2DYRE

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Structures and physiological roles of 13 integral lipids of bovine heart cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 41
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2006-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2dyrE00
3ABKE 2EILE 2DYSE 2EIJE 2Y69E 2DYRE 3AG2E 1V55E 2EIKE 1V54E 1OCCE 2EIME 2EINE 5B1AE 3ABME 5B3SE 3AG4E 5B1BE 3ABLE 3ASNE 1OCRE 3WG7E 2OCCE 3AG3E 5IY5E 3X2QE 1OCZE 3AG1E 3ASOE 1OCOE 2ZXWE
chains in the Genus database with same CATH superfamily
2GW1A 3AU5A 2LAHA 4GYWA 3V79K 4HFGA 4BWRA 3KEAA 3CV0A 1E7VA 3UXGA 2ONDA 3ABLE 5BV0A 4ZHBA 3TAXA 5FWQA 2FI7A 5KJLA 2BKGA 1HF8A 2WQ7A 3ASFA 3D9PA 3DWLG 2FO1E 1TNBA 2V4LA 3BG1B 3OXLA 1KZPA 2MHKA 1SA4A 4FU3A 2C0LA 3PVLA 4AOFA 2P9KG 2WXKA 2XEHA 4MBGA 3LY9A 3LVQE 1OWOA 3HVEA 4L2LA 2GRRB 3DSSA 5JHBA 3UT8A 3CKCA 1D8DA 4BETA 3B7SA 2QY7A 1RZ4A 3SI5A 2WXIA 1MHQA 1TN7A 4N2SA 2XEEA 4HORA 2GRNB 2ZGDA 3PREA 3GZ1A 1O1RA 2Y4UA 3CVXA 3PDNA 5C2YA 1TNYA 4N5CA 4U8YD 4JHRA 3CQGB 4CGWA 2WXRA 3HYMB 4HOUA 2AW6A 4CT4A 3FUKA 4ILGA 2XRZA 1EF1C 1U3CA 3FTYA 1X81A 2V0PA 4WNEA 3ISMC 4JW1A 2X6KA 4HLLA 2I6HA 3FU3A 3CHRA 4HVBA 1OWMA 1SW6A 2IO3C 5LCWJ 2WXMA 3CVQA 2NC9A 5BUZA 4OVUA 4TRQA 1XGWA 1NL4A 3HXBA 4U0ZA 3UKRG 5B1BE 2IOLA 2WXPA 3Q78A 1SA5A 1N11A 3D3MA 4GYYA 3RO2A 3V2XA 2XQ0A 1MQSA 2WM9A 3Q5MA 4Z68A 4N3AA 2J8SD 4BTBA 2UY1B 1DC2A 1DCQA 2CHWA 3CGHA 3EU9A 3IXEA 3LPZA 2ILRA 3W9GA 1H6KA 1QQEA 5AJLA 3T5XA 4AY5A 1NI1A 3TJPA 3FUHA 5E75A 3AS8A 4M7CA 5E76A 2L0TB 3R7QA 2HE0A 1OCCE 2EINE 4LNGA 5BT1A 2BKKB 5AAOA 2HO1A 1Y8MA 1BLXB 3FTZA 3ZU7B 3IHYA 4JPSA 3MGBA 3ZYMA 3HRAA 2CFZA 5G2NA 4YDOA 3E34A 5AQ9A 4IULA 2ZU6B 3SFXA 2KATA 1HG5A 2AXUA 1KZOA 4HOSA 2FEZA 3S7DA 2P58C 4GB9A 4TUUA 3AG1E 3LVRE 1E90A 3FTVA 1OWNA 4HS2A 3FTWA 2VSOE 4I2WA 1OWLA 5DIZA 1OUVA 1TN8A 1TJCA 2H6HA 3ESKA 4DUIA 3I5PA 4DPRA 1EYHA 2KCKA 3UUXA 2XEVA 4B8CB 2OVFA 5C1DA 3PEVB 3JUEA 4ATZD 2V8SE 1KT1A 4KZCA 5D66A 4ANUA 3MKQB 2ZXWE 3TWUA 3U9WA 3TWRA 3EDTB 3ZW3A 3O4ZA 2QZAA 3RU0A 5JA4D 1JUQA 2X6HA 4FHKA 1QNFA 4A63B 5G55A 2J09A 4C0MA 1A17A 4KZ0A 2XGSA 2VQ2A 3C3QA 1OY3D 4F1SA 2OV8A 3KS2A 3UMVA 3Q47B 3TGOA 3FU6A 3L13A 5ENOD 2PL2A 3LKUA 3VTYA 5CMYA 4BEPA 5KWDA 4FADA 4AIFA 5JMND 4CDNA 3ZKJA 4EZJA 2AXVA 3IV0A 3WXXA 3RJVA 3AS4A 3G2VA 5T4YA 4TXRA 3RRNB 3U64A 2HYZA 4TUMA 1HO8A 4J8FA 3FUDA 3T8MA 4FP7A 5T8IA 3RK6A 1YA0A 3MV3B 1MX2A 5AQAA 3MCXA 5AJDA 1TR4A 2WQHA 3ESLA 5CRVA 5BNWA 2H6IA 2AVPA 3L16A 3PE4A 3KEZA 4NACA 4BSXA 1OCOE 3B7BA 3S7BA 1WG0A 1NA3A 4BY6A 3S2AA 3ZXSA 4YVQC 4E6HA 3FULA 2FBNA 2P2CP 3LYAA 2NXPA 1IKND 3ULEG 3BU8A 3G2TA 4N5QA 3QAQA 1S64A 1K8KG 2RKKA 4YVOA 3JYSA 4I2ZA 4B94A 3PUJA 2BF0X 2RFMA 1HS6A 4EQFA 1FCHA 1QYMA 4ATGA 2ETAA 2FO7A 4U8VD 4H7XA 3AAAC 1YYHA 4K5AB 3TG4A 4DX6D 2WMNA 4LUNU 3CHSA 4LSZE 4TXQA 4KBQA 3ZRHA 4GA1A 1FPPA 2YHCA 3IKOB 2VSYA 2LSVA 4I9CA 4I1MA 1HH8A 3B7RL 3UKUG 4FC8A 1H2VC 5HQ8A 