2DYSE

Bovine heart cytochrome c oxidase modified by dccd
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures and physiological roles of 13 integral lipids of bovine heart cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 43
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2006-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2dysE00
2Y69E 1V54E 3X2QE 2OCCE 2DYRE 2EILE 5IY5E 1OCZE 3ABKE 3ABME 2EIME 2EINE 3AG4E 1V55E 3AG2E 5B3SE 5B1BE 2DYSE 3ABLE 3AG1E 1OCOE 3ASOE 2EIKE 3WG7E 5B1AE 1OCCE 3ASNE 2EIJE 2ZXWE 3AG3E 1OCRE
chains in the Genus database with same CATH superfamily
4LCTA 3UT8A 4NURA 2V5QC 3Q49B 3UIOC 4AIFA 4A63B 2R03A 3ZU7B 4ABNA 1OWPA 2A5EA 3LJ3A 3D3MA 4O60A 1WG0A 4APFA 1KLXA 3L08A 3NB2A 3QDNA 4ATGA 2J07A 3O4ZA 3B7UX 2ZIRA 1DCQA 2ZGDA 4HBDA 3CR3A 3QC1A 4FHKA 3BG1B 3NOGD 3PREA 1TYQG 3IHVA 3CK9A 5B3SE 2DZOA 3CVQA 4LEUA 3PNTB 1Z3XA 5AQ9A 2WXMA 5C2YA 5JA4D 3ABLE 3P1UA 3KSLA 3CVWA 5BV1A 4GA0A 5B1AE 2P58C 4BWRA 1S64A 2AXVA 4LERA 3LY9A 3ABME 2XGMA 2EINE 3SHFA 3T5VA 4CYMD 5FZSA 5EKQD 3SD5A 4GTVA 4PH4B 3AG3E 4G23A 1N94A 1SA5A 4JA9A 2OCCE 4X8QA 2AJAA 1WDYA 2OOEA 2OEWA 4MRUA 3AS4A 3JYSA 3W9GA 5LP0A 4GZ6A 2Q7FA 2IO2C 3B7TA 3SQVA 2M63A 3D9NA 3GZ2A 4CDRA 3AAAC 2J8SD 2H6GA 3UIPC 5BT1A 3JQ1A 1MX2A 4E85A 5JJ6A 4HRMB 4JW1A 2HR2A 5A7DB 4CRWA 4ZFHA 1G3NB 4UWHA 3V2XA 4MBGA 2R59A 2VSNA 4B0ZA 4F6RD 4L23A 3QB2A 5D0QD 2B0OE 3D9LA 2KCVA 4ILGA 4HORA 2GGFA 4TXPA 4UQXA 2X3MA 5B1BE 3SBSA 3IXEA 2RFAA 3UXGA 4ME2A 1IYGA 3PE3A 4GTOA 3LY7A 5KBAA 3R7RA 3ONLA 2KM4A 2VJ8A 3ASDA 3ZGQA 1OCZE 4Q96A 3RIBA 4C0MA 4CCAA 2KZTA 3DSTA 3NZSA 4LNUD 2RKKA 1PY1A 5ENOD 3CIAA 5D66A 5AQAA 3MX3A 4FC8A 5HS0A 4XZ4A 2LAHA 1YMPA 5AYWD 5ITZF 4L2LA 3ZW3A 2IQCA 3R7QA 1N54A 2MHKA 4YNDA 1OUVA 3D9JA 4TV3A 3RO2A 1OWNA 3OXFA 2VSOE 4DX6D 3Q79A 3EU5A 4JXTA 2ETBA 3RAUA 1BD8A 2ONDA 2VGXB 2VGXA 1UOHA 4U8YD 5AENA 5CECB 5FTPA 4CGWA 4F7AA 2IY0C 3CGHA 4U7EB 1A17A 1YYHA 4EQFA 3NF1A 1OWLA 1WAO1 5G05C 4JD2G 4EZJA 1AWCB 1NP7A 5KJLA 2BF0X 4EBAA 3FTXA 3AJIA 4TUUA 4R7LA 3FUKA 2HO1A 5EYPF 2F8XK 3TG4A 3FH5A 4UI9K 2X6FA 3TWUA 4JEHA 4PUCA 3CSFA 2VSYA 3L13A 3VTXA 2LSUA 4OVVA 4FP7A 1MQSA 4WNGA 1SZ9A 3ESKA 4BT9A 3E32A 3S7JA 3QWWA 2IJGX 5BNWA 2LSVA 4J8EA 4G2VA 1K3ZD 3PZ4A 1D8EA 1TNBA 3VLEA 2IONA 5JHBA 1FPPA 3B7BA 2WXLA 3ZFWA 3B7SA 4DX2A 3Q7AA 3FU3A 2XHEA 3U9WA 3LVQE 3HXCA 2I9CA 3EHQA 4AXHA 4BFRA 3CHQA 2KATA 1TN6A 5JJ7A 3ISMC 1U3DA 2EIJE 3DXKG 4IRUA 4GZ3A 5KNHD 4I9EA 4HOSA 4FA6A 2V5FA 3TXNA 3G2TA 1HXIA 2I6HA 1N4QA 1HX8A 4BX8A 3MEKA 4HOUA 2I2OA 3NOCD 4RG9A 4J8DA 3UMVA 4C9BB 4JZYA 2CFZA 3ASHA 5BUZA 4IYPA 1N0RA 2XCCA 3KEAA 2DIWA 5ENSD 1JPLA 4Z68A 1OWOA 4KVMA 5G2NA 4FU3A 3FEYA 4GZCA 5EX3A 3Q78A 2P9SG 5G05J 4K5CA 3ZVVA 4LNGA 2IFUA 3QWVA 1ELWA 3NZUA 4J7WA 2WB2A 3QK0A 4I1OB 1ZBPA 4UI9J 4AV7A 3CHOA 2OV8A 4BY6A 2KXPC 2OVBA 1H0AA 3T9KA 2XEVA 4AY6A 3FU0A 3DSXA 5FT9A 2P2CP 4N3AA 1E96B 4TRQA 5AQBA 4GZ5A 3D9HA 5G55A 2WQ6A 2F8YA 4JB8P 