL7B 4LVOP 3M6VA 1NMEB 1J2VA 4DPUA 3B78A 2HQ3A 2HSEB 4RZRA 4IR1A 4V19X 1XTZA 4UZBA 1VLOA 1P9YA 3HHLA 5L1LA 1VYAA 2DR5A 5IC4B 4KBIA 1M90T 1N32J 4DG1A 3EICA 4FYXB 2VBYA 5HBMB 1CC7A 3JS9A 3SSSA 3TI0A 1HNWJ 1RA6A 3MOZA 1XR7A 2W2OP 2Y0SD 4FF1A 4P2MA 1HWJA 4B3RF 4WYWA 1HBMA 2IBOA 1TZ0A 2A18A 1EKSA 4KHMA 1WUUA 3C2PA 4NXMJ 4F02A 3DHXA 4XDCA 5B0AA 3QZ7A 1LK5A 4GVBA 4OYWA 3AA8A 1HW9A 1T9TA 3B54A 3HULA 2A6MA 2GQQA 1U2RA 2H9ZA 1U49A 1Q5VA 1A9NB 1K8AT 3GYNA 1IKWB 2X1AA 3RB3A 4KKOA 2G4BA 4RO0A 1R8AA 3OTCA 4DR5F 5IXUA 4ECXA 2EI5A 3CVKA 5HLFB 3MM9B 4P52A 1R0CB 1QAIA 3Q8VA 2HEKA 2GV1A 1R8PA 2AJ1A 2DNGA 4P75A 1JLGA 4N47A 3UR3C 4Q2LA 3CPWR 3V4IB 5T7LA 2QA4G 2COLA 1M1GA 2HRTA 4A8SA 2RUSA 2DVIA 3OFEA 4K0KJ 5MLCV 1K0TA 3IWXA 2FVSA 2GFFA 4HI2A 2ZBCA 2GQ2A 4RPFA 5LSLA 3J7YI 2HK2A 2AYGA 3PY8A 1B7YB 4OI6A 5A76A 3QRPA 5K8MA 1NK8A 4WBFA 2XMTA 3G82B 4RJVA 1X31C 3BBFA 4C8YA 3MR3A 4FBTA 4YB5A 1L3KA 1HMVB 1FVQA 4PKDB 3WX8A 1U4BA 2Y8YA 3FBEA 3WBZA 4TQRA 4OYPA 3NCQA 1ACMB 3UN2A 1FNMA 2LECA 2Y1IA 4M63A 2V67A 4F25A 3OL7A 4DEZA 3KLGA 3BSCA 3NMAA 3EX7B 5CZXA 5DM7Q 4B3SF 1XK8A 3W63A 1HYSB 3HHNB 1WF2A 2YX7A 1OPIA 3T5HA 2VG7B 3OPKA 1RTHB 2IVFB 1Q8KA 4QYZJ 2WSFC 3NNHA 2CQ1A 2VBWA 2RF2B 2YNHB 3VHQA 2BACA 5KOXA 1L3TA 2M2BA 2VDIA 3ET6B 1Q8LA 1FWPA 4KC5A 4EMDA 4J9OA 2IHR1 5B0EA 1YKWA 4JI2J 1N33F 3W3SA 3UD3P 1F60B 4USVA 1S1VA 4NRUA 4LFAJ 1JJ4A 1WF0A 4OL8A 5K5MA 5DG9A 2C2MB 3F41A 1T03B 1G2EA 4EBCA 4J91A 2DBBA 3UDEA 3ZTRA 1FTRA 4NLPA 1WTFA 1ICEB 1TUGB 5KFGA 2W7AA 2N82B 3NRBA 2MXYA 3HFVA 3TX0A 4PUOA 5HJYA 5DGAA 3LA0A 1WSRA 1YWXA 1VK8A 3UVJB 3MPDA 5KG1A 1NSAA 2DGTA 2PT0A 4QR2A 1NXIA 3OHAA 1GTEA 1FWLA 2ZNZA 1VS3A 3ISNC 2YX4A 1JMTA 1Q7YT 3ELHA 2DK2A 1SV5A 2DPJA 1TK5A 1DHMA 4TNOA 2CQDA 2ZKTA 1HI0P 2NXNA 2XBPA 3VVTA 4CNZA 2KFNA 1NB2A 4JOUA 2B51A 2CPYA 3PHTA 3R7NB 3RJMB 1GX5A 4CH7A 3ICLA 3KNGA 3G4SS 2MSTA 3BV8A 3LAMA 4LR8A 2XY7A 2FLPA 2C2OB 4ED0A 4O3QA 3M8ZA 1G1XA 2IRYA 1Y7PA 2F63A 3C19A 2Q6BA 5KG7A 5CAAA 3AB4B 5K8OA 4IQXA 1EX8A 4J9SA 1DTTB 4YB6A 1S1TA 2B4UA 3AAWB 3KK1B 1VQLS 1RT7B 4RW8B 1V3RA 4DPYA 1BQNB 3OR2A 1IN0A 1S1XB 3ETOA 3QATA 1RA7A 2RQKA 3K5NA 4IFVA 1U1OA 3HO1A 3NNAA 1FJGJ 4X4NA 2DXFA 4WFZA 1O0PA 4IOAQ 5CYMB 3CJSA 4KPCA 3CB4A 3AODA 3R9LA 2VJVA 4QU6A 3UW1A 1T3NA 1NKCA 4OX8A 4OZ3A 3GV8B 2CZ4A 2D69A 3DFEA 3DGVA 2V50A 2ROEA 3K2YA 3T41A 1FKOA 4DL0C 2CQ0A 4MJKA 2W9BB 2E1AA 1C1CB 5GAGU 2C2RA 4WE1A 1ZM2A 5GAEU 1U2CA 2E7XA 1CJUA 2PIIA 2IVYA 2M52A 4LIWA 4ZCMA 5B0DA 3CJRA 3D1QA 4WU3A 4NI2A 1Q95G 4RNFA 2BW7A 2A6OA 3M8SA 1NBEB 9RUBA 1BY9A 3JTOA 4QWBA 3RR8A 2HK3A 4ECWA 3EVMA 4JV2A 5HVFA 2J7KA 3V6HA 1C1BA 3VF0B 5H1SV 3FNNA 3H5SA 3A8IA 3SQGB 3CO0P 2LQJA 4F4XA 2JLEA 1HQEA 1TL4A 2MEWA 1F9HA 1N5VA 2H65B 2YWFA 3BYPA 2ACYA 3GJTB 1LWEB 2XLIA 4A8FA 2B7CB 3TAMA 3GQCA 2E9TA 3J7YU 1CLFA 4YHHF 3K59A 3KK1A 2UUCJ 2XMAA 2YNGB 3Q0AA 2CZ9A 3FZ2A 2AJQA 1B0VA 1XIQA 2WVEA 1RTJB 4ICLA 1T05A 1DQAA 1MMDA 2PA3A 2MLXA 4RR5A 1RWKB 5ETMA 1BHNA 3UFCX 3DDKA 3H40A 2HHQA 5C7PA 3MAAB 4WPAA 4X4OA 3ENAA 4TXSA 4DR5J 1HHTP 4C7QA 2F4VF 3AOCA 3NS7B 4X4RA 3I31A 2R7SA 3H2VE 4KR0B 5JJBA 1XEZA 2E44A 1KKHA 1ZBTA 2E7VA 2CQ2A 2HWHA 4L3KA 3GV7B 2EG1A 1SKUB 4M5KA 1S76D 1Y4ZB 4E0DA 2PFFB 2O67A 4X65J 4DV6J 5ETTA 3DCAA 2VKZG 2BUNA 3QMQA 3QSIA 2W7PA 2BQUA 3OL8A 3MUMP 1RKJA 1S1UA 2ASLA 4KO0A 1N0UA 5EN1A 3BR8A 3HVTA 3QAEA 4Q0BB 6FD1A 4ECTA 1B0TA 1ZAVA 2EVZA 3CE8A 1R43A 3RBZA 3C15A 3Q22A 2KKHA 3LP0B 2JZ5A 5ETLA 1IBMJ 2FLLA 1S0NA 3R2CJ 1S9FA 1RHMB 1UPMB 2FTRA 3BH7B 4YDXA 5I3UA 3UCGA 4FF3A 1RTIA 2IAJB 5BYSA 2BJ7A 2J0SD 3KNAA 1ZA1B 1QSYA 3CJ2A 1KD1T 3W2VA 4UW2A 4DBQA 3CCTA 4F67A 3U1MA 4A8MP 4P9SA 4TVAB 2DNNA 4HHHA 4FS2A 3G87A 2ZZMA 2OPQB 2ROPA 1EARA 2JSXA 2NXCA 1XR6A 4HH0A 1JLGB 3C66A 5J1PA 1XMQF 1FD2A 2WVDA 3ZZTA 4U8YA 4BC7A 3DYAA 2M8DB 2NXJA 2W24A 5CCMA 5HO4A 3OUYA 2RE1A 1SI9A 2X51A 3AD8C 2AEFA 4CT8A 2EBEA 5IWAJ 5DLFA 4NXNJ 2UUCF 1IXKA 4C8NA 3CIZA 1D8ZA 4EBEA 3CDWA 4DUYF 3AD9C 4WIIA 3JSRA 1ZH5A 2UXCJ 5LOQA 3OLBA 1HYSA 2I0XA 3IR5B 1AFIA 2LVWA 5D0GA 1H73A 2HWTA 1S48A 3KLGB 3BKUA 3V6JA 3PO4A 2K7KA 5LJ5Y 1CBKA 3C6UA 2FPHX 1VI7A 3R5GA 2R4FA 2R3VA 4B9NA 4F7VA 4DS5A 3I82A 2K06A 2H3EB 4A8KA 2QG9B 1CJVA 3I0SB 4NMXA 5B0GA 3AQPA 5E3QA 1MN7A 3MCOA 2M70A 3V5RA 4MKBA 2K7JA 2HURA 2XEXA 3DOLA 5HI7A 4OZ0A 3VGVA 2W25A 5DDQC 2MQ8A 4MKYA 1L3VA 3KLEA 2UXDJ 2OI2A 4MMOA 4G1QB 1SC4B 5FJ4A 3DLKA 3T1AA 4EUVA 2DR9A 1U24A 3IM8A 4W98A 4WKRA 2DXEA 3LPYA 4MFBB 1GMWA 1S6QB 3IWNC 4KFBA 1JQGA 4CLZA 2MQOA 2JOQA 3DRRB 3FVYA 1S7IA 4A47A 2SXLA 1SCJB 1YG0A 2YKOA 2WZ1A 1RT2B 5GAEI 3NGSA 5JMNA 4FXDA 3EZ5A 2ZH4A 1RWOB 4K4SA 1RWXB 4H4MB 1HNVB 1PYOB 3GE9A 4PPZA 4GVBB 2V4RA 2GCFA 5GAHI 4DQPA 7FDRA 4ZPVR 2GJIA 5HSPA 4X65F 4ZLPA 1FDNA 3LGNA 2ZUGA 4TY8A 3B4DA 3H4BA 3R27A 4USKA 2W9CB 2XLJA 3HXMA 3TVZA 2XCPA 4DUYJ 4DUZJ 2PEBA 2DHHA 3DGPB 1Y3JA 2CWXA 1X4CA 3EGNA 3CSKA 3N6LA 5KFHA 5IWAF 4DL3A 2K3IA 3PO5A 4NCGB 2JEGA 1W2IA 4EBDA 2YKMA 4LJMA 4WFNQ 1ZAXA 5ETPA 2DRDA 1KOHA 2EC2A 4U67Q 3QRRA 4AXIA 2MZTA 1RWNB 2HGLA 2ZBIA 4MT1A 4QWAA 3JSMB 1X4DA 3MD1A 1J5OA 4YHHJ 2XTJP 2QSWA 2FZGB 3H98A 1WNEA 3M6WA 2CJAA 1H2UX 2MQLA 4W92B 1HL6A 1MNEA 4PXEA 3CCSS 2FY1A 3H5YA 4G1QA 2RB7A 9ATCB 5F3ZA 3ZZ0A 1TQLA 1U0HA 3M30B 4KQZA 4R8UA 4U8VA 1F9EB 2QYGA 4CYUB 3MR6A 4JI5J 1S6UA 4JYAF 2BJDA 5U47A 3TOQA 3QO9B 3QT7A 4N8OA 3OTOJ 2QFJA 4ZVHA 4OHVA 5CHCB 2XGPA 4GMKA 4CLFA 1S9GA 1UJ4A 1R8HA 2VJUA 3K5OA 4NZ0A 1IM6A 1I1GA 3CMQA 2BQRA 2DR8A 2Z58B 3FQLA 4WP9A 2KVIA 2M88A 4WE1B 1IKXB 3W5YA 4M5JA 4RUAA 1K1SA 4PYAA 2KM8C 1M0SA 1V6HA 4NX9A 2MZQA 3X3UA 2GAGC 2ZWPA 5F8HA 3IXQA 4A8QA 1W2BR 2O66A 3W2WA 2KM8B 1PKUA 2V4JA 3VAGA 5T41A 1N5QA 2HYIB 3MM7B 5KFYA 1HA1A 2XYGB 3GSIA 3M1VA 4BWMA 4KIAA 1RADB 1HBNB 1FE0A 1JLCA 4OQJA 4ZCKA 1O51A 4H4OA 1Q82T 4NL5A 1FF2A 1GTHA 1TKTA 5KFBA 2J6UA 5B7WA 1QTNB 2HLTA 2J9CA 3MDFA 4FXWA 4ZMMA 2LQBA 1U0SA 2LU1A 2MDAA 1JXVA 3NP5A 1G3OA 3AJ1A 5C25A 3IMQJ 2ZBRA 4J37A 3PW0A 1S6PA 4WYLA 1YGYA 1NUEA 3GR0A 3RG6A 4ETXA 1IKXA 3GLJA 2QJ3A 5KFJA 2V6AA 3DLGB 3CDUA 2PN6A 1F9FA 2QYCA 3I0RA 4ZPTR 5IM0B 1UETA 1KEKA 1U8SA 3ZNJ1 5FDLA 5KT4A 2L48A 2RQCA 2JLFA 1UTAA 4N41A 3KKFA 2CJXB 2ZDOA 2YNGA 2OKQA 3HT0A 3CJKB 4DSLA 4IDKB 2W9AA 4M8LA 3HKZD 2BM1A 2CQCA 1JJHA 4AT1B 1BQMB 5IQQA 1YRTA 2V9KA 3CC4S 4WF9Q 4B9TA 2G1DA 3M8QB 4DR3F 3ILJA 2H1YA 1PJ7A 2CIMA 5KFWA 2WSEC 1JXEA 2XNQA 2IJRA 1UL3A 5I3UB 5J2PA 2AT1B 3D5MA 4GRSA 2PMZD 2FUG9 1H72C 2MMYA 4KGMA 3CC2S 4J9RA 3PR5B 1WKLA 2W4PA 5C25B 4KO0B 5LL6d 4ECQA 3GFZA 2YKNB 2OPQA 2DKOB 4ZP7A 2EFPA 3GV5B 1NU4A 3NNCA 3PEHA 4NA2A 4Q44A 4WZQA 4MIBA 5KFIA 4QWEA 4LF5J 1V3ZA 3IG1A 4DSJA 3WQPA 3OJSA 3LP1B 3W64A 1CJTB 3LAKA 1TL1B 3IGNA 2R7VA 2KT2A 3VR1A 4F8RA 1GEHA 4NPOA 3TR5A 5GAHU 4B3SJ 1DTQA 4FDFA 5IV4A 5A2QU 2CNNB 2MYFA 2AZ3A 2BYCA 5KFRA 4B3OA 1RXOB 2N4DA 4NRTA 4RX6A 2KFZA 2MHEA 1S4EA 2ZM6J 4Q45A 5D15A 5HK4A 3HK2A 4DF4A 2GVZB 1QVGR 1QJHA 2BABA 4ES3A 3TUZC 3RB0A 4R5PB 4O0NA 3T19A 2IRXA 3KDNA 1KVKA 2YWWA 1EETB 1X0PA 2QRRA 5HQ8A 5HMWA 5GADI 3V81B 4YR3A 2P6SA 2QT7A 3NL0A 3TUPA 1JLEB 2NQPA 2KH9A 2DNQA 1SKWA 3G8QA 2ZC4A 2ATCB 2H4WB 5GMEA 4A48A 3AJ2A 2FD2A 1S5ZA 3MM8A 4ZP6A 2QMUB 5HQMA 1VQ6S 4LSLB 1F5AA 2DH7A 1OPZA 2QSFA 3DXBA 4K59A 3FJ2A 2ZH6A 1SL0A 4PAAA 1U8WA 2QX0A 4V1Ak 3L3CA 4WP8A 4BCAA 4OHYA 2BKPA 3HVWA 2WK4A 4OX7A 4CLSA 5HROB 1DTTA 4FP9A 4C97A 3DOMB 2AF6A 4K5RA 3KK3A 3E2EA 5KFXA 3RU0A 3T9ZA 2HHHJ 3OBIA 4AL7A 1FESA 4IH6A 3VZIA 1ZM3A 3NGTA 3RBDA 1CEZA 2K8GA 3IGVA 4ED5A 4TQSA 3RZAA 5AE1A 2J6TA 3LGHA 3MZIA 3OL9A 2IPOB 2CQ4A 3OD2A 1HBOA 3FFIA 3M2UB 2VDHA 2OEMA 2D3O1 4EYIB 2KT3A 4DR4J 3D67A 1NK6A 2CVEA 4QR0A 1WF1A 5KOWA 3ETMA 1T7PA 4Y2KA 1XERA 3D54A 3KLFA 3QBCA 1TL5A 3KUGA 2QLFB 1KP6A 1OIAA 2AEMA 1FKOB 2B3TB 4ED8A 3AFGA 2HQIA 1RBOB 2CQPA 1S1VB 3P45B 4PRFA 1IR0A 2MQQA 5L9NA 1GX6A 1UFWA 3PYEA 4JB8B 4N7TA 1F5CA 2VG7A 2YVSA 2C3MA 1MWYA 3PKYA 2XY5A 1PJ6A 3EWGA 3ISZA 3LOUA 2E9ZA 5B0FA 3EUNA 4DFJA 2X1BA 3BZQA 2IM1A 1RTZA 1DAXA 2ALYB 3KJQB 3LW5C 3GJSB 1QAXA 1M1HA 3PFEA 3UNGC 3W7BA 2RRAA 2B9EA 3DKDA 4FKYA 3SV4A 3K5PA 1VJQA 1VQ5S 3M2RB 3N79A 3M8WA 2BKOA 3CD5A 4X4SA 4P2SA 4O3SA 2V8GA 3TX8A 1PYSB 4CLTA 1GMUA 1Y9OA 4FYWB 2UUAJ 2LLZA 4DV0F 4P71A 2HHHF 4OYAA 1Y5IB 3GYXB 3H5UA 4USHA 4TU7A 2Q66A 5HN0A 3UO0A 1X5OA 2B8PA 4Y34A 2BE2B 4RNMA 3S01A 1LWCA 3CC7S 2EC0A 1X9SA 2DO0A 1SVDA 3IWLA 4DV3J 2KVQE 4BWJA 2BOAA 3SCIE 3OVAA 1AA1B 4ZJOA 5KFCA 1SJQA 4I2PA 2EK1A 4ZVOB 4C0HA 1SV5B 3MWBA 3RTVA 4BLGA 4X66J 5C5JA 5IT9U 4U96A 1YLXA 1MROB 1UWBA 2DIUA 1DURA 4WFBQ 3O2IA 5A6WA 4EWTA 5I3QA 2KFYA 3BJYA 4H54A 3O3LA 4P7VA 2EPIA 1TKTB 3DLJA 4ZVFA 2ZH3A 3TO8A 3UCUP 2E1CA 1RAGB 2ZOFA 2MJNA 2VOOA 2VOPA 1OYEA 3O8WA 1WOOA 3P96A 2D3OR 4ED3A 2QLXA 5DLGA 4YOEA 4ZVTB 1NEEA 2ZFHA 2HQDA 3OSNA 3MFHA 1AUSL 1F1BB 1DY3A 3KDOA 3LP0A 5DDRC 3BGUA 4KV8B 4Z2XA 2IA6A 4HTJA 1NH8A 2DRBA 3WC0A 3CJTA 1JLBB 3O6QA 4YB7A 4M1KA 5J1EA 1VC6A 5C24B 1AROP 1HQ2A 1YJRA 3CDEA 3L95X 3AQOA 4J9VA 2CJBA 5FDLB 1KLNA 2XNRA 2BJ9A 3D0IE 3FDSA 4K4TA 4IR9A 2W2MP 1R0AB 1KBRA 3SZ2A 1RT3A 4PG4A 2XO6A 2VQFJ 3GJQB 2RILA 1CSJA 3MR5A 2LQ5A 3HSDA 3B8HA 3KYLA 1RB0A 4YR2A 1FDBA 1TL3A 5L1IA 4HR2A 4NEYA 3GG1A 3PTWA 2D3UA 2CPZA 4LRAA 1DLOA 4D3HA 4RW7A 3ILLA 3JXOA 1RISA 4GO5X 4Z37A 2YQ0A 3KG4A 3ZTSA 2IC3B 4NLQA 5F8NA 2M5YA 1C0UA 1FRLA 1RHKB 2VG6A 4TY9A 5J2QB 4PXCA 4U7CA 1FK9A 3BKFA 2YH0A 4KB7A 5GADU 2R8HA 1YJWS 1K73T 1UW9A 2ADCA 1TL7A 3OR1B 4I6WA 4PWUA 3KJFB 3W65A 4ZIWA 2PMWA 2JC1A 3LQVA 4NA3A 4JI2F 5F8IA 4KRWA 3H4DA 2JX2A 3SQGA 1QSSA 3MAHA 1S7HA 2ZOGA 1J5EF 2OJ3A 2CWKA 3KLHA 1CPZA 5KT6A 1T95A 2BXJA 4K4VA 3WIUA 1UJ5A 2YWEA 3N0VA 3ZC4A 3M8PB 2GMLA 4IG0A 2WHOA 3S7RA 2DTJA 3V4IA 