3L82A 3PEUB 4AEZC 5EYPF 4OAUC 1E8YA 4FJYA 3ZYKA 3CSFA 4A1SA 2DIWA 3TWVA 4NQ0A 2I9CA 3DSTA 4CZ2D 3QWWA 1HFAA 1KT0A 3HXEA 2LAIA 2XGMA 3TG5A 1PY1A 3TXMA 1BPOA 4U96D 3OXGA 5T3RA 4DLQA 2J4DA 4RQIA 2LSUA 1YCSB 3BQOA 4UWGA 1K3ZD 1Z6TA 2HR2A 3P2BA 2UY1A 5D0OD 5JJTA 4E85A 4FJZA 4D10C 4K5BA 5M72A 4K03A 1IXVA 2PM7A 1H0AA 2WB2A 1WY6A 5A6CA 2Y4TA 3ENEA 5G04C 4F53A 3ONKA 2GRMA 3R9AB 2WVIA 3ZHEB 2RFAA 3B13A 3LJNA 3NAWA 4I9EA 4KT6B 4C48B 5ENTD 3TWSA 2MOWA 4JA9A 1V55E 3KD7A 5A23A 3UX4A 5D2MC 5BXUA 4JC8A 4Q96A 3SNXA 4IRUA 4GTPA 4GZCA 2H6GA 1UG3A 3JUIA 1O1TA 1N94A 1IYGA 2RG8A 1LTXA 1ELKA 1ZU2A 4LEUA 4YNDA 3APDA 1UW4B 4BT9A 5CCLA 2R59A 3PRZA 4O60A 3ZPJA 3FWVA 2P9LG 1FVFA 3DXMG 3TWWA 2X3MA 3U3WA 3B95A 3AG3E 4C0EA 3EHRA 3NZSA 5D0QD 5EN5D 2Y69E 5EIDA 1IHGA 2CHZA 3FHEA 4C9BB 2XRYA 3FUJA 4U07A 3CHQA 3G2WA 2ZISA 4PS8A 2OOEA 2DVWA 3AU4A 3LJ3A 3ML8A 3ZGQA 2IJGX 4PS7A 4DJAA 3QB2A 2LUHA 2WXLA 3UTMA 4YDWA 3RSEG 3D9OA 4B89A 2XZTG 4UWKA 4UQYA 2XENA 3VLEA 3DSWA 1PAQA 2PZIA 2I2OA 4JA7A 3NQPA 3CVUA 2CHXA 3UT7A 5BW8C 3Q7AA 4G23A 3FFLA 4PH4B 2PQRA 4H7YA 4PDXA 2DCPA 4F1PA 4FA6A 4X8QA 4GTQA 4XKCA 4GZ6A 5HI7A 4ACKA 1N4QA 5LOZA 4JZYA 2RD0A 3J5QB 1A5EA 2WXQA 4TV3A 2IY0C 3NF1A 4LG6A 3ML9A 4ANWA 2WPVA 4WWPA 5ENPD 2EIKE 3QWPA 2XPZA 4U7EB 2NSZA 3S7FA 3QDNA 3SHFA 3FTXA 1NZNA 5FZQA 2VGXA 5CBOA 3TXNA 5KNGA 4BX9A 3T9KA 4JD2G 3EJNA 2IFUA 4I1AA 3LY7A 3UM2A 3EUVA 3ZEFA 2BUGA 3DSVA 4TXPA 4I6GA 4BT8A 1S70B 2A5EA 4A3TA 2L0IA 2XCBA 4WAFA 2VSXE 2QYJA 1S63A 3CVLA 2KC7A 1EDUA 3AG4E 1D8EA 3VTXA 3B7UX 4ZFHA 5ENSD 5G05C 3CQCB 4K5CA 3Q79A 1HXIA 4J0UA 3C72A 3FEXA 3EHQA 2KCVA 3D9JA 2IO2C 2QYUA 2XHEA 2YHEA 5AQ7A 4WNGA 3JXJA 3VLDA 4J6IA 1L5JA 4KYOB 2DBAA 4CEMA 3Q49B 1BI8B 4BSZB 1IQUA 4JXTA 4G2VA 3CHPA 4KMOA 3N71A 3L17A 2P9PG 3ASHA 1TN6A 5FINA 3PE3A 4B8AA 4B0ZA 2KZTB 4L7TA 1OCZE 3DPDA 3G2SA 4M3OA 3TWXA 2NYJA 3FUFA 4HI8A 4A3VA 3W9FA 3Q9UC 2BTDA 4JL0A 2XCCA 1H19A 3PZ2A 4HB5A 3HHMA 1U2VG 4ACLA 4AP2A 5IY5E 3X2QE 2FF4A 3E33A 2EIJE 3SBSA 1INZA 1N0QA 1MX4A 3SO8A 3TWQA 3E32A 4KVOA 3QOUA 2GRQB 4HQDA 4LNUD 3MX3A 4EZKA 4ANVA 2XGOA 1OWPA 3QKYA 2EQXA 4HRNA 3BG0B 3UM3A 3U4TA 1ELRA 5FQ6A 3C98A 3IBEA 3APCA 1D9SA 3DEPA 4U95D 1FT2A 1MJ0A 3CIAA 5ITZF 3V30A 3V31A 3CVYA 1UJJA 4I17A 3D9NA 3NBNB 2IEJA 2J9QA 4WWOA 4GZDA 4AM9A 1IHBA 1N4SA 2E2EA 3C3RA 1AP7A 4WNFA 5EIBE 2GRPB 5KCMA 3LDZA 4HOTA 3UI2A 4A55A 3U66A 4CDRA 4GTOA 4DX1A 4UUCA 3CSTA 3RKVA 3ZIMA 1FT1A 3ULYA 4JVSA 4GTVA 3EU5A 3ZN3A 5HS0A 3SFYA 4F7AA 3PZ1A 3CK7A 3GYZA 2L9BA 1Z5SC 3CLJA 2XZDG 3ASOE 3E30A 4ILHB 4RVBA 1UJKA 3VLFA 1UN9A 1NP7A 1SVXA 2I1KA 2R5SA 3L54A 3PS6A 2X6JA 3Q75A 5EX0A 3MA5A 4GA0A 4J8EA 4I6EA 4RG6A 5ENRD 2GRLA 3AG2E 3FH8A 2FULA 4FLHA 3P1UA 1TNZA 2ETCA 3OXFA 5J08A 1Z3XA 4UQZA 2QFCA 2GGFA 2WQ6A 4BESA 4DX5D 2YINA 4K0RA 2C2LA 2J07A 3LS8A 4QQIA 4GAAA 5ENNA 1HE8A 4N2QA 1AWCB 3ASDA 4FLBA 3LXUX 3R7RA 3ZUVB 1OCRE 3F6QA 2LXLA 3GZSA 3FH7A 4G11A 4JHKA 3ZYQA 2WXNA 1QBQA 3SGHA 2DYRE 4HRMB 