4BSXA 1MJ0A 4FJZA 1HO8A 3HIZA 1OCOE 4G8KA 4TXQA 2P9NG 1NZNA 1U3CA 2X6HA 1FCHA 5ENPD 3TWSA 5CEAA 3UTMA 1N0QA 2XS1A 4HNAD 1FVFA 3TXMA 4AM9A 2GRQB 1NA0A 5FJYA 3AU5A 3T8MA 4B89A 4HOTA 3MV3B 4A3TA 4JPSA 2DBAA 4B8AA 2PNNA 3RRNB 3IHYA 4G26A 4U0UA 4NIKA 3C3RA 3D9OA 1MHQA 1LD8A 3CLJA 4K5BA 3DPDA 4K0RA 4PS7A 3I4GA 4KZCA 2NXPA 2VTBA 5FQ7A 4ATZD 3ZUVB 3U3WA 3Q4AB 1HH8A 3SNXA 4ANVA 4HI9A 2GRNB 4M3OA 1EPUA 1E7VA 2JEKA 3ZPJA 1ZB1A 3EDTB 4RSYA 5G04J 2R17C 1K1BA 4J8FA 4AP2A 5EN5D 5ARFA 4UWFA 1NI1A 2DYRE 1OY3D 3C3QA 4MKTA 5T8IA 4C0EA 1Y8MA 3DWLG 3FTVA 3W9FA 1JUQA 2E0IA 3HXEA 4E6HA 4GAAA 3D9KA 2BKGA 1DCEA 4N3CA 3FU5A 2IO3C 3CVUA 4N5CA 2QYUA 3FTUA 3ZEFA 1E8YA 1Z5SC 2A4ZA 4G11A 3BEEA 4ANWA 2LNIA 4F1SA 4N3BA 2L0TB 5CRUA 1LD7A 3I5PA 1DC2A 5C1DA 2FULA 3L6AA 3N71A 5E76A 4DX5D 4DX1A 1N9AA 4D10C 4WNDA 1OT8A 3IKOB 4I2WA 4UQZA 3TWRA 5EIBE 1HFAA 4ANXA 3P2BA 4OYSA 4J0UA 3C5RA 2RG8A 5AAOA 3DEOA 3ABKE 4J8YA 4WWNA 4BESA 3IBEA 2KC7A 5EILA 3C72A 5CBNA 2Y1LE 4G24A 4K03A 3MYVA 3NBNB 3CHPA 1N4SA 1H6PA 5KCMA 4BSZB 4AVXA 3ZIMA 4DJAA 1DVPA 3SFYA 3UM0A 2DWZA 3CVNA 4GYWA 3E37A 4CT0A 4XI0A 2ZGGA 1ELKA 1EYHA 4URKA 3DSWA 1WM5A 4HOQA 1FT1A 1TEZA 2XPZA 4FLHA 3GZSA 2H6IA 1H2TC 3UI2A 3Q47B 1HU3A 4V3IA 2QFCA 4I1MA 4XEIG 3EHNA 1UJKA 4RQIA 2P9IG 1S63A 3OTNA 5ANLA 3FUDA 3UPVA 4F3VA 1PAQA 1WY6A 1JWGA 3HG0D 4OVUA 2GROB 4GCOA 3JXIA 3ULEG 4NACA 1JCRA 3UT4A 3ONKA 2WPVA 3CKBA 5E75A 4GTTA 4U8HA 2PZIA 3MV2B 1JCSA 3LDZA 3TJPA 3FUMA 4AJWA 4N2SA 3FULA 4YVQC 3JCKC 5JHAA 2B6CA 2KBXA 4GTRA 2YNQA 2EIME 1BPOA 3TG5A 5LFAA 3QAQA 4KYOB 1H6OA 5FWQA 3CKCA 2LO6A 3WG7E 5AN8A 1NA3A 3DRAA 3ZYQA 2FI7A 5BV0A 4GCNA 2OVFA 3ESLA 3SZ7A 3DSVA 2XGOA 4WNFA 4YDEA 4A1GA 1XGWA 4HS2A 1A5EA 3VLDA 3KAEA 5J08A 1KPSB 1YA0A 3F6QA 3ZHEA 1KT0A 3FUJA 1U2VG 3PVLA 4CDNA 2ILRA 2EQXA 5T3RA 4AOFA 2GRRB 2LXMA 3PZ3A 3QWPA 1OWMA 1TNUA 4DUIA 3CQGB 5AJDA 4DLOA 3GW4A 3VTYA 4DX7D 3LPZA 3U64A 5CBOA 4JHJA 3ZYLA 1Z3YA 5T4YA 4UWLA 3ZRHA 3S7BA 2DZNA 3OAWA 3FUFA 3HVEB 3J5PA 4HQDA 5ANRA 1FVHA 2P9PG 3RRMB 3PEVB 5CHEE 4OAVB 3Q5MA 4WAFA 4KMOA 1X81A 3QNKA 1E90A 4HFGA 2C0MA 1IHGA 2BTDA 3FUIA 5ENNA 4ANUA 4GYOA 1QBQA 3V2OA 1TJFA 4EBAG 2GRMA 3CVXA 2F0YA 1O1RA 4IN3B 3APCA 1LF8A 2X38A 4EPZA 2VTBB 1OCCE 3LYAA 1JCQA 2ETCA 1TR4A 3Q73A 4J6IA 3CVLA 5A23A 3CK7A 4A55A 3UM1A 3EU9A 4OAUC 1Q2ZA 4YDWA 3FUEA 1TJCA 3UKUG 1H2UA 1QYMA 2VGEA 1E7UA 2XS8A 1E8ZA 4BEPA 4DI4A 3FTSA 5FQ4A 2WXPA 3T8KA 2UWJG 3LEWA 2FO1E 2V0PA 3TWVA 4ACKA 4KT6B 4RLYA 5FZQA 2CHWA 3RO3A 4ACLA 1TNZA 1D8DA 1TNYA 5LCWC 3APDA 4NQ0A 3OXGA 2QC9A 3FTZA 4U0SA 4KZ0A 4M7CA 3RJVA 1NFIE 2XGSA 3PS6A 5IY5E 3ASFA 1EDUA 3G2VA 4HB5A 5EYLA 3UM2A 3CVPA 3MJWA 4GPMA 4GTQA 5LCWJ 2BKKB 4U0ZA 5AIJA 1ZU2A 3X2QE 4RVBA 4U8VD 3MZLB 4GA1A 2NYJA 3WXXA 3MKQA 4O6FA 5FQ6A 1E8XA 4KBQA 3PE4A 4LUNU 3EUVA 2AWIA 3D9IA 3ASNE 2LUHA 3NQPA 2FF4A 2XRYA 4WNEA 3FU6A 1N11A 4PDXA 2L0IA 4ILHB 5HKPA 3HXFA 2AXUA 3D9MA 3CK8A 3E30A 4BX9A 3PZ1A 2Y4UA 1BLXB 4WWPA 2AVPA 2Y0BG 5BW8C 