2DYSE

Bovine heart cytochrome c oxidase modified by dccd
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
105
structure length
105
Chain Sequence
b'HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures and physiological roles of 13 integral lipids of bovine heart cytochrome c oxidase
pubmed doi rcsb
molecule keywords Cytochrome c oxidase subunit 1
molecule tags Oxidoreductase
total genus 43
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2006-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2dysE00
2EILE 1V54E 5IY5E 3X2QE 2DYRE 1V55E 1OCZE 2ZXWE 5B1AE 3AG4E 2OCCE 2EIME 2EIJE 3AG2E 3ASOE 2DYSE 3AG1E 3ABKE 3ABLE 3ABME 3ASNE 3WG7E 2EINE 5B1BE 1OCRE 2EIKE 3AG3E 1OCOE 1OCCE 2Y69E 5B3SE
chains in the Genus database with same CATH superfamily
2HYZA 1N54A 4N5CA 1V55E 1IQUA 3LY8A 4KVOA 2UY1B 4U7EB 2EIME 2J9QA 1JCRA 4GYYA 4GTMA 4GAAA 5G04J 4MLPA 4U0ZA 3CVUA 2HO1A 2OVFA 2EINE 4K5BA 4GA0A 4JA9A 2Y4TA 4PH4B 4AY5A 3W9GA 4ATGA 4BESA 5CCLA 2QZAA 3CVXA 3TWQA 3SBSA 4U96D 3QWPA 3EHNA 4N5QA 4OVVA 3KSQA 3J5PA 1WAO1 1N95A 3D9LA 4AY6A 4ANXA 2MYOA 2L0IA 1OWPA 3TWXA 1QBQA 2DWZA 3CR3A 3FHEA 4MS6A 4L2LA 4I1MA 3FUHA 5FZRA 5FT9A 4ILHB 3SD5A 2XCBA 5DBKA 5FQ7A 3MKQA 3UM2A 1S0PA 4CGWA 2KATA 3RKVA 1KZPA 3ASFA 4Z68A 4I6EA 3D3MA 1MQSA 2XGMA 4AJWA 3D9HA 1FT1A 3HXDA 4JXTA 4K0RA 1BPOA 3ZHEA 3FU3A 3HHMA 4EECA 3AG3E 5CMYA 4UI9J 2I1KA 4GTQA 3UI2A 4U8HA 2XPYA 3FUDA 2DYRE 3Q75A 2JEKA 3B7RL 5EX0A 3JUIA 3ESKA 4I1AA 1JCQA 3OAWA 3DXKG 4RQIA 1IQRA 1HO8A 2XPIA 4HRMB 1NI1A 3UM3A 3CK7A 1E7UA 2J4BA 4KZ0A 5G55A 4NACA 4CGVA 3ZXSA 5LFAA 2VTBB 3NOGD 3MZLB 3ASHA 2P9UG 2IEJA 3PUJA 3FUFA 4BX9A 2B0OE 2LSVA 3S7JA 4YDWA 5D2MC 2AXZA 4GU5A 1TNOA 2I1JA 3V2XA 4HOTA 3ABKE 2KCKA 3F6QA 4TUMA 5CCMA 3QK0A 4L1BA 2QY7A 3ZIMA 2PL2A 2WXKA 2P9NG 2WXIA 3QWWA 4BERA 3K9IA 4J7WA 1HU3A 3MX3A 3IXEA 3B7UX 1H0AA 2F0YA 5BNWA 2R03A 3ESLA 3ZYQA 2XHEA 4GTTA 1OXJA 1V54E 1OWOA 1P5QA 5AJLA 4UWGA 