5EYLA 4ILIA 1ZBPA 1YMPA 5FZRA 3ABME 3CKBA 4UI9K 4NIKA 3BUAA 3T8KA 4DLOA 3Q9NC 2KM4A 4HBDA 3FTUA 1Q2ZA 5CEAA 1N54A 3HDXA 4CYMD 1WDYA 4DI4A 2R05A 4GYOA 4DRXE 2X6IA 3ASGA 4EPZA 4FHJA 4MS6A 4QFVA 1UN8A 1N9AA 1PC2A 3FTSA 3GZ2A 2PNNA 4HI9A 4RLYA 3ZVVA 3FUEA 3SQVA 3HG0D 3S7JA 1GW6A 3L9TA 3MEKA 4EBAG 2J49A 3KSLA 3G2UA 1S0PA 3Q15A 4GCOA 5CCMA 3JQ1A 1K1BA 5AN8A 1H6OA 2IQCA 2Y3AA 4N39A 2KZTA 3L08A 4V3IA 4L1BA 2R03A 5G05J 5JJ7A 3NOGD 4DK5A 4J8DA 4GU5A 2P9IG 4L23A 4J8SA 5ARFA 2AXZA 5FZSA 4L2YA 4HRLA 3SFZA 2V5QC 3RO3A 5AQBA 3MKQA 3C3OA 4GMJA 1G3NB 4EECA 3CK9A 4A1GA 4DX2A 5AENA 1X5BA 2J4BA 3CVVA 4GTMA 1OXJA 2QC9A 1DCEA 2VTBB 4WUYA 5AIJA 4G26A 3L22A 1LD7A 3K9IA 2F8XK 4N3CA 3MV2B 3UT4A 4UWFA 3FUNA 1KLXA 3DRAA 5EX3A 5KNHD 2Q7FA 3FU0A 5B3SE 1WAO1 4AXHA 4GTSA 3NB2A 4LCTA 2AWIA 1NFIE 3AJIA 1FVHA 3CEQA 5KJMA 3I3NA 5KJNA 2ZGGA 3KSQA 3JQ0A 2P9NG 3C5RA 2F37A 4OAVB 5FQ4A 4P29A 5CBNA 4UI9C 2H6FA 3CVNA 3NZUA 2M63A 2PQNA 4GZ5A 2V5FA 4HOQA 5FQ7A 3UM0A 4EBAA 2I1JA 4MLPA 5J90A 4ME2A 2ETBA 4RSYA 3ZNGA 2DZOA 3ASNE 1N4PA 1O1SA 3BEEA 3FY4A 5JHAA 5CMWA 3B7TA 3PH0C 4WNDA 2YNQA 1H2UA 4BTAA 1Z3YA 2OEVA 2MYOA 5JJ6A 3PUKA 3HXCA 4MKTA 2XPIA 4DX7D 2CG3A 2IF4A 2LO6A 3EIJA 4G24A 4GMLA 2GROB 4UQXA 3ZFWA 3CHOA 1E96B 4UWHA 2B0OE 4O1OA 3HXDA 3CR3A 4URKA 2OCCE 1MZCA 5FTPA 1MX6A 4JEUA 3UQ3A 1IQRA 1B89A 4PS3A 1NA0A 2KXPC 2EIME 2HM8A 1OT8A 1JCSA 4L9PA 2XS8A 3T5VA 1UOHA 3FUIA 3DPYA 3QARA 2R17C 2R2LA 3IEGA 3D9HA 2CFUA 2KBXA 3UIPC 2EILE 3EHMA 2OVBA 4CGVA 1LD8A 1BI7B 3KAEA 1E8ZA 4JB8P 4BX8A 4U63A 3URZA 4OYSA 4J7WA 1E8XA 3LCAA 4EZLA 3CVPA 4I43A 2WXFA 4GTRA 4MRUA 4UWLA 1SQMA 5AYWD 3I4RB 4R7LA 3DBSA 1ZB1A 3DSUA 5LX8A 3RRMB 5CHEE 4WWNA 2AJAA 4BERA 4G25A 4Y6CA 1TJFA 1LF8A 4Q69A 1H2TC 3ULQA 2DYSE 2JLBA 3E37A 4ANXA 3NOCD 5ARGA 2MRIA 5CRUA 2XPYA 4DI3A 3MKRA 4HNAD 4O1PA 3UIOC 3QNKA 3ZHEA 4XI9A 5KJKA 2VGYA 5FIOA 2VJ8A 4O6FA 1MYOA 2UWJG 3D9LA 3ABKE 3UPVA 1TEZA 1TNUA 1BU9A 3E4BA 3ZXPA 4RG9A 4U0SA 1EPUA 1SZ9A 3LY8A 4G8KA 5BPPA 5HKPA 4IYPA 1RW2A 2BEDA 3J5PA 4GTTA 3FDHA 3DEOA 2CG2A 3CHMA 3CK8A 3D9IA 4APOA 5FJYA 2Y0BG 2WXGA 4B93B 4I6JA 1N52A 3HVEB 4GMRA 4PUCA 5G04J 3RAUA 2WXHA 5LCWC 1Y6IA 5EKQD 1JWFA 1H6PA 1N4RA 2KCLA 5DBKA 4LRZA 4BFRA 3PNTB 3OTNA 2V4HC 3SF4A 4U8HA 4JHJA 4CRWA 2B6CA 4APFA 1BD8A 4KVMA 4F6RD 4CT0A 4LERA 3EIQC 3PZ4A 4HLEA 1ELWA 2VTBA 3L6AA 2VGEA 3O48A 5AARA 2VYIA 2DZNA 3Q4AB 5CERB 3JXIA 1V54E 4OVVA 2VSNA 3EHNA 3AS5A 1SZAA 4G1TA 4XEIG 4XI0A 2X38A 3DXKG 2A5UA 2VGXB 2J08A 4XKBA 3PZ3A 3HXFA 5HRYA 5H7PA 1DVPA 5ENQD 4XX5A 2LXMA 4YDEA 3QJZA 4GCNA 4N3BA 2JEKA 1W3BA 3LEWA 3OAWA 1TNOA 2JABA 2OEWA 3TL5A 4CDMA 1XNFA 3I4GA 3MYVA 5BV1A 4Y6WA 3ONLA 1HU3A 1JCRA 3ZYLA 4AY6A 3JCKC 1U3DA 1QZ2A 5KBAA 3QWVA 2PM6A 2WXJA 3CVWA 4EHMA 3GW4A 4HXIA 3V2OA 1K1AA 2LNIA 3UINC 1N95A 2P9SG 2L6BA 3Q7FA 3FH5A 3D9KA 1HG2A 5CECB 4GPKA 4AJWA 3DSXA 4U04A 2IOSA 5BXOA 3SY2A 5ANLA 3RIBA 2IU1A 2A4ZA 3FUMA 3APFA 4NRHB 4UI9J 1TYQG 3SD5A 4XZ4A 3QK0A 5A7DB 