3I3NA 3MKRA 3KSQA 3FDHA 4FHJA 4WWOA 3SFXA 2DVWA 3Q9NC 1HG2A 3HXDA 3UQ3A 3PUKA 4HLEA 3FUHA 5D2MC 3HHMA 3UUXA 2XEEA 4C48B 3FTWA 2CG3A 5FQ8A 2ZXWE 1E8WA 1OCRE 5EDSA 2BEDA 1MZCA 2R5SA 3NAWA 3R9MA 3HYMB 2R2LA 2ZISA 3E33A 5HRYA 4A3VA 2L6BA 3DSUA 1KZPA 2FEZA 4U96D 2FO7A 2OEVA 5ENRD 3TAXA 1O1TA 5CERB 2XRZA 4PS3A 4PS8A 5ARGA 1SQMA 4FLBA 5BPPA 4UWKA 3JUIA 4O1PA 3L9TA 3KD7A 4UWGA 4ZHBA 3ZNGA 3L82A 4CT4A 5HI7A 3V79K 2MRIA 3MKQB 2YHEA 2VSXE 4AEZC 3ASGA 1H6KA 1O5MA 4Y6WA 3QARA 2VQ2A 3GYZA 4BTAA 3FY4A 5ENQD 2WM9A 1QZ2A 3FEXA 3C98A 3PH0C 3MCXA 5A6CA 3L54A 3S7DA 1IHBA 1MYOA 3FH7A 2J49A 4DLQA 2GRLA 4NRHB 4Q94A 2J09A 3AG4E 3APFA 3AG2E 4APOA 4XKBA 1ELRA 3GZ1A 3L22A 4EECA 4HXIA 2CHXA 4GTMA 1HG5A 3E34A 3T5XA 3RKVA 5EIDA 2FBNA 2P9LG 2GW1A 3TWTA 2C2LA 4I6EA 3PEUB 4TUMA 2UY1A 1TN8A 3FUNA 4I2ZA 1S0PA 3S2AA 4B8CB 3PZDA 3CEQA 2VYIA 3G2WA 2JABA 2QYJA 4LSZE 1QNFA 3SY2A 2XQ0A 1V55E 5ENTD 1LTXA 2I1KA 4F1PA 3ZHEB 3LXUX 4AY5A 4YDYA 4G8LA 4MLPA 4XI9A 1HS6A 1Y6IA 3ZXPA 3O48A 2BUGA 2IF4A 3LKUA 3EHMA 4CGVA 2YINA 5FZRA 3HXBA 2J4DA 1HZ4A 2WQ7A 4A1SA 3D9PA 1V54E 3CQCB 3UX4A 2AXZA 2DYSE 2E2EA 1FT2A 3FTYA 2V8SE 3HVEA 5LX8A 4JVSA 5KJNA 2XZTG 4K5AB 4GYYA 1D9SA 4G25A 5FIOA 5J90A 2P9KG 3ULYA 4MS6A 4QFVA 2MOWA 4GTSA 4TXRA 2V4HC 2PM6A 1KT1A 2LXLA 5BXOA 2NC9A 4U07A 4BETA 4HRLA 3RSEG 5AQ7A 1XNFA 3Q9UC 3DEPA 3SBTB 4HRNA 3UINC 2H6HA 1H19A 4JHKA 1N4RA 2R02A 4Y6CA 4JEUA 2HM8A 3RRUA 4N39A 1X5BA 1K8KG 3ZKJA 2F37A 3EJNA 1SA4A 3LVRE 2A5UA 4GZDA 3TGOA 1O1SA 1IXVA 4QQIA 3ASOE 5DIZA 4B94A 2IEJA 5KWDA 2L6JA 4WUYA 2Y69E 4DPRA 4HI8A 3KS2A 1TNOA 2Y3AA 4U95D 4DK5A 4LG6A 5JJTA 1AP7A 3MGBA 3Q75A 2XEHA 2CG2A 3LJNA 1N4PA 2PM7A 4UI9C 4JA7A 1MX4A 2IOLA 3SO8A 3ML8A 3L17A 3BU8A 3R9AB 3TWXA 4YVOA 3Q7FA 3U4TA 1IQUA 4L7TA 1W3BA 5KNGA 2WMOA 1VDYA 3CHSA 3B95A 3LY8A 1H2VC 3RK6A 3FFLA 1TN7A 3SGHA 1GW6A 5CEDB 3TL5A 3V31A 3PNLB 3UT7A 4BTBA 2XPYA 1UN9A 4H7XA 4U63A 5JMND 4BT8A 2PQRA 1B89A 4FJYA 5EX0A 3SFZA 3AG1E 3JUEA 4W9RA 4I6JA 4UUCA 2X6IA 1EF1C 1UW4B 4JC8A 4GTPA 4CZ2D 3PRZA 2PL2A 4N5QA 2EIKE 3EIQC 3UKRG 3FWVA 4EZLA 2YQ8A 4L9PA 3MA5A 2I1JA 4L2YA 3B7RL 4I9CA 4GMLA 1SVXA 3BUAA 1UJJA 2KZTB 3G2SA 4GB9A 5G04C 3U66A 1P5QA 2Y4TA 4I17A 4B93B 3J5QB 1BI7B 2IOSA 2V4LA 4LRZA 3PUJA 4O1OA 3QJZA 3HDXA 2EILE 3BG0B 3B13A 5AARA 2H6FA 3G2UA 4GMJA 1DNPA 3TWWA 3CSTA 3JXJA 2LAIA 4I6GA 3IEGA 2CFUA 2WVIA 4UQYA 2CHZA 3JQ0A 4BERA 4DI3A 5CMYA 2XENA 2QY7A 1NL4A 1IKND 3V30A 1QQEA 1UN8A 2P9UG 3HRAA 4EZKA 2WXNA 2PQNA 4XIFA 4GMRA 5FINA 4XE0A 5M72A 2HYZA 3FHEA 4Q69A 2WXRA 4H7YA 3CHRA 5CMWA 2MYOA 4YDOA 4U04A 3DXMG 3VLFA 2WXIA 4I1AA 4ILIA 1RW2A 3DBSA 3SF4A 3ZYKA 2WXGA 2WXJA 3FP3A 4XKCA 3ML9A 2WXKA 1HF8A 4JHRA 4HVBA 5DBKA 4LNBA 2C0LA 2HE0A 3FH8A 2WXFA 1INZA 3I4RB 4GPKA 2XPIA 3AS5A 4RG6A 1N52A 1N95A 2J9QA 4GA2A 4XX5A 2ZU6B 4CEMA 4EHMA 1BI8B 3QOUA 3UM3A 2JLBA 3S7FA 2UY1B 3DPYA 4HLLA 3ENEA 3CVYA 3IV0A 2X6KA 2WXHA 1KZOA 1BU9A 5AJLA 3CV0A 3AU4A 2WMNA 1SZAA 2KCLA 5H7PA 3URZA 5LOZA 