1E8XA 4FJYA 2IOSA 3PZ4A 4X8QA 5JJ7A 1BU9A 2MHKA 5KBAA 4HI9A 1YMPA 2ZU6B 2A5EA 2X6JA 3GZ2A 1U3CA 4BTBA 1HX8A 4G2VA 2I2OA 4FP7A 4ANVA 2WXMA 3FDHA 5HS0A 5D0QD 3C72A 1ELRA 5LCWJ 2FI7A 1WG0A 3NB2A 4JVSA 3CKCA 3JQ0A 5ARFA 3EIQC 4MRUA 1EF1C 1W3BA 1EPUA 3CSFA 4OVUA 4DPRA 4B89A 5T8IA 4IRUA 3OXGA 3Q15A 1GW6A 4DX1A 3B13A 3U64A 1MX6A 3MKRA 4TXPA 3QC1A 5FQ4A 1JUQA 2J4DA 5FZQA 4WAFA 4WNDA 4LNGA 2WQ7A 4Y6CA 3ULYA 2FULA 3UUXA 3L08A 2KZTB 3FP3A 1SZ9A 5LX8A 1TNBA 3ASGA 2A4ZA 1JPLA 2LXMA 3T8MA 3APDA 3EDTB 4CT0A 4YVQC 3S2AA 2H6HA 2XEHA 2IOLA 3UTMA 5EX3A 3FUKA 4L2YA 5FQ8A 3G2WA 2PQRA 5BT1A 2WMNA 1H19A 3B7BA 4A55A 3RSEG 3CGHA 5E75A 3R7RA 5H7PA 4LEUA 4MKTA 2WXHA 3CHQA 1UOHA 2XCCA 2HR2A 1XGWA 3DSTA 3CK9A 3Q79A 2FO1E 4RG9A 4CEMA 4EBAA 3ABME 3FUNA 5KNHD 3Q73A 1N9AA 4GCNA 1JWFA 3LCAA 4UUCA 2A5UA 4I9CA 4J0UA 5AIJA 3L54A 1FVFA 2AWIA 4KT6B 3SO8A 4JL0A 3V31A 4Q94A 5FIOA 3NZSA 5AQAA 1TNYA 1E96B 3HXFA 3Q7AA 4J6IA 3EJNA 3CHPA 4H7YA 4UQXA 5CBOA 2JABA 5M72A 4AOFA 1Z6TA 4DX5D 1H2UA 3FULA 4HXIA 2VGEA 5T4YA 2CG2A 5KCMA 3UT4A 2F8YA 4CZ2D 3MKQB 3PZ3A 2WPVA 1IHBA 5ENRD 3UKRG 2B6CA 1PY1A 3ML9A 3PS6A 4WWPA 2WXNA 3V30A 3CK8A 2CFUA 3LY7A 5CHEE 2NSZA 3ZHEB 3VLEA 1KT1A 1BLXB 4GTSA 3KSLA 5EIBE 3CHSA 3N71A 4J8YA 2ETAA 5JA4D 3BU8A 4JZYA 3Q4AB 2R59A 1SZAA 4I9EA 4BSXA 2ZGGA 1SQMA 3FUMA 4Q69A 1OWNA 3E34A 4G26A 3CIAA 4HS2A 3PRZA 4NQ0A 1OCCE 3MV2B 5AAOA 4HBDA 2E2EA 4FLHA 4I43A 3FFLA 3CHRA 3QDNA 2J8SD 4HORA 4K5AB 3TWWA 5G04C 3T9KA 4GZ3A 4NIKA 3PEUB 3MYVA 4ANUA 4G23A 2XENA 1AP7A 3KS2A 1FPPA 5AJDA 3ZUVB 1N11A 4G8LA 3CKBA 3TXNA 4MBGA 4OAVB 2KZTA 2BKGA 5AN8A 3QJZA 3DSVA 4JEUA 1X5BA 2ONDA 3Q49B 4LSZE 4HLLA 4JHRA 2QFCA 3Q7FA 4CRWA 3EU9A 1VDYA 3DRAA 3E30A 4YVOA 4AXHA 3FH5A 3LVQE 3FEXA 3ZYKA 2IY0C 5HQ8A 4Q96A 4ILIA 5E76A 1UG3A 3JUEA 4A1GA 1X81A 4GMRA 1OY3D 5FTPA 4N39A 2V4LA 4A63B 3UPVA 3KAEA 1TNUA 3U4TA 2V5FA 3CSTA 1G3NB 4TV3A 4UI9C 2GGFA 5ENOD 5ANRA 2C0MA 3SGHA 5ENTD 4C0EA 3IHYA 1A5EA 2DYSE 