5EDSA 4FULA 1JPLA 4J8YA 2E0IA 4ABNA 4GA2A 4IN3B 2C0MA 4XIFA 2YQ8A 4GPMA 3HIZA 3Q73A 3R9MA 4AV7A 2Y1LE 5LP0A 4G8LA 1KPSB 3MJWA 3UM1A 4XE0A 5EILA 5FQ8A 3FEYA 2WMOA 4JEHA 3IHVA 4LNBA 3QC1A 2X6FA 1DNPA 3FU5A 3TWTA 5CEDB 1O5MA 4NURA 4CCAA 4F3VA 1E7UA 1VDYA 3SBTB 3PZDA 1JCQA 4YDYA 1JWGA 2L6JA 4AVXA 2R02A 3D9MA 4I1OB 3PNLB 3MZLB 5ANRA 1HZ4A 2WXOA 1E8WA 4GZ3A 2P9UG 1N0RA 1HX8A 2IONA 1P5QA 5FT9A 2F8YA 3SZ7A 2F0YA 2ZIRA 4U0UA 5B1AE 4Q94A 3FP3A 1WM5A 5LFAA 2XS1A 2DWZA 3WG7E 3RRUA 4W9RA 4KXKB
chains in the Genus database with same CATH topology
3ABKE 2EILE 2DYSE 2EIJE 2Y69E 2DYRE 3AG2E 1V55E 2EIKE 1V54E 1OCCE 2EIME 2EINE 5B1AE 3ABME 5B3SE 3AG4E 5B1BE 3ABLE 3ASNE 1OCRE 3WG7E 2OCCE 3AG3E 5IY5E 3X2QE 1OCZE 3AG1E 3ASOE 1OCOE 2ZXWE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABK E;  2EIL E;  2DYS E;  2EIJ E;  2Y69 E;  2DYR E;  3AG2 E;  1V55 E;  2EIK E;  1V54 E;  1OCC E;  2EIM E;  2EIN E;  5B1A E;  3ABM E;  5B3S E;  3AG4 E;  5B1B E;  3ABL E;  3ASN E;  1OCR E;  3WG7 E;  2OCC E;  3AG3 E;  5IY5 E;  3X2Q E;  1OCZ E;  3AG1 E;  3ASO E;  1OCO E;  2ZXW E; 
#chains in the Genus database with same CATH topology
 2GW1 A;  3AU5 A;  2LAH A;  4GYW A;  3V79 K;  4HFG A;  4BWR A;  3KEA A;  3CV0 A;  1E7V A;  3UXG A;  2OND A;  3ABL E;  5BV0 A;  4ZHB A;  3TAX A;  5FWQ A;  2FI7 A;  5KJL A;  2BKG A;  1HF8 A;  2WQ7 A;  3ASF A;  3D9P A;  3DWL G;  2FO1 E;  1TNB A;  2V4L A;  3BG1 B;  3OXL A;  1KZP A;  2MHK A;  1SA4 A;  4FU3 A;  2C0L A;  3PVL A;  4AOF A;  2P9K G;  2WXK A;  2XEH A;  4MBG A;  3LY9 A;  3LVQ E;  1OWO A;  3HVE A;  4L2L A;  2GRR B;  3DSS A;  5JHB A;  3UT8 A;  3CKC A;  1D8D A;  4BET A;  3B7S A;  2QY7 A;  1RZ4 A;  3SI5 A;  2WXI A;  1MHQ A;  1TN7 A;  4N2S A;  2XEE A;  4HOR A;  2GRN B;  2ZGD A;  3PRE A;  3GZ1 A;  1O1R A;  2Y4U A;  3CVX A;  3PDN A;  5C2Y A;  1TNY A;  4N5C A;  4U8Y D;  4JHR A;  3CQG B;  4CGW A;  2WXR A;  3HYM B;  4HOU A;  2AW6 A;  4CT4 A;  3FUK A;  4ILG A;  2XRZ A;  1EF1 C;  1U3C A;  3FTY A;  1X81 A;  2V0P A;  4WNE A;  3ISM C;  4JW1 A;  2X6K A;  4HLL A;  2I6H A;  3FU3 A;  3CHR A;  4HVB A;  1OWM A;  1SW6 A;  2IO3 C;  5LCW J;  2WXM A;  3CVQ A;  2NC9 A;  5BUZ A;  4OVU A;  4TRQ A;  1XGW A;  1NL4 A;  3HXB A;  4U0Z A;  3UKR G;  5B1B E;  2IOL A;  2WXP A;  3Q78 A;  1SA5 A;  1N11 A;  3D3M A;  4GYY A;  3RO2 A;  3V2X A;  2XQ0 A;  1MQS A;  2WM9 A;  3Q5M A;  4Z68 A;  4N3A A;  2J8S D;  4BTB A;  2UY1 B;  1DC2 A;  1DCQ A;  2CHW A;  3CGH A;  3EU9 A;  3IXE A;  3LPZ A;  2ILR A;  3W9G A;  1H6K A;  1QQE A;  5AJL A;  3T5X A;  4AY5 A;  1NI1 A;  3TJP A;  3FUH A;  5E75 A;  3AS8 A;  4M7C A;  5E76 A;  2L0T B;  3R7Q A;  2HE0 A;  1OCC E;  2EIN E;  4LNG A;  5BT1 A;  2BKK B;  5AAO A;  2HO1 A;  1Y8M A;  1BLX B;  3FTZ A;  3ZU7 B;  3IHY A;  4JPS A;  3MGB A;  3ZYM A;  3HRA A;  2CFZ A;  5G2N A;  4YDO A;  3E34 A;  5AQ9 A;  4IUL A;  2ZU6 B;  3SFX A;  2KAT A;  1HG5 A;  2AXU A;  1KZO A;  4HOS A;  2FEZ A;  