3QKYA 2X6JA 4J8SA 1UG3A 2VGYA 3RU0A 3DSSA 5BXUA 2RD0A 2KCKA 2XCBA 1K1AA 5HQ8A 3ZXSA 5KJMA 3KEZA 1IQRA 2XZDG 4FULA 4GU5A 3EIJA 2AW6A 1HE8A 5CCMA 1RZ4A 3PZ2A 3C3OA 2J4BA 3ZYMA 2WXOA 2NSZA 4JL0A 3ULQA 5CRVA 3LS8A 3CHMA 1S70B 1PC2A 3E4BA 3SI5A 2DCPA 2R05A 3PDNA 2QZAA 3OXLA 4L1BA 3L16A 4KXKB 1YCSB 3K9IA 3LCAA 1OXJA 3BQOA 5KJKA 4KVOA 3ZN3A 2L9BA 3EHRA 1SW6A 4FADA 5D0OD 2IU1A 1Z6TA 4DRXE 4F53A 4N2QA 2GRPB 2WQHA 4I43A 3CVVA 2RFMA 2YHCA 3TWQA 2WXQA 1MX6A 5CCLA 4P29A 2J08A 1JWFA 3Q15A 4G1TA 4IULA 3AS8A 4CDMA 2ETAA 1L5JA
chains in the Genus database with same CATH topology
2Y69E 1V54E 3X2QE 2OCCE 2DYRE 2EILE 5IY5E 1OCZE 3ABKE 3ABME 2EIME 2EINE 3AG4E 1V55E 3AG2E 5B3SE 5B1BE 2DYSE 3ABLE 3AG1E 1OCOE 3ASOE 2EIKE 3WG7E 5B1AE 1OCCE 3ASNE 2EIJE 2ZXWE 3AG3E 1OCRE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y69 E;  1V54 E;  3X2Q E;  2OCC E;  2DYR E;  2EIL E;  5IY5 E;  1OCZ E;  3ABK E;  3ABM E;  2EIM E;  2EIN E;  3AG4 E;  1V55 E;  3AG2 E;  5B3S E;  5B1B E;  2DYS E;  3ABL E;  3AG1 E;  1OCO E;  3ASO E;  2EIK E;  3WG7 E;  5B1A E;  1OCC E;  3ASN E;  2EIJ E;  2ZXW E;  3AG3 E;  1OCR E; 
#chains in the Genus database with same CATH topology
 4LCT A;  3UT8 A;  4NUR A;  2V5Q C;  3Q49 B;  3UIO C;  4AIF A;  4A63 B;  2R03 A;  3ZU7 B;  4ABN A;  1OWP A;  2A5E A;  3LJ3 A;  3D3M A;  4O60 A;  1WG0 A;  4APF A;  1KLX A;  3L08 A;  3NB2 A;  3QDN A;  4ATG A;  2J07 A;  3O4Z A;  3B7U X;  2ZIR A;  1DCQ A;  2ZGD A;  4HBD A;  3CR3 A;  3QC1 A;  4FHK A;  3BG1 B;  3NOG D;  3PRE A;  1TYQ G;  3IHV A;  3CK9 A;  5B3S E;  2DZO A;  3CVQ A;  4LEU A;  3PNT B;  1Z3X A;  5AQ9 A;  2WXM A;  5C2Y A;  5JA4 D;  3ABL E;  3P1U A;  3KSL A;  3CVW A;  5BV1 A;  4GA0 A;  5B1A E;  2P58 C;  4BWR A;  1S64 A;  2AXV A;  4LER A;  3LY9 A;  3ABM E;  2XGM A;  2EIN E;  3SHF A;  3T5V A;  4CYM D;  5FZS A;  5EKQ D;  3SD5 A;  4GTV A;  4PH4 B;  3AG3 E;  4G23 A;  1N94 A;  1SA5 A;  4JA9 A;  2OCC E;  4X8Q A;  2AJA A;  1WDY A;  2OOE A;  2OEW A;  4MRU A;  3AS4 A;  3JYS A;  3W9G A;  5LP0 A;  4GZ6 A;  2Q7F A;  2IO2 C;  3B7T A;  3SQV A;  2M63 A;  3D9N A;  3GZ2 A;  4CDR A;  3AAA C;  2J8S D;  2H6G A;  3UIP C;  5BT1 A;  3JQ1 A;  1MX2 A;  4E85 A;  5JJ6 A;  4HRM B;  4JW1 A;  2HR2 A;  5A7D B;  4CRW A;  4ZFH A;  1G3N B;  4UWH A;  3V2X A;  4MBG A;  2R59 A;  2VSN A;  4B0Z A;  4F6R D;  4L23 A;  3QB2 A;  5D0Q D;  2B0O E;  3D9L A;  2KCV A;  4ILG A;  4HOR A;  2GGF A;  4TXP A;  4UQX A;  2X3M A;  5B1B E;  3SBS A;  3IXE A;  2RFA A;  3UXG A;  4ME2 A;  1IYG A;  3PE3 A;  4GTO A;  3LY7 A;  5KBA A;  3R7R A;  3ONL A;  2KM4 A;  2VJ8 A;  3ASD A;  3ZGQ A;  1OCZ E;  4Q96 A;  3RIB A;  4C0M A;  4CCA A;  2KZT A;  3DST A;  3NZS A;  4LNU D;  2RKK A;  1PY1 A;  5ENO D;  3CIA A;  5D66 A;  5AQA A;  3MX3 A;  4FC8 A;  5HS0 A;  4XZ4 A;  2LAH A;  1YMP A;  5AYW D;  5ITZ F;  4L2L A;  3ZW3 A;  2IQC A;  3R7Q A;  1N54 A;  2MHK A;  4YND A;  1OUV A;  3D9J A;  4TV3 A;  3RO2 A;  1OWN A;  3OXF