2DYSE

Bovine heart cytochrome c oxidase modified by dccd
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures and physiological roles of 13 integral lipids of bovine heart cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 43
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2006-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2dysE00
5B3SE 3ABKE 5B1BE 3WG7E 3AG3E 3X2QE 1OCOE 3ABLE 2EIME 1V54E 3AG2E 1OCZE 2DYSE 2EINE 3ABME 2OCCE 1V55E 5IY5E 1OCCE 2Y69E 2EILE 3AG4E 3AG1E 3ASNE 2DYRE 2EIJE 1OCRE 2ZXWE 3ASOE 5B1AE 2EIKE
chains in the Genus database with same CATH superfamily
4L7TA 1OCOE 1H2VC 3PEUB 5CBOA 3TJPA 3V2XA 4AM9A 4EHMA 1E8YA 4DK5A 3ZHEB 2P9IG 3RAUA 4RLYA 4HB5A 1HH8A 2PQRA 4B0ZA 2CFZA 3FTZA 4YDOA 1LD7A 4GCNA 4FHKA 4DUIA 2H6HA 3Q7FA 4BX9A 2HM8A 3HVEA 5AENA 2H6IA 4GZDA 3CQCB 3UT7A 4JL0A 3ZUVB 1U3CA 3RIBA 3QAQA 4AJWA 3JXIA 3CHSA 3E33A 1DCQA 3QWWA 3RRNB 1ZBPA 2DYRE 3I4RB 4GTVA 4UUCA 4J7WA 1YCSB 2WXKA 3UM2A 3ONKA 3LPZA 1V54E 4UQXA 4OAVB 4NRHB 5AJDA 1NA3A 1D8EA 2XZTG 4LERA 3VTYA 4YVQC 3FTSA 2WM9A 3DSXA 5ENOD 1BI8B 2EILE 2QZAA 3BG0B 2Y3AA 4Q96A 3SO8A 4J8YA 3MX3A 2WQ6A 2DZOA 3R9MA 3L82A 3Q9NC 4I1MA 2CHWA 4DX7D 4WNEA 5EIDA 1MX4A 3E32A 3D9IA 4GTMA 4Q94A 1H6PA 3ESKA 3CV0A 2IONA 3V30A 5LP0A 4TRQA 1H2TC 3APCA 1RW2A 3MKQA 4XKCA 4HS2A 1QZ2A 5ANRA 4Q69A 3JXJA 3FUNA 5EX3A 1BI7B 1G3NB 1IHBA 3MA5A 5E76A 1S64A 5ENSD 5T8IA 3ZRHA 3LY9A 2YNQA 3HXCA 4A55A 5A6CA 3QDNA 3E37A 4D10C 3T5XA 5E75A 2FI7A 3EHRA 3JQ0A 3TWXA 2AWIA 3AG4E 2BKKB 3TWUA 2DZNA 4RQIA 3JCKC 3X2QE 4UWLA 3PREA 3FUEA 4HQDA 4A1SA 4DLOA 4AXHA 3DEPA 2R17C 5AYWD 3L16A 2I1JA 3TXNA 4TUMA 3BG1B 5KNHD 4AY5A 1JUQA 2VYIA 3KEZA 2ETCA 4BESA 1IKND 1UW4B 1VDYA 2P9LG 3UIPC 4K5BA 3EJNA 3TWQA 2A5EA 3L08A 3ASNE 4CRWA 2GRLA 2J49A 2OV8A 4ANVA 3PZDA 5LCWC 3UM1A 2KCKA 2HR2A 3DSWA 5D66A 4KT6B 3O4ZA 5CRUA 3NOCD 2FF4A 4QFVA 2VTBB 3QOUA 4H7YA 2V4HC 3R9AB 1KT0A 2LXLA 3AJIA 1OWNA 3Q78A 2MYOA 2KZTB 1JCSA 4CGWA 3G2UA 4U8YD 3KSQA 2A5UA 1H6KA 4LG6A 3SI5A 2OVBA 1HO8A 2L6JA 3ULQA 3VLEA 3CVUA 4F7AA 3I5PA 1SA5A 4CDNA 3DXKG 5FQ6A 3PZ2A 2YHEA 2XGSA 1KZOA 2WXFA 1ZU2A 1HF8A 2JLBA 4GPKA 2I6HA 2VGYA 2Y4UA 3F6QA 4G25A 1N4QA 5HRYA 3QWPA 3LY8A 1H19A 1E8XA 1FVFA 3DRAA 5AQBA 2I1KA 2IOSA 3WG7E 3RJVA 4CYMD 4DPRA 3UTMA 1NA0A 4XE0A 3EUVA 3CVXA 4GTQA 3ISMC 2BEDA 4J8EA 3AS5A 5FJYA 2L0TB 4BETA 2V0PA 4I6GA 2WXLA 4HBDA 4DJAA 1IHGA 3ZNGA 3T8MA 2IY0C 2GRNB 2GW1A 3GZ2A 1TN6A 3QC1A 3I3NA 4O60A 4CT0A 4BT8A 3OAWA 3PRZA 2PM6A 5JMND 3EU9A 3HXFA 1AP7A 4M3OA 4J8FA 3CK7A 3QK0A 5KJNA 3UUXA 1NI1A 4JZYA 4APFA 4UQYA 2WXPA 4N2SA 2AW6A 3UMVA 1V55E 2XS1A 2IOLA 3B7TA 3FU5A 1YA0A 4AOFA 2C0LA 4HLEA 4A3VA 4OVUA 1E7UA 3P2BA 4MS6A 2XS8A 5ENQD 3DPDA 3SBTB 2L9BA 4G26A 5EYPF 3LJNA 2X6JA 2F8XK 1TR4A 2LNIA 4TXQA 5BW8C 4HXIA 3KD7A 4UQZA 1JWGA 4CEMA 4JHKA 4HRNA 4J8SA 4G8LA 4LCTA 3T5VA 4DI4A 3ZU7B 4KXKB 2Q7FA 5AIJA 2LAHA 1SVXA 3Q7AA 1HFAA 2VGXB 5BXUA 3AG1E 3V2OA 4U0ZA 5CCLA 2I2OA 