4N56A 3PW4A 2JEFA 2OFHX 3UWTA 3EVOA 3I96A 1WHVA 1U1QA 1IBCB 4K2JA 1YRUA 4P7TA 2CDQA 2UP1A 3QO9A 3TJAA 1KQGB 2QLBB 4OX6A 3U1LA 1GT8A 4JI8F 2CPFA 1BWVA 4KKOB 5ETNA 5LXRA 3UR0A 5DGBA 4QWCA 1X5PA 3PW2A 5F3TA 1UZDA 4M5MA 2CPDA 1JNRB 4JI5F 2WSCC 3B6BA 1LFWA 1UEVA 2DHAA 2RQMA 3T6BA 3J7A1 2V34A 2PD1A 3D3CJ 2HZCA 5IV3A 5M2PA 1VQPS 3N4WA 1IKYA 3GFYA 3O5TB 2HW3A 2KT5A 5KFQA 4CLPA 2MGZB 4K4UA 2VL1A 2J9EA 5K14B 1VHIA 2F9DA 1IR1A 1JLEA 1JKHA 2RHQB 2VG6B 4LFAF 1RT1A 1NHUA 4CRJA 4EZ9A 1I51B 2EKNA 1GMWD 4L74A 2RH3A 3WHIA 3ZZRA 1WG4A 2PGCA 3MECA 3O1LA 4LRCA 2W8KA 4LSNA 5CD4H 3CJ5A 2OD4A 3F0NA 4OZLA 1SB6A 2DD8S 3FRZA 2GVDB 5EUHA 5G4DA 2L08A 1FHTA 3IN5A 4GKJJ 5I4MA 1FI4A 4DCJB 2YH1A 2CQBA 3QJPA 4JV1A 1NK9A 2I2YA 3SDEA 2KRRA 4FPRA 3ZZOA 3JYTB 1M1KT 4WZMA 1G7CB 1CJKB 2Z2LA 5AXKA 3DOKB 5IS2A 5KG3A 1RBAA 1Z1ZA 2JWNA 4ECZA 3MPVA 3DDNA 3MR2A 3OW2R 2J0WA 3KK3B 5D0EA 3D1HA 4F04B 3GR1A 1R89A 5EHHA 3T5LA 2HHWA 2XMJA 2M8HA 1UVLA 1KTQA 3J80Y 3FSXA 2FJDB 3Q86A 1Q0NA 5D4NA 4ZPWR 4DX7A 1N32F 1ULRA 3LWMA 2JFKA 1NSKL 5DDPC 1M5PC 1KRPA 3EDRB 4ECSA 1IUJA 3BBCA 5E5NA 4IFYA 1UVJA 1MSWD 2DCUB 5M2UA 4UUXA 1URRA 3W60A 2CADA 2XMVA 1ZYQA 1X4FA 4ZOSA 1ZAWA 1EQMA 3GILA 5EX3A 2H5IB 2J9DE 2P5VA 1FE4A 4H4OB 2VPXB 4QJVA 3UI3A 2ADBA 1DQ8A 2G2OA 3ENWA 2FHMA 4QBUA 3VALA 4LREA 1J5EJ 4IOCQ 1CC8A 3BYRA 3M2RA 3HFZB 1LWXA 1ZM9A 1NJWA 3MURP 1BQNA 4H4KC 3CCES 3RAQA 1U48A 2OH2A 4CH0S 3IP0A 1UVKA 2W2QP 1EQ0A 4NE9C 2R2SA 3MPYA 1KR4A 1LWCB 2OMOA 2VD3A 2XZWA 5E3AA 5L9XA 4C3LA 4U7UK 4X4PA 2JLGA 3R2DJ 1Q4RA 3TJ8A 2WAQD 4D3GA 4UY85 1DARA 3ISND 3N9UC 1BLUA 3P5BP 4RNNA 2C3PA 3J81Y 1RTDB 1N33J 2LFVA 4ZPDA 2MKYA 4DMZA 1U7LA 2OEKA 1LWFB 3EM1A 4ES1A 4X64J 3D1OA 2E5LF 2V8HA 2M4MA 4BS2A 3UD4P 3W5ZA 3B82A 2MKKA 1X4GA 4DV4J 3JQJA 4CO0A 5DQIA 2VKRA 3BB5A 3CDBA 1HQUB 1REVA 2JC0A 3NCPA 4PEOA 3SMZA 4F4ZA 1NJIT 1N34F 1RCXB 1QSLA 4H4MA 3A3PB 1GAOA 3PX4A 3TA0A 4F26A 3JQKA 2H4YB 2HKEA 1FD8A 4USIA 2QE5A 3MCMA 5CYJA 3OV7A 3E51A 4PWDB 2IDEA 2XMKA 4Q7AA 2UVWA 1BXNA 2VHGA 2WCXA 2C22A 4OJ3A 3PVXA 4CZCA 5KFDA 4C11A 1CG2A 1CJUB 2IVMA 2X7IA 4AYBD 3DLHA 1Q7LB 4TLRA 3ILIA 2KJVA 4NEZA 4IRDA 3IR6B 3VWSA 4PQAA 5KT3A 1RP5A 2Z56B 2WBRA 1N4LA 3D9BA 1YBAA 3C14A 2AD9A 2ASJA 5IZHA 4DV7J 2LDYA 5LM7E 4DSIA 1LWFA 4E2FB 1U0HB 2I9SA 3AD7C 2Z4PA 3KK2B 3FEZA 1YZ7A 3L7PA 5A8RB 2MZJA 5F8LA 2R8JA 1FTCA 2XM3A 2XS5A 5ITHA 1RAEB 1BMQB 1P8GA 2BA9A 4NYZA 4DV0J 1K0VA 1REVB 2MKJA 5L38A 2GVZA 4HHUA 3EGWB 4EFAC 3IS9A 3M9NB 1ZTTA 2IC3A 4R5PA 2ZJQQ 1FRXA 1VRTB 2KJWA 1VLYA 4C11B 3G8TA 2E7WA 2XGQA 2LA4A 2XY6A 1E6VB 4L73A 1B64A 2FIUA 1CULA 1RQ0A 1H2TZ 2YWHA 3MM5B 2PMHA 4C8KA 3KLIA 3D6HB 5K20B 1SL1A 2VFSA 1HWUA 4CP5A 2AQ4A 1Q78A 2UUBJ 1FDDA 2ROGA 2ZH5A 1TAQA 3M6XA 2CNKB 3CCWA 3IBFB 1OY8A 3MM6A 4F0HA 3LP2B 3HHLD 1M5HA 2HFSA 3CCZA 3MEEB 4FVCA 4OLPA 2XLKA 2V8VA 5CZVA 5JVHQ 1NKBA 3Q8RB 2CDRB 4IG0B 4EEYA 3JSYA 4TLQA 3IO1A 4K8RA 4B3RJ 2YWGA 3W2VB 4LF8J 4G1PA 4MYTA 3TP2A 2XYPB 3GIJA 1DZ5A 3TW0A 1B70B 3W1YC 4DR4F 5CYMA 4UQGA 3QWPA 1BWEA 1OS5A 1LK7A 5BR8F 4DSKA 3KXDA 5A8KA 2WVBA 1WDTA 4RKUC 1XNRF 4CO4A 5H9EK 2F8HA 3BN7A 4DX5A 2BW2A 3EXYA 5AXMA 3VVUA 4AQYF 3PX6A 1T11A 3KMQA 3SCKE 4P10A 1FJCA 1ROFA 2OPRB 1EHWA 1HNIA 4O44A 4IDKA 4P74A 5KFUA 2P6TA 5CCLA 2KZZA 1OSDA 3UQSA 2VBZA 2RU9A 2LKZA 3LH2S 3QWUA 5F41A 1KQFB 4OYIA 2KXFA 5KTQA 4LF9F 3CWJA 1X4BA 2D1CA 1IBLF 4XPCA 1QTMA 3NGDA 2NR0A 2HHTA 3W62A 1WJ9A 1RT6B 2FGCA 2IY5B 4OHXA 4DCPB 3CUNA 2BKNA 2HMIB 5IT9Y 3M8QA 1JIHA 4JI0J 2B4VA 2UVUA 4OI0A 5KFZA 1S79A 2PO4A 1VRUA 2YBVA 4IG3A 5K14A 4RNHA 1VBXA 4DXLA 4KE5A 3W9JA 5J2NA 4B3MF 2NREA 1K47A 2HQGA 3IRXB 3UN3A 1T3OA 3DLLQ 2RHSB 4IO1A 1NZ8A 2XYHB 4KGZB 5CD4A 1GFWB 4Y2IA 5I3PA 3E01B 4F4KA 3V2UC 5C2GA 1A0OB 3SQOP 4LFCF 3GSDA 1L3SA 4ILMA 2HG4A 5F0WA 2VFVA 3MAQA 5D8HB 1SC3B 4NWBA 3CCQS 1WEYA 2MKSA 2OPPB 5T14A 2G2ZA 1NKEA 1NCLA 3CTRA 3DOKA 3HZGA 4I2PB 4C8LA 4Y2MA 1JX4A 1RAOA 2DGUA 1HD1A 3A8KA 2QMWA 4WK3A 8AT1B 2YTCA 3GG0A 4M5NA 1NJXA 4IFYB 2IAJA 4OX9F 1PC5A 2ZWOA 1Z2ZA 4Q5VA 4RUHA 4B9SA 2NPIA 1T02A 1RT6A 1HNXJ 4NYOA 2KU7A 3KUEA 1RTHA 4P6QA 3U1NA 1HD0A 4CI0B 3T6JA 1Q16B 1WTBA 4JUZA 2JEIA 2HAIA 2N4CA 2HNDA 1TELA 4ED2A 2HLUA 2WBMA 1F5BA 4QR1A 4ZHRB 5IQ6A 1U2FA 3KJVB 5HROA 4S0MA 3FSYA 5A8WB 4I56A 2B0GA 3EE3A 1TKXB 2QZ8A 3IRXA 1HBUA 2RRNA 3A3NB 2ZVSA 4O4RA 2K2PA 1O6XA 1Y0HA 1SQFA 3SV3A 3CD0A 1VFJA 4HEA9 1S9GB 3JSMA 4Q8FA 3BGOP 2VQFF 3FZBA 1MMLA 3QT8A 4GO7X 4U95A 3G6ES 2JNJA 2FY8A 2L9DA 3TEGA 5A0YB 5EWEA 1U02A 3M4XA 1FKAF 2FJWA 1RK8A 2EEYA 2JL9A 3EJMA 3AHPA 4CLWA 1IWAA 3OTOF 1IWGA 5E3CA 1CJVB 1FT8A 1NRKA 2ILZA 2L9WA 2ZNYA 4RW6B 1N5YA 4ETZA 2WONB 1SH2A 2IDLA 2Y3YA 3KUHA 3M2UA 1WC5A 4LF1A 4ZPBA 2OAUA 3C16A 1VJWA 2Q6CA 4B02A 4ZDNA 3A8EA 3THTA 1H7WA 1OMSA 2HNDB 1ZA2B 1RT4B 3D2WA 4PWDA 2ZBQA 5GMKa 5B09A 4NOHA 2W2NP 4YMEA 3UDCA 1YITS 1Y00A 2EKYA 2OSQA 2YY3A 2GHVC 1Q1KA 2ZDPA 2KXHA 3OTDA 5THWA 2AIRB 3BO4A 2V9WA 1XNRJ 2FZKB 3LPEA 1RWWB 4PQUA 2DNZA 2C2KB 1HQUA 2NPFA 3OXGA 2VF3A 1F6TA 1LQ9A 2U1AA 2Z30B 3M8PA 3P3DA 4ZVEA 1QE1B 3L7OA 3CT9A 4MIAA 2OHDA 2G0IA 2QIFA 3IR7B 2UV8G 4DN9A 4YY3J 1C1CA 1UFKA 2MSSA 2YKQA 5DQHA 2FZCB 4BC9A 3Q23A 4DV2J 4DLEA 2DY1A 5HBMA 4C48A 3MPWA 2DHXA 2UVVA 4YUDA 1HHQA 3HF5A 4LVNP 5A0YA 3I5AA 4HYKA 4HHJA 1VMBA 3FCVA 1PSDA 3FBFA 3ZTPA 1XWLA 2GO9A 2UU9J 2UUBF 2XZTB 4WWSA 4KT0C 4USUA 2EFVA 3B4MA 3CCRS 1BQMA 4U9RA 4DQQA 1R6VA 3PEJA 2IFXA 1VISA 1FEEA 3FQKA 7AT1B 5FLXU 3QJLA 2OUGA 2R7UA 2HHPA 2PE8A 1Q8IA 4ENOA 1YRXA 3RUBL 2DCLA 1AFJA 1Q8BA 2ZE2A 4LR7A 1PJ5A 2AJ2A 4A8OA 4DJBA 4M5LA 1SC6A 3ZZPA 1VQ9S 1CVJA 4O3PA 1RT3B 5GMDA 1KWMA 4IKAA 1VQMS 2QLWA 3AJDA 1SQGA 4QOTA 2C3UA 2C2ZB 3I0SA 2UXDF 3SI8A 1MW7A 3ZZUA 2Z8QA 1QUPA 3RAMA 2BX6A 1SQEA 3LP1A 4FVMA 4C6AA 5HL7Q 1UA0A 4B08A 1UA1A 3QIPB 1QDUB 5KG0A 2ERRA 3I56S 1TKDA 3GIIA 2F40A 3JSBA 4USJC 3QGIA 1PAUB 2HFUA 2HHVA 2P9GA 4ED7A 4OI3A 3PRDA 1C0TA 3TVYA 3MUTP 2HHUA 3WZ0A 4A4JA 3PG9A 3J81j 1S10A 1KFSA 3DRSA 4DX8H 5D3GA 2E5JA 1FWKA 3I9ZA 4HL9A 2LEPA 1HMVA 3HD2A 4EO8A 2RS2A 1N48A 1E6YB 2W4CA 1D9DA 4CLKA 1NPKA 3DLEA 4CO5A 2NXEA 4DHVA 3PRBA 4RW9B 1XMQJ 1U45A 4LF6J 3PNIA 3HX9A 3RB4A 1TV6B 2D74B 2R7QA 3BGRA 1LXNA 1WD6A 1FDAA 2WB1D 4MTPA 3TYTA 4QWDA 3DRXA 3K58A 3QYYA 2MQNA 3W2WB 4DL4A 1FX4A 2A0FB 4GC6A 5H9FK 3MEKA 5HVHA 4CM0A 1N5TA 2GNKA 1CS4A 4Q0BA 3MHYA 2E1MC 2OO4A 1WOPA 4WKYA 2DNKA 2RKIA 4NCBA 1R8BA 3N5BA 2ZC3A 1V5IB 2AKWB 2RDDA 3QIPA 2BE9B 3DDIA 3ZNUA 4AE5A 1SJFA 4IOBA 1U1PA 3CEDA 3BSAA 4F50A 2J0QD 1S12A 3C6TB 2FVQA 3GPAA 4ED4A 4F36A 3C15B 4YY3F 1KONA 1T8EA 4FZVA 1R27B 1RU1A 5E3PA 3DMJA 1KS2A 3LALA 2UXBF 2R7WA 1FJGF 5K9FA 3K5LA 1WKKA 1R8CA 2VFRA 2EFGA 1V9OA 2GX8A 4ELVA 4M5DB 4IH5A 1NDLA 1UAWA 3RBEA 2CZVC 3BDEA 1H0HB 1BUXA 3GIKA 1IKYB 4LF5F 2OPSA 3GWCA 3M2VA 3K7RA 1YTYA 2NSCA 2AV5A 2HPUA 2RJZA 1KOOA 1NDCA 2J8SA 3I32A 4CIOA 1HWKA 1HR0J 4R0JA 5KFVA 4DS4A 2CG8A 4ZA1A 2Z2YB 1NDKA 5IT0A 5D0HA 1S97A 4Y3CA 1K1QA 3QFHA 2FHJA 4O3NA 5LT5A 1EAYC 1OO0B 5ETVA 1WELA 2HFNA 3H8YA 2B4OA 2E5IA 1HBOB 3FFIB 1CS4B 2IMWP 3POTB 4OJGA 5IFMA 3C46A 2JVOA 4JV5F 4DN0A 2B9WA 1VCTA 1FRKA 4HVZA 2J9DA 5C42B 3DRRA 1NK0A 2FJVA 4CLYA 3HJFA 1ITPA 4PCQA 1Q79A 2CJQA 3M9OB 1X60A 3M2VB 1S49A 2D9PA 4YS2A 4C2MA 1HPZA 1RT5B 1SH3A 2OSRA 2FQQB 3GONA 5JXSA 4LFBJ 4J9KA 3OFGA 1IQZA 2DR7A 3OTEA 3MMJA 1RJJA 1HBUB 4JI4J 1XR5A 4N8NA 4FPIA 1T94A 2Q3PA 3NG8A 3CDAA 1P1LA 2Z2ZA 4NLOA 3NS6A 3IAS9 4CWBA 4RBTA 1RABB 4DPWA 1UKUA 1Z2LA 1PCAA 2XSJA 1RHRB 3R5AA 4I0WA 4UTGA 3KK2A 1YI2S 4QYZK 2AX0A 2E1PA 1WDDA 2BBEA 1VBKA 3PHEA 4URQU 5IM0A 2ZH2A 3VQTA 1YVFA 3OVSA 2P9CA 2R7XA 3PW7A 1XMOJ 1I6JA 1REGX 5HATA 3G6XA 2DHSA 4NLVA 3VAFA 2AZ1A 4USTA 4G65A 3KG1A 5DJBA 2VPZB 1NM2A 2WTFA 3AA9A 3R97A 1D9AA 1NB7A 3NAIA 5D4PA 1U26A 1WHWA 1UWAA 2HZVA 1U09A 1OYDA 1HNVA 2IMOA 2X1GA 2Z57B 3DRPB 2QA1A 5C42A 2KHCA 1HHSA 2HQFA 1RT4A 3D66A 1N88A 3SIPB 4GKKF 2PSZA 4NLUA 1MG7A 3IC1A 3POTA 3J81U 1TUVA 3LO3A 4TN2A 4CTAA 3OJUA 3PIPQ 2XO7A 3E3XA 2AX1A 1SL2A 2ZHAA 2G0JA 4TU8A 3HSGA 2LYVA 5D78A 2VA3A 4C8OA 3PR4A 2OGUA 2RT3A 2VU5A 3Q8YA 2KG0A 3G9CA 3PCOB 2YKNA 3CCMS 4IUFA 4JYAJ 2GA7A 3BS9A 3OXLA 4WK1A 1QE1A 4ZPCA 1VK3A 1WC6A 3U27A 1TL3B 1VDHA 3AXMA 2YKAA 2PDAA 4O0IA 1RTDA 2ASYA 4P2FA 2V5HG 4PQUB 4OYMA 4OV1A 1VR6A 2HVDA 2C3YA 1UVIA 2E9RX 4NLDA 4RNOA 2ZE2B 5KFKA 4R8UB 2GS8A 4QIGA 3VTIA 3F56A 1N6QB 2VFUA 3HVTB 5J2QA 1JLBA 2MKCA 3MTKA 5KG4A 1V3SA 4FNIA 3BO3A 2FGOA 5F9NA 3M8RA 1PO6A 3ZTQA 1P27B 4RW7B 5LMUJ 1QVFR 2XS7A 1FFGB 3GTYX 4PXDA 4JI1J 5AT1B 3UPFA 4YQWA 3M6UA 2FVCA 2GGPB 3HVRA 4QIWD 1KLMA 2J7WA 3HM9A 3RRGA 4ANDA 4LRFA 1RUSA 3DLGA 3M1VB 4LBPA 3ZTOA 4ZHRA 2MKHA 4N5SA 2VQEF 2D41A 2V4JB 3K8WA 2RDJA 3CCLS 3F44A 2AYMA 1NO8A 1DQ9A 1XBWA 2RQ4A 4DPXA 2MY7A 4ECYA 1UZHA 2JJ4D 2RSQA 3HHEA 4PPDA 1TFYA 4I67A 5KAKA 4DUTA 2GO8A 4OZ2A 1AXQA 3TQEA 5RUBA 1HW8A 4MK7A 2LMIA 3DM2A 4MIWA 1XMBA 2V2VA 3IM9A 1NSQA 1S0MA 2FYXA 1TR0A 2MTLA 1B99A 5DO2A 2B5JB 3NBPB 4JI7F 3UDVA 1YJTA 1D09B 2HQCA 2APOA 2C2DA 3RAXA 2JFDA 4AXJA 1E6VA 1S0VA 2EFOA 1N8RT 3NEKA 4B9VA 3HFKA 4QQBA 1Q5YA 3VAJA 3UNYA 4NYPA 3KHHA 5KG5A 3IS9B 3FRYA 2OMLA 1PBAA 2FVRA 2GVDA 4F4WA 2HBYB 4DZ6A 4X66F 4DV7F 1R0AA 2BZ2A 4LSNB 1VGYA 3EDQB 1VQYA 3HCXA 1B4SA 1DBDA 2F1FA 2MPUA 1OY6A 2UV8A 2AW0A 2NSBA 3HSZA 2E5HA 1JB0C 1GK8A 5DZ6A 4ZJLA 4DCOB 5KFPA 1VRTA 1LV5A 1JKHB 3DNCA 1JNZB 2DYAA 2XI3A 3KHLA 1S1WB 1VQOS 3ITHA 4EK2A 4KHPF 2HS3A 2Y1LB 5G0RB 5LSRA 3G71S 3CULA 1JWWA 2ZJRQ 1S6QA 3RRKA 3WC2A 2DJWA 3SSQA 4A8WA 5BJRA 2CVIA 3D7SB 2ACMA 3T9NA 2AWZA 2W7OA 3TAMB 1YBTA 4ZJQA 2B8QA 1DLOB 2BEFA 2CKWA 1YJ9S 5BR8J 3AY0A 3CIMA 3L4BC 4NXMF 1FFSB 3CGIA 2IM3A 3BPSP 2NS1B 3QLHB 1YJNS 3P4UB 4ER8A 5KFFA 4JV5J 