3S7D A;  2P58 C;  4GB9 A;  4TUU A;  3AG1 E;  3LVR E;  1E90 A;  3FTV A;  1OWN A;  4HS2 A;  3FTW A;  2VSO E;  4I2W A;  1OWL A;  5DIZ A;  1OUV A;  1TN8 A;  1TJC A;  2H6H A;  3ESK A;  4DUI A;  3I5P A;  4DPR A;  1EYH A;  2KCK A;  3UUX A;  2XEV A;  4B8C B;  2OVF A;  5C1D A;  3PEV B;  3JUE A;  4ATZ D;  2V8S E;  1KT1 A;  4KZC A;  5D66 A;  4ANU A;  3MKQ B;  2ZXW E;  3TWU A;  3U9W A;  3TWR A;  3EDT B;  3ZW3 A;  3O4Z A;  2QZA A;  3RU0 A;  5JA4 D;  1JUQ A;  2X6H A;  4FHK A;  1QNF A;  4A63 B;  5G55 A;  2J09 A;  4C0M A;  1A17 A;  4KZ0 A;  2XGS A;  2VQ2 A;  3C3Q A;  1OY3 D;  4F1S A;  2OV8 A;  3KS2 A;  3UMV A;  3Q47 B;  3TGO A;  3FU6 A;  3L13 A;  5ENO D;  2PL2 A;  3LKU A;  3VTY A;  5CMY A;  4BEP A;  5KWD A;  4FAD A;  4AIF A;  5JMN D;  4CDN A;  3ZKJ A;  4EZJ A;  2AXV A;  3IV0 A;  3WXX A;  3RJV A;  3AS4 A;  3G2V A;  5T4Y A;  4TXR A;  3RRN B;  3U64 A;  2HYZ A;  4TUM A;  1HO8 A;  4J8F A;  3FUD A;  3T8M A;  4FP7 A;  5T8I A;  3RK6 A;  1YA0 A;  3MV3 B;  1MX2 A;  5AQA A;  3MCX A;  5AJD A;  1TR4 A;  2WQH A;  3ESL A;  5CRV A;  5BNW A;  2H6I A;  2AVP A;  3L16 A;  3PE4 A;  3KEZ A;  4NAC A;  4BSX A;  1OCO E;  3B7B A;  3S7B A;  1WG0 A;  1NA3 A;  4BY6 A;  3S2A A;  3ZXS A;  4YVQ C;  4E6H A;  3FUL A;  2FBN A;  2P2C P;  3LYA A;  2NXP A;  1IKN D;  3ULE G;  3BU8 A;  3G2T A;  4N5Q A;  3QAQ A;  1S64 A;  1K8K G;  2RKK A;  4YVO A;  3JYS A;  4I2Z A;  4B94 A;  3PUJ A;  2BF0 X;  2RFM A;  1HS6 A;  4EQF A;  1FCH A;  1QYM A;  4ATG A;  2ETA A;  2FO7 A;  4U8V D;  4H7X A;  3AAA C;  1YYH A;  4K5A B;  3TG4 A;  4DX6 D;  2WMN A;  4LUN U;  3CHS A;  4LSZ E;  4TXQ A;  4KBQ A;  3ZRH A;  4GA1 A;  1FPP A;  2YHC A;  3IKO B;  2VSY A;  2LSV A;  4I9C A;  4I1M A;  1HH8 A;  3B7R L;  3UKU G;  4FC8 A;  1H2V C;  5HQ8 A;  3L82 A;  3PEU B;  4AEZ C;  5EYP F;  4OAU C;  1E8Y A;  4FJY A;  3ZYK A;  3CSF A;  4A1S A;  2DIW A;  3TWV A;  4NQ0 A;  2I9C A;  3DST A;  4CZ2 D;  3QWW A;  1HFA A;  1KT0 A;  3HXE A;  2LAI A;  2XGM A;  3TG5 A;  1PY1 A;  3TXM A;  1BPO A;  4U96 D;  3OXG A;  5T3R A;  4DLQ A;  2J4D A;  4RQI A;  2LSU A;  1YCS B;  3BQO A;  4UWG A;  1K3Z D;  1Z6T A;  2HR2 A;  3P2B A;  2UY1 A;  5D0O D;  5JJT A;  4E85 A;  4FJZ A;  4D10 C;  4K5B A;  5M72 A;  4K03 A;  1IXV A;  2PM7 A;  1H0A A;  2WB2 A;  1WY6 A;  5A6C A;  2Y4T A;  3ENE A;  5G04 C;  4F53 A;  3ONK A;  2GRM A;  3R9A B;  2WVI A;  3ZHE B;  2RFA A;  3B13 A;  3LJN A;  3NAW A;  4I9E A;  4KT6 B;  4C48 B;  5ENT D;  3TWS A;  2MOW A;  4JA9 A;  1V55 E;  3KD7 A;  5A23 A;  3UX4 A;  5D2M C;  5BXU A;  4JC8 A;  4Q96 A;  3SNX A;  4IRU A;  4GTP A;  4GZC A;  2H6G A;  1UG3 A;  3JUI A;  1O1T A;  1N94 A;  1IYG A;  2RG8 A;  1LTX A;  1ELK A;  1ZU2 A;  4LEU A;  4YND A;  3APD A;  1UW4 B;  4BT9 A;  5CCL A;  2R59 A;  3PRZ A;  4O60 A;  3ZPJ A;  3FWV A;  2P9L G;  1FVF A;  3DXM G;  3TWW A;  2X3M A;  3U3W A;  3B95 A;  3AG3 E;  4C0E A;  3EHR A;  3NZS A;  5D0Q D;  5EN5 D;  2Y69 E;  5EID A;  1IHG A;  