1E90A 3EDTB 3LDZA 4HOUA 3OXFA 3R7QA 3TWRA 3SGHA 2P58C 3UINC 3B7BA 2XPYA 2WB2A 1OCCE 1S70B 4EECA 1RZ4A 4U63A 4APOA 3RSEG 5FT9A 3TWSA 1MYOA 4U0SA 1EF1C 5G2NA 4HI9A 4CT4A 3FHEA 5FIOA 1O1SA 2MRIA 3Q47B 3B7RL 5ENTD 3LS8A 1YYHA 2XPIA 2UY1B 5KJLA 1KZPA 3TL5A 1TNBA 3G2WA 3PE3A 2LUHA 4GMJA 4G23A 3U9WA 4ANWA 3FUHA 3W9FA 3C5RA 3ASOE 3CVPA 3NBNB 4HOQA 4E85A 2RG8A 3NZUA 4X8QA 3LYAA 4ZHBA 2DBAA 1UOHA 3RK6A 2B0OE 4B8AA 2KM4A 3B7SA 3FUDA 4JVSA 4JXTA 3UX4A 2UWJG 4XI0A 2WQ7A 1WDYA 4HORA 4EZKA 1MZCA 5T4YA 4I2WA 2RD0A 4DI3A 1TJCA 2IEJA 3IHVA 2C2LA 2FEZA 1N4PA 3IBEA 1K1AA 3PS6A 4O6FA 3U4TA 4GYOA 2XGMA 4BT9A 2WXJA 4C9BB 2OVFA 4Y6WA 3DXMG 3HXDA 3CVVA 4GZ5A 5LCWJ 3J5PA 4L2YA 4JPSA 4TUUA 4YDYA 4F6RD 5LFAA 2KATA 3G2TA 3C72A 1FT2A 2FO7A 3L13A 5FZSA 3E34A 2KBXA 4J0UA 3LXUX 3FEXA 4WNGA 3CQGB 2YINA 4CGVA 3MV3B 3RKVA 3ZKJA 5FQ7A 1EYHA 3P1UA 1N9AA 3ZFWA 2VTBA 3EIJA 3MJWA 5JJ7A 2DCPA 3CVYA 3IKOB 2E2EA 2XCCA 4PS7A 3Q75A 3AG3E 1H0AA 1N0RA 2WXQA 4RSYA 2H6GA 3NQPA 4AV7A 1N95A 2X6KA 1NL4A 1Y6IA 1FCHA 2VSOE 4AEZC 3CLJA 3MCXA 5JA4D 4DX1A 4KMOA 5KWDA 1UN8A 5LX8A 3N71A 3MKRA 1N94A 2L0IA 4P29A 4RG6A 1O1TA 1H2UA 1SZAA 4HNAD 1JCRA 3PZ4A 2AXZA 5B1BE 2F8YA 4KYOB 4FC8A 4B93B 4WWOA 3J5QB 4N5CA 2CHXA 3PDNA 3UT4A 4URKA 4G2VA 1MHQA 4WNDA 3FU0A 1BPOA 1N0QA 2CHZA 2AJAA 4Y6CA 3B95A 5CERB 4GCOA 2WQHA 2MHKA 5ARGA 4MBGA 5FINA 5EKQD 1H6OA 3TAXA 4K03A 3ASHA 2QYJA 2XRZA 5M72A 2OCCE 2GRPB 5IY5E 4FLBA 3DEOA 5G04J 3PZ1A 3ZGQA 4BY6A 5ANLA 2OOEA 2IF4A 3JYSA 3ZYLA 3MEKA 1KT1A 3T8KA 2A4ZA 1OCZE 3FH7A 3ABME 2J09A 3ZYMA 4WAFA 4IRUA 3RRUA 2NYJA 1TJFA 3B13A 4DX6D 2XHEA 5J08A 3KSLA 1QBQA 4MKTA 5JJTA 3FTVA 3FFLA 4J6IA 3C3OA 3NOGD 3PVLA 4NIKA 3GZSA 4ILIA 1N11A 4L9PA 2PL2A 4C0MA 4GTRA 4L2LA 2GGFA 4NURA 5D2MC 2FULA 3MKQB 4JW1A 5EX0A 4ILGA 2XQ0A 5CEDB 2CG2A 1A5EA 2P9KG 1BU9A 3E30A 5JHAA 2V5FA 3CGHA 3QARA 2JABA 4BERA 5G04C 4U04A 4JB8P 5FWQA 4FULA 1PC2A 4LSZE 1U2VG 3CHQA 3HIZA 5ARFA 3SFZA 3VTXA 4ANXA 4IN3B 3FTUA 3CSTA 3SY2A 5EILA 5G55A 2R03A 4GA1A 3FTXA 3HXEA 4NACA 1ELWA 2CFUA 4C48B 4ZFHA 2V4LA 4O1OA 2IO2C 3PH0C 5JJ6A 5C2YA 2FBNA 3SZ7A 5KJKA 4CDMA 2EINE 3ZIMA 5AJLA 1TNZA 4ATGA 4GTPA 1U3DA 4F3VA 3CHPA 3ULYA 3QB2A 3KAEA 2WMOA 3Q9UC 2B6CA 1OWMA 3ZPJA 3ZXSA 4LNBA 2R02A 5BUZA 4JEHA 4AIFA 3HXBA 1DNPA 2RKKA 5DIZA 4U7EB 1BLXB 3TG5A 4AVXA 2XCBA 4I1AA 1E8WA 2R5SA 5AQ9A 4QQIA 3MZLB 2WMNA 3BQOA 4KZCA 2YQ8A 4I9CA 4HFGA 3CVWA 2I9CA 2V5QC 2RFMA 3SQVA 2NC9A 3EHMA 4LNUD 1IYGA 4LRZA 3CHRA 2DYSE 1A17A 3ZYKA 3CHMA 1MJ0A 3ZYQA 4BSXA 4EBAA 3G2VA 3JUIA 4XKBA 5CECB 1OUVA 4TV3A 1PAQA 2P9PG 1AWCB 3CK8A 3R7RA 3BU8A 4FA6A 2QY7A 4MLPA 2BUGA 2VGXA 2CG3A 3UI2A 4ABNA 1DVPA 4XX5A 3DSUA 2PM7A 4LUNU 4HLLA 2P2CP 5AQ7A 3L6AA 3DPYA 3B7UX 1O5MA 1TNOA 3DSSA 2VSNA 4OYSA 3CKBA 3AS4A 4BFRA 2XGOA 1EPUA 4UI9C 4XI9A 4UWGA 4C0EA 3RO3A 1S0PA 3GZ1A 4GA0A 5ENPD 1Q2ZA 3VLFA 4M7CA 4JA7A 2IQCA 1JWFA 5CMYA 1SQMA 1SA4A 3BEEA 4ME2A 1X5BA 3TG4A 1IXVA 5CHEE 4G11A 5FZRA 2DIWA 3IHYA 4UI9K 3SD5A 