2V5QC 2XS1A 3OXLA 1TR4A 4I6GA 3VTXA 4CYMD 4DRXE 4HRNA 3AU4A 2IO3C 2WXQA 3ZU7B 2X6FA 4WNFA 4UWKA 1OWMA 3PH0C 4JD2G 3CHOA 4I2ZA 2ETBA 5JHAA 2PZIA 4I1OB 3VTYA 4OYSA 4RLYA 2IJGX 3GYZA 4C48B 4HNAD 3I5PA 3T5VA 1D9SA 3G2SA 4DX7D 3KEAA 4H7XA 4AM9A 1IKND 4N3AA 2NXPA 3HVEB 3LY9A 3KD7A 1E8YA 3D9KA 4O1OA 2J08A 4L9PA 2DVWA 2IF4A 4F3VA 5A23A 3BUAA 3SF4A 4GPKA 1O1SA 4GTPA 2ZIRA 3LYAA 4EBAG 3QARA 3ASDA 1YCSB 4ABNA 4ANWA 1H6KA 3DWLG 4PS7A 4O60A 1Z5SC 3CHMA 3D9NA 1Z3XA 3FUEA 4APOA 1BI8B 5BV1A 5JMND 4XX5A 3ZGQA 2WXPA 3UM1A 3AU5A 4QQIA 3TG5A 4FC8A 4DJAA 4UQYA 1N4QA 2AW6A 3AG1E 5JJ6A 3VLDA 2XGSA 1QZ2A 2HM8A 2AXVA 5JHBA 3RJVA 4JC8A 4IN3B 4JW1A 4ZFHA 2WM9A 4HOQA 5EYLA 4ACKA 1SW6A 1OCZE 2PNNA 2XRZA 4FA6A 1Y6IA 3SQVA 1MZCA 4B93B 4I6JA 3FTYA 2FO7A 4U07A 1U3DA 5LCWC 3HYMB 4CDMA 3S7BA 3C3OA 2X6IA 2PM7A 4HOSA 3PREA 3PDNA 3TWUA 1DVPA 2C0LA 1TNZA 4V3IA 3SNXA 1TN7A 4IULA 4JPSA 4URKA 2VSXE 1E7VA 5EIDA 2KC7A 5B3SE 3EUVA 3TWTA 3HRAA 2BKKB 4UWHA 2WQ6A 4CDRA 2R5SA 1K3ZD 1LTXA 3FTWA 3Q9NC 1B89A 5C2YA 4ME2A 3IKOB 5BPPA 3D9MA 1TN6A 2F37A 1NP7A 3MV3B 3ZKJA 3OTNA 3UQ3A 3ZFWA 4K03A 3DSSA 3Q5MA 1MHQA 3RAUA 3V2OA 3ZEFA 1N4SA 3UMVA 2KCLA 4EZJA 2Y4UA 5AQ9A 1U2VG 5KNGA 2J07A 5CMWA 2NC9A 4J8DA 2X6HA 4Y6WA 1SVXA 3D9IA 3DEOA 3NQPA 4GA1A 3TAXA 3CVWA 4GYWA 1UN8A 4BETA 2RFAA 2LSUA 4G1TA 3HXBA 2MRIA 3NZUA 2DCPA 1EDUA 3ULEG 3CVYA 2IQCA 3OXFA 1KPSB 4WUYA 4W9RA 3UXGA 3EHMA 3HVEA 4B8CB 2H6GA 3CQGB 1UJKA 1ZBPA 4XI0A 3S7FA 3DPDA 3DPYA 3RK6A 4WNGA 2GRQB 3L17A 2XPZA 3FUJA 3RRUA 4FADA 4UQZA 3CVNA 3UKUG 3ZXPA 2OOEA 4DLQA 4DI4A 3GW4A 5EKQD 2XZTG 2VGYA 1INZA 3WXXA 4F53A 1NA3A 3V79K 3SHFA 2YQ8A 4F7AA 2CHZA 3P1UA 4EZLA 5HI7A 3UT8A 5ENSD 4CCAA 1AWCB 3JXIA 3RRMB 1ZB1A 2XEEA 2ZISA 4P29A 3D9PA 1DC2A 2GROB 4G25A 4J8SA 4KBQA 1E90A 1HXIA 3FU5A 4LERA 3ZVVA 3ZYLA 4HQDA 2I6HA 4GYOA 3FUIA 1OWLA 1YA0A 1IHGA 3T8KA 2WXOA 3JXJA 2L6BA 4E85A 3CVLA 4UI9K 1NA0A 1FVHA 1QNFA 2WXJA 1S63A 4GTOA 3AG2E 4HI8A 3QKYA 