3W61A 3JTNA 3M32A 4LBHA 3MCNA 3P8BB 4LF8F 2LEAA 2CQHA 4X2BA 2AP6A 4I6YA 5EGYA 5GVQA 4ZCIA 3J7Z5 2G9OA 1OQ3A 1UW4A 4WJBA 4DV5J 4ECVA 3T1HJ 4UF4A 1TL1A 1D8YA 4I6AA 4PR6A 5FD1A 5ETOA 1D1UA 2VC1A 2VA2A 4G1IA 5KFOA 1OSCA 4B3OB 1J27A 2AGQA 3GB0A 1RAJA 5F0UA 4ZVGA 2I5JB 2KXNB 3H25A 1Q86T 5MAOA 4JI3F 1KFDA 2K1RB 2V2KA 1RHQB 3PYFA 5HANA 3OLAA 4AD6A 2FLOA 3CF5Q 3NOGA 2R8GA 2GIRA 2V4QA 5M2RA 1BE4A 1FX2A 2KB2A 1W7WA 2E1RA 1YSJA 2Y1JA 1X7VA 3E01A 4YN3B 3VGSA 3R3TA 4JI4F 5J2NB 2FJBB 5DETA 1DJ0A 3ITHB 4Y2AA 4YP3A 3MM8B 1WKJA 3QQCD 2R2RA 3WX4A 1Y11A 3CMAS 1U1LA 3C3LA 2YKMB 1OWXA 2DY9A 2POKA 4TKTA 4WTYA 5CXTA 1VQNS 2RF2A 3EZUA 5E33A 1H3DA 4DG1B 5L1KA 2FHJD 2R2UA 3VAIA 3D3BJ 1BQXA 3ET6A 4AUKA 4ES2A 2B6AB 1GH8A 4ZVQB 2LA6A 1N0VC 1S57A 2CQGA 2NYHA 1I3OB 1VBYA 3H2UB 2EFNA 1UVMA 3OUYB 2XSJB 4DR2F 1X0FA 1U6FA 4LT6A 3FUYA 1P1TA 4FXVA 1HNWF 3H42A 5A6PA 4DDFA 2ZHOA 1LW2B 2F65A 1F3VA 2CJYB 2JH3A 3M30A 4OMFG 1AYEA 2R8IA 2V8PA 4K4ZA 1Y10A 3FBBA 1RZMA 3KJVA 1NAQA 1TVRB 2XQCA 1C4CA 3PX0A 4F4YA 4DFPA 2LDIA 4JI7J 4FKXA 1UEKA 3R6GB 4RW4A 4CTAB 2MLYA 1ZZFA 3MGJA 4DLGA 4NCAA 1MU2A 2MZSA 3R1HA 2GC8A 2RNEA 4MAKA 2GJ2A 1ZTWA 3FKBA 2ZH8A 2BE7D 3DLKB 2B9XA 3ONQA 4LF4J 1FRMA 5DDOC 3H59A 4WFXA 3US5A 4EYHB 4ID5B 3GU0A 2HNZA 3C14B 3Q83A 4DL7A 2HGNA 2E5LJ 4I2QB 2VPWB 2RIJA 4XO0A 3ZZYA 3KLVA 2N3LA 2NZ4A 2M3DA 4OYZA 2XMMA 2PI4A 2BE2A 4F4AA 2C28A 3EMTA 3Q8UA 3H2LA 4M5HA 1NK4A 2KYXA 3HD1A 4LR9A 2XCAA 2CRLA 3IBWA 2E66A 4HDGA 2I38A 4FYYB 4KH1B 3MEGB 5D4LA 3K5MA 2R42A 1S6PB 2CPEA 4RUBA 3R8YA 4NI2B 1TK8A 1D9FA 2VZ9A 3S1TA 3BBBA 4MKVA 4MKAA 4XK8C 5EX0A 4WP3A 2LEBA 3AH6A 4ANCA 2BM0A 1UP1A 1GNKA 5ETSA 3DN9A 1O5JA 2QGFB 2DB1A 4KGXB 4L75A 1QUVA 3PYGA 3TNVA 2HVZA 4U7UD 3RGIA 4LQ9A 2RDIA 4HT5A 2CJ9A 2QC3A 2GHPA 2HBRB 2ZZTA 4FYVB 2PFDA 4DR1J 3L09A 4X84A 5HP1A 2V2ZA 1AB8A 1IR2A 4QU7A 4ZS6A 1TP7A 1EB0A 2GZOA 2IM2A 4UOHA 3TJ9A 4V19J 2VB6A 4A46A 4UT4A 1F3FA 4BHQA 3FEYB 3QGGA 4LRDA 3SSRA 1AZSA 4K4XA 4DSFA 4NA1A 5H9EJ 3DHWC 2CPHA 2DEJA 4LF7J 1HI1A 2ZBPA 2RUGA 2F9JA 1U1NA 4DR7F 4I69A 1WACA 3MEDB 1SH0A 3PACA 4DV1J 4E8UA 1JXLA 1MMNA 4ZVPB 1VQ8S 3IA0A 2XC9A 1XQIA 3GYGA 2WW8A 3NBPA 4O3RA 2HS0A 2CNLB 4UOCA 5KFLA 3PDNA 4DL2A 1UMJA 3UN5A 1G4CA 5KFNA 2HHXA 1KN6A 2KG1A 3LWLA 2HVHA 2DNOA 1RHUB 2Y0BB 3WDOA 3AT1B 1IBKJ 3QRQA 4KPYA 5CA5A 3VAHA 2QTWA 2YPZA 3GFXA 1Q81T 2OEJA 3MEEA 1AUDA 4EGLA 4QW9A 2P9EA 5L46A 3X1LB 1BC6A 1TMMA 2YQ1A 2JEJA 4YEAA 3K57A 2MQMA 2VG5A 2PA8D 5B0CA 4RU2A 3HSJA 3IAM9 1XN9A 2L41A 4B3TJ 3QGPA 5I42A 2VODA 4C0OC 2W1BA 3HHLB 1QM9A 3HKWA 2DRAA 4ZCLA 1IVZA 4PG5A 5D6GA 3MD3A 1KVJA 1ELOA 2A10A 3HHLC 3PJ9A 4QPXA 5LSOA 1IJEB 2X3GA 4DOZA 1SJ1A 4C3MA 1K9MT 1FNXH 3ZO7A 2CJKA 3OT9A 3QT5A 5SZTA 1X4AA 4LQ3A 3Q8PB 1S1WA 1HI8A 1YZ6A 2B7BB 5A2QY 3EXCX 3PRVA 3LF0A 4IO9Q 3HHDA 2MB0B 4DR6J 4CO3A 1EP4B 3U02A 2R9LA 3CJKA 1KQKA 4L3NA 4NLSA 1MN9A 5F8GA 2HVIA 3BR9A 2AYEA 3R5DA 3VCDA 2CPIA 4Q2MA 4L76A 5AXNA 4ELTA 4OZ1A 1X8DA 4JI8J 2CUYA 3P49B 2PC6A 3BO2A 2KRBA 3C8YA 3R6LB 4RW9A 4NLXA 2DIVA 4ECUA 1E6YA 2B56A 3TVKA 1KHWA 3QIDA 1OJ4A 2K3KA 4OIXA 5D3GB 1A7GE 4P72A 1XJWB 4EZ6A 2F8EX 3GCWP 2HAFA 3M8YA 3G86A 1B3TA 5T7LB 3CW2C 1GQEA 2LU2A 2WW4A 3AOBA 3OQ2A 5H9FJ 3I5BA 4C3KA 5B0BA 2BJEA 1CQNA 2DGVA 2LCWA 3BH6B 1YHQS 1KVIA 1UEUA 2CPXA 1VQ4S 3SFGA 3NS5A 1T9VA 4OI4A 3EZOA 4KYZA 2OTJS 1AW0A 4ZPAA 3QT6A 1HQEB 1TTHB 2NUUG 2ILYA 4LMZA 3ILOA 3G6YA 2O5DA 1RYSA 4PABA 4M5DA 2K1RA 4JI3J 1CQMA 1YJUA 2EFQA 3F73A 4LFBF 1VQKS 4ERDA 1RT7A 4RW8A 3KWMA 1RE1B 4KJIA 2CXEA 2BMBA 4C98A 1H98A 5K8NA 2UU9F 3N6NA 3MMAA 1SJ4P 3DMJB 3K8VA 2VC0A 1JK9B 5EWGA 5ETRA 3BSNA 3CMES 4ECRA 1I94F 1B7FA 3RW7A 1T0TV 3OFFA 4F0MA 1T9YA 3BGLA 5IC6B 4ZVRB 1TU0B 3DU6A 3MM9A 5LMNJ 4IH7A 1VBZA 4F3MA 2GAHC 5C2CA 3GCXP 4DV2F 4NZ6A 1FNOA 4OFZA 1QAJA 3FEXB 1W26A 2MHNA 4Y28C 2VBXA 2XWYA 3PYDA 2HBQB 2GQCA 4ZK7M 1WHYA 1RWPB 2CYYA 2YKPA 3DC2A 5KFMA 2ZM6F 2VIHA 1MWZA 2GJFA 4HI1A 4X4VA 2YNIB 4QYRA 4LRBA 4OZJA 4XAKA 4OHZA 1HNIB 4O44B 4AL6A 1GXLA 5AJ3F 1HWIA 2BR0A 1U47A 4HKQA 3IFEA 2HRUA 2CQ3A 1WSVA 1WWHA 1JLAA 3BF4A 4YB1P 1HR0F 4FBUA 4FF2A 4JI6J 4QCLA 4LF6F 2MZ1A 1RTIB 2HNYB 4CH1A 2J6SA 2M7SA 5KFEA 1C1BB 2VQEJ 2RS8A 4DQRA 3Q24A 2E5GA 2U2FA 4CLLA 1FKPA 4HTIA 2ABYA 1T03A 3H5XA 3I6PA 4NCGA 2CNOB 1VIXA 1JLQB 1NNDA 2DNMA 4NXNF 5J2MA 4OV6A 4A8YA 1UFLA 2ZD1B 1RWVB 2WRMA 4UOGA 1IBMF 3VGUA 1WC0A 2HFZA 1YJVA 1X5TA 3FGVA 1H7XA 3LANA 2YNHA 2DR6A 5FIIA 4LSLA 3D0GE 2JVRA 5J1EB 4KGVB 3D0HE 3SCJE 3S6EA 3H90A 4ALZA 3DI6A 3QNWB 1VQ7S 2DNYA 2NUHA 3MMBA 3THVA 2NXUA 3K17A 3MR7A 1R7IA 2ZITA 2AU0A 1HNZF 4DWIA 1RTJA 1TKZA 5DQGA 4KTQA 3CNQP 3RRHA 2WOMB 2R7TA 5HQLA 3TZXA 2KHDA 3BN4A 3OR1A 2IIHA 1N5SA 1SC1B 2OFGX 5IOLA 4UUWA 5D4OA 4JP8A 5LXYA 3BREA 1NH7A 4B9UA 1NPPA 1U6ZA 4I4BA 3P5TL 1S1XA 4BBYA 1FXRA 1FK9B 4WU2A 4F3QA 5DS7A 3CO9A 3A3OB 4RL1A 3SEOA 3DOLB 1S1TB 3KFWX 4M5IA 5A8WA 1TUWA 2C42A 5HP1B 3G2XA 4F2SA 3GFHA 2EG2A 3KOAA 3I4HX 4DV5F 2H5JB 3T1HF 1R3NA 4O4GA 4EI2A 2VONA 1D3WA 1P6TA 4YR0A 4N76A 2HNYA 3CJ0A 2DGSA 4GKKJ 3Q2SC 5ETQA 5JVGQ 1HWLA 4HDHA 3R1LA 1U1RA 1PG5B 2HZAA 4C8MA 3T1YF 1ZETA 2HIYA 2VPYB 4H4KA 1X4EA 3J80U 3BQ1A 4FYDA 1PC4A 4ED1A 2EK6A 2QL9B 4NMLA 5J2MB 1G6BA 1LNQA 2WVFA 3MMBB 5HMYA 3CCUS 2G1HA 1WORA 1RT2A 2OP5A 2BANB 3VGTA 4NLWA 1TV6A 3BGRB 1ZPWX 3H0PA 4CDIA 2DITA 3MEDA 1TK0A 4LUBA 1JLFA 4E98A 1KNZA 1UVNA 5CYQA 3DRYA 3N28A 3PFOA 2V2QA 3S8SA 2HRYA 1SUQB 3A13A 4MK8A 4QZVB 2RKIB 3SXLA 4JI0F 1N5YB 2OLWA 4OYXA 4ZP8A 1MROA 1UWBB 2OPPA 3V6DB 3VAKA 1C0TB 3DLBA 2IBKA 4IRCA 1URNA 3PW5A 5LJ3Y 1RDRA 3GP9A 1JJCB 2EW9A 2HFVA 1X4HA 4OI1A 3R7SB 3TWZA 3NCRA 3HPOA 1MU2B 4KH0B 1FJ7A 4DL5A 4Y00A 1WG1A 4OZ5A 4TU9A 3FC9A 1RYRA 1X9MA 3DXSX 3UCZP 3BDPA 5J2PB 1Y3KA 2V63A 2XI2A 2DGOA 2F5GA 2LP4A 3PM9A 2JDJA 2RMLA 3CXCR 3TZYA 1RWUA 3OVBA 2X1FA 2XWXA 1A6LA 3A4TA 2QV6A 1IKWA 5E41A 1IKVA 3HI9A 3QFWA 3PXGa 3RBXA 3BQ2A 4DPTA 4HT7A 2P2CB 3TQ1A 2HVEA 2C2NA 3K89A 2Q1LA 2QA4S 3EVWA 3P6YC 3TA1A 2R7RA 1DTQB 3HZEA 1R6YA 2A2CA 4K2XA 3TUJC 1GMVA 3W8GA 1PAEX 2W2PP 3NWGA 2QFIA 4YDDB 1XC9A 3W8PA 1WI8A 4DUZF 1YBUA 5CQGA 2MZRA 4G3IA 3HMJG 1VIOA 2F8MA 3HHKA 3O44A 4DR7J 3MAAA 1M5VC 2DH9A 3TEHB 4OX9J 4ICLB 2BJ8A 1T05B 1TFWA 2OIHA 5F8JA 3CD6S 3D6FB 4J90A 2J5AA 1EP4A 2HS4A 3R7BB 2OPRA 3J7ZT 1QY7A 2YX1A 3JAMY 2AHOB 3MF5A 1NJYA 1RAAB 2DNHA 5BXIA 2FB0A 3WIVA 1XNQF 4ZLNA 3QSYB 2NYIA 3IRWP 1N36F
chains in the Genus database with same CATH topology
4UOGA 4S0MA 2DXFA 2HURA 3VGUA 3DKDA 4FKYA 3EE3A 3L7UA 1HIYA 3VGVA 4KPCA 3B54A 3R9LA 3DDIA 1BE4A 1W7WA 1UCNA 2HVDA 3VGSA 3GPAA 4W98A 2DXEA 4F36A 1WKJA 2B8PA 1KDNA 2DY9A 1NDPA 3Q8VA 3ZTQA 5IOLA 3PJ9A 3EJMA 1WKKA 1S57A 1WKLA 4CP5A 3NGSA 3EVMA 1NDLA 1LEOA 3PRVA 1BUXA 4ANDA 3Q86A 3ZTOA 3G2XA 4WBFA 1MN9A 1NSKL 1NDCA 1NHKL 3BBFA 3BBCA 3FBBA 3WX8A 1NDKA 4DUTA 3FBEA 4FKXA 1XIQA 2AZ3A 1NSQA 1BHNA 1F6TA 1B99A 3FKBA 5C7PA 3ENAA 3VVUA 4O0NA 3VGTA 3FCWA 1EHWA 3Q89A 3BH6B 1LWXA 3Q83A 4HR2A 1HHQA 2ZUAA 4ANEA 3ZTSA 3FCVA 3FBFA 3ZTPA 4F4AA 1K44A 3EMTA 4DZ6A 3Q8UA 3NGRA 1HLWA 1S5ZA 3GP9A 1B4SA 3ZTRA 3BH7B 1U8WA 4ENOA 3EM1A 3FC9A 2DYAA 1ZS6A 3BBBA 4EK2A 3MPDA 4ANCA 1S59A 2CWKA 3NGTA 1PKUA 1NSPA 3ELHA 2AZ1A 3NGUA 2B8QA 2BEFA 2BX6A 2HVEA 3VVTA 4C6AA 3EVWA 1NB2A 3EVOA 3FBCA 1NLKL 3ETMA 2NCKL 1PAEX 1NCLA 4UOHA 1JXVA 1F3FA 5CAAA 3B6BA 1NUEA 1VYAA 1NPKA 4UOFA 5CABA 3EICA 3JS9A 4DI6A 1XQIA 5BXIA 2VU5A 3Q8YA 1MN7A 2DXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UOG A;  4S0M A;  2DXF A;  2HUR A;  3VGU A;  3DKD A;  4FKY A;  3EE3 A;  3L7U A;  1HIY A;  3VGV A;  4KPC A;  3B54 A;  3R9L A;  3DDI A;  1BE4 A;  1W7W A;  1UCN A;  2HVD A;  3VGS A;  3GPA A;  4W98 A;  2DXE A;  4F36 A;  1WKJ A;  2B8P A;  1KDN A;  2DY9 A;  1NDP A;  3Q8V A;  3ZTQ A;  5IOL A;  3PJ9 A;  3EJM A;  1WKK A;  1S57 A;  1WKL A;  4CP5 A;  3NGS A;  3EVM A;  1NDL A;  1LEO A;  3PRV A;  1BUX A;  4AND A;  3Q86 A;  3ZTO A;  3G2X A;  4WBF A;  1MN9 A;  1NSK L;  1NDC A;  1NHK L;  3BBF A;  3BBC A;  3FBB A;  3WX8 A;  1NDK A;  4DUT A;  3FBE A;  4FKX A;  1XIQ A;  2AZ3 A;  1NSQ A;  1BHN A;  1F6T A;  1B99 A;  3FKB A;  5C7P A;  3ENA A;  3VVU A;  4O0N A;  3VGT A;  3FCW A;  1EHW A;  3Q89 A;  3BH6 B;  1LWX A;  3Q83 A;  4HR2 A;  1HHQ A;  2ZUA A;  4ANE A;  3ZTS A;  3FCV A;  3FBF A;  3ZTP A;  4F4A A;  1K44 A;  3EMT A;  4DZ6 A;  3Q8U A;  3NGR A;  1HLW A;  1S5Z A;  3GP9 A;  1B4S A;  3ZTR A;  3BH7 B;  1U8W A;  4ENO A;  3EM1 A;  3FC9 A;  2DYA A;  1ZS6 A;  3BBB A;  4EK2 A;  3MPD A;  4ANC A;  1S59 A;  2CWK A;  3NGT A;  1PKU A;  1NSP A;  3ELH A;  2AZ1 A;  3NGU A;  2B8Q A;  2BEF A;  2BX6 A;  2HVE A;  3VVT A;  4C6A A;  3EVW A;  1NB2 A;  3EVO A;  3FBC A;  1NLK L;  3ETM A;  2NCK L;  1PAE X;  1NCL A;  4UOH A;  1JXV A;  1F3F A;  5CAA A;  3B6B A;  1NUE A;  1VYA A;  1NPK A;  4UOF A;  5CAB A;  3EIC A;  3JS9 A;  4DI6 A;  1XQI A;  5BXI A;  2VU5 A;  3Q8Y A;  1MN7 A;  2DXD A; 
#chains in the Genus database with same CATH topology