3KEAA 1OWPA 3D9OA 3LVQE 2GRMA 2P9NG 2ZGDA 4MRUA 3FULA 2OEVA 4ILHB 2R59A 3L9TA 4TXRA 2XPZA 3AU4A 2DVWA 1MX6A 2QYUA 4UWFA 3FP3A 4GTSA 2E0IA 2AVPA 2BF0X 3DSVA 3PNLB 4HVBA 1IQRA 2IFUA 4U95D 3DBSA 3ZVVA 2XENA 5AQAA 4EZJA 4LEUA 4AP2A 3V31A 1BD8A 2H6FA 5JHBA 2BKGA 4GU5A 3APFA 2ETAA 1B89A 4I6EA 3W9GA 2R05A 3EHQA 4U0UA 5CEAA 2WXNA 4UWKA 1QNFA 3FU3A 4N39A 3FH5A 3CKCA 1D8DA 4PS3A 2VSYA 4RVBA 3FUJA 3LJ3A 1DC2A 2IJGX 4DRXE 2X6HA 5A7DB 2KC7A 3BUAA 4CCAA 4EQFA 4U96D 4GYWA 1JPLA 4GZ3A 3URZA 1WM5A 5B3SE 4KBQA 3PUJA 1NZNA 1UJJA 2GRQB 5J90A 4GZ6A 5ENNA 4B89A 3D3MA 3D9KA 2OEWA 2X3MA 2XEEA 4PUCA 4YVOA 3RU0A 2LSVA 1ZB1A 5HKPA 1TEZA 2WXGA 2XEHA 2ONDA 2WXIA 2QC9A 3ML8A 1NFIE 3FU6A 1N4RA 2VQ2A 3OTNA 4BSZB 4G24A 4IULA 2KZTA 5T3RA 1MX2A 4FU3A 3VLDA 4J8DA 5FQ4A 3D9NA 1W3BA 2P9SG 4CDRA 4A1GA 4U8VD 3PEVB 4GTTA 2V8SE 4FADA 5CCMA 1UN9A 4N3AA 3D9JA 3ULEG 2NSZA 5ITZF 3UPVA 5HI7A 2Y69E 1OWOA 4HRMB 2LAIA 3O48A 4WWPA 3U64A 4GYYA 3MGBA 3GW4A 4N2QA 3S7JA 2AXVA 1QYMA 3LVRE 4FJYA 4WNFA 5BT1A 4DLQA 4WWNA 4G8KA 4GMLA 3SBSA 4K5CA 3D9HA 1Z5SC 4L1BA 3I4GA 5BXOA 3LKUA 2MOWA 3PE4A 4NQ0A 1HS6A 3CIAA 1NP7A 3QJZA 4GMRA 3L54A 3UQ3A 3Q4AB 1PY1A 3D9PA 4ACLA 3QWVA 3ZEFA 4FP7A 2R2LA 2J08A 3QKYA 3TGOA 1HE8A 2WXOA 4U8HA 3NB2A 4XZ4A 1IQUA 2X38A 2WVIA 3RO2A 4JHJA 5EN5D 2AXUA 1ELKA 4A63B 3OXLA 3ZXPA 4ACKA 5LOZA 1YMPA 5KCMA 1P5QA 3L22A 3KS2A 3HVEB 2Y0BG 2F37A 4FJZA 1E96B 1TN7A 3UT8A 4EBAG 3C98A 3Q73A 4N3BA 5CBNA 2F0YA 3UKUG 4BTBA 5FQ8A 3WXXA 4W9RA 3AAAC 4N3CA 5BPPA 4AY6A 1INZA 3FUMA 1XNFA 1SW6A 4I43A 2L6BA 4I9EA 5H7PA 5HS0A 1K8KG 2C0MA 4F1SA 3TWTA 2WXMA 5A23A 3CR3A 4I1OB 3HDXA 5B1AE 2EIKE 2HO1A 2KXPC 3E4BA 4BEPA 5FZQA 4PS8A 3FTWA 2Y1LE 3Q15A 5DBKA 4EZLA 5EDSA 2HYZA 3QNKA 3LEWA 3Q5MA 4GA2A 4JHRA 2Y4TA 5CMWA 3APDA 3IEGA 4DX2A 4N5QA 1K3ZD 4FHJA 4OAUC 2J4DA 5BNWA 1Z3YA 2ZIRA 3UKRG 1FPPA 3DSTA 3UXGA 3CSFA 4GZCA 3ASDA 3D9LA 1GW6A 4L23A 2GRRB 2XRYA 3SFXA 3FTYA 4JA9A 3FUIA 1Z3XA 5AAOA 3FY4A 4U07A 4GPMA 2X6IA 4YDEA 2X6FA 4OVVA 2LXMA 1TNYA 2UY1A 1HU3A 4JD2G 3TWWA 3PZ3A 4HOSA 2ZU6B 2ZXWE 2IU1A 3UIOC 1L5JA 5ENRD 2PNNA 3ABLE 3ZN3A 5HQ8A 2FO1E 1N52A 4F1PA 3ZHEA 1E8ZA 5AARA 4HI8A 3AS8A 1Y8MA 3HHMA 3ML9A 3IXEA 2EQXA 3PUKA 4YNDA 3ASGA 1FVHA 2PQNA 1OT8A 2RFAA 2J4BA 3FDHA 1JCQA 2NXPA 4RG9A 2LSUA 2BTDA 2IO3C 3LCAA 2JEKA 4BX8A 3TXMA 2XZDG 1X81A 5CRVA 4UI9J 1HXIA 4KVMA 3NF1A 1WG0A 5EIBE 1OY3D 1TN8A 4GB9A 3G2SA 2J9QA 4DX5D 2P9UG 1KLXA 3GYZA 2EIME 3MYVA 3NZSA 4JEUA 4XEIG 1N54A 3HRAA 4JC8A 2ILRA 3EHNA 4Z68A 4HRLA 3S7DA 3CVNA 3S2AA 3CEQA 1D9SA 2KCVA 3ABKE 4GAAA 2VSXE 4KVOA 5FTPA 1XGWA 4WUYA 3TWVA 4XIFA 3T9KA 1FT1A 3CK9A 3S7FA 2WXRA 4B8CB 4PDXA 4ATZD 4B94A 3FWVA 5BV1A 2WPVA 3ZW3A 4PH4B 3FH8A 1OXJA 5KBAA 5D0OD 1QQEA 3ONLA 4BTAA 4E6HA 2J07A 3HYMB 4GTOA 3MV2B 2WXHA 3PNTB 1S63A 3DWLG 3EIQC 4K0RA 1O1RA 3UM3A 3AG2E 1TYQG 3ENEA 1MQSA 3U3WA 3C3QA 1ELRA 1LD8A 2GROB 4H7XA 2J8SD 1HG2A 1LF8A 2ZISA 1WAO1 4K5AB 3C3RA 1UG3A 4EPZA 1UJKA 2YHCA 3V79K 1LTXA 4F53A 