A;  2VSO E;  4DX6 D;  3Q79 A;  3EU5 A;  4JXT A;  2ETB A;  3RAU A;  1BD8 A;  2OND A;  2VGX B;  2VGX A;  1UOH A;  4U8Y D;  5AEN A;  5CEC B;  5FTP A;  4CGW A;  4F7A A;  2IY0 C;  3CGH A;  4U7E B;  1A17 A;  1YYH A;  4EQF A;  3NF1 A;  1OWL A;  1WAO 1;  5G05 C;  4JD2 G;  4EZJ A;  1AWC B;  1NP7 A;  5KJL A;  2BF0 X;  4EBA A;  3FTX A;  3AJI A;  4TUU A;  4R7L A;  3FUK A;  2HO1 A;  5EYP F;  2F8X K;  3TG4 A;  3FH5 A;  4UI9 K;  2X6F A;  3TWU A;  4JEH A;  4PUC A;  3CSF A;  2VSY A;  3L13 A;  3VTX A;  2LSU A;  4OVV A;  4FP7 A;  1MQS A;  4WNG A;  1SZ9 A;  3ESK A;  4BT9 A;  3E32 A;  3S7J A;  3QWW A;  2IJG X;  5BNW A;  2LSV A;  4J8E A;  4G2V A;  1K3Z D;  3PZ4 A;  1D8E A;  1TNB A;  3VLE A;  2ION A;  5JHB A;  1FPP A;  3B7B A;  2WXL A;  3ZFW A;  3B7S A;  4DX2 A;  3Q7A A;  3FU3 A;  2XHE A;  3U9W A;  3LVQ E;  3HXC A;  2I9C A;  3EHQ A;  4AXH A;  4BFR A;  3CHQ A;  2KAT A;  1TN6 A;  5JJ7 A;  3ISM C;  1U3D A;  2EIJ E;  3DXK G;  4IRU A;  4GZ3 A;  5KNH D;  4I9E A;  4HOS A;  4FA6 A;  2V5F A;  3TXN A;  3G2T A;  1HXI A;  2I6H A;  1N4Q A;  1HX8 A;  4BX8 A;  3MEK A;  4HOU A;  2I2O A;  3NOC D;  4RG9 A;  4J8D A;  3UMV A;  4C9B B;  4JZY A;  2CFZ A;  3ASH A;  5BUZ A;  4IYP A;  1N0R A;  2XCC A;  3KEA A;  2DIW A;  5ENS D;  1JPL A;  4Z68 A;  1OWO A;  4KVM A;  5G2N A;  4FU3 A;  3FEY A;  4GZC A;  5EX3 A;  3Q78 A;  2P9S G;  5G05 J;  4K5C A;  3ZVV A;  4LNG A;  2IFU A;  3QWV A;  1ELW A;  3NZU A;  4J7W A;  2WB2 A;  3QK0 A;  4I1O B;  1ZBP A;  4UI9 J;  4AV7 A;  3CHO A;  2OV8 A;  4BY6 A;  2KXP C;  2OVB A;  1H0A A;  3T9K A;  2XEV A;  4AY6 A;  3FU0 A;  3DSX A;  5FT9 A;  2P2C P;  4N3A A;  1E96 B;  4TRQ A;  5AQB A;  4GZ5 A;  3D9H A;  5G55 A;  2WQ6 A;  2F8Y A;  4JB8 P;  4BSX A;  1MJ0 A;  4FJZ A;  1HO8 A;  3HIZ A;  1OCO E;  4G8K A;  4TXQ A;  2P9N G;  1NZN A;  1U3C A;  2X6H A;  1FCH A;  5ENP D;  3TWS A;  5CEA A;  3UTM A;  1N0Q A;  2XS1 A;  4HNA D;  1FVF A;  3TXM A;  4AM9 A;  2GRQ B;  1NA0 A;  5FJY A;  3AU5 A;  3T8M A;  4B89 A;  4HOT A;  3MV3 B;  4A3T A;  4JPS A;  2DBA A;  4B8A A;  2PNN A;  3RRN B;  3IHY A;  4G26 A;  4U0U A;  4NIK A;  3C3R A;  3D9O A;  1MHQ A;  1LD8 A;  3CLJ A;  4K5B A;  3DPD A;  4K0R A;  4PS7 A;  3I4G A;  4KZC A;  2NXP A;  2VTB A;  5FQ7 A;  4ATZ D;  3ZUV B;  3U3W A;  3Q4A B;  1HH8 A;  3SNX A;  4ANV A;  4HI9 A;  2GRN B;  4M3O A;  1EPU A;  1E7V A;  2JEK A;  3ZPJ A;  1ZB1 A;  3EDT B;  4RSY A;  5G04 J;  2R17 C;  1K1B A;  4J8F A;  4AP2 A;  5EN5 D;  5ARF A;  4UWF A;  1NI1 A;  2DYR E;  1OY3 D;  3C3Q A;  4MKT A;  5T8I A;  4C0E A;  1Y8M A;  3DWL G;  3FTV A;  3W9F A;  1JUQ A;  2E0I A;  3HXE A;  4E6H A;  4GAA A;  3D9K A;  2BKG A;  1DCE A;  4N3C A;  3FU5 A;  2IO3 C;  3CVU A;  4N5C A;  2QYU A;  3FTU A;  3ZEF A;  1E8Y A;  1Z5S C;  2A4Z A;  4G11 A;  3BEE A;  4ANW A;  2LNI A;  4F1S A;  4N3B A;  2L0T B;  5CRU A;  1LD7 A;  3I5P A;  1DC2 A;  5C1D A;  2FUL A;  3L6A A;  3N71 A;  5E76 A;  4DX5 D;  4DX1 A;  1N9A A;  