 4AL5 A;  2P8I A;  2ZKU A;  4L72 B;  4URG A;  2DO4 A;  3L7U A;  4ELU A;  4LBI A;  2PI5 A;  3G82 A;  2AMC B;  4Y65 A;  1HNZ J;  4USW A;  1SIZ A;  1UCN A;  3M32 B;  1Y5N B;  1N56 A;  3I5C A;  2W4D A;  5FLX Y;  4OHW A;  1RBL A;  1O8B A;  1SPB P;  4KSE B;  4O3O A;  3NAH A;  4J9L A;  3NMR A;  5KFS A;  3MXH P;  3VQS A;  3QPI A;  1KDN A;  2OD6 A;  1RHJ B;  3GIR A;  3TAN A;  2FVP A;  4NLG A;  3MMC A;  4EO6 A;  2UVR A;  1FER A;  4C0B A;  2ZZN A;  2HMI A;  1N36 J;  4A8X A;  2D7S A;  3HVA A;  4ILL A;  4MYU A;  3PIO Q;  1J5O B;  4ITS A;  2LXF A;  3W66 A;  4XDD A;  3KG0 A;  1RGV A;  4NLR A;  1LW0 A;  3N6M A;  5KFT A;  4CYU A;  1VC5 A;  2AJF E;  1HNX F;  5AE2 A;  2DIS A;  3MFI A;  1FXD A;  1H6K X;  3FMW A;  4CO2 A;  1RT1 B;  3QLH A;  4BDP A;  3HT3 A;  1IJF B;  1S9E A;  2DNP A;  3MMA B;  4K4W A;  4OJ1 A;  1APS A;  4PG6 A;  1NHV A;  1YQH A;  2BVZ A;  4I68 A;  2ZVI A;  2A1B A;  7FD1 A;  1JLA B;  5DM6 Q;  3EPG A;  1Q53 A;  5SUH A;  1WEZ A;  1UJ6 A;  3AB2 B;  3C6U B;  4J9U E;  1YX2 A;  3VV2 B;  3ZFV A;  4LF4 F;  5HMZ A;  3OFH A;  5L39 A;  5HLF A;  3G96 A;  3I4P A;  5EDW A;  1PIE A;  1OY9 A;  4X62 J;  4IRK A;  4UZC A;  1R31 A;  4LFC J;  3QZ8 A;  3T5K A;  1S0O A;  2FHO B;  3JQM A;  1XMO F;  3ENV A;  3D6T B;  3TAQ A;  4RWX A;  2Y9H A;  3BGF A;  3FCW A;  2Z0G A;  4Y6I A;  3NKY A;  1LW0 B;  4RBV A;  2ZH1 A;  2UUA F;  2HIQ A;  1X9W A;  3ENQ A;  2J0X A;  3MMC B;  2H54 B;  1VC0 A;  4CQ1 A;  5F8M A;  3T3F A;  3PKM A;  1QD1 A;  4OZN A;  4QIE A;  2ZD1 A;  2XZD B;  1AZS B;  4FNH A;  3RYL A;  3PV8 A;  4M95 A;  1WC4 A;  4TY8 B;  4ANE A;  2IA0 A;  3JB9 k;  1I94 J;  1TKX A;  4J9M A;  4ZKA A;  1DRZ A;  1YJ7 A;  4JV0 A;  1RKI A;  2W9B A;  1FCA A;  3KLE B;  5GAG I;  1FKP B;  4K0K F;  2W01 A;  4P73 A;  1T9X A;  1M5K C;  1JLQ A;  1S6O A;  3DI6 B;  1KTV A;  4NLY A;  1IBL J;  2NZC A;  2L3M A;  1M5O C;  4LF9 J;  4DFK A;  4IFV B;  3DLE B;  4DV6 F;  1ZS6 A;  2WON A;  1SXL A;  2CPJ A;  2ZHB A;  1M5S A;  1TVR A;  4XIU A;  1RCO B;  3OSP A;  2VH7 A;  2DGX A;  1S59 A;  2VFT A;  3OR2 B;  5AXL A;  4RWW A;  2WVC A;  1H74 A;  1HBM B;  2CAJ A;  3GJR B;  4U6P A;  4O23 A;  4DFM A;  2O1P A;  1LW2 A;  3NGU A;  3OL6 A;  4WXW A;  3TZZ A;  2AGO A;  1SKS A;  3N5F A;  4K50 A;  2ZH9 A;  4X4T A;  4O4G B;  1R0B G;  1ZM4 A;  2EXU A;  5I42 B;  2ASD A;  1N52 B;  4I7F A;  4PZV A;  3NOC A;  3R5B A;  1F0X A;  3T1Y J;  2RD5 C;  3FBC A;  5KT7 A;  1KLM B;  4Z7Y A;  1QLN A;  4Z7C A;  1U6B A;  1LKZ A;  1S4F A;  2NCK L;  8RUC A;  3EGV A;  3TUI C;  2W9C A;  1P9Q C;  4WFA Q;  2VV5 A;  3C6T A;  2ATL A;  3E8O A;  2XB2 D;  4ZLL A;  2F7V A;  1HKA A;  2KN4 A;  3CJ3 A;  4FS1 A;  5C24 A;  2KL8 A;  1LOU A;  2QMX A;  3D4J A;  1TMJ A;  4HAC A;  4X4Q A;  2DHG A;  1HPZ B;  1RT5 A;  2OTL S;  4UOF A;  4DR6 F;  2HNZ B;  5CAB A;  3TAR A;  4KV8 A;  4FN5 A;  2YNF A;  2O3D A;  4Y0F A;  2DNR A;  3W5X A;  2FJA B;  2ZOM A;  3MEG A;  3NWR A;  3BEG B;  1LWE A;  4LF2 A;  3AXK A;  3QJJ A;  5F9L A;  4DSE A;  1PGZ A;  5KFA A;  4USM A;  1N54 B;  2UXB J;  2XMW A;  2CQI A;  1JLC B;  3MTJ A;  2BJ3 A;  3TA2 A;  4NLT A;  2R7O A;  4QPT A;  4EU0 A;  2HFO A;  3V6K A;  5DRK A;  1S99 A;  4I2Q A;  2PEH A;  4I7F B;  3IG1 B;  1IQT A;  2XS2 A;  3EGZ A;  1T9W A;  2YPY A;  2I1R A;  1KQS R;  2KYZ A;  3DRP A;  3R5C A;  3PJW A;  1WHX A;  2QA2 A;  3HJV A;  2XMU A;  3MM7 A;  5E3R A;  3G8S A;  4DV4 F;  1RSC A;  1YIJ S;  5D0R A;  2XHC A;  1C4A A;  1SUQ A;  2MY8 A;  2V69 A;  3BPD A;  5L8R C;  1VHF A;  3ULH A;  3EYZ A;  5LMN F;  1FFW B;  3UE2 A;  2FJX A;  4J9P A;  2DH8 A;  1EZZ B;  4DU8 A;  1JLF B;  4X62 F;  2ZH7 A;  5A8K B;  4XPE A;  2N7Y A;  2G13 A;  1WOS A;  2EWH A;  5CYQ B;  2UUT A;  3AOA A;  6AT1 B;  5KG2 A;  5CH7 B;  1HBN A;  1BD6 A;  3I0R B;  2OEL A;  3KLH B;  1SKR A;  4QIV A;  2XHW A;  1OQ6 A;  3DRS B;  1FEH A;  1PBU A;  3DU5 A;  3FK4 A;  3MCS A;  4WCE Q;  2W8L A;  4OYB A;  2QL7 B;  4I1T A;  4IYQ A;  4N77 A;  2ALZ A;  1AT1 B;  4MK9 A;  4DV1 F;  2Q79 A;  3LUY A;  4IQM A;  5D77 A;  1FRJ A;  4JI6 F;  2B43 A;  4TYB A;  2UXC F;  1VRU B;  2M0G B;  2J8A A;  2V68 A;  4IG3 B;  1IKV B;  4HAC B;  4JBC A;  5HJX A;  1Y5L B;  1B0P A;  2LQ9 A;  2IRU A;  3VZH A;  2NLW A;  4ZP9 A;  5G0R A;  3KTQ A;  3BKT A;  2UUW A;  5HVG A;  5AJ3 J;  3FSI A;  1S72 S;  4F3O A;  1FO1 A;  2D9O A;  1C2P A;  5A8R A;  1VRQ C;  5BYR A;  1FRH A;  4WIQ A;  4K7Q A;  4B9M A;  3SCL E;  3NLC A;  1GXU A;  1YDL A;  5DZ7 A;  4DQS A;  1CUL B;  4DZD A;  4F2R A;  1N34 J;  2BOP A;  2V0N A;  3HDS A;  4LIR A;  2AJ4 A;  3GMG A;  4PXB A;  2R8K A;  2C2E A;  2G0C A;  2MGZ A;  4KHR A;  1EKR A;  5K8P A;  3CD7 A;  3TRG A;  4MH8 A;  2LQ8 A;  4J9Q A;  3L9Z A;  4DR3 J;  1PYT A;  3Q89 A;  5E7O B;  4UY8 T;  4J7C A;  3KLF B;  4X64 F;  3MM6 B;  2G2Y A;  2HBZ B;  2ZUA A;  1TAU A;  2EBG A;  3SYZ A;  2D3Z A;  1U1M A;  2DPI A;  1WC1 A;  1QAY A;  3LGM A;  3MPU B;  3M9M B;  1L3U A;  5ETK A;  3JAM U;  3PZP A;  1K44 A;  3IBC B;  1H2V Z;  4JI1 F;  1SIW B;  1HLW A;  2VIC A;  1NJZ A;  1SJR A;  3MM5 A;  4R25 A;  1CJK A;  5LMU F;  5EWF A;  4ZVS B;  1X5S A;  2IYI A;  1BGX T;  2CFX A;  2VG5 B;  3LP2 A;  2GMJ A;  4CNY A;  3Q8Q B;  3JYT A;  1FJE B;  1CJT A;  2F3J A;  1DFD A;  4MFB A;  4ID8 A;  2KDO A;  3BQ0 A;  2J76 E;  3NGK A;  4B3T F;  5B08 A;  1KSP A;  4GKJ F;  2C1E B;  3H7H B;  2QO3 A;  4HLB A;  1U25 A;  4ZVU B;  2B6A A;  4OI2 A;  5AE3 A;  3R5J B;  3THP A;  3RB6 A;  2GW8 A;  5BYQ A;  5KG6 A;  2OPS B;  2IYG A;  2MQP A;  3ZXW A;  1NK7 A;  2B5J A;  5JUM A;  5DG8 A;  4I64 A;  4KAI A;  4Y2C A;  2MJU A;  4RBU A;  4KFB B;  3D6M B;  3I9V 9;  3GIM A;  5DG7 A;  2MKI A;  3KJN B;  1WG5 A;  1EET A;  2YXL A;  4ATN A;  2JHE A;  2LXI A;  1GXT A;  2JRS A;  2BQ3 A;  2KI2 A;  4OYO A;  4LSZ B;  4DF8 A;  3I55 S;  5ADZ A;  1MWQ A;  1NPR A;  2Y1R I;  3Q2T C;  2J7U A;  3OHB A;  1S1U B;  1RAH B;  1TKZ B;  1T9U A;  2E29 A;  3CJ4 A;  1EIY B;  4J5O A;  2V94 A;  4B17 A;  3BM7 A;  2LXU A;  2F4F A;  2A3J A;  2DNL A;  3A12 A;  3N01 A;  4DI6 A;  4KGK A;  3J7A N;  2Z2M A;  4WTO B;  4DR2 J;  5L1J A;  3V81 A;  2GIF A;  5KT2 A;  2R2T A;  3QAU A;  3TZW A;  2DXD A;  2QL5 B;  3CCV S;  4RLE A;  4OJH A;  3UDL A;  4DV3 F;  1ZPV A;  2I6W A;  2FC9 A;  2ZJP Q;  1HIY A;  2O01 C;  3DYA B;  4DX6 A;  3Q8S B;  4C4W A;  2IM0 A;  4ZN1 A;  4ID5 A;  3V4M A;  1VOM A;  4PG7 A;  1IM4 A;  2QEX S;  2WB4 A;  3GZ7 A;  1U1K A;  2BRL A;  1VQS A;  4K5S A;  1Z4U A;  3UD5 A;  4ZIV A;  6FDR A;  1H38 A;  1S77 D;  1NZA A;  3HP6 A;  8ATC B;  4R0E A;  4RU9 A;  1JJ2 R;  3MUV P;  3ADA C;  2XSF A;  4PWW A;  1UPP A;  4GC7 A;  4AQY J;  4ED6 A;  1HAR A;  2A2D A;  2CA9 A;  4PUO B;  4K4Y A;  1D0E A;  2YQ3 A;  3DM2 B;  4ZN3 A;  1IBK F;  3UVJ A;  1NDP A;  3EPI A;  1RWM B;  1KC8 T;  2UZA A;  2FDN A;  2YWK A;  1ZOT A;  1V5V A;  2RRB A;  4P2X A;  3K0J A;  2VAS A;  4RUC A;  2RVJ A;  1WEX A;  3DOM A;  2B4P A;  1C0U B;  4M5G A;  4URS A;  2YNI A;  3BSO A;  3MOJ B;  1FXL A;  2DGW A;  1KHV A;  1LEO A;  1EJ7 L;  1YK9 A;  2GMH A;  3V6D A;  2KO1 A;  4DL6 A;  4M94 A;  4PYD A;  4X4U A;  4LF7 F;  1RAC B;  1FVS A;  1NHK L;  2GIQ A;  2QN6 B;  4QW8 A;  4G6V B;  3PJX A;  3SFU A;  3CCJ S;  4KY3 A;  3M7V A;  3KMS A;  2QLJ B;  1I5O B;  2IJN A;  2BDP A;  3LTO A;  1RAI B;  4YFU A;  2VUG A;  2H51 B;  2HWI A;  2Q43 A;  1WI6 A;  4DR1 F;  4DPO A;  3OXF A;  2N7C A;  2AEJ A;  1ZZN A;  2H48 B;  2FHK A;  2I8E A;  2ZEJ A;  3A8J A;  4CM2 A;  3HLU A;  1LFP A;  3KHG A;  1FA0 A;  4DQI A;  2CG4 A;  4Q43 A;  4F0K A;  3U7J A;  2IJF A;  1N6Q A;  1L5U A;  2DGQ A;  2GHW A;  3A1Y G;  1RLC L;  4WFY A;  2WOM A;  4B3M J;  1SBR A;  3D28 A;  4KHP J;  3ZZZ A;  3CJQ A;  4PG8 A;  2RU3 A;  1S9E B;  4XTT A;  4CLU A;  1F2G A;  1RLD A;  4DU7 A;  3TAP A;  4ZLJ A;  2BJ1 A;  4WXO A;  2BV3 A;  2M9K A;  2MLZ A;  1RAF B;  2XG8 A;  4Q8E A;  2HGM A;  1FRI A;  3OTB A;  5IT4 A;  2KTQ A;  3NGR A;  2FJE B;  1PIL A;  2YNF B;  3DGP A;  1RU2 A;  3H20 A;  1RI7 A;  1NK5 A;  2N3O A;  2XUL A;  3VAM A;  3QGH A;  2AGP A;  3C16 B;  4CO1 A;  4AFF A;  4B9L A;  3I87 A;  3NXZ A;  3W9I A;  1XNQ J;  2DEI A;  2AJ0 A;  3FCH A;  1F2H A;  5E0O A;  3RR7 A;  4RW6 A;  4UQT A;  4C8Z A;  2GGP A;  5J1N A;  2FLN A;  4W90 B;  4C9D A;  4W4M A;  4J9N A;  2X3D A;  4TYA A;  3NY0 A;  1LXJ A;  5HMX A;  2BAN A;  1MLA A;  5HAO A;  4RW4 B;  4FF4 A;  1W25 A;  3MEC B;  2KZM A;  2C3O A;  4GVL A;  2I5J A;  2HHS A;  3M05 A;  4NAS A;  2F4V J;  4CT9 A;  2DT9 A;  2L9N A;  1NSP A;  1WC3 A;  1HFE L;  2BRK A;  3KLI B;  4ILR A;  5E2Q A;  1SJ3 P;  2AYB A;  3KHR A;  2V8D A;  2FC8 A;  4ZIT A;  3D68 A;  4NZ7 A;  3G6V A;  3JTP A;  3SBM A;  3T5J A;  3RW6 A;  3MI7 X;  3SDE B;  4CCH A;  4QIF A;  3W9H A;  5KT5 A;  1NLK L;  3FMB A;  4L6V 3;  2RAQ A;  2B9Y A;  4HH1 A;  3CJ8 A;  2H5E A;  4OLO A;  2Y8W A;  1TL7 B;  4LVO P;  3M6V A;  1NME B;  1J2V A;  4DPU A;  3B78 A;  2HQ3 A;  2HSE B;  4RZR A;  4IR1 A;  4V19 X;  1XTZ A;  4UZB A;  1VLO A;  1P9Y A;  3HHL A;  5L1L A;  1VYA A;  2DR5 A;  5IC4 B;  4KBI A;  1M90 T;  1N32 J;  4DG1 A;  3EIC A;  4FYX B;  2VBY A;  5HBM B;  1CC7 A;  3JS9 A;  3SSS A;  3TI0 A;  1HNW J;  1RA6 A;  3MOZ A;  1XR7 A;  2W2O P;  2Y0S D;  4FF1 A;  4P2M A;  1HWJ A;  4B3R F;  4WYW A;  1HBM A;  2IBO A;  1TZ0 A;  2A18 A;  1EKS A;  4KHM A;  1WUU A;  3C2P A;  4NXM J;  4F02 A;  3DHX A;  4XDC A;  5B0A A;  3QZ7 A;  1LK5 A;  4GVB A;  4OYW A;  3AA8 A;  1HW9 A;  1T9T A;  3B54 A;  3HUL A;  2A6M A;  2GQQ A;  1U2R A;  2H9Z A;  1U49 A;  1Q5V A;  1A9N B;  1K8A T;  3GYN A;  1IKW B;  2X1A A;  3RB3 A;  4KKO A;  2G4B A;  4RO0 A;  1R8A A;  3OTC A;  4DR5 F;  5IXU A;  4ECX A;  2EI5 A;  3CVK A;  5HLF B;  3MM9 B;  4P52 A;  1R0C B;  1QAI A;  3Q8V A;  2HEK A;  2GV1 A;  1R8P A;  2AJ1 A;  2DNG A;  4P75 A;  1JLG A;  4N47 A;  3UR3 C;  4Q2L A;  3CPW R;  3V4I B;  5T7L A;  2QA4 G;  2COL A;  1M1G A;  2HRT A;  4A8S A;  2RUS A;  2DVI A;  3OFE A;  4K0K J;  5MLC V;  1K0T A;  3IWX A;  2FVS A;  2GFF A;  4HI2 A;  2ZBC A;  2GQ2 A;  4RPF A;  5LSL A;  3J7Y I;  2HK2 A;  2AYG A;  3PY8 A;  1B7Y B;  4OI6 A;  5A76 A;  3QRP A;  5K8M A;  1NK8 A;  4WBF A;  2XMT A;  3G82 B;  4RJV A;  1X31 C;  3BBF A;  4C8Y A;  3MR3 A;  4FBT A;  4YB5 A;  1L3K A;  1HMV B;  1FVQ A;  4PKD B;  3WX8 A;  1U4B A;  2Y8Y A;  