3PNTB 3C5RA 2WXLA 2VQ2A 3FTXA 3FH8A 5D0OD 4I17A 1PC2A 4E6HA 2XQ0A 4N3CA 3URZA 2EIJE 4BWRA 2VGXB 3QAQA 2QC9A 3LPZA 1N4RA 3DBSA 5KWDA 3TG4A 4A3TA 4WNEA 2H6IA 4DI3A 2GRMA 3LVRE 5ENQD 2VSYA 4KXKB 3SFXA 3AAAC 3SY2A 3ONKA 2OCCE 3U9WA 1TN8A 2XS8A 3E33A 3ZYMA 3WG7E 5BV0A 3E32A 2MOWA 3CVQA 2V4HC 2QYJA 3RRNB 3L9TA 5CRUA 4GCOA 1TJFA 4K5CA 2RD0A 1MYOA 3UIOC 4CT4A 1E8ZA 4YNDA 2KXPC 4FULA 4IYPA 1LF8A 4U63A 2RG8A 3ZPJA 5KJKA 4RSYA 4AP2A 3NF1A 3RO3A 3PZ1A 4CDNA 4N2QA 2R2LA 3GZ1A 1XNFA 4OAUC 2WQHA 3C3RA 3C98A 3G2VA 5A6CA 3QNKA 4DX6D 1KZOA 2H6FA 3ZRHA 4ACLA 5AQ7A 5IY5E 2DBAA 5G05J 2R17C 2FEZA 4B94A 3T5XA 3RO2A 4U0SA 2R02A 2NYJA 1UJJA 3TWRA 1FCHA 4AEZC 5C1DA 2VSOE 4N3BA 2UWJG 4GA2A 1SA4A 3B7TA 3NBNB 2FF4A 4DLOA 3AS4A 3R7QA 3TL5A 4B8AA 5CERB 5BXUA 4TXRA 5CEDB 2P9IG 5EDSA 4L7TA 1JWGA 5J90A 3EU5A 4HVBA 4WWNA 3BG0B 2P9SG 1MX2A 2XRYA 3U3WA 3W9FA 3PE4A 1QYMA 4G24A 1O1TA 3JCKC 4RG6A 3CEQA 4A1SA 4KYOB 3LJ3A 2BF0X 1IXVA 3RIBA 5KJLA 1K1BA 4J8FA 4BT9A 3CLJA 3MJWA 2RFMA 4I2WA 5EN5D 5AENA 1HFAA 1NFIE 5FJYA 5D66A 2KM4A 1UW4B 1HF8A 1JCSA 4C0MA 3BEEA 2X6KA 3HDXA 3E4BA 1MJ0A 2X3MA 2KBXA 3IV0A 5B1BE 3FTUA 3LJNA 1WDYA 2RKKA 3I3NA 3MGBA 4DX2A 3MEKA 3FTSA 3AG4E 4DUIA 3ASOE 2VGXA 3PZDA 3IHVA 3ASNE 2GRLA 2ILRA 2LXLA 1HG5A 3NOCD 2LAHA 2BEDA 2GRNB 1OT8A 1L5JA 4R7LA 4BEPA 4NURA 3Q47B 3FEYA 4GB9A 4JEHA 1E8WA 2V0PA 3FU6A 4HOUA 4JHKA 3PUKA 2ETCA 1FT2A 3CV0A 3APCA 3DSUA 4HFGA 2WMOA 3UIPC 4BTAA 4XIFA 2YINA 2Q7FA 1RW2A 3C3QA 5JJTA 3HIZA 5BW8C 4GTVA 1DCEA 3EIJA 3UINC 2CHWA 2FBNA 3LEWA 4NRHB 3E37A 2EIKE 4XZ4A 2LNIA 1H2TC 3MA5A 3B95A 1A17A 5A7DB 5HKPA 2WXRA 4KMOA 4O6FA 4FU3A 4G8KA 2VSNA 4AIFA 4U95D 1Q2ZA 5FZSA 1LD8A 3O4ZA 1ELKA 4XKCA 3FU0A 2KCVA 1O1RA 1WY6A 3TJPA 3FWVA 3ZN3A 2GW1A 2AVPA 3BG1B 4GZCA 4TXQA 3X2QE 3CVPA 3UX4A 2JLBA 2OV8A 4EPZA 2Y0BG 1EYHA 3L22A 1Z3YA 4RVBA 3PEVB 2EQXA 2WXFA 4L23A 4EQFA 1HE8A 1TYQG 5BXOA 3GZSA 3G2TA 4GTRA 1H2VC 3L13A 3EHRA 3TWSA 4AV7A 4U8VD 3TWVA 3B7SA 