2CHZ A;  3FHE A;  4C9B B;  2XRY A;  3FUJ A;  4U07 A;  3CHQ A;  3G2W A;  2ZIS A;  4PS8 A;  2OOE A;  2DVW A;  3AU4 A;  3LJ3 A;  3ML8 A;  3ZGQ A;  2IJG X;  4PS7 A;  4DJA A;  3QB2 A;  2LUH A;  2WXL A;  3UTM A;  4YDW A;  3RSE G;  3D9O A;  4B89 A;  2XZT G;  4UWK A;  4UQY A;  2XEN A;  3VLE A;  3DSW A;  1PAQ A;  2PZI A;  2I2O A;  4JA7 A;  3NQP A;  3CVU A;  2CHX A;  3UT7 A;  5BW8 C;  3Q7A A;  4G23 A;  3FFL A;  4PH4 B;  2PQR A;  4H7Y A;  4PDX A;  2DCP A;  4F1P A;  4FA6 A;  4X8Q A;  4GTQ A;  4XKC A;  4GZ6 A;  5HI7 A;  4ACK A;  1N4Q A;  5LOZ A;  4JZY A;  2RD0 A;  3J5Q B;  1A5E A;  2WXQ A;  4TV3 A;  2IY0 C;  3NF1 A;  4LG6 A;  3ML9 A;  4ANW A;  2WPV A;  4WWP A;  5ENP D;  2EIK E;  3QWP A;  2XPZ A;  4U7E B;  2NSZ A;  3S7F A;  3QDN A;  3SHF A;  3FTX A;  1NZN A;  5FZQ A;  2VGX A;  5CBO A;  3TXN A;  5KNG A;  4BX9 A;  3T9K A;  4JD2 G;  3EJN A;  2IFU A;  4I1A A;  3LY7 A;  3UM2 A;  3EUV A;  3ZEF A;  2BUG A;  3DSV A;  4TXP A;  4I6G A;  4BT8 A;  1S70 B;  2A5E A;  4A3T A;  2L0I A;  2XCB A;  4WAF A;  2VSX E;  2QYJ A;  1S63 A;  3CVL A;  2KC7 A;  1EDU A;  3AG4 E;  1D8E A;  3VTX A;  3B7U X;  4ZFH A;  5ENS D;  5G05 C;  3CQC B;  4K5C A;  3Q79 A;  1HXI A;  4J0U A;  3C72 A;  3FEX A;  3EHQ A;  2KCV A;  3D9J A;  2IO2 C;  2QYU A;  2XHE A;  2YHE A;  5AQ7 A;  4WNG A;  3JXJ A;  3VLD A;  4J6I A;  1L5J A;  4KYO B;  2DBA A;  4CEM A;  3Q49 B;  1BI8 B;  4BSZ B;  1IQU A;  4JXT A;  4G2V A;  3CHP A;  4KMO A;  3N71 A;  3L17 A;  2P9P G;  3ASH A;  1TN6 A;  5FIN A;  3PE3 A;  4B8A A;  4B0Z A;  2KZT B;  4L7T A;  1OCZ E;  3DPD A;  3G2S A;  4M3O A;  3TWX A;  2NYJ A;  3FUF A;  4HI8 A;  4A3V A;  3W9F A;  3Q9U C;  2BTD A;  4JL0 A;  2XCC A;  1H19 A;  3PZ2 A;  4HB5 A;  3HHM A;  1U2V G;  4ACL A;  4AP2 A;  5IY5 E;  3X2Q E;  2FF4 A;  3E33 A;  2EIJ E;  3SBS A;  1INZ A;  1N0Q A;  1MX4 A;  3SO8 A;  3TWQ A;  3E32 A;  4KVO A;  3QOU A;  2GRQ B;  4HQD A;  4LNU D;  3MX3 A;  4EZK A;  4ANV A;  2XGO A;  1OWP A;  3QKY A;  2EQX A;  4HRN A;  3BG0 B;  3UM3 A;  3U4T A;  1ELR A;  5FQ6 A;  3C98 A;  3IBE A;  3APC A;  1D9S A;  3DEP A;  4U95 D;  1FT2 A;  1MJ0 A;  3CIA A;  5ITZ F;  3V30 A;  3V31 A;  3CVY A;  1UJJ A;  4I17 A;  3D9N A;  3NBN B;  2IEJ A;  2J9Q A;  4WWO A;  4GZD A;  4AM9 A;  1IHB A;  1N4S A;  2E2E A;  3C3R A;  1AP7 A;  4WNF A;  5EIB E;  2GRP B;  5KCM A;  3LDZ A;  4HOT A;  3UI2 A;  4A55 A;  3U66 A;  4CDR A;  4GTO A;  4DX1 A;  4UUC A;  3CST A;  3RKV A;  3ZIM A;  1FT1 A;  3ULY A;  4JVS A;  4GTV A;  3EU5 A;  3ZN3 A;  5HS0 A;  3SFY A;  4F7A A;  3PZ1 A;  3CK7 A;  3GYZ A;  2L9B A;  1Z5S C;  3CLJ A;  2XZD G;  3ASO E;  3E30 A;  4ILH B;  4RVB A;  1UJK A;  3VLF A;  1UN9 A;  1NP7 A;  1SVX A;  2I1K A;  2R5S A;  3L54 A;  3PS6 A;  2X6J A;  3Q75 A;  5EX0 A;  3MA5 A;  4GA0 A;  4J8E A;  4I6E A;  4RG6 A;  5ENR D;  2GRL A;  3AG2 E;  3FH8 A;  2FUL A;  4FLH A;  3P1U A;  1TNZ A;  2ETC A;  3OXF A;  5J08 A;  1Z3X A;  4UQZ A;  2QFC A;  2GGF A;  2WQ6 