3FBE A;  3WBZ A;  4TQR A;  4OYP A;  3NCQ A;  1ACM B;  3UN2 A;  1FNM A;  2LEC A;  2Y1I A;  4M63 A;  2V67 A;  4F25 A;  3OL7 A;  4DEZ A;  3KLG A;  3BSC A;  3NMA A;  3EX7 B;  5CZX A;  5DM7 Q;  4B3S F;  1XK8 A;  3W63 A;  1HYS B;  3HHN B;  1WF2 A;  2YX7 A;  1OPI A;  3T5H A;  2VG7 B;  3OPK A;  1RTH B;  2IVF B;  1Q8K A;  4QYZ J;  2WSF C;  3NNH A;  2CQ1 A;  2VBW A;  2RF2 B;  2YNH B;  3VHQ A;  2BAC A;  5KOX A;  1L3T A;  2M2B A;  2VDI A;  3ET6 B;  1Q8L A;  1FWP A;  4KC5 A;  4EMD A;  4J9O A;  2IHR 1;  5B0E A;  1YKW A;  4JI2 J;  1N33 F;  3W3S A;  3UD3 P;  1F60 B;  4USV A;  1S1V A;  4NRU A;  4LFA J;  1JJ4 A;  1WF0 A;  4OL8 A;  5K5M A;  5DG9 A;  2C2M B;  3F41 A;  1T03 B;  1G2E A;  4EBC A;  4J91 A;  2DBB A;  3UDE A;  3ZTR A;  1FTR A;  4NLP A;  1WTF A;  1ICE B;  1TUG B;  5KFG A;  2W7A A;  2N82 B;  3NRB A;  2MXY A;  3HFV A;  3TX0 A;  4PUO A;  5HJY A;  5DGA A;  3LA0 A;  1WSR A;  1YWX A;  1VK8 A;  3UVJ B;  3MPD A;  5KG1 A;  1NSA A;  2DGT A;  2PT0 A;  4QR2 A;  1NXI A;  3OHA A;  1GTE A;  1FWL A;  2ZNZ A;  1VS3 A;  3ISN C;  2YX4 A;  1JMT A;  1Q7Y T;  3ELH A;  2DK2 A;  1SV5 A;  2DPJ A;  1TK5 A;  1DHM A;  4TNO A;  2CQD A;  2ZKT A;  1HI0 P;  2NXN A;  2XBP A;  3VVT A;  4CNZ A;  2KFN A;  1NB2 A;  4JOU A;  2B51 A;  2CPY A;  3PHT A;  3R7N B;  3RJM B;  1GX5 A;  4CH7 A;  3ICL A;  3KNG A;  3G4S S;  2MST A;  3BV8 A;  3LAM A;  4LR8 A;  2XY7 A;  2FLP A;  2C2O B;  4ED0 A;  4O3Q A;  3M8Z A;  1G1X A;  2IRY A;  1Y7P A;  2F63 A;  3C19 A;  2Q6B A;  5KG7 A;  5CAA A;  3AB4 B;  5K8O A;  4IQX A;  1EX8 A;  4J9S A;  1DTT B;  4YB6 A;  1S1T A;  2B4U A;  3AAW B;  3KK1 B;  1VQL S;  1RT7 B;  4RW8 B;  1V3R A;  4DPY A;  1BQN B;  3OR2 A;  1IN0 A;  1S1X B;  3ETO A;  3QAT A;  1RA7 A;  2RQK A;  3K5N A;  4IFV A;  1U1O A;  3HO1 A;  3NNA A;  1FJG J;  4X4N A;  2DXF A;  4WFZ A;  1O0P A;  4IOA Q;  5CYM B;  3CJS A;  4KPC A;  3CB4 A;  3AOD A;  3R9L A;  2VJV A;  4QU6 A;  3UW1 A;  1T3N A;  1NKC A;  4OX8 A;  4OZ3 A;  3GV8 B;  2CZ4 A;  2D69 A;  3DFE A;  3DGV A;  2V50 A;  2ROE A;  3K2Y A;  3T41 A;  1FKO A;  4DL0 C;  2CQ0 A;  4MJK A;  2W9B B;  2E1A A;  1C1C B;  5GAG U;  2C2R A;  4WE1 A;  1ZM2 A;  5GAE U;  1U2C A;  2E7X A;  1CJU A;  2PII A;  2IVY A;  2M52 A;  4LIW A;  4ZCM A;  5B0D A;  3CJR A;  3D1Q A;  4WU3 A;  4NI2 A;  1Q95 G;  4RNF A;  2BW7 A;  2A6O A;  3M8S A;  1NBE B;  9RUB A;  1BY9 A;  3JTO A;  4QWB A;  3RR8 A;  2HK3 A;  4ECW A;  3EVM A;  4JV2 A;  5HVF A;  2J7K A;  3V6H A;  1C1B A;  3VF0 B;  5H1S V;  3FNN A;  3H5S A;  3A8I A;  3SQG B;  3CO0 P;  2LQJ A;  4F4X A;  2JLE A;  1HQE A;  1TL4 A;  2MEW A;  1F9H A;  1N5V A;  2H65 B;  2YWF A;  3BYP A;  2ACY A;  3GJT B;  1LWE B;  2XLI A;  4A8F A;  2B7C B;  3TAM A;  3GQC A;  2E9T A;  3J7Y U;  1CLF A;  4YHH F;  3K59 A;  3KK1 A;  2UUC J;  2XMA A;  2YNG B;  3Q0A A;  2CZ9 A;  3FZ2 A;  2AJQ A;  1B0V A;  1XIQ A;  2WVE A;  1RTJ B;  4ICL A;  1T05 A;  1DQA A;  1MMD A;  2PA3 A;  2MLX A;  4RR5 A;  1RWK B;  5ETM A;  1BHN A;  3UFC X;  3DDK A;  3H40 A;  2HHQ A;  5C7P A;  3MAA B;  4WPA A;  4X4O A;  3ENA A;  4TXS A;  4DR5 J;  1HHT P;  4C7Q A;  2F4V F;  3AOC A;  3NS7 B;  4X4R A;  3I31 A;  2R7S A;  3H2V E;  4KR0 B;  5JJB A;  1XEZ A;  2E44 A;  1KKH A;  1ZBT A;  2E7V A;  2CQ2 A;  2HWH A;  4L3K A;  3GV7 B;  2EG1 A;  1SKU B;  4M5K A;  1S76 D;  1Y4Z B;  4E0D A;  2PFF B;  2O67 A;  4X65 J;  4DV6 J;  5ETT A;  3DCA A;  2VKZ G;  2BUN A;  3QMQ A;  3QSI A;  2W7P A;  2BQU A;  3OL8 A;  3MUM P;  1RKJ A;  1S1U A;  2ASL A;  4KO0 A;  1N0U A;  5EN1 A;  3BR8 A;  3HVT A;  3QAE A;  4Q0B B;  6FD1 A;  4ECT A;  1B0T A;  1ZAV A;  2EVZ A;  3CE8 A;  1R43 A;  3RBZ A;  3C15 A;  3Q22 A;  2KKH A;  3LP0 B;  2JZ5 A;  5ETL A;  1IBM J;  2FLL A;  1S0N A;  3R2C J;  1S9F A;  1RHM B;  1UPM B;  2FTR A;  3BH7 B;  4YDX A;  5I3U A;  3UCG A;  4FF3 A;  1RTI A;  2IAJ B;  5BYS A;  2BJ7 A;  2J0S D;  3KNA A;  1ZA1 B;  1QSY A;  3CJ2 A;  1KD1 T;  3W2V A;  4UW2 A;  4DBQ A;  3CCT A;  4F67 A;  3U1M A;  4A8M P;  4P9S A;  4TVA B;  2DNN A;  4HHH A;  4FS2 A;  3G87 A;  2ZZM A;  2OPQ B;  2ROP A;  1EAR A;  2JSX A;  2NXC A;  1XR6 A;  4HH0 A;  1JLG B;  3C66 A;  5J1P A;  1XMQ F;  1FD2 A;  2WVD A;  3ZZT A;  4U8Y A;  4BC7 A;  3DYA A;  2M8D B;  2NXJ A;  2W24 A;  5CCM A;  5HO4 A;  3OUY A;  2RE1 A;  1SI9 A;  2X51 A;  3AD8 C;  2AEF A;  4CT8 A;  2EBE A;  5IWA J;  5DLF A;  4NXN J;  2UUC F;  1IXK A;  4C8N A;  3CIZ A;  1D8Z A;  4EBE A;  3CDW A;  4DUY F;  3AD9 C;  4WII A;  3JSR A;  1ZH5 A;  2UXC J;  5LOQ A;  3OLB A;  1HYS A;  2I0X A;  3IR5 B;  1AFI A;  2LVW A;  5D0G A;  1H73 A;  2HWT A;  1S48 A;  3KLG B;  3BKU A;  3V6J A;  3PO4 A;  2K7K A;  5LJ5 Y;  1CBK A;  3C6U A;  2FPH X;  1VI7 A;  3R5G A;  2R4F A;  2R3V A;  4B9N A;  4F7V A;  4DS5 A;  3I82 A;  2K06 A;  2H3E B;  4A8K A;  2QG9 B;  1CJV A;  3I0S B;  4NMX A;  5B0G A;  3AQP A;  5E3Q A;  1MN7 A;  3MCO A;  2M70 A;  3V5R A;  4MKB A;  2K7J A;  2HUR A;  2XEX A;  3DOL A;  5HI7 A;  4OZ0 A;  3VGV A;  2W25 A;  5DDQ C;  2MQ8 A;  4MKY A;  1L3V A;  3KLE A;  2UXD J;  2OI2 A;  4MMO A;  4G1Q B;  1SC4 B;  5FJ4 A;  3DLK A;  3T1A A;  4EUV A;  2DR9 A;  1U24 A;  3IM8 A;  4W98 A;  4WKR A;  2DXE A;  3LPY A;  4MFB B;  1GMW A;  1S6Q B;  3IWN C;  4KFB A;  1JQG A;  4CLZ A;  2MQO A;  2JOQ A;  3DRR B;  3FVY A;  1S7I A;  4A47 A;  2SXL A;  1SCJ B;  1YG0 A;  2YKO A;  2WZ1 A;  1RT2 B;  5GAE I;  3NGS A;  5JMN A;  4FXD A;  3EZ5 A;  2ZH4 A;  1RWO B;  4K4S A;  1RWX B;  4H4M B;  1HNV B;  1PYO B;  3GE9 A;  4PPZ A;  4GVB B;  2V4R A;  2GCF A;  5GAH I;  4DQP A;  7FDR A;  4ZPV R;  2GJI A;  5HSP A;  4X65 F;  4ZLP A;  1FDN A;  3LGN A;  2ZUG A;  4TY8 A;  3B4D A;  3H4B A;  3R27 A;  4USK A;  2W9C B;  2XLJ A;  3HXM A;  3TVZ A;  2XCP A;  4DUY J;  4DUZ J;  2PEB A;  2DHH A;  3DGP B;  1Y3J A;  2CWX A;  1X4C A;  3EGN A;  3CSK A;  3N6L A;  5KFH A;  5IWA F;  4DL3 A;  2K3I A;  3PO5 A;  4NCG B;  2JEG A;  1W2I A;  4EBD A;  2YKM A;  4LJM A;  4WFN Q;  1ZAX A;  5ETP A;  2DRD A;  1KOH A;  2EC2 A;  4U67 Q;  3QRR A;  4AXI A;  2MZT A;  1RWN B;  2HGL A;  2ZBI A;  4MT1 A;  4QWA A;  3JSM B;  1X4D A;  3MD1 A;  1J5O A;  4YHH J;  2XTJ P;  2QSW A;  2FZG B;  3H98 A;  1WNE A;  3M6W A;  2CJA A;  1H2U X;  2MQL A;  4W92 B;  1HL6 A;  1MNE A;  4PXE A;  3CCS S;  2FY1 A;  3H5Y A;  4G1Q A;  2RB7 A;  9ATC B;  5F3Z A;  3ZZ0 A;  1TQL A;  1U0H A;  3M30 B;  4KQZ A;  4R8U A;  4U8V A;  1F9E B;  2QYG A;  4CYU B;  3MR6 A;  4JI5 J;  1S6U A;  4JYA F;  2BJD A;  5U47 A;  3TOQ A;  3QO9 B;  3QT7 A;  4N8O A;  3OTO J;  2QFJ A;  4ZVH A;  4OHV A;  5CHC B;  2XGP A;  4GMK A;  4CLF A;  1S9G A;  1UJ4 A;  1R8H A;  2VJU A;  3K5O A;  4NZ0 A;  1IM6 A;  1I1G A;  3CMQ A;  2BQR A;  2DR8 A;  2Z58 B;  3FQL A;  4WP9 A;  2KVI A;  2M88 A;  4WE1 B;  1IKX B;  3W5Y A;  4M5J A;  4RUA A;  1K1S A;  4PYA A;  2KM8 C;  1M0S A;  1V6H A;  4NX9 A;  2MZQ A;  3X3U A;  2GAG C;  2ZWP A;  5F8H A;  3IXQ A;  4A8Q A;  1W2B R;  2O66 A;  3W2W A;  2KM8 B;  1PKU A;  2V4J A;  3VAG A;  5T41 A;  1N5Q A;  2HYI B;  3MM7 B;  5KFY A;  1HA1 A;  2XYG B;  3GSI A;  3M1V A;  4BWM A;  4KIA A;  1RAD B;  1HBN B;  1FE0 A;  1JLC A;  4OQJ A;  4ZCK A;  1O51 A;  4H4O A;  1Q82 T;  4NL5 A;  1FF2 A;  1GTH A;  1TKT A;  5KFB A;  2J6U A;  5B7W A;  1QTN B;  2HLT A;  2J9C A;  3MDF A;  4FXW A;  4ZMM A;  2LQB A;  1U0S A;  2LU1 A;  2MDA A;  1JXV A;  3NP5 A;  1G3O A;  3AJ1 A;  5C25 A;  3IMQ J;  2ZBR A;  4J37 A;  3PW0 A;  1S6P A;  4WYL A;  1YGY A;  1NUE A;  3GR0 A;  3RG6 A;  4ETX A;  1IKX A;  3GLJ A;  2QJ3 A;  5KFJ A;  2V6A A;  3DLG B;  3CDU A;  2PN6 A;  1F9F A;  2QYC A;  3I0R A;  4ZPT R;  5IM0 B;  1UET A;  1KEK A;  1U8S A;  3ZNJ 1;  5FDL A;  5KT4 A;  2L48 A;  2RQC A;  2JLF A;  1UTA A;  4N41 A;  3KKF A;  2CJX B;  2ZDO A;  2YNG A;  2OKQ A;  3HT0 A;  3CJK B;  4DSL A;  4IDK B;  2W9A A;  4M8L A;  3HKZ D;  2BM1 A;  2CQC A;  1JJH A;  4AT1 B;  1BQM B;  5IQQ A;  1YRT A;  2V9K A;  3CC4 S;  4WF9 Q;  4B9T A;  2G1D A;  3M8Q B;  4DR3 F;  3ILJ A;  2H1Y A;  1PJ7 A;  2CIM A;  5KFW A;  2WSE C;  1JXE A;  2XNQ A;  2IJR A;  1UL3 A;  5I3U B;  5J2P A;  2AT1 B;  3D5M A;  4GRS A;  2PMZ D;  2FUG 9;  1H72 C;  2MMY A;  4KGM A;  3CC2 S;  4J9R A;  3PR5 B;  1WKL A;  2W4P A;  5C25 B;  4KO0 B;  5LL6 d;  4ECQ A;  3GFZ A;  2YKN B;  2OPQ A;  2DKO B;  4ZP7 A;  2EFP A;  3GV5 B;  1NU4 A;  3NNC A;  3PEH A;  4NA2 A;  4Q44 A;  4WZQ A;  4MIB A;  5KFI A;  4QWE A;  4LF5 J;  1V3Z A;  3IG1 A;  4DSJ A;  3WQP A;  3OJS A;  3LP1 B;  3W64 A;  1CJT B;  3LAK A;  1TL1 B;  3IGN A;  2R7V A;  2KT2 A;  3VR1 A;  4F8R A;  1GEH A;  4NPO A;  3TR5 A;  5GAH U;  4B3S J;  1DTQ A;  4FDF A;  5IV4 A;  5A2Q U;  2CNN B;  2MYF A;  2AZ3 A;  2BYC A;  5KFR A;  4B3O A;  1RXO B;  2N4D A;  4NRT A;  4RX6 A;  2KFZ A;  2MHE A;  1S4E A;  2ZM6 J;  4Q45 A;  5D15 A;  5HK4 A;  3HK2 A;  4DF4 A;  2GVZ B;  1QVG R;  1QJH A;  2BAB A;  4ES3 A;  3TUZ C;  3RB0 A;  4R5P B;  4O0N A;  3T19 A;  2IRX A;  3KDN A;  1KVK A;  2YWW A;  1EET B;  1X0P A;  2QRR A;  5HQ8 A;  5HMW A;  5GAD I;  3V81 B;  4YR3 A;  2P6S A;  2QT7 A;  3NL0 A;  3TUP A;  1JLE B;  2NQP A;  2KH9 A;  2DNQ A;  1SKW A;  3G8Q A;  2ZC4 A;  2ATC B;  2H4W B;  5GME A;  4A48 A;  3AJ2 A;  2FD2 A;  1S5Z A;  3MM8 A;  4ZP6 A;  2QMU B;  5HQM A;  1VQ6 S;  4LSL B;  1F5A A;  2DH7 A;  1OPZ A;  2QSF A;  3DXB A;  4K59 A;  3FJ2 A;  2ZH6 A;  1SL0 A;  4PAA A;  1U8W A;  2QX0 A;  4V1A k;  3L3C A;  4WP8 A;  4BCA A;  4OHY A;  2BKP A;  3HVW A;  2WK4 A;  4OX7 A;  4CLS A;  5HRO B;  1DTT A;  4FP9 A;  4C97 A;  3DOM B;  2AF6 A;  4K5R A;  3KK3 A;  3E2E A;  5KFX A;  3RU0 A;  3T9Z A;  2HHH J;  3OBI A;  4AL7 A;  