1KPSB 1K1BA 3RRMB 1Z6TA 3SHFA 5KNGA 3UM0A 2LO6A 3CVLA 2EIJE 4V3IA 3Q79A 3SNXA 4LNGA 3OXGA 3AU5A 3EU5A 5AN8A 5G05C 4ANUA 5G05J 3S7BA 4A3TA 2PZIA 4BWRA 4FLHA 1EDUA 1OWLA 5EYLA 4IYPA 2XEVA 5BV0A 3L17A 4R7LA 5C1DA 3FUKA 2ZGGA 4O1PA 3ASFA 4UWHA 3IV0A 4I6JA 2HE0A 3D9MA 2QFCA 2DWZA 3NAWA 4CZ2D 3SF4A 1DCEA 3JUEA 4YDWA 5D0QD 3SFYA 3Q49B 3FEYA 1HG5A 3CVQA 3LY7A 4HOTA 4TXPA 3ESLA 1SZ9A 2KCLA 2VJ8A 3CHOA 1E7VA 4KZ0A 4I2ZA 3FUFA 1N4SA 1OCRE 2M63A 4G1TA 5KJMA 3HG0D 1WY6A 4I17A 2ETBA 3U66A 1HX8A 1HZ4A 3JQ1A 2VGEA 1TNUA 3K9IA
chains in the Genus database with same CATH topology
5B3SE 3ABKE 5B1BE 3WG7E 3AG3E 3X2QE 1OCOE 3ABLE 2EIME 1V54E 3AG2E 1OCZE 2DYSE 2EINE 3ABME 2OCCE 1V55E 5IY5E 1OCCE 2Y69E 2EILE 3AG4E 3AG1E 3ASNE 2DYRE 2EIJE 1OCRE 2ZXWE 3ASOE 5B1AE 2EIKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B3S E;  3ABK E;  5B1B E;  3WG7 E;  3AG3 E;  3X2Q E;  1OCO E;  3ABL E;  2EIM E;  1V54 E;  3AG2 E;  1OCZ E;  2DYS E;  2EIN E;  3ABM E;  2OCC E;  1V55 E;  5IY5 E;  1OCC E;  2Y69 E;  2EIL E;  3AG4 E;  3AG1 E;  3ASN E;  2DYR E;  2EIJ E;  1OCR E;  2ZXW E;  3ASO E;  5B1A E;  2EIK E; 
#chains in the Genus database with same CATH topology
 4L7T A;  1OCO E;  1H2V C;  3PEU B;  5CBO A;  3TJP A;  3V2X A;  4AM9 A;  4EHM A;  1E8Y A;  4DK5 A;  3ZHE B;  2P9I G;  3RAU A;  4RLY A;  4HB5 A;  1HH8 A;  2PQR A;  4B0Z A;  2CFZ A;  3FTZ A;  4YDO A;  1LD7 A;  4GCN A;  4FHK A;  4DUI A;  2H6H A;  3Q7F A;  4BX9 A;  2HM8 A;  3HVE A;  5AEN A;  2H6I A;  4GZD A;  3CQC B;  3UT7 A;  4JL0 A;  3ZUV B;  1U3C A;  3RIB A;  3QAQ A;  4AJW A;  3JXI A;  3CHS A;  3E33 A;  1DCQ A;  3QWW A;  3RRN B;  1ZBP A;  2DYR E;  3I4R B;  4GTV A;  4UUC A;  4J7W A;  1YCS B;  2WXK A;  3UM2 A;  3ONK A;  3LPZ A;  1V54 E;  4UQX A;  4OAV B;  4NRH B;  5AJD A;  1NA3 A;  1D8E A;  2XZT G;  4LER A;  3VTY A;  4YVQ C;  3FTS A;  2WM9 A;  3DSX A;  5ENO D;  1BI8 B;  2EIL E;  2QZA A;  3BG0 B;  2Y3A A;  4Q96 A;  3SO8 A;  4J8Y A;  3MX3 A;  2WQ6 A;  2DZO A;  3R9M A;  3L82 A;  3Q9N C;  4I1M A;  2CHW A;  4DX7 D;  4WNE A;  5EID A;  1MX4 A;  3E32 A;  3D9I A;  4GTM A;  4Q94 A;  1H6P A;  3ESK A;  3CV0 A;  2ION A;  3V30 A;  5LP0 A;  4TRQ A;  1H2T C;  3APC A;  1RW2 A;  3MKQ A;  4XKC A;  4HS2 A;  1QZ2 A;  5ANR A;  4Q69 A;  3JXJ A;  3FUN A;  5EX3 A;  1BI7 B;  1G3N B;  1IHB A;  3MA5 A;  5E76 A;  1S64 A;  5ENS D;  5T8I A;  3ZRH A;  3LY9 A;  2YNQ A;  3HXC A;  4A55 A;  5A6C A;  3QDN A;  3E37 A;  4D10 C;  3T5X A;  5E75 A;  2FI7 A;  3EHR A;  3JQ0 A;  3TWX A;  2AWI A;  3AG4 E;  2BKK B;  3TWU A;  2DZN A;  4RQI A;  3JCK C;  3X2Q E;  4UWL A;  3PRE A;  3FUE A;  4HQD A;  4A1S A;  4DLO A;  4AXH A;  3DEP A;  2R17 C;  5AYW D;  3L16 A;  2I1J A;  3TXN A;  4TUM A;  3BG1 B;  5KNH D;  4AY5 A;  1JUQ A;  2VYI A;  3KEZ A;  2ETC A;  4BES A;  1IKN D;  1UW4 B;  1VDY A;  2P9L G;  3UIP C;  4K5B A;  3EJN A;  3TWQ A;  2A5E A;  3L08 A;  3ASN E;  4CRW A;  2GRL A;  2J49 A;  2OV8 A;  