A;  4BES A;  4DX5 D;  2YIN A;  4K0R A;  2C2L A;  2J07 A;  3LS8 A;  4QQI A;  4GAA A;  5ENN A;  1HE8 A;  4N2Q A;  1AWC B;  3ASD A;  4FLB A;  3LXU X;  3R7R A;  3ZUV B;  1OCR E;  3F6Q A;  2LXL A;  3GZS A;  3FH7 A;  4G11 A;  4JHK A;  3ZYQ A;  2WXN A;  1QBQ A;  3SGH A;  2DYR E;  4HRM B;  5EYL A;  4ILI A;  1ZBP A;  1YMP A;  5FZR A;  3ABM E;  3CKB A;  4UI9 K;  4NIK A;  3BUA A;  3T8K A;  4DLO A;  3Q9N C;  2KM4 A;  4HBD A;  3FTU A;  1Q2Z A;  5CEA A;  1N54 A;  3HDX A;  4CYM D;  1WDY A;  4DI4 A;  2R05 A;  4GYO A;  4DRX E;  2X6I A;  3ASG A;  4EPZ A;  4FHJ A;  4MS6 A;  4QFV A;  1UN8 A;  1N9A A;  1PC2 A;  3FTS A;  3GZ2 A;  2PNN A;  4HI9 A;  4RLY A;  3ZVV A;  3FUE A;  3SQV A;  3HG0 D;  3S7J A;  1GW6 A;  3L9T A;  3MEK A;  4EBA G;  2J49 A;  3KSL A;  3G2U A;  1S0P A;  3Q15 A;  4GCO A;  5CCM A;  3JQ1 A;  1K1B A;  5AN8 A;  1H6O A;  2IQC A;  2Y3A A;  4N39 A;  2KZT A;  3L08 A;  4V3I A;  4L1B A;  2R03 A;  5G05 J;  5JJ7 A;  3NOG D;  4DK5 A;  4J8D A;  4GU5 A;  2P9I G;  4L23 A;  4J8S A;  5ARF A;  2AXZ A;  5FZS A;  4L2Y A;  4HRL A;  3SFZ A;  2V5Q C;  3RO3 A;  5AQB A;  3MKQ A;  3C3O A;  4GMJ A;  1G3N B;  4EEC A;  3CK9 A;  4A1G A;  4DX2 A;  5AEN A;  1X5B A;  2J4B A;  3CVV A;  4GTM A;  1OXJ A;  2QC9 A;  1DCE A;  2VTB B;  4WUY A;  5AIJ A;  4G26 A;  3L22 A;  1LD7 A;  3K9I A;  2F8X K;  4N3C A;  3MV2 B;  3UT4 A;  4UWF A;  3FUN A;  1KLX A;  3DRA A;  5EX3 A;  5KNH D;  2Q7F A;  3FU0 A;  5B3S E;  1WAO 1;  4AXH A;  4GTS A;  3NB2 A;  4LCT A;  2AWI A;  1NFI E;  3AJI A;  1FVH A;  3CEQ A;  5KJM A;  3I3N A;  5KJN A;  2ZGG A;  3KSQ A;  3JQ0 A;  2P9N G;  3C5R A;  2F37 A;  4OAV B;  5FQ4 A;  4P29 A;  5CBN A;  4UI9 C;  2H6F A;  3CVN A;  3NZU A;  2M63 A;  2PQN A;  4GZ5 A;  2V5F A;  4HOQ A;  5FQ7 A;  3UM0 A;  4EBA A;  2I1J A;  4MLP A;  5J90 A;  4ME2 A;  2ETB A;  4RSY A;  3ZNG A;  2DZO A;  3ASN E;  1N4P A;  1O1S A;  3BEE A;  3FY4 A;  5JHA A;  5CMW A;  3B7T A;  3PH0 C;  4WND A;  2YNQ A;  1H2U A;  4BTA A;  1Z3Y A;  2OEV A;  2MYO A;  5JJ6 A;  3PUK A;  3HXC A;  4MKT A;  2XPI A;  4DX7 D;  2CG3 A;  2IF4 A;  2LO6 A;  3EIJ A;  4G24 A;  4GML A;  2GRO B;  4UQX A;  3ZFW A;  3CHO A;  1E96 B;  4UWH A;  2B0O E;  4O1O A;  3HXD A;  3CR3 A;  4URK A;  2OCC E;  1MZC A;  5FTP A;  1MX6 A;  4JEU A;  3UQ3 A;  1IQR A;  1B89 A;  4PS3 A;  1NA0 A;  2KXP C;  2EIM E;  2HM8 A;  1OT8 A;  1JCS A;  4L9P A;  2XS8 A;  3T5V A;  1UOH A;  3FUI A;  3DPY A;  3QAR A;  2R17 C;  2R2L A;  3IEG A;  3D9H A;  2CFU A;  2KBX A;  3UIP C;  2EIL E;  3EHM A;  2OVB A;  4CGV A;  1LD8 A;  1BI7 B;  3KAE A;  1E8Z A;  4JB8 P;  4BX8 A;  4U63 A;  3URZ A;  4OYS A;  4J7W A;  1E8X A;  3LCA A;  4EZL A;  3CVP A;  4I43 A;  2WXF A;  4GTR A;  4MRU A;  4UWL A;  1SQM A;  5AYW D;  3I4R B;  4R7L A;  3DBS A;  1ZB1 A;  3DSU A;  5LX8 A;  3RRM B;  5CHE E;  4WWN A;  2AJA A;  4BER A;  4G25 A;  4Y6C A;  1TJF A;  1LF8 A;  4Q69 A;  1H2T C;  3ULQ A;  2DYS E;  2JLB A;  3E37 A;  4ANX