1FES A;  4IH6 A;  3VZI A;  1ZM3 A;  3NGT A;  3RBD A;  1CEZ A;  2K8G A;  3IGV A;  4ED5 A;  4TQS A;  3RZA A;  5AE1 A;  2J6T A;  3LGH A;  3MZI A;  3OL9 A;  2IPO B;  2CQ4 A;  3OD2 A;  1HBO A;  3FFI A;  3M2U B;  2VDH A;  2OEM A;  2D3O 1;  4EYI B;  2KT3 A;  4DR4 J;  3D67 A;  1NK6 A;  2CVE A;  4QR0 A;  1WF1 A;  5KOW A;  3ETM A;  1T7P A;  4Y2K A;  1XER A;  3D54 A;  3KLF A;  3QBC A;  1TL5 A;  3KUG A;  2QLF B;  1KP6 A;  1OIA A;  2AEM A;  1FKO B;  2B3T B;  4ED8 A;  3AFG A;  2HQI A;  1RBO B;  2CQP A;  1S1V B;  3P45 B;  4PRF A;  1IR0 A;  2MQQ A;  5L9N A;  1GX6 A;  1UFW A;  3PYE A;  4JB8 B;  4N7T A;  1F5C A;  2VG7 A;  2YVS A;  2C3M A;  1MWY A;  3PKY A;  2XY5 A;  1PJ6 A;  3EWG A;  3ISZ A;  3LOU A;  2E9Z A;  5B0F A;  3EUN A;  4DFJ A;  2X1B A;  3BZQ A;  2IM1 A;  1RTZ A;  1DAX A;  2ALY B;  3KJQ B;  3LW5 C;  3GJS B;  1QAX A;  1M1H A;  3PFE A;  3UNG C;  3W7B A;  2RRA A;  2B9E A;  3DKD A;  4FKY A;  3SV4 A;  3K5P A;  1VJQ A;  1VQ5 S;  3M2R B;  3N79 A;  3M8W A;  2BKO A;  3CD5 A;  4X4S A;  4P2S A;  4O3S A;  2V8G A;  3TX8 A;  1PYS B;  4CLT A;  1GMU A;  1Y9O A;  4FYW B;  2UUA J;  2LLZ A;  4DV0 F;  4P71 A;  2HHH F;  4OYA A;  1Y5I B;  3GYX B;  3H5U A;  4USH A;  4TU7 A;  2Q66 A;  5HN0 A;  3UO0 A;  1X5O A;  2B8P A;  4Y34 A;  2BE2 B;  4RNM A;  3S01 A;  1LWC A;  3CC7 S;  2EC0 A;  1X9S A;  2DO0 A;  1SVD A;  3IWL A;  4DV3 J;  2KVQ E;  4BWJ A;  2BOA A;  3SCI E;  3OVA A;  1AA1 B;  4ZJO A;  5KFC A;  1SJQ A;  4I2P A;  2EK1 A;  4ZVO B;  4C0H A;  1SV5 B;  3MWB A;  3RTV A;  4BLG A;  4X66 J;  5C5J A;  5IT9 U;  4U96 A;  1YLX A;  1MRO B;  1UWB A;  2DIU A;  1DUR A;  4WFB Q;  3O2I A;  5A6W A;  4EWT A;  5I3Q A;  2KFY A;  3BJY A;  4H54 A;  3O3L A;  4P7V A;  2EPI A;  1TKT B;  3DLJ A;  4ZVF A;  2ZH3 A;  3TO8 A;  3UCU P;  2E1C A;  1RAG B;  2ZOF A;  2MJN A;  2VOO A;  2VOP A;  1OYE A;  3O8W A;  1WOO A;  3P96 A;  2D3O R;  4ED3 A;  2QLX A;  5DLG A;  4YOE A;  4ZVT B;  1NEE A;  2ZFH A;  2HQD A;  3OSN A;  3MFH A;  1AUS L;  1F1B B;  1DY3 A;  3KDO A;  3LP0 A;  5DDR C;  3BGU A;  4KV8 B;  4Z2X A;  2IA6 A;  4HTJ A;  1NH8 A;  2DRB A;  3WC0 A;  3CJT A;  1JLB B;  3O6Q A;  4YB7 A;  4M1K A;  5J1E A;  1VC6 A;  5C24 B;  1ARO P;  1HQ2 A;  1YJR A;  3CDE A;  3L95 X;  3AQO A;  4J9V A;  2CJB A;  5FDL B;  1KLN A;  2XNR A;  2BJ9 A;  3D0I E;  3FDS A;  4K4T A;  4IR9 A;  2W2M P;  1R0A B;  1KBR A;  3SZ2 A;  1RT3 A;  4PG4 A;  2XO6 A;  2VQF J;  3GJQ B;  2RIL A;  1CSJ A;  3MR5 A;  2LQ5 A;  3HSD A;  3B8H A;  3KYL A;  1RB0 A;  4YR2 A;  1FDB A;  1TL3 A;  5L1I A;  4HR2 A;  4NEY A;  3GG1 A;  3PTW A;  2D3U A;  2CPZ A;  4LRA A;  1DLO A;  4D3H A;  4RW7 A;  3ILL A;  3JXO A;  1RIS A;  4GO5 X;  4Z37 A;  2YQ0 A;  3KG4 A;  3ZTS A;  2IC3 B;  4NLQ A;  5F8N A;  2M5Y A;  1C0U A;  1FRL A;  1RHK B;  2VG6 A;  4TY9 A;  5J2Q B;  4PXC A;  4U7C A;  1FK9 A;  3BKF A;  2YH0 A;  4KB7 A;  5GAD U;  2R8H A;  1YJW S;  1K73 T;  1UW9 A;  2ADC A;  1TL7 A;  3OR1 B;  4I6W A;  4PWU A;  3KJF B;  3W65 A;  4ZIW A;  2PMW A;  2JC1 A;  3LQV A;  4NA3 A;  4JI2 F;  5F8I A;  4KRW A;  3H4D A;  2JX2 A;  3SQG A;  1QSS A;  3MAH A;  1S7H A;  2ZOG A;  1J5E F;  2OJ3 A;  2CWK A;  3KLH A;  1CPZ A;  5KT6 A;  1T95 A;  2BXJ A;  4K4V A;  3WIU A;  1UJ5 A;  2YWE A;  3N0V A;  3ZC4 A;  3M8P B;  2GML A;  4IG0 A;  2WHO A;  3S7R A;  2DTJ A;  3V4I A;  4N56 A;  3PW4 A;  2JEF A;  2OFH X;  3UWT A;  3EVO A;  3I96 A;  1WHV A;  1U1Q A;  1IBC B;  4K2J A;  1YRU A;  4P7T A;  2CDQ A;  2UP1 A;  3QO9 A;  3TJA A;  1KQG B;  2QLB B;  4OX6 A;  3U1L A;  1GT8 A;  4JI8 F;  2CPF A;  1BWV A;  4KKO B;  5ETN A;  5LXR A;  3UR0 A;  5DGB A;  4QWC A;  1X5P A;  3PW2 A;  5F3T A;  1UZD A;  4M5M A;  2CPD A;  1JNR B;  4JI5 F;  2WSC C;  3B6B A;  1LFW A;  1UEV A;  2DHA A;  2RQM A;  3T6B A;  3J7A 1;  2V34 A;  2PD1 A;  3D3C J;  2HZC A;  5IV3 A;  5M2P A;  1VQP S;  3N4W A;  1IKY A;  3GFY A;  3O5T B;  2HW3 A;  2KT5 A;  5KFQ A;  4CLP A;  2MGZ B;  4K4U A;  2VL1 A;  2J9E A;  5K14 B;  1VHI A;  2F9D A;  1IR1 A;  1JLE A;  1JKH A;  2RHQ B;  2VG6 B;  4LFA F;  1RT1 A;  1NHU A;  4CRJ A;  4EZ9 A;  1I51 B;  2EKN A;  1GMW D;  4L74 A;  2RH3 A;  3WHI A;  3ZZR A;  1WG4 A;  2PGC A;  3MEC A;  3O1L A;  4LRC A;  2W8K A;  4LSN A;  5CD4 H;  3CJ5 A;  2OD4 A;  3F0N A;  4OZL A;  1SB6 A;  2DD8 S;  3FRZ A;  2GVD B;  5EUH A;  5G4D A;  2L08 A;  1FHT A;  3IN5 A;  4GKJ J;  5I4M A;  1FI4 A;  4DCJ B;  2YH1 A;  2CQB A;  3QJP A;  4JV1 A;  1NK9 A;  2I2Y A;  3SDE A;  2KRR A;  4FPR A;  3ZZO A;  3JYT B;  1M1K T;  4WZM A;  1G7C B;  1CJK B;  2Z2L A;  5AXK A;  3DOK B;  5IS2 A;  5KG3 A;  1RBA A;  1Z1Z A;  2JWN A;  4ECZ A;  3MPV A;  3DDN A;  3MR2 A;  3OW2 R;  2J0W A;  3KK3 B;  5D0E A;  3D1H A;  4F04 B;  3GR1 A;  1R89 A;  5EHH A;  3T5L A;  2HHW A;  2XMJ A;  2M8H A;  1UVL A;  1KTQ A;  3J80 Y;  3FSX A;  2FJD B;  3Q86 A;  1Q0N A;  5D4N A;  4ZPW R;  4DX7 A;  1N32 F;  1ULR A;  3LWM A;  2JFK A;  1NSK L;  5DDP C;  1M5P C;  1KRP A;  3EDR B;  4ECS A;  1IUJ A;  3BBC A;  5E5N A;  4IFY A;  1UVJ A;  1MSW D;  2DCU B;  5M2U A;  4UUX A;  1URR A;  3W60 A;  2CAD A;  2XMV A;  1ZYQ A;  1X4F A;  4ZOS A;  1ZAW A;  1EQM A;  3GIL A;  5EX3 A;  2H5I B;  2J9D E;  2P5V A;  1FE4 A;  4H4O B;  2VPX B;  4QJV A;  3UI3 A;  2ADB A;  1DQ8 A;  2G2O A;  3ENW A;  2FHM A;  4QBU A;  3VAL A;  4LRE A;  1J5E J;  4IOC Q;  1CC8 A;  3BYR A;  3M2R A;  3HFZ B;  1LWX A;  1ZM9 A;  1NJW A;  3MUR P;  1BQN A;  4H4K C;  3CCE S;  3RAQ A;  1U48 A;  2OH2 A;  4CH0 S;  3IP0 A;  1UVK A;  2W2Q P;  1EQ0 A;  4NE9 C;  2R2S A;  3MPY A;  1KR4 A;  1LWC B;  2OMO A;  2VD3 A;  2XZW A;  5E3A A;  5L9X A;  4C3L A;  4U7U K;  4X4P A;  2JLG A;  3R2D J;  1Q4R A;  3TJ8 A;  2WAQ D;  4D3G A;  4UY8 5;  1DAR A;  3ISN D;  3N9U C;  1BLU A;  3P5B P;  4RNN A;  2C3P A;  3J81 Y;  1RTD B;  1N33 J;  2LFV A;  4ZPD A;  2MKY A;  4DMZ A;  1U7L A;  2OEK A;  1LWF B;  3EM1 A;  4ES1 A;  4X64 J;  3D1O A;  2E5L F;  2V8H A;  2M4M A;  4BS2 A;  3UD4 P;  3W5Z A;  3B82 A;  2MKK A;  1X4G A;  4DV4 J;  3JQJ A;  4CO0 A;  5DQI A;  2VKR A;  3BB5 A;  3CDB A;  1HQU B;  1REV A;  2JC0 A;  3NCP A;  4PEO A;  3SMZ A;  4F4Z A;  1NJI T;  1N34 F;  1RCX B;  1QSL A;  4H4M A;  3A3P B;  1GAO A;  3PX4 A;  3TA0 A;  4F26 A;  3JQK A;  2H4Y B;  2HKE A;  1FD8 A;  4USI A;  2QE5 A;  3MCM A;  5CYJ A;  3OV7 A;  3E51 A;  4PWD B;  2IDE A;  2XMK A;  4Q7A A;  2UVW A;  1BXN A;  2VHG A;  2WCX A;  2C22 A;  4OJ3 A;  3PVX A;  4CZC A;  5KFD A;  4C11 A;  1CG2 A;  1CJU B;  2IVM A;  2X7I A;  4AYB D;  3DLH A;  1Q7L B;  4TLR A;  3ILI A;  2KJV A;  4NEZ A;  4IRD A;  3IR6 B;  3VWS A;  4PQA A;  5KT3 A;  1RP5 A;  2Z56 B;  2WBR A;  1N4L A;  3D9B A;  1YBA A;  3C14 A;  2AD9 A;  2ASJ A;  5IZH A;  4DV7 J;  2LDY A;  5LM7 E;  4DSI A;  1LWF A;  4E2F B;  1U0H B;  2I9S A;  3AD7 C;  2Z4P A;  3KK2 B;  3FEZ A;  1YZ7 A;  3L7P A;  5A8R B;  2MZJ A;  5F8L A;  2R8J A;  1FTC A;  2XM3 A;  2XS5 A;  5ITH A;  1RAE B;  1BMQ B;  1P8G A;  2BA9 A;  4NYZ A;  4DV0 J;  1K0V A;  1REV B;  2MKJ A;  5L38 A;  2GVZ A;  4HHU A;  3EGW B;  4EFA C;  3IS9 A;  3M9N B;  1ZTT A;  2IC3 A;  4R5P A;  2ZJQ Q;  1FRX A;  1VRT B;  2KJW A;  1VLY A;  4C11 B;  3G8T A;  2E7W A;  2XGQ A;  2LA4 A;  2XY6 A;  1E6V B;  4L73 A;  1B64 A;  2FIU A;  1CUL A;  1RQ0 A;  1H2T Z;  2YWH A;  3MM5 B;  2PMH A;  4C8K A;  3KLI A;  3D6H B;  5K20 B;  1SL1 A;  2VFS A;  1HWU A;  4CP5 A;  2AQ4 A;  1Q78 A;  2UUB J;  1FDD A;  2ROG A;  2ZH5 A;  1TAQ A;  3M6X A;  2CNK B;  3CCW A;  3IBF B;  1OY8 A;  3MM6 A;  4F0H A;  3LP2 B;  3HHL D;  1M5H A;  2HFS A;  3CCZ A;  3MEE B;  4FVC A;  4OLP A;  2XLK A;  2V8V A;  5CZV A;  5JVH Q;  1NKB A;  3Q8R B;  2CDR B;  4IG0 B;  4EEY A;  3JSY A;  4TLQ A;  3IO1 A;  4K8R A;  4B3R J;  2YWG A;  3W2V B;  4LF8 J;  4G1P A;  4MYT A;  3TP2 A;  2XYP B;  3GIJ A;  1DZ5 A;  3TW0 A;  1B70 B;  3W1Y C;  4DR4 F;  5CYM A;  4UQG A;  3QWP A;  1BWE A;  1OS5 A;  1LK7 A;  5BR8 F;  4DSK A;  3KXD A;  5A8K A;  2WVB A;  1WDT A;  4RKU C;  1XNR F;  4CO4 A;  5H9E K;  2F8H A;  3BN7 A;  4DX5 A;  2BW2 A;  3EXY A;  5AXM A;  3VVU A;  4AQY F;  3PX6 A;  1T11 A;  3KMQ A;  3SCK E;  4P10 A;  1FJC A;  1ROF A;  2OPR B;  1EHW A;  1HNI A;  4O44 A;  4IDK A;  4P74 A;  5KFU A;  2P6T A;  5CCL A;  2KZZ A;  1OSD A;  3UQS A;  2VBZ A;  2RU9 A;  2LKZ A;  3LH2 S;  3QWU A;  5F41 A;  1KQF B;  4OYI A;  2KXF A;  5KTQ A;  4LF9 F;  3CWJ A;  1X4B A;  2D1C A;  1IBL F;  4XPC A;  1QTM A;  3NGD A;  2NR0 A;  2HHT A;  3W62 A;  1WJ9 A;  1RT6 B;  2FGC A;  2IY5 B;  4OHX A;  4DCP B;  3CUN A;  2BKN A;  2HMI B;  5IT9 Y;  3M8Q A;  1JIH A;  4JI0 J;  2B4V A;  2UVU A;  4OI0 A;  5KFZ A;  1S79 A;  2PO4 A;  1VRU A;  2YBV A;  4IG3 A;  5K14 A;  4RNH A;  1VBX A;  4DXL A;  4KE5 A;  3W9J A;  5J2N A;  4B3M F;  2NRE A;  1K47 A;  2HQG A;  3IRX B;  3UN3 A;  1T3O A;  3DLL Q;  2RHS B;  4IO1 A;  1NZ8 A;  2XYH B;  4KGZ B;  5CD4 A;  1GFW B;  4Y2I A;  5I3P A;  3E01 B;  4F4K A;  3V2U C;  5C2G A;  1A0O B;  3SQO P;  4LFC F;  3GSD A;  1L3S A;  4ILM A;  2HG4 A;  5F0W A;  2VFV A;  3MAQ A;  5D8H B;  1SC3 B;  4NWB A;  3CCQ S;  1WEY A;  2MKS A;  2OPP B;  5T14 A;  2G2Z A;  1NKE A;  1NCL A;  3CTR A;  3DOK A;  3HZG A;  4I2P B;  4C8L A;  4Y2M A;  1JX4 A;  1RAO A;  2DGU A;  1HD1 A;  3A8K A;  2QMW A;  4WK3 A;  8AT1 B;  2YTC A;  3GG0 A;  4M5N A;  1NJX A;  4IFY B;  2IAJ A;  4OX9 F;  1PC5 A;  2ZWO A;  1Z2Z A;  4Q5V A;  4RUH A;  4B9S A;  2NPI A;  1T02 A;  1RT6 A;  1HNX J;  4NYO A;  2KU7 A;  3KUE A;  1RTH A;  4P6Q A;  3U1N A;  1HD0 A;  4CI0 B;  3T6J A;  1Q16 B;  1WTB A;  4JUZ A;  2JEI A;  2HAI A;  2N4C A;  2HND A;  1TEL A;  4ED2 A;  2HLU A;  2WBM A;  