4ANV A;  3PZD A;  5LCW C;  3UM1 A;  2KCK A;  2HR2 A;  3DSW A;  5D66 A;  4KT6 B;  3O4Z A;  5CRU A;  3NOC D;  2FF4 A;  4QFV A;  2VTB B;  3QOU A;  4H7Y A;  2V4H C;  3R9A B;  1KT0 A;  2LXL A;  3AJI A;  1OWN A;  3Q78 A;  2MYO A;  2KZT B;  1JCS A;  4CGW A;  3G2U A;  4U8Y D;  3KSQ A;  2A5U A;  1H6K A;  4LG6 A;  3SI5 A;  2OVB A;  1HO8 A;  2L6J A;  3ULQ A;  3VLE A;  3CVU A;  4F7A A;  3I5P A;  1SA5 A;  4CDN A;  3DXK G;  5FQ6 A;  3PZ2 A;  2YHE A;  2XGS A;  1KZO A;  2WXF A;  1ZU2 A;  1HF8 A;  2JLB A;  4GPK A;  2I6H A;  2VGY A;  2Y4U A;  3F6Q A;  4G25 A;  1N4Q A;  5HRY A;  3QWP A;  3LY8 A;  1H19 A;  1E8X A;  1FVF A;  3DRA A;  5AQB A;  2I1K A;  2IOS A;  3WG7 E;  3RJV A;  4CYM D;  4DPR A;  3UTM A;  1NA0 A;  4XE0 A;  3EUV A;  3CVX A;  4GTQ A;  3ISM C;  2BED A;  4J8E A;  3AS5 A;  5FJY A;  2L0T B;  4BET A;  2V0P A;  4I6G A;  2WXL A;  4HBD A;  4DJA A;  1IHG A;  3ZNG A;  3T8M A;  2IY0 C;  2GRN B;  2GW1 A;  3GZ2 A;  1TN6 A;  3QC1 A;  3I3N A;  4O60 A;  4CT0 A;  4BT8 A;  3OAW A;  3PRZ A;  2PM6 A;  5JMN D;  3EU9 A;  3HXF A;  1AP7 A;  4M3O A;  4J8F A;  3CK7 A;  3QK0 A;  5KJN A;  3UUX A;  1NI1 A;  4JZY A;  4APF A;  4UQY A;  2WXP A;  4N2S A;  2AW6 A;  3UMV A;  1V55 E;  2XS1 A;  2IOL A;  3B7T A;  3FU5 A;  1YA0 A;  4AOF A;  2C0L A;  4HLE A;  4A3V A;  4OVU A;  1E7U A;  3P2B A;  4MS6 A;  2XS8 A;  5ENQ D;  3DPD A;  3SBT B;  2L9B A;  4G26 A;  5EYP F;  3LJN A;  2X6J A;  2F8X K;  1TR4 A;  2LNI A;  4TXQ A;  5BW8 C;  4HXI A;  3KD7 A;  4UQZ A;  1JWG A;  4CEM A;  4JHK A;  4HRN A;  4J8S A;  4G8L A;  4LCT A;  3T5V A;  4DI4 A;  3ZU7 B;  4KXK B;  2Q7F A;  5AIJ A;  2LAH A;  1SVX A;  3Q7A A;  1HFA A;  2VGX B;  5BXU A;  3AG1 E;  3V2O A;  4U0Z A;  5CCL A;  2I2O A;  1E90 A;  3EDT B;  3LDZ A;  4HOU A;  3OXF A;  3R7Q A;  3TWR A;  3SGH A;  2P58 C;  3UIN C;  3B7B A;  2XPY A;  2WB2 A;  1OCC E;  1S70 B;  4EEC A;  1RZ4 A;  4U63 A;  4APO A;  3RSE G;  5FT9 A;  3TWS A;  1MYO A;  4U0S A;  1EF1 C;  5G2N A;  4HI9 A;  4CT4 A;  3FHE A;  5FIO A;  1O1S A;  2MRI A;  3Q47 B;  3B7R L;  5ENT D;  3LS8 A;  1YYH A;  2XPI A;  2UY1 B;  5KJL A;  1KZP A;  3TL5 A;  1TNB A;  3G2W A;  3PE3 A;  2LUH A;  4GMJ A;  4G23 A;  3U9W A;  4ANW A;  3FUH A;  3W9F A;  3C5R A;  3ASO E;  3CVP A;  3NBN B;  4HOQ A;  4E85 A;  2RG8 A;  3NZU A;  4X8Q A;  3LYA A;  4ZHB A;  2DBA A;  1UOH A;  3RK6 A;  2B0O E;  4B8A A;  2KM4 A;  3B7S A;  3FUD A;  4JVS A;  4JXT A;  3UX4 A;  2UWJ G;  4XI0 A;  2WQ7 A;  1WDY A;  4HOR A;  4EZK A;  1MZC A;  5T4Y A;  4I2W A;  2RD0 A;  4DI3 A;  1TJC A;  2IEJ A;  3IHV A;  2C2L A;  2FEZ A;  1N4P A;  3IBE A;  1K1A A;  3PS6 A;  4O6F A;  3U4T A;  4GYO A;  2XGM A;  4BT9 A;  2WXJ A;  4C9B B;  2OVF A;  4Y6W A;  3DXM G;  3HXD A;  3CVV A;  4GZ5 A;  5LCW J;  3J5P A;  4L2Y A;  4JPS A;  4TUU A;  4YDY A;  4F6R D;  5LFA A;  2KAT A;  3G2T A;  3C72 A;  1FT2 A;  2FO7 A;  3L13 A;  5FZS A;  3E34 A;  2KBX A;  4J0U A;  3LXU X;  3FEX A;  4WNG A;  3CQG B;  