4D10 C;  4WND A;  1OT8 A;  3IKO B;  4I2W A;  4UQZ A;  3TWR A;  5EIB E;  1HFA A;  4ANX A;  3P2B A;  4OYS A;  4J0U A;  3C5R A;  2RG8 A;  5AAO A;  3DEO A;  3ABK E;  4J8Y A;  4WWN A;  4BES A;  3IBE A;  2KC7 A;  5EIL A;  3C72 A;  5CBN A;  2Y1L E;  4G24 A;  4K03 A;  3MYV A;  3NBN B;  3CHP A;  1N4S A;  1H6P A;  5KCM A;  4BSZ B;  4AVX A;  3ZIM A;  4DJA A;  1DVP A;  3SFY A;  3UM0 A;  2DWZ A;  3CVN A;  4GYW A;  3E37 A;  4CT0 A;  4XI0 A;  2ZGG A;  1ELK A;  1EYH A;  4URK A;  3DSW A;  1WM5 A;  4HOQ A;  1FT1 A;  1TEZ A;  2XPZ A;  4FLH A;  3GZS A;  2H6I A;  1H2T C;  3UI2 A;  3Q47 B;  1HU3 A;  4V3I A;  2QFC A;  4I1M A;  4XEI G;  3EHN A;  1UJK A;  4RQI A;  2P9I G;  1S63 A;  3OTN A;  5ANL A;  3FUD A;  3UPV A;  4F3V A;  1PAQ A;  1WY6 A;  1JWG A;  3HG0 D;  4OVU A;  2GRO B;  4GCO A;  3JXI A;  3ULE G;  4NAC A;  1JCR A;  3UT4 A;  3ONK A;  2WPV A;  3CKB A;  5E75 A;  4GTT A;  4U8H A;  2PZI A;  3MV2 B;  1JCS A;  3LDZ A;  3TJP A;  3FUM A;  4AJW A;  4N2S A;  3FUL A;  4YVQ C;  3JCK C;  5JHA A;  2B6C A;  2KBX A;  4GTR A;  2YNQ A;  2EIM E;  1BPO A;  3TG5 A;  5LFA A;  3QAQ A;  4KYO B;  1H6O A;  5FWQ A;  3CKC A;  2LO6 A;  3WG7 E;  5AN8 A;  1NA3 A;  3DRA A;  3ZYQ A;  2FI7 A;  5BV0 A;  4GCN A;  2OVF A;  3ESL A;  3SZ7 A;  3DSV A;  2XGO A;  4WNF A;  4YDE A;  4A1G A;  1XGW A;  4HS2 A;  1A5E A;  3VLD A;  3KAE A;  5J08 A;  1KPS B;  1YA0 A;  3F6Q A;  3ZHE A;  1KT0 A;  3FUJ A;  1U2V G;  3PVL A;  4CDN A;  2ILR A;  2EQX A;  5T3R A;  4AOF A;  2GRR B;  2LXM A;  3PZ3 A;  3QWP A;  1OWM A;  1TNU A;  4DUI A;  3CQG B;  5AJD A;  4DLO A;  3GW4 A;  3VTY A;  4DX7 D;  3LPZ A;  3U64 A;  5CBO A;  4JHJ A;  3ZYL A;  1Z3Y A;  5T4Y A;  4UWL A;  3ZRH A;  3S7B A;  2DZN A;  3OAW A;  3FUF A;  3HVE B;  3J5P A;  4HQD A;  5ANR A;  1FVH A;  2P9P G;  3RRM B;  3PEV B;  5CHE E;  4OAV B;  3Q5M A;  4WAF A;  4KMO A;  1X81 A;  3QNK A;  1E90 A;  4HFG A;  2C0M A;  1IHG A;  2BTD A;  3FUI A;  5ENN A;  4ANU A;  4GYO A;  1QBQ A;  3V2O A;  1TJF A;  4EBA G;  2GRM A;  3CVX A;  2F0Y A;  1O1R A;  4IN3 B;  3APC A;  1LF8 A;  2X38 A;  4EPZ A;  2VTB B;  1OCC E;  3LYA A;  1JCQ A;  2ETC A;  1TR4 A;  3Q73 A;  4J6I A;  3CVL A;  5A23 A;  3CK7 A;  4A55 A;  3UM1 A;  3EU9 A;  4OAU C;  1Q2Z A;  4YDW A;  3FUE A;  1TJC A;  3UKU G;  1H2U A;  1QYM A;  2VGE A;  1E7U A;  2XS8 A;  1E8Z A;  4BEP A;  4DI4 A;  3FTS A;  5FQ4 A;  2WXP A;  3T8K A;  2UWJ G;  3LEW A;  2FO1 E;  2V0P A;  3TWV A;  4ACK A;  4KT6 B;  4RLY A;  5FZQ A;  2CHW A;  3RO3 A;  4ACL A;  1TNZ A;  1D8D A;  1TNY A;  5LCW C;  3APD A;  4NQ0 A;  3OXG A;  2QC9 A;  3FTZ A;  4U0S A;  4KZ0 A;  4M7C A;  3RJV A;  1NFI E;  2XGS A;  3PS6 A;  5IY5 E;  3ASF A;  1EDU A;  3G2V A;  4HB5 A;  5EYL A;  3UM2 A;  3CVP A;  3MJW A;  4GPM A;  4GTQ A;  5LCW J;  2BKK B;  4U0Z A;  5AIJ A;  1ZU2 A;  3X2Q E;  4RVB A;  4U8V D;  3MZL B;  4GA1 A;  2NYJ A;  3WXX A;  3MKQ A;  4O6F A;  5FQ6 A;  1E8X A;  4KBQ A;  3PE4 A;  4LUN U;  3EUV A;  