A;  3NOC D;  5ARG A;  2MRI A;  5CRU A;  2XPY A;  4DI3 A;  3MKR A;  4HNA D;  4O1P A;  3UIO C;  3QNK A;  3ZHE A;  4XI9 A;  5KJK A;  2VGY A;  5FIO A;  2VJ8 A;  4O6F A;  1MYO A;  2UWJ G;  3D9L A;  3ABK E;  3UPV A;  1TEZ A;  1TNU A;  1BU9 A;  3E4B A;  3ZXP A;  4RG9 A;  4U0S A;  1EPU A;  1SZ9 A;  3LY8 A;  4G8K A;  5BPP A;  5HKP A;  4IYP A;  1RW2 A;  2BED A;  3J5P A;  4GTT A;  3FDH A;  3DEO A;  2CG2 A;  3CHM A;  3CK8 A;  3D9I A;  4APO A;  5FJY A;  2Y0B G;  2WXG A;  4B93 B;  4I6J A;  1N52 A;  3HVE B;  4GMR A;  4PUC A;  5G04 J;  3RAU A;  2WXH A;  5LCW C;  1Y6I A;  5EKQ D;  1JWF A;  1H6P A;  1N4R A;  2KCL A;  5DBK A;  4LRZ A;  4BFR A;  3PNT B;  3OTN A;  2V4H C;  3SF4 A;  4U8H A;  4JHJ A;  4CRW A;  2B6C A;  4APF A;  1BD8 A;  4KVM A;  4F6R D;  4CT0 A;  4LER A;  3EIQ C;  3PZ4 A;  4HLE A;  1ELW A;  2VTB A;  3L6A A;  2VGE A;  3O48 A;  5AAR A;  2VYI A;  2DZN A;  3Q4A B;  5CER B;  3JXI A;  1V54 E;  4OVV A;  2VSN A;  3EHN A;  3AS5 A;  1SZA A;  4G1T A;  4XEI G;  4XI0 A;  2X38 A;  3DXK G;  2A5U A;  2VGX B;  2J08 A;  4XKB A;  3PZ3 A;  3HXF A;  5HRY A;  5H7P A;  1DVP A;  5ENQ D;  4XX5 A;  2LXM A;  4YDE A;  3QJZ A;  4GCN A;  4N3B A;  2JEK A;  1W3B A;  3LEW A;  3OAW A;  1TNO A;  2JAB A;  2OEW A;  3TL5 A;  4CDM A;  1XNF A;  3I4G A;  3MYV A;  5BV1 A;  4Y6W A;  3ONL A;  1HU3 A;  1JCR A;  3ZYL A;  4AY6 A;  3JCK C;  1U3D A;  1QZ2 A;  5KBA A;  3QWV A;  2PM6 A;  2WXJ A;  3CVW A;  4EHM A;  3GW4 A;  4HXI A;  3V2O A;  1K1A A;  2LNI A;  3UIN C;  1N95 A;  2P9S G;  2L6B A;  3Q7F A;  3FH5 A;  3D9K A;  1HG2 A;  5CEC B;  4GPK A;  4AJW A;  3DSX A;  4U04 A;  2IOS A;  5BXO A;  3SY2 A;  5ANL A;  3RIB A;  2IU1 A;  2A4Z A;  3FUM A;  3APF A;  4NRH B;  4UI9 J;  1TYQ G;  3SD5 A;  4XZ4 A;  3QK0 A;  5A7D B;  5EDS A;  4FUL A;  1JPL A;  4J8Y A;  2E0I A;  4ABN A;  4GA2 A;  4IN3 B;  2C0M A;  4XIF A;  2YQ8 A;  4GPM A;  3HIZ A;  3Q73 A;  3R9M A;  4AV7 A;  2Y1L E;  5LP0 A;  4G8L A;  1KPS B;  3MJW A;  3UM1 A;  4XE0 A;  5EIL A;  5FQ8 A;  3FEY A;  2WMO A;  4JEH A;  3IHV A;  4LNB A;  3QC1 A;  2X6F A;  1DNP A;  3FU5 A;  3TWT A;  5CED B;  1O5M A;  4NUR A;  4CCA A;  4F3V A;  1E7U A;  1VDY A;  3SBT B;  3PZD A;  1JCQ A;  4YDY A;  1JWG A;  2L6J A;  4AVX A;  2R02 A;  3D9M A;  4I1O B;  3PNL B;  3MZL B;  5ANR A;  1HZ4 A;  2WXO A;  1E8W A;  4GZ3 A;  2P9U G;  1N0R A;  1HX8 A;  2ION A;  1P5Q A;  5FT9 A;  2F8Y A;  3SZ7 A;  2F0Y A;  2ZIR A;  4U0U A;  5B1A E;  4Q94 A;  3FP3 A;  1WM5 A;  5LFA A;  2XS1 A;  2DWZ A;  3WG7 E;  3RRU A;  4W9R A;  4KXK B; 
#chains in the Genus database with same CATH homology
 3ABK E;  2EIL E;  2DYS E;  2EIJ E;  2Y69 E;  2DYR E;  3AG2 E;  1V55 E;  2EIK E;  1V54 E;  1OCC E;  2EIM E;  2EIN E;  5B1A E;  3ABM E;  5B3S E;  3AG4 E;  5B1B E;  3ABL E;  3ASN E;  1OCR E;  3WG7 E;  2OCC E;  3AG3 E;  5IY5 E;  3X2Q E;  1OCZ E;  3AG1 E;  3ASO E;  1OCO E;  2ZXW E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...