2YIN A;  4CGV A;  3MV3 B;  3RKV A;  3ZKJ A;  5FQ7 A;  1EYH A;  3P1U A;  1N9A A;  3ZFW A;  2VTB A;  3EIJ A;  3MJW A;  5JJ7 A;  2DCP A;  3CVY A;  3IKO B;  2E2E A;  2XCC A;  4PS7 A;  3Q75 A;  3AG3 E;  1H0A A;  1N0R A;  2WXQ A;  4RSY A;  2H6G A;  3NQP A;  4AV7 A;  1N95 A;  2X6K A;  1NL4 A;  1Y6I A;  1FCH A;  2VSO E;  4AEZ C;  3CLJ A;  3MCX A;  5JA4 D;  4DX1 A;  4KMO A;  5KWD A;  1UN8 A;  5LX8 A;  3N71 A;  3MKR A;  1N94 A;  2L0I A;  4P29 A;  4RG6 A;  1O1T A;  1H2U A;  1SZA A;  4HNA D;  1JCR A;  3PZ4 A;  2AXZ A;  5B1B E;  2F8Y A;  4KYO B;  4FC8 A;  4B93 B;  4WWO A;  3J5Q B;  4N5C A;  2CHX A;  3PDN A;  3UT4 A;  4URK A;  4G2V A;  1MHQ A;  4WND A;  3FU0 A;  1BPO A;  1N0Q A;  2CHZ A;  2AJA A;  4Y6C A;  3B95 A;  5CER B;  4GCO A;  2WQH A;  2MHK A;  5ARG A;  4MBG A;  5FIN A;  5EKQ D;  1H6O A;  3TAX A;  4K03 A;  3ASH A;  2QYJ A;  2XRZ A;  5M72 A;  2OCC E;  2GRP B;  5IY5 E;  4FLB A;  3DEO A;  5G04 J;  3PZ1 A;  3ZGQ A;  4BY6 A;  5ANL A;  2OOE A;  2IF4 A;  3JYS A;  3ZYL A;  3MEK A;  1KT1 A;  3T8K A;  2A4Z A;  1OCZ E;  3FH7 A;  3ABM E;  2J09 A;  3ZYM A;  4WAF A;  4IRU A;  3RRU A;  2NYJ A;  1TJF A;  3B13 A;  4DX6 D;  2XHE A;  5J08 A;  3KSL A;  1QBQ A;  4MKT A;  5JJT A;  3FTV A;  3FFL A;  4J6I A;  3C3O A;  3NOG D;  3PVL A;  4NIK A;  3GZS A;  4ILI A;  1N11 A;  4L9P A;  2PL2 A;  4C0M A;  4GTR A;  4L2L A;  2GGF A;  4NUR A;  5D2M C;  2FUL A;  3MKQ B;  4JW1 A;  5EX0 A;  4ILG A;  2XQ0 A;  5CED B;  2CG2 A;  1A5E A;  2P9K G;  1BU9 A;  3E30 A;  5JHA A;  2V5F A;  3CGH A;  3QAR A;  2JAB A;  4BER A;  5G04 C;  4U04 A;  4JB8 P;  5FWQ A;  4FUL A;  1PC2 A;  4LSZ E;  1U2V G;  3CHQ A;  3HIZ A;  5ARF A;  3SFZ A;  3VTX A;  4ANX A;  4IN3 B;  3FTU A;  3CST A;  3SY2 A;  5EIL A;  5G55 A;  2R03 A;  4GA1 A;  3FTX A;  3HXE A;  4NAC A;  1ELW A;  2CFU A;  4C48 B;  4ZFH A;  2V4L A;  4O1O A;  2IO2 C;  3PH0 C;  5JJ6 A;  5C2Y A;  2FBN A;  3SZ7 A;  5KJK A;  4CDM A;  2EIN E;  3ZIM A;  5AJL A;  1TNZ A;  4ATG A;  4GTP A;  1U3D A;  4F3V A;  3CHP A;  3ULY A;  3QB2 A;  3KAE A;  2WMO A;  3Q9U C;  2B6C A;  1OWM A;  3ZPJ A;  3ZXS A;  4LNB A;  2R02 A;  5BUZ A;  4JEH A;  4AIF A;  3HXB A;  1DNP A;  2RKK A;  5DIZ A;  4U7E B;  1BLX B;  3TG5 A;  4AVX A;  2XCB A;  4I1A A;  1E8W A;  2R5S A;  5AQ9 A;  4QQI A;  3MZL B;  2WMN A;  3BQO A;  4KZC A;  2YQ8 A;  4I9C A;  4HFG A;  3CVW A;  2I9C A;  2V5Q C;  2RFM A;  3SQV A;  2NC9 A;  3EHM A;  4LNU D;  1IYG A;  4LRZ A;  3CHR A;  2DYS E;  1A17 A;  3ZYK A;  3CHM A;  1MJ0 A;  3ZYQ A;  4BSX A;  4EBA A;  3G2V A;  3JUI A;  4XKB A;  5CEC B;  1OUV A;  4TV3 A;  1PAQ A;  2P9P G;  1AWC B;  3CK8 A;  3R7R A;  3BU8 A;  4FA6 A;  2QY7 A;  4MLP A;  2BUG A;  2VGX A;  2CG3 A;  3UI2 A;  4ABN A;  1DVP A;  4XX5 A;  3DSU A;  2PM7 A;  4LUN U;  4HLL A;  2P2C P;  5AQ7 A;  3L6A A;  3DPY A;  3B7U X;  1O5M A;  1TNO A;  3DSS A;  2VSN A;  4OYS A;  3CKB A;  3AS4 A;  4BFR A;  2XGO A;  1EPU A;  4UI9 C;  4XI9 A;  4UWG A;  