1F5B A;  4QR1 A;  4ZHR B;  5IQ6 A;  1U2F A;  3KJV B;  5HRO A;  4S0M A;  3FSY A;  5A8W B;  4I56 A;  2B0G A;  3EE3 A;  1TKX B;  2QZ8 A;  3IRX A;  1HBU A;  2RRN A;  3A3N B;  2ZVS A;  4O4R A;  2K2P A;  1O6X A;  1Y0H A;  1SQF A;  3SV3 A;  3CD0 A;  1VFJ A;  4HEA 9;  1S9G B;  3JSM A;  4Q8F A;  3BGO P;  2VQF F;  3FZB A;  1MML A;  3QT8 A;  4GO7 X;  4U95 A;  3G6E S;  2JNJ A;  2FY8 A;  2L9D A;  3TEG A;  5A0Y B;  5EWE A;  1U02 A;  3M4X A;  1FKA F;  2FJW A;  1RK8 A;  2EEY A;  2JL9 A;  3EJM A;  3AHP A;  4CLW A;  1IWA A;  3OTO F;  1IWG A;  5E3C A;  1CJV B;  1FT8 A;  1NRK A;  2ILZ A;  2L9W A;  2ZNY A;  4RW6 B;  1N5Y A;  4ETZ A;  2WON B;  1SH2 A;  2IDL A;  2Y3Y A;  3KUH A;  3M2U A;  1WC5 A;  4LF1 A;  4ZPB A;  2OAU A;  3C16 A;  1VJW A;  2Q6C A;  4B02 A;  4ZDN A;  3A8E A;  3THT A;  1H7W A;  1OMS A;  2HND B;  1ZA2 B;  1RT4 B;  3D2W A;  4PWD A;  2ZBQ A;  5GMK a;  5B09 A;  4NOH A;  2W2N P;  4YME A;  3UDC A;  1YIT S;  1Y00 A;  2EKY A;  2OSQ A;  2YY3 A;  2GHV C;  1Q1K A;  2ZDP A;  2KXH A;  3OTD A;  5THW A;  2AIR B;  3BO4 A;  2V9W A;  1XNR J;  2FZK B;  3LPE A;  1RWW B;  4PQU A;  2DNZ A;  2C2K B;  1HQU A;  2NPF A;  3OXG A;  2VF3 A;  1F6T A;  1LQ9 A;  2U1A A;  2Z30 B;  3M8P A;  3P3D A;  4ZVE A;  1QE1 B;  3L7O A;  3CT9 A;  4MIA A;  2OHD A;  2G0I A;  2QIF A;  3IR7 B;  2UV8 G;  4DN9 A;  4YY3 J;  1C1C A;  1UFK A;  2MSS A;  2YKQ A;  5DQH A;  2FZC B;  4BC9 A;  3Q23 A;  4DV2 J;  4DLE A;  2DY1 A;  5HBM A;  4C48 A;  3MPW A;  2DHX A;  2UVV A;  4YUD A;  1HHQ A;  3HF5 A;  4LVN P;  5A0Y A;  3I5A A;  4HYK A;  4HHJ A;  1VMB A;  3FCV A;  1PSD A;  3FBF A;  3ZTP A;  1XWL A;  2GO9 A;  2UU9 J;  2UUB F;  2XZT B;  4WWS A;  4KT0 C;  4USU A;  2EFV A;  3B4M A;  3CCR S;  1BQM A;  4U9R A;  4DQQ A;  1R6V A;  3PEJ A;  2IFX A;  1VIS A;  1FEE A;  3FQK A;  7AT1 B;  5FLX U;  3QJL A;  2OUG A;  2R7U A;  2HHP A;  2PE8 A;  1Q8I A;  4ENO A;  1YRX A;  3RUB L;  2DCL A;  1AFJ A;  1Q8B A;  2ZE2 A;  4LR7 A;  1PJ5 A;  2AJ2 A;  4A8O A;  4DJB A;  4M5L A;  1SC6 A;  3ZZP A;  1VQ9 S;  1CVJ A;  4O3P A;  1RT3 B;  5GMD A;  1KWM A;  4IKA A;  1VQM S;  2QLW A;  3AJD A;  1SQG A;  4QOT A;  2C3U A;  2C2Z B;  3I0S A;  2UXD F;  3SI8 A;  1MW7 A;  3ZZU A;  2Z8Q A;  1QUP A;  3RAM A;  2BX6 A;  1SQE A;  3LP1 A;  4FVM A;  4C6A A;  5HL7 Q;  1UA0 A;  4B08 A;  1UA1 A;  3QIP B;  1QDU B;  5KG0 A;  2ERR A;  3I56 S;  1TKD A;  3GII A;  2F40 A;  3JSB A;  4USJ C;  3QGI A;  1PAU B;  2HFU A;  2HHV A;  2P9G A;  4ED7 A;  4OI3 A;  3PRD A;  1C0T A;  3TVY A;  3MUT P;  2HHU A;  3WZ0 A;  4A4J A;  3PG9 A;  3J81 j;  1S10 A;  1KFS A;  3DRS A;  4DX8 H;  5D3G A;  2E5J A;  1FWK A;  3I9Z A;  4HL9 A;  2LEP A;  1HMV A;  3HD2 A;  4EO8 A;  2RS2 A;  1N48 A;  1E6Y B;  2W4C A;  1D9D A;  4CLK A;  1NPK A;  3DLE A;  4CO5 A;  2NXE A;  4DHV A;  3PRB A;  4RW9 B;  1XMQ J;  1U45 A;  4LF6 J;  3PNI A;  3HX9 A;  3RB4 A;  1TV6 B;  2D74 B;  2R7Q A;  3BGR A;  1LXN A;  1WD6 A;  1FDA A;  2WB1 D;  4MTP A;  3TYT A;  4QWD A;  3DRX A;  3K58 A;  3QYY A;  2MQN A;  3W2W B;  4DL4 A;  1FX4 A;  2A0F B;  4GC6 A;  5H9F K;  3MEK A;  5HVH A;  4CM0 A;  1N5T A;  2GNK A;  1CS4 A;  4Q0B A;  3MHY A;  2E1M C;  2OO4 A;  1WOP A;  4WKY A;  2DNK A;  2RKI A;  4NCB A;  1R8B A;  3N5B A;  2ZC3 A;  1V5I B;  2AKW B;  2RDD A;  3QIP A;  2BE9 B;  3DDI A;  3ZNU A;  4AE5 A;  1SJF A;  4IOB A;  1U1P A;  3CED A;  3BSA A;  4F50 A;  2J0Q D;  1S12 A;  3C6T B;  2FVQ A;  3GPA A;  4ED4 A;  4F36 A;  3C15 B;  4YY3 F;  1KON A;  1T8E A;  4FZV A;  1R27 B;  1RU1 A;  5E3P A;  3DMJ A;  1KS2 A;  3LAL A;  2UXB F;  2R7W A;  1FJG F;  5K9F A;  3K5L A;  1WKK A;  1R8C A;  2VFR A;  2EFG A;  1V9O A;  2GX8 A;  4ELV A;  4M5D B;  4IH5 A;  1NDL A;  1UAW A;  3RBE A;  2CZV C;  3BDE A;  1H0H B;  1BUX A;  3GIK A;  1IKY B;  4LF5 F;  2OPS A;  3GWC A;  3M2V A;  3K7R A;  1YTY A;  2NSC A;  2AV5 A;  2HPU A;  2RJZ A;  1KOO A;  1NDC A;  2J8S A;  3I32 A;  4CIO A;  1HWK A;  1HR0 J;  4R0J A;  5KFV A;  4DS4 A;  2CG8 A;  4ZA1 A;  2Z2Y B;  1NDK A;  5IT0 A;  5D0H A;  1S97 A;  4Y3C A;  1K1Q A;  3QFH A;  2FHJ A;  4O3N A;  5LT5 A;  1EAY C;  1OO0 B;  5ETV A;  1WEL A;  2HFN A;  3H8Y A;  2B4O A;  2E5I A;  1HBO B;  3FFI B;  1CS4 B;  2IMW P;  3POT B;  4OJG A;  5IFM A;  3C46 A;  2JVO A;  4JV5 F;  4DN0 A;  2B9W A;  1VCT A;  1FRK A;  4HVZ A;  2J9D A;  5C42 B;  3DRR A;  1NK0 A;  2FJV A;  4CLY A;  3HJF A;  1ITP A;  4PCQ A;  1Q79 A;  2CJQ A;  3M9O B;  1X60 A;  3M2V B;  1S49 A;  2D9P A;  4YS2 A;  4C2M A;  1HPZ A;  1RT5 B;  1SH3 A;  2OSR A;  2FQQ B;  3GON A;  5JXS A;  4LFB J;  4J9K A;  3OFG A;  1IQZ A;  2DR7 A;  3OTE A;  3MMJ A;  1RJJ A;  1HBU B;  4JI4 J;  1XR5 A;  4N8N A;  4FPI A;  1T94 A;  2Q3P A;  3NG8 A;  3CDA A;  1P1L A;  2Z2Z A;  4NLO A;  3NS6 A;  3IAS 9;  4CWB A;  4RBT A;  1RAB B;  4DPW A;  1UKU A;  1Z2L A;  1PCA A;  2XSJ A;  1RHR B;  3R5A A;  4I0W A;  4UTG A;  3KK2 A;  1YI2 S;  4QYZ K;  2AX0 A;  2E1P A;  1WDD A;  2BBE A;  1VBK A;  3PHE A;  4URQ U;  5IM0 A;  2ZH2 A;  3VQT A;  1YVF A;  3OVS A;  2P9C A;  2R7X A;  3PW7 A;  1XMO J;  1I6J A;  1REG X;  5HAT A;  3G6X A;  2DHS A;  4NLV A;  3VAF A;  2AZ1 A;  4UST A;  4G65 A;  3KG1 A;  5DJB A;  2VPZ B;  1NM2 A;  2WTF A;  3AA9 A;  3R97 A;  1D9A A;  1NB7 A;  3NAI A;  5D4P A;  1U26 A;  1WHW A;  1UWA A;  2HZV A;  1U09 A;  1OYD A;  1HNV A;  2IMO A;  2X1G A;  2Z57 B;  3DRP B;  2QA1 A;  5C42 A;  2KHC A;  1HHS A;  2HQF A;  1RT4 A;  3D66 A;  1N88 A;  3SIP B;  4GKK F;  2PSZ A;  4NLU A;  1MG7 A;  3IC1 A;  3POT A;  3J81 U;  1TUV A;  3LO3 A;  4TN2 A;  4CTA A;  3OJU A;  3PIP Q;  2XO7 A;  3E3X A;  2AX1 A;  1SL2 A;  2ZHA A;  2G0J A;  4TU8 A;  3HSG A;  2LYV A;  5D78 A;  2VA3 A;  4C8O A;  3PR4 A;  2OGU A;  2RT3 A;  2VU5 A;  3Q8Y A;  2KG0 A;  3G9C A;  3PCO B;  2YKN A;  3CCM S;  4IUF A;  4JYA J;  2GA7 A;  3BS9 A;  3OXL A;  4WK1 A;  1QE1 A;  4ZPC A;  1VK3 A;  1WC6 A;  3U27 A;  1TL3 B;  1VDH A;  3AXM A;  2YKA A;  2PDA A;  4O0I A;  1RTD A;  2ASY A;  4P2F A;  2V5H G;  4PQU B;  4OYM A;  4OV1 A;  1VR6 A;  2HVD A;  2C3Y A;  1UVI A;  2E9R X;  4NLD A;  4RNO A;  2ZE2 B;  5KFK A;  4R8U B;  2GS8 A;  4QIG A;  3VTI A;  3F56 A;  1N6Q B;  2VFU A;  3HVT B;  5J2Q A;  1JLB A;  2MKC A;  3MTK A;  5KG4 A;  1V3S A;  4FNI A;  3BO3 A;  2FGO A;  5F9N A;  3M8R A;  1PO6 A;  3ZTQ A;  1P27 B;  4RW7 B;  5LMU J;  1QVF R;  2XS7 A;  1FFG B;  3GTY X;  4PXD A;  4JI1 J;  5AT1 B;  3UPF A;  4YQW A;  3M6U A;  2FVC A;  2GGP B;  3HVR A;  4QIW D;  1KLM A;  2J7W A;  3HM9 A;  3RRG A;  4AND A;  4LRF A;  1RUS A;  3DLG A;  3M1V B;  4LBP A;  3ZTO A;  4ZHR A;  2MKH A;  4N5S A;  2VQE F;  2D41 A;  2V4J B;  3K8W A;  2RDJ A;  3CCL S;  3F44 A;  2AYM A;  1NO8 A;  1DQ9 A;  1XBW A;  2RQ4 A;  4DPX A;  2MY7 A;  4ECY A;  1UZH A;  2JJ4 D;  2RSQ A;  3HHE A;  4PPD A;  1TFY A;  4I67 A;  5KAK A;  4DUT A;  2GO8 A;  4OZ2 A;  1AXQ A;  3TQE A;  5RUB A;  1HW8 A;  4MK7 A;  2LMI A;  3DM2 A;  4MIW A;  1XMB A;  2V2V A;  3IM9 A;  1NSQ A;  1S0M A;  2FYX A;  1TR0 A;  2MTL A;  1B99 A;  5DO2 A;  2B5J B;  3NBP B;  4JI7 F;  3UDV A;  1YJT A;  1D09 B;  2HQC A;  2APO A;  2C2D A;  3RAX A;  2JFD A;  4AXJ A;  1E6V A;  1S0V A;  2EFO A;  1N8R T;  3NEK A;  4B9V A;  3HFK A;  4QQB A;  1Q5Y A;  3VAJ A;  3UNY A;  4NYP A;  3KHH A;  5KG5 A;  3IS9 B;  3FRY A;  2OML A;  1PBA A;  2FVR A;  2GVD A;  4F4W A;  2HBY B;  4DZ6 A;  4X66 F;  4DV7 F;  1R0A A;  2BZ2 A;  4LSN B;  1VGY A;  3EDQ B;  1VQY A;  3HCX A;  1B4S A;  1DBD A;  2F1F A;  2MPU A;  1OY6 A;  2UV8 A;  2AW0 A;  2NSB A;  3HSZ A;  2E5H A;  1JB0 C;  1GK8 A;  5DZ6 A;  4ZJL A;  4DCO B;  5KFP A;  1VRT A;  1LV5 A;  1JKH B;  3DNC A;  1JNZ B;  2DYA A;  2XI3 A;  3KHL A;  1S1W B;  1VQO S;  3ITH A;  4EK2 A;  4KHP F;  2HS3 A;  2Y1L B;  5G0R B;  5LSR A;  3G71 S;  3CUL A;  1JWW A;  2ZJR Q;  1S6Q A;  3RRK A;  3WC2 A;  2DJW A;  3SSQ A;  4A8W A;  5BJR A;  2CVI A;  3D7S B;  2ACM A;  3T9N A;  2AWZ A;  2W7O A;  3TAM B;  1YBT A;  4ZJQ A;  2B8Q A;  1DLO B;  2BEF A;  2CKW A;  1YJ9 S;  5BR8 J;  3AY0 A;  3CIM A;  3L4B C;  4NXM F;  1FFS B;  3CGI A;  2IM3 A;  3BPS P;  2NS1 B;  3QLH B;  1YJN S;  3P4U B;  4ER8 A;  5KFF A;  4JV5 J;  3W61 A;  3JTN A;  3M32 A;  4LBH A;  3MCN A;  3P8B B;  4LF8 F;  2LEA A;  2CQH A;  4X2B A;  2AP6 A;  4I6Y A;  5EGY A;  5GVQ A;  4ZCI A;  3J7Z 5;  2G9O A;  1OQ3 A;  1UW4 A;  4WJB A;  4DV5 J;  4ECV A;  3T1H J;  4UF4 A;  1TL1 A;  1D8Y A;  4I6A A;  4PR6 A;  5FD1 A;  5ETO A;  1D1U A;  2VC1 A;  2VA2 A;  4G1I A;  5KFO A;  1OSC A;  4B3O B;  1J27 A;  2AGQ A;  3GB0 A;  1RAJ A;  5F0U A;  4ZVG A;  2I5J B;  2KXN B;  3H25 A;  1Q86 T;  5MAO A;  4JI3 F;  1KFD A;  2K1R B;  2V2K A;  1RHQ B;  3PYF A;  5HAN A;  3OLA A;  4AD6 A;  2FLO A;  3CF5 Q;  3NOG A;  2R8G A;  2GIR A;  2V4Q A;  5M2R A;  1BE4 A;  1FX2 A;  2KB2 A;  1W7W A;  2E1R A;  1YSJ A;  2Y1J A;  1X7V A;  3E01 A;  4YN3 B;  3VGS A;  3R3T A;  4JI4 F;  5J2N B;  2FJB B;  5DET A;  1DJ0 A;  3ITH B;  4Y2A A;  4YP3 A;  3MM8 B;  1WKJ A;  3QQC D;  2R2R A;  3WX4 A;  1Y11 A;  3CMA S;  1U1L A;  3C3L A;  2YKM B;  1OWX A;  2DY9 A;  2POK A;  4TKT A;  4WTY A;  5CXT A;  1VQN S;  2RF2 A;  3EZU A;  5E33 A;  1H3D A;  4DG1 B;  5L1K A;  2FHJ D;  2R2U A;  3VAI A;  3D3B J;  1BQX A;  3ET6 A;  4AUK A;  4ES2 A;  2B6A B;  1GH8 A;  4ZVQ B;  2LA6 A;  1N0V C;  1S57 A;  2CQG A;  2NYH A;  1I3O B;  1VBY A;  3H2U B;  2EFN A;  1UVM A;  3OUY B;  2XSJ B;  4DR2 F;  1X0F A;  1U6F A;  4LT6 A;  3FUY A;  1P1T A;  4FXV A;  1HNW F;  3H42 A;  5A6P A;  4DDF A;  2ZHO A;  1LW2 B;  2F65 A;  1F3V A;  2CJY B;  2JH3 A;  3M30 A;  4OMF G;  1AYE A;  2R8I A;  2V8P A;  4K4Z A;  