2AWI A;  3D9I A;  3ASN E;  2LUH A;  3NQP A;  2FF4 A;  2XRY A;  4WNE A;  3FU6 A;  1N11 A;  4PDX A;  2L0I A;  4ILH B;  5HKP A;  3HXF A;  2AXU A;  3D9M A;  3CK8 A;  3E30 A;  4BX9 A;  3PZ1 A;  2Y4U A;  1BLX B;  4WWP A;  2AVP A;  2Y0B G;  5BW8 C;  3I3N A;  3MKR A;  3KSQ A;  3FDH A;  4FHJ A;  4WWO A;  3SFX A;  2DVW A;  3Q9N C;  1HG2 A;  3HXD A;  3UQ3 A;  3PUK A;  4HLE A;  3FUH A;  5D2M C;  3HHM A;  3UUX A;  2XEE A;  4C48 B;  3FTW A;  2CG3 A;  5FQ8 A;  2ZXW E;  1E8W A;  1OCR E;  5EDS A;  2BED A;  1MZC A;  2R5S A;  3NAW A;  3R9M A;  3HYM B;  2R2L A;  2ZIS A;  3E33 A;  5HRY A;  4A3V A;  2L6B A;  3DSU A;  1KZP A;  2FEZ A;  4U96 D;  2FO7 A;  2OEV A;  5ENR D;  3TAX A;  1O1T A;  5CER B;  2XRZ A;  4PS3 A;  4PS8 A;  5ARG A;  1SQM A;  4FLB A;  5BPP A;  4UWK A;  3JUI A;  4O1P A;  3L9T A;  3KD7 A;  4UWG A;  4ZHB A;  3ZNG A;  3L82 A;  4CT4 A;  5HI7 A;  3V79 K;  2MRI A;  3MKQ B;  2YHE A;  2VSX E;  4AEZ C;  3ASG A;  1H6K A;  1O5M A;  4Y6W A;  3QAR A;  2VQ2 A;  3GYZ A;  4BTA A;  3FY4 A;  5ENQ D;  2WM9 A;  1QZ2 A;  3FEX A;  3C98 A;  3PH0 C;  3MCX A;  5A6C A;  3L54 A;  3S7D A;  1IHB A;  1MYO A;  3FH7 A;  2J49 A;  4DLQ A;  2GRL A;  4NRH B;  4Q94 A;  2J09 A;  3AG4 E;  3APF A;  3AG2 E;  4APO A;  4XKB A;  1ELR A;  3GZ1 A;  3L22 A;  4EEC A;  4HXI A;  2CHX A;  4GTM A;  1HG5 A;  3E34 A;  3T5X A;  3RKV A;  5EID A;  2FBN A;  2P9L G;  2GW1 A;  3TWT A;  2C2L A;  4I6E A;  3PEU B;  4TUM A;  2UY1 A;  1TN8 A;  3FUN A;  4I2Z A;  1S0P A;  3S2A A;  4B8C B;  3PZD A;  3CEQ A;  2VYI A;  3G2W A;  2JAB A;  2QYJ A;  4LSZ E;  1QNF A;  3SY2 A;  2XQ0 A;  1V55 E;  5ENT D;  1LTX A;  2I1K A;  4F1P A;  3ZHE B;  3LXU X;  4AY5 A;  4YDY A;  4G8L A;  4MLP A;  4XI9 A;  1HS6 A;  1Y6I A;  3ZXP A;  3O48 A;  2BUG A;  2IF4 A;  3LKU A;  3EHM A;  4CGV A;  2YIN A;  5FZR A;  3HXB A;  2J4D A;  1HZ4 A;  2WQ7 A;  4A1S A;  3D9P A;  1V54 E;  3CQC B;  3UX4 A;  2AXZ A;  2DYS E;  2E2E A;  1FT2 A;  3FTY A;  2V8S E;  3HVE A;  5LX8 A;  4JVS A;  5KJN A;  2XZT G;  4K5A B;  4GYY A;  1D9S A;  4G25 A;  5FIO A;  5J90 A;  2P9K G;  3ULY A;  4MS6 A;  4QFV A;  2MOW A;  4GTS A;  4TXR A;  2V4H C;  2PM6 A;  1KT1 A;  2LXL A;  5BXO A;  2NC9 A;  4U07 A;  4BET A;  4HRL A;  3RSE G;  5AQ7 A;  1XNF A;  3Q9U C;  3DEP A;  3SBT B;  4HRN A;  3UIN C;  2H6H A;  1H19 A;  4JHK A;  1N4R A;  2R02 A;  4Y6C A;  4JEU A;  2HM8 A;  3RRU A;  4N39 A;  1X5B A;  1K8K G;  3ZKJ A;  2F37 A;  3EJN A;  1SA4 A;  3LVR E;  2A5U A;  4GZD A;  3TGO A;  1O1S A;  1IXV A;  4QQI A;  3ASO E;  5DIZ A;  4B94 A;  2IEJ A;  5KWD A;  2L6J A;  4WUY A;  2Y69 E;  4DPR A;  4HI8 A;  3KS2 A;  1TNO A;  2Y3A A;  4U95 D;  4DK5 A;  4LG6 A;  5JJT A;  1AP7 A;  3MGB A;  3Q75 A;  2XEH A;  2CG2 A;  3LJN A;  1N4P A;  2PM7 A;  4UI9 C;  4JA7 A;  1MX4 A;  2IOL A;  3SO8 A;  3ML8 A;  3L17 A;  3BU8 A;  3R9A B;  3TWX A;  4YVO A;  3Q7F A;  3U4T A;  1IQU A;  4L7T A;  1W3B A;  5KNG A;  2WMO A;  1VDY A;  3CHS A;  3B95 A;  