4C0E A;  3RO3 A;  1S0P A;  3GZ1 A;  4GA0 A;  5ENP D;  1Q2Z A;  3VLF A;  4M7C A;  4JA7 A;  2IQC A;  1JWF A;  5CMY A;  1SQM A;  1SA4 A;  3BEE A;  4ME2 A;  1X5B A;  3TG4 A;  1IXV A;  5CHE E;  4G11 A;  5FZR A;  2DIW A;  3IHY A;  4UI9 K;  3SD5 A;  3KEA A;  1OWP A;  3D9O A;  3LVQ E;  2GRM A;  2P9N G;  2ZGD A;  4MRU A;  3FUL A;  2OEV A;  4ILH B;  2R59 A;  3L9T A;  4TXR A;  2XPZ A;  3AU4 A;  2DVW A;  1MX6 A;  2QYU A;  4UWF A;  3FP3 A;  4GTS A;  2E0I A;  2AVP A;  2BF0 X;  3DSV A;  3PNL B;  4HVB A;  1IQR A;  2IFU A;  4U95 D;  3DBS A;  3ZVV A;  2XEN A;  5AQA A;  4EZJ A;  4LEU A;  4AP2 A;  3V31 A;  1BD8 A;  2H6F A;  5JHB A;  2BKG A;  4GU5 A;  3APF A;  2ETA A;  1B89 A;  4I6E A;  3W9G A;  2R05 A;  3EHQ A;  4U0U A;  5CEA A;  2WXN A;  4UWK A;  1QNF A;  3FU3 A;  4N39 A;  3FH5 A;  3CKC A;  1D8D A;  4PS3 A;  2VSY A;  4RVB A;  3FUJ A;  3LJ3 A;  1DC2 A;  2IJG X;  4DRX E;  2X6H A;  5A7D B;  2KC7 A;  3BUA A;  4CCA A;  4EQF A;  4U96 D;  4GYW A;  1JPL A;  4GZ3 A;  3URZ A;  1WM5 A;  5B3S E;  4KBQ A;  3PUJ A;  1NZN A;  1UJJ A;  2GRQ B;  5J90 A;  4GZ6 A;  5ENN A;  4B89 A;  3D3M A;  3D9K A;  2OEW A;  2X3M A;  2XEE A;  4PUC A;  4YVO A;  3RU0 A;  2LSV A;  1ZB1 A;  5HKP A;  1TEZ A;  2WXG A;  2XEH A;  2OND A;  2WXI A;  2QC9 A;  3ML8 A;  1NFI E;  3FU6 A;  1N4R A;  2VQ2 A;  3OTN A;  4BSZ B;  4G24 A;  4IUL A;  2KZT A;  5T3R A;  1MX2 A;  4FU3 A;  3VLD A;  4J8D A;  5FQ4 A;  3D9N A;  1W3B A;  2P9S G;  4CDR A;  4A1G A;  4U8V D;  3PEV B;  4GTT A;  2V8S E;  4FAD A;  5CCM A;  1UN9 A;  4N3A A;  3D9J A;  3ULE G;  2NSZ A;  5ITZ F;  3UPV A;  5HI7 A;  2Y69 E;  1OWO A;  4HRM B;  2LAI A;  3O48 A;  4WWP A;  3U64 A;  4GYY A;  3MGB A;  3GW4 A;  4N2Q A;  3S7J A;  2AXV A;  1QYM A;  3LVR E;  4FJY A;  4WNF A;  5BT1 A;  4DLQ A;  4WWN A;  4G8K A;  4GML A;  3SBS A;  4K5C A;  3D9H A;  1Z5S C;  4L1B A;  3I4G A;  5BXO A;  3LKU A;  2MOW A;  3PE4 A;  4NQ0 A;  1HS6 A;  3CIA A;  1NP7 A;  3QJZ A;  4GMR A;  3L54 A;  3UQ3 A;  3Q4A B;  1PY1 A;  3D9P A;  4ACL A;  3QWV A;  3ZEF A;  4FP7 A;  2R2L A;  2J08 A;  3QKY A;  3TGO A;  1HE8 A;  2WXO A;  4U8H A;  3NB2 A;  4XZ4 A;  1IQU A;  2X38 A;  2WVI A;  3RO2 A;  4JHJ A;  5EN5 D;  2AXU A;  1ELK A;  4A63 B;  3OXL A;  3ZXP A;  4ACK A;  5LOZ A;  1YMP A;  5KCM A;  1P5Q A;  3L22 A;  3KS2 A;  3HVE B;  2Y0B G;  2F37 A;  4FJZ A;  1E96 B;  1TN7 A;  3UT8 A;  4EBA G;  3C98 A;  3Q73 A;  4N3B A;  5CBN A;  2F0Y A;  3UKU G;  4BTB A;  5FQ8 A;  3WXX A;  4W9R A;  3AAA C;  4N3C A;  5BPP A;  4AY6 A;  1INZ A;  3FUM A;  1XNF A;  1SW6 A;  4I43 A;  2L6B A;  4I9E A;  5H7P A;  5HS0 A;  1K8K G;  2C0M A;  4F1S A;  3TWT A;  2WXM A;  5A23 A;  3CR3 A;  4I1O B;  3HDX A;  5B1A E;  2EIK E;  2HO1 A;  2KXP C;  3E4B A;  4BEP A;  5FZQ A;  4PS8 A;  3FTW A;  2Y1L E;  3Q15 A;  5DBK A;  4EZL A;  5EDS A;  2HYZ A;  3QNK A;  3LEW A;  3Q5M A;  4GA2 A;  4JHR A;  2Y4T A;  5CMW A;  3APD A;  3IEG A;  4DX2 A;  4N5Q A;  1K3Z D;  4FHJ A;  