1Y10 A;  3FBB A;  1RZM A;  3KJV A;  1NAQ A;  1TVR B;  2XQC A;  1C4C A;  3PX0 A;  4F4Y A;  4DFP A;  2LDI A;  4JI7 J;  4FKX A;  1UEK A;  3R6G B;  4RW4 A;  4CTA B;  2MLY A;  1ZZF A;  3MGJ A;  4DLG A;  4NCA A;  1MU2 A;  2MZS A;  3R1H A;  2GC8 A;  2RNE A;  4MAK A;  2GJ2 A;  1ZTW A;  3FKB A;  2ZH8 A;  2BE7 D;  3DLK B;  2B9X A;  3ONQ A;  4LF4 J;  1FRM A;  5DDO C;  3H59 A;  4WFX A;  3US5 A;  4EYH B;  4ID5 B;  3GU0 A;  2HNZ A;  3C14 B;  3Q83 A;  4DL7 A;  2HGN A;  2E5L J;  4I2Q B;  2VPW B;  2RIJ A;  4XO0 A;  3ZZY A;  3KLV A;  2N3L A;  2NZ4 A;  2M3D A;  4OYZ A;  2XMM A;  2PI4 A;  2BE2 A;  4F4A A;  2C28 A;  3EMT A;  3Q8U A;  3H2L A;  4M5H A;  1NK4 A;  2KYX A;  3HD1 A;  4LR9 A;  2XCA A;  2CRL A;  3IBW A;  2E66 A;  4HDG A;  2I38 A;  4FYY B;  4KH1 B;  3MEG B;  5D4L A;  3K5M A;  2R42 A;  1S6P B;  2CPE A;  4RUB A;  3R8Y A;  4NI2 B;  1TK8 A;  1D9F A;  2VZ9 A;  3S1T A;  3BBB A;  4MKV A;  4MKA A;  4XK8 C;  5EX0 A;  4WP3 A;  2LEB A;  3AH6 A;  4ANC A;  2BM0 A;  1UP1 A;  1GNK A;  5ETS A;  3DN9 A;  1O5J A;  2QGF B;  2DB1 A;  4KGX B;  4L75 A;  1QUV A;  3PYG A;  3TNV A;  2HVZ A;  4U7U D;  3RGI A;  4LQ9 A;  2RDI A;  4HT5 A;  2CJ9 A;  2QC3 A;  2GHP A;  2HBR B;  2ZZT A;  4FYV B;  2PFD A;  4DR1 J;  3L09 A;  4X84 A;  5HP1 A;  2V2Z A;  1AB8 A;  1IR2 A;  4QU7 A;  4ZS6 A;  1TP7 A;  1EB0 A;  2GZO A;  2IM2 A;  4UOH A;  3TJ9 A;  4V19 J;  2VB6 A;  4A46 A;  4UT4 A;  1F3F A;  4BHQ A;  3FEY B;  3QGG A;  4LRD A;  3SSR A;  1AZS A;  4K4X A;  4DSF A;  4NA1 A;  5H9E J;  3DHW C;  2CPH A;  2DEJ A;  4LF7 J;  1HI1 A;  2ZBP A;  2RUG A;  2F9J A;  1U1N A;  4DR7 F;  4I69 A;  1WAC A;  3MED B;  1SH0 A;  3PAC A;  4DV1 J;  4E8U A;  1JXL A;  1MMN A;  4ZVP B;  1VQ8 S;  3IA0 A;  2XC9 A;  1XQI A;  3GYG A;  2WW8 A;  3NBP A;  4O3R A;  2HS0 A;  2CNL B;  4UOC A;  5KFL A;  3PDN A;  4DL2 A;  1UMJ A;  3UN5 A;  1G4C A;  5KFN A;  2HHX A;  1KN6 A;  2KG1 A;  3LWL A;  2HVH A;  2DNO A;  1RHU B;  2Y0B B;  3WDO A;  3AT1 B;  1IBK J;  3QRQ A;  4KPY A;  5CA5 A;  3VAH A;  2QTW A;  2YPZ A;  3GFX A;  1Q81 T;  2OEJ A;  3MEE A;  1AUD A;  4EGL A;  4QW9 A;  2P9E A;  5L46 A;  3X1L B;  1BC6 A;  1TMM A;  2YQ1 A;  2JEJ A;  4YEA A;  3K57 A;  2MQM A;  2VG5 A;  2PA8 D;  5B0C A;  4RU2 A;  3HSJ A;  3IAM 9;  1XN9 A;  2L41 A;  4B3T J;  3QGP A;  5I42 A;  2VOD A;  4C0O C;  2W1B A;  3HHL B;  1QM9 A;  3HKW A;  2DRA A;  4ZCL A;  1IVZ A;  4PG5 A;  5D6G A;  3MD3 A;  1KVJ A;  1ELO A;  2A10 A;  3HHL C;  3PJ9 A;  4QPX A;  5LSO A;  1IJE B;  2X3G A;  4DOZ A;  1SJ1 A;  4C3M A;  1K9M T;  1FNX H;  3ZO7 A;  2CJK A;  3OT9 A;  3QT5 A;  5SZT A;  1X4A A;  4LQ3 A;  3Q8P B;  1S1W A;  1HI8 A;  1YZ6 A;  2B7B B;  5A2Q Y;  3EXC X;  3PRV A;  3LF0 A;  4IO9 Q;  3HHD A;  2MB0 B;  4DR6 J;  4CO3 A;  1EP4 B;  3U02 A;  2R9L A;  3CJK A;  1KQK A;  4L3N A;  4NLS A;  1MN9 A;  5F8G A;  2HVI A;  3BR9 A;  2AYE A;  3R5D A;  3VCD A;  2CPI A;  4Q2M A;  4L76 A;  5AXN A;  4ELT A;  4OZ1 A;  1X8D A;  4JI8 J;  2CUY A;  3P49 B;  2PC6 A;  3BO2 A;  2KRB A;  3C8Y A;  3R6L B;  4RW9 A;  4NLX A;  2DIV A;  4ECU A;  1E6Y A;  2B56 A;  3TVK A;  1KHW A;  3QID A;  1OJ4 A;  2K3K A;  4OIX A;  5D3G B;  1A7G E;  4P72 A;  1XJW B;  4EZ6 A;  2F8E X;  3GCW P;  2HAF A;  3M8Y A;  3G86 A;  1B3T A;  5T7L B;  3CW2 C;  1GQE A;  2LU2 A;  2WW4 A;  3AOB A;  3OQ2 A;  5H9F J;  3I5B A;  4C3K A;  5B0B A;  2BJE A;  1CQN A;  2DGV A;  2LCW A;  3BH6 B;  1YHQ S;  1KVI A;  1UEU A;  2CPX A;  1VQ4 S;  3SFG A;  3NS5 A;  1T9V A;  4OI4 A;  3EZO A;  4KYZ A;  2OTJ S;  1AW0 A;  4ZPA A;  3QT6 A;  1HQE B;  1TTH B;  2NUU G;  2ILY A;  4LMZ A;  3ILO A;  3G6Y A;  2O5D A;  1RYS A;  4PAB A;  4M5D A;  2K1R A;  4JI3 J;  1CQM A;  1YJU A;  2EFQ A;  3F73 A;  4LFB F;  1VQK S;  4ERD A;  1RT7 A;  4RW8 A;  3KWM A;  1RE1 B;  4KJI A;  2CXE A;  2BMB A;  4C98 A;  1H98 A;  5K8N A;  2UU9 F;  3N6N A;  3MMA A;  1SJ4 P;  3DMJ B;  3K8V A;  2VC0 A;  1JK9 B;  5EWG A;  5ETR A;  3BSN A;  3CME S;  4ECR A;  1I94 F;  1B7F A;  3RW7 A;  1T0T V;  3OFF A;  4F0M A;  1T9Y A;  3BGL A;  5IC6 B;  4ZVR B;  1TU0 B;  3DU6 A;  3MM9 A;  5LMN J;  4IH7 A;  1VBZ A;  4F3M A;  2GAH C;  5C2C A;  3GCX P;  4DV2 F;  4NZ6 A;  1FNO A;  4OFZ A;  1QAJ A;  3FEX B;  1W26 A;  2MHN A;  4Y28 C;  2VBX A;  2XWY A;  3PYD A;  2HBQ B;  2GQC A;  4ZK7 M;  1WHY A;  1RWP B;  2CYY A;  2YKP A;  3DC2 A;  5KFM A;  2ZM6 F;  2VIH A;  1MWZ A;  2GJF A;  4HI1 A;  4X4V A;  2YNI B;  4QYR A;  4LRB A;  4OZJ A;  4XAK A;  4OHZ A;  1HNI B;  4O44 B;  4AL6 A;  1GXL A;  5AJ3 F;  1HWI A;  2BR0 A;  1U47 A;  4HKQ A;  3IFE A;  2HRU A;  2CQ3 A;  1WSV A;  1WWH A;  1JLA A;  3BF4 A;  4YB1 P;  1HR0 F;  4FBU A;  4FF2 A;  4JI6 J;  4QCL A;  4LF6 F;  2MZ1 A;  1RTI B;  2HNY B;  4CH1 A;  2J6S A;  2M7S A;  5KFE A;  1C1B B;  2VQE J;  2RS8 A;  4DQR A;  3Q24 A;  2E5G A;  2U2F A;  4CLL A;  1FKP A;  4HTI A;  2ABY A;  1T03 A;  3H5X A;  3I6P A;  4NCG A;  2CNO B;  1VIX A;  1JLQ B;  1NND A;  2DNM A;  4NXN F;  5J2M A;  4OV6 A;  4A8Y A;  1UFL A;  2ZD1 B;  1RWV B;  2WRM A;  4UOG A;  1IBM F;  3VGU A;  1WC0 A;  2HFZ A;  1YJV A;  1X5T A;  3FGV A;  1H7X A;  3LAN A;  2YNH A;  2DR6 A;  5FII A;  4LSL A;  3D0G E;  2JVR A;  5J1E B;  4KGV B;  3D0H E;  3SCJ E;  3S6E A;  3H90 A;  4ALZ A;  3DI6 A;  3QNW B;  1VQ7 S;  2DNY A;  2NUH A;  3MMB A;  3THV A;  2NXU A;  3K17 A;  3MR7 A;  1R7I A;  2ZIT A;  2AU0 A;  1HNZ F;  4DWI A;  1RTJ A;  1TKZ A;  5DQG A;  4KTQ A;  3CNQ P;  3RRH A;  2WOM B;  2R7T A;  5HQL A;  3TZX A;  2KHD A;  3BN4 A;  3OR1 A;  2IIH A;  1N5S A;  1SC1 B;  2OFG X;  5IOL A;  4UUW A;  5D4O A;  4JP8 A;  5LXY A;  3BRE A;  1NH7 A;  4B9U A;  1NPP A;  1U6Z A;  4I4B A;  3P5T L;  1S1X A;  4BBY A;  1FXR A;  1FK9 B;  4WU2 A;  4F3Q A;  5DS7 A;  3CO9 A;  3A3O B;  4RL1 A;  3SEO A;  3DOL B;  1S1T B;  3KFW X;  4M5I A;  5A8W A;  1TUW A;  2C42 A;  5HP1 B;  3G2X A;  4F2S A;  3GFH A;  2EG2 A;  3KOA A;  3I4H X;  4DV5 F;  2H5J B;  3T1H F;  1R3N A;  4O4G A;  4EI2 A;  2VON A;  1D3W A;  1P6T A;  4YR0 A;  4N76 A;  2HNY A;  3CJ0 A;  2DGS A;  4GKK J;  3Q2S C;  5ETQ A;  5JVG Q;  1HWL A;  4HDH A;  3R1L A;  1U1R A;  1PG5 B;  2HZA A;  4C8M A;  3T1Y F;  1ZET A;  2HIY A;  2VPY B;  4H4K A;  1X4E A;  3J80 U;  3BQ1 A;  4FYD A;  1PC4 A;  4ED1 A;  2EK6 A;  2QL9 B;  4NML A;  5J2M B;  1G6B A;  1LNQ A;  2WVF A;  3MMB B;  5HMY A;  3CCU S;  2G1H A;  1WOR A;  1RT2 A;  2OP5 A;  2BAN B;  3VGT A;  4NLW A;  1TV6 A;  3BGR B;  1ZPW X;  3H0P A;  4CDI A;  2DIT A;  3MED A;  1TK0 A;  4LUB A;  1JLF A;  4E98 A;  1KNZ A;  1UVN A;  5CYQ A;  3DRY A;  3N28 A;  3PFO A;  2V2Q A;  3S8S A;  2HRY A;  1SUQ B;  3A13 A;  4MK8 A;  4QZV B;  2RKI B;  3SXL A;  4JI0 F;  1N5Y B;  2OLW A;  4OYX A;  4ZP8 A;  1MRO A;  1UWB B;  2OPP A;  3V6D B;  3VAK A;  1C0T B;  3DLB A;  2IBK A;  4IRC A;  1URN A;  3PW5 A;  5LJ3 Y;  1RDR A;  3GP9 A;  1JJC B;  2EW9 A;  2HFV A;  1X4H A;  4OI1 A;  3R7S B;  3TWZ A;  3NCR A;  3HPO A;  1MU2 B;  4KH0 B;  1FJ7 A;  4DL5 A;  4Y00 A;  1WG1 A;  4OZ5 A;  4TU9 A;  3FC9 A;  1RYR A;  1X9M A;  3DXS X;  3UCZ P;  3BDP A;  5J2P B;  1Y3K A;  2V63 A;  2XI2 A;  2DGO A;  2F5G A;  2LP4 A;  3PM9 A;  2JDJ A;  2RML A;  3CXC R;  3TZY A;  1RWU A;  3OVB A;  2X1F A;  2XWX A;  1A6L A;  3A4T A;  2QV6 A;  1IKW A;  5E41 A;  1IKV A;  3HI9 A;  3QFW A;  3PXG a;  3RBX A;  3BQ2 A;  4DPT A;  4HT7 A;  2P2C B;  3TQ1 A;  2HVE A;  2C2N A;  3K89 A;  2Q1L A;  2QA4 S;  3EVW A;  3P6Y C;  3TA1 A;  2R7R A;  1DTQ B;  3HZE A;  1R6Y A;  2A2C A;  4K2X A;  3TUJ C;  1GMV A;  3W8G A;  1PAE X;  2W2P P;  3NWG A;  2QFI A;  4YDD B;  1XC9 A;  3W8P A;  1WI8 A;  4DUZ F;  1YBU A;  5CQG A;  2MZR A;  4G3I A;  3HMJ G;  1VIO A;  2F8M A;  3HHK A;  3O44 A;  4DR7 J;  3MAA A;  1M5V C;  2DH9 A;  3TEH B;  4OX9 J;  4ICL B;  2BJ8 A;  1T05 B;  1TFW A;  2OIH A;  5F8J A;  3CD6 S;  3D6F B;  4J90 A;  2J5A A;  1EP4 A;  2HS4 A;  3R7B B;  2OPR A;  3J7Z T;  1QY7 A;  2YX1 A;  3JAM Y;  2AHO B;  3MF5 A;  1NJY A;  1RAA B;  2DNH A;  5BXI A;  2FB0 A;  3WIV A;  1XNQ F;  4ZLN A;  3QSY B;  2NYI A;  3IRW P;  1N36 F; 
#chains in the Genus database with same CATH homology
 4UOG A;  4S0M A;  2DXF A;  2HUR A;  3VGU A;  3DKD A;  4FKY A;  3EE3 A;  3L7U A;  1HIY A;  3VGV A;  4KPC A;  3B54 A;  3R9L A;  3DDI A;  1BE4 A;  1W7W A;  1UCN A;  2HVD A;  3VGS A;  3GPA A;  4W98 A;  2DXE A;  4F36 A;  1WKJ A;  2B8P A;  1KDN A;  2DY9 A;  1NDP A;  3Q8V A;  3ZTQ A;  5IOL A;  3PJ9 A;  3EJM A;  1WKK A;  1S57 A;  1WKL A;  4CP5 A;  3NGS A;  3EVM A;  1NDL A;  1LEO A;  3PRV A;  1BUX A;  4AND A;  3Q86 A;  3ZTO A;  3G2X A;  4WBF A;  1MN9 A;  1NSK L;  1NDC A;  1NHK L;  3BBF A;  3BBC A;  3FBB A;  3WX8 A;  1NDK A;  4DUT A;  3FBE A;  4FKX A;  1XIQ A;  2AZ3 A;  1NSQ A;  1BHN A;  1F6T A;  1B99 A;  3FKB A;  5C7P A;  3ENA A;  3VVU A;  4O0N A;  3VGT A;  3FCW A;  1EHW A;  3Q89 A;  3BH6 B;  1LWX A;  3Q83 A;  4HR2 A;  1HHQ A;  2ZUA A;  4ANE A;  3ZTS A;  3FCV A;  3FBF A;  3ZTP A;  4F4A A;  1K44 A;  3EMT A;  4DZ6 A;  3Q8U A;  3NGR A;  1HLW A;  1S5Z A;  3GP9 A;  1B4S A;  3ZTR A;  3BH7 B;  1U8W A;  4ENO A;  3EM1 A;  3FC9 A;  2DYA A;  1ZS6 A;  3BBB A;  4EK2 A;  3MPD A;  4ANC A;  1S59 A;  2CWK A;  3NGT A;  1PKU A;  1NSP A;  3ELH A;  2AZ1 A;  3NGU A;  2B8Q A;  2BEF A;  2BX6 A;  2HVE A;  3VVT A;  4C6A A;  3EVW A;  1NB2 A;  3EVO A;  3FBC A;  1NLK L;  3ETM A;  2NCK L;  1PAE X;  1NCL A;  4UOH A;  1JXV A;  1F3F A;  5CAA A;  3B6B A;  1NUE A;  1VYA A;  1NPK A;  4UOF A;  5CAB A;  3EIC A;  3JS9 A;  4DI6 A;  1XQI A;  5BXI A;  2VU5 A;  3Q8Y A;  1MN7 A;  2DXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...