3LY8 A;  1H2V C;  3RK6 A;  3FFL A;  1TN7 A;  3SGH A;  1GW6 A;  5CED B;  3TL5 A;  3V31 A;  3PNL B;  3UT7 A;  4BTB A;  2XPY A;  1UN9 A;  4H7X A;  4U63 A;  5JMN D;  4BT8 A;  2PQR A;  1B89 A;  4FJY A;  5EX0 A;  3SFZ A;  3AG1 E;  3JUE A;  4W9R A;  4I6J A;  4UUC A;  2X6I A;  1EF1 C;  1UW4 B;  4JC8 A;  4GTP A;  4CZ2 D;  3PRZ A;  2PL2 A;  4N5Q A;  2EIK E;  3EIQ C;  3UKR G;  3FWV A;  4EZL A;  2YQ8 A;  4L9P A;  3MA5 A;  2I1J A;  4L2Y A;  3B7R L;  4I9C A;  4GML A;  1SVX A;  3BUA A;  1UJJ A;  2KZT B;  3G2S A;  4GB9 A;  5G04 C;  3U66 A;  1P5Q A;  2Y4T A;  4I17 A;  4B93 B;  3J5Q B;  1BI7 B;  2IOS A;  2V4L A;  4LRZ A;  3PUJ A;  4O1O A;  3QJZ A;  3HDX A;  2EIL E;  3BG0 B;  3B13 A;  5AAR A;  2H6F A;  3G2U A;  4GMJ A;  1DNP A;  3TWW A;  3CST A;  3JXJ A;  2LAI A;  4I6G A;  3IEG A;  2CFU A;  2WVI A;  4UQY A;  2CHZ A;  3JQ0 A;  4BER A;  4DI3 A;  5CMY A;  2XEN A;  2QY7 A;  1NL4 A;  1IKN D;  3V30 A;  1QQE A;  1UN8 A;  2P9U G;  3HRA A;  4EZK A;  2WXN A;  2PQN A;  4XIF A;  4GMR A;  5FIN A;  4XE0 A;  5M72 A;  2HYZ A;  3FHE A;  4Q69 A;  2WXR A;  4H7Y A;  3CHR A;  5CMW A;  2MYO A;  4YDO A;  4U04 A;  3DXM G;  3VLF A;  2WXI A;  4I1A A;  4ILI A;  1RW2 A;  3DBS A;  3SF4 A;  3ZYK A;  2WXG A;  2WXJ A;  3FP3 A;  4XKC A;  3ML9 A;  2WXK A;  1HF8 A;  4JHR A;  4HVB A;  5DBK A;  4LNB A;  2C0L A;  2HE0 A;  3FH8 A;  2WXF A;  1INZ A;  3I4R B;  4GPK A;  2XPI A;  3AS5 A;  4RG6 A;  1N52 A;  1N95 A;  2J9Q A;  4GA2 A;  4XX5 A;  2ZU6 B;  4CEM A;  4EHM A;  1BI8 B;  3QOU A;  3UM3 A;  2JLB A;  3S7F A;  2UY1 B;  3DPY A;  4HLL A;  3ENE A;  3CVY A;  3IV0 A;  2X6K A;  2WXH A;  1KZO A;  1BU9 A;  5AJL A;  3CV0 A;  3AU4 A;  2WMN A;  1SZA A;  2KCL A;  5H7P A;  3URZ A;  5LOZ A;  3QKY A;  2X6J A;  4J8S A;  1UG3 A;  2VGY A;  3RU0 A;  3DSS A;  5BXU A;  2RD0 A;  2KCK A;  2XCB A;  1K1A A;  5HQ8 A;  3ZXS A;  5KJM A;  3KEZ A;  1IQR A;  2XZD G;  4FUL A;  4GU5 A;  3EIJ A;  2AW6 A;  1HE8 A;  5CCM A;  1RZ4 A;  3PZ2 A;  3C3O A;  2J4B A;  3ZYM A;  2WXO A;  2NSZ A;  4JL0 A;  3ULQ A;  5CRV A;  3LS8 A;  3CHM A;  1S70 B;  1PC2 A;  3E4B A;  3SI5 A;  2DCP A;  2R05 A;  3PDN A;  2QZA A;  3OXL A;  4L1B A;  3L16 A;  4KXK B;  1YCS B;  3K9I A;  3LCA A;  1OXJ A;  3BQO A;  5KJK A;  4KVO A;  3ZN3 A;  2L9B A;  3EHR A;  1SW6 A;  4FAD A;  5D0O D;  2IU1 A;  1Z6T A;  4DRX E;  4F53 A;  4N2Q A;  2GRP B;  2WQH A;  4I43 A;  3CVV A;  2RFM A;  2YHC A;  3TWQ A;  2WXQ A;  1MX6 A;  5CCL A;  4P29 A;  2J08 A;  1JWF A;  3Q15 A;  4G1T A;  4IUL A;  3AS8 A;  4CDM A;  2ETA A;  1L5J A; 
#chains in the Genus database with same CATH homology
 2Y69 E;  1V54 E;  3X2Q E;  2OCC E;  2DYR E;  2EIL E;  5IY5 E;  1OCZ E;  3ABK E;  3ABM E;  2EIM E;  2EIN E;  3AG4 E;  1V55 E;  3AG2 E;  5B3S E;  5B1B E;  2DYS E;  3ABL E;  3AG1 E;  1OCO E;  3ASO E;  2EIK E;  3WG7 E;  5B1A E;  1OCC E;  3ASN E;  2EIJ E;  2ZXW E;  3AG3 E;  1OCR E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...