4OAU C;  2J4D A;  5BNW A;  1Z3Y A;  2ZIR A;  3UKR G;  1FPP A;  3DST A;  3UXG A;  3CSF A;  4GZC A;  3ASD A;  3D9L A;  1GW6 A;  4L23 A;  2GRR B;  2XRY A;  3SFX A;  3FTY A;  4JA9 A;  3FUI A;  1Z3X A;  5AAO A;  3FY4 A;  4U07 A;  4GPM A;  2X6I A;  4YDE A;  2X6F A;  4OVV A;  2LXM A;  1TNY A;  2UY1 A;  1HU3 A;  4JD2 G;  3TWW A;  3PZ3 A;  4HOS A;  2ZU6 B;  2ZXW E;  2IU1 A;  3UIO C;  1L5J A;  5ENR D;  2PNN A;  3ABL E;  3ZN3 A;  5HQ8 A;  2FO1 E;  1N52 A;  4F1P A;  3ZHE A;  1E8Z A;  5AAR A;  4HI8 A;  3AS8 A;  1Y8M A;  3HHM A;  3ML9 A;  3IXE A;  2EQX A;  3PUK A;  4YND A;  3ASG A;  1FVH A;  2PQN A;  1OT8 A;  2RFA A;  2J4B A;  3FDH A;  1JCQ A;  2NXP A;  4RG9 A;  2LSU A;  2BTD A;  2IO3 C;  3LCA A;  2JEK A;  4BX8 A;  3TXM A;  2XZD G;  1X81 A;  5CRV A;  4UI9 J;  1HXI A;  4KVM A;  3NF1 A;  1WG0 A;  5EIB E;  1OY3 D;  1TN8 A;  4GB9 A;  3G2S A;  2J9Q A;  4DX5 D;  2P9U G;  1KLX A;  3GYZ A;  2EIM E;  3MYV A;  3NZS A;  4JEU A;  4XEI G;  1N54 A;  3HRA A;  4JC8 A;  2ILR A;  3EHN A;  4Z68 A;  4HRL A;  3S7D A;  3CVN A;  3S2A A;  3CEQ A;  1D9S A;  2KCV A;  3ABK E;  4GAA A;  2VSX E;  4KVO A;  5FTP A;  1XGW A;  4WUY A;  3TWV A;  4XIF A;  3T9K A;  1FT1 A;  3CK9 A;  3S7F A;  2WXR A;  4B8C B;  4PDX A;  4ATZ D;  4B94 A;  3FWV A;  5BV1 A;  2WPV A;  3ZW3 A;  4PH4 B;  3FH8 A;  1OXJ A;  5KBA A;  5D0O D;  1QQE A;  3ONL A;  4BTA A;  4E6H A;  2J07 A;  3HYM B;  4GTO A;  3MV2 B;  2WXH A;  3PNT B;  1S63 A;  3DWL G;  3EIQ C;  4K0R A;  1O1R A;  3UM3 A;  3AG2 E;  1TYQ G;  3ENE A;  1MQS A;  3U3W A;  3C3Q A;  1ELR A;  1LD8 A;  2GRO B;  4H7X A;  2J8S D;  1HG2 A;  1LF8 A;  2ZIS A;  1WAO 1;  4K5A B;  3C3R A;  1UG3 A;  4EPZ A;  1UJK A;  2YHC A;  3V79 K;  1LTX A;  4F53 A;  1KPS B;  1K1B A;  3RRM B;  1Z6T A;  3SHF A;  5KNG A;  3UM0 A;  2LO6 A;  3CVL A;  2EIJ E;  4V3I A;  3Q79 A;  3SNX A;  4LNG A;  3OXG A;  3AU5 A;  3EU5 A;  5AN8 A;  5G05 C;  4ANU A;  5G05 J;  3S7B A;  4A3T A;  2PZI A;  4BWR A;  4FLH A;  1EDU A;  1OWL A;  5EYL A;  4IYP A;  2XEV A;  5BV0 A;  3L17 A;  4R7L A;  5C1D A;  3FUK A;  2ZGG A;  4O1P A;  3ASF A;  4UWH A;  3IV0 A;  4I6J A;  2HE0 A;  3D9M A;  2QFC A;  2DWZ A;  3NAW A;  4CZ2 D;  3SF4 A;  1DCE A;  3JUE A;  4YDW A;  5D0Q D;  3SFY A;  3Q49 B;  3FEY A;  1HG5 A;  3CVQ A;  3LY7 A;  4HOT A;  4TXP A;  3ESL A;  1SZ9 A;  2KCL A;  2VJ8 A;  3CHO A;  1E7V A;  4KZ0 A;  4I2Z A;  3FUF A;  1N4S A;  1OCR E;  2M63 A;  4G1T A;  5KJM A;  3HG0 D;  1WY6 A;  4I17 A;  2ETB A;  3U66 A;  1HX8 A;  1HZ4 A;  3JQ1 A;  2VGE A;  1TNU A;  3K9I A; 
#chains in the Genus database with same CATH homology
 5B3S E;  3ABK E;  5B1B E;  3WG7 E;  3AG3 E;  3X2Q E;  1OCO E;  3ABL E;  2EIM E;  1V54 E;  3AG2 E;  1OCZ E;  2DYS E;  2EIN E;  3ABM E;  2OCC E;  1V55 E;  5IY5 E;  1OCC E;  2Y69 E;  2EIL E;  3AG4 E;  3AG1 E;  3ASN E;  2DYR E;  2EIJ E;  1OCR E;  2ZXW E;  3ASO E;  5B1A E;  2EIK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...