1MX4A 4JB8P 3J5QB 2BUGA 2WVIA 2YHCA 2M63A 1NZNA 3IEGA 4DK5A 5CEAA 3DEPA 3CVVA 4U04A 4EZKA 5ARGA 3L16A 4UWLA 3FTZA 4UWFA 5ENNA 5CECB 4GZ6A 1OUVA 4BY6A 2UY1A 5ITZF 5T3RA 4HLEA 2WXGA 1HS6A 3P2BA 5BUZA 2Y3AA 4PUCA 3FH7A 5FQ6A 3EHQA 4BX8A 2OEVA 2WB2A 4FLBA 3I4GA 4YDEA 4TRQA 3ZNGA 4ATZD 1IYGA 3BQOA 4M3OA 3G2UA 3QOUA 2HE0A 2P9KG 5AYWD 1ZU2A 3R9MA 3PE3A 1WM5A 3I4RB 4LNUD 4N2SA 1N0RA 4GMLA 3SI5A 4U0UA 4XEIG 4XKBA 3JQ1A 4AVXA 1K1AA 2GRPB 3KEZA 2OVBA 3PVLA 1KT0A 2P58C 2QYUA 3VLFA 3UT7A 2XZDG 3QB2A 2AXUA 4BSZB 2CFZA 4FJZA 3SFZA 1UN9A 3D9OA 1BI7B 1HG2A 3AJIA 2PQNA 1HH8A 4LNBA 1TEZA 2LO6A 3SFYA 1Y8MA 4LCTA 3O48A 3ABLE 1S70B 3DSXA 1QQEA 4JA7A 3TXMA 4F1PA 1H6PA 2ZXWE 4F1SA 4LG6A 1N94A 2YHEA 2VJ8A 3LS8A 5EILA 2VTBA 2CG3A 2XEVA 3U66A 5J08A 1KLXA 1DCQA 3HXCA 2ZGDA 5HRYA 1YYHA 2I9CA 2DZOA 5G2NA 4YDYA 1K8KG 5B1AE 2LAIA 3Q9UC 4LUNU 2L6JA 3JYSA 1PAQA 4KZCA 3ENEA 4JHJA 2Y1LE 3Q78A 1NL4A 3TGOA 2OEWA 3DSWA 2F8XK 4U8YD 2L9BA 4GZ5A 5FWQA 5KJMA 4G11A 2YNQA 3HG0D 3ZW3A 3PZ2A 1SA5A 1HZ4A 4BT8A 1D8DA 4XE0A 4GPMA 5LP0A 4EHMA 2XGOA 4TUUA 2DIWA 2V8SE 3AS5A 2J09A 4BFRA 3DXMG 3L6AA 5G05C 2IO2C 3D9JA 4YDOA 4D10C 4O1PA 5AARA 4GZDA 1N4PA 2R05A 3APFA 3UM0A 3FTVA 2GRRB 2DZNA 4ZHBA 1DNPA 3L82A 2E0IA 5ENPD 1N52A 2IFUA 2PM6A 4FHJA 3RU0A 1D8EA 5LOZA 3ULQA 4LRZA 5ANLA 2P9PG 4KVMA 3CQCB 3IBEA 3ML8A 4WWOA 4GMJA 2Y69E 4ILGA 2EILE 3LDZA 5CRVA 1ELWA 1LD7A 1TJCA 3LKUA 4J8EA 5AQBA 1O5MA 4XI9A 4HB5A 3AS8A 3ISMC 2CHXA 3LXUX 2P2CP 3PNLB 5FINA 2C2LA 3R9AB 4PS3A 3SBTB 1OCOE 2AJAA 5KJNA 1H6OA 1RZ4A 2X38A 1S64A 4C9BB 4QFVA 4A3VA 3QWVA 4HRLA 3FY4A 4PDXA 2BTDA 4M7CA 1BD8A 4FHKA 2J49A 2IONA 3SZ7A 4APFA 1N0QA 2P9LG 2L0TB 4PS8A 5CBNA 2LUHA 4B0ZA 3MCXA 1OCRE 3HXEA 5EYPF 3NAWA 3ONLA 2VYIA 4F6RD 3S7DA 2IU1A 5DIZA
chains in the Genus database with same CATH topology
2EILE 1V54E 5IY5E 3X2QE 2DYRE 1V55E 1OCZE 2ZXWE 5B1AE 3AG4E 2OCCE 2EIME 2EIJE 3AG2E 3ASOE 2DYSE 3AG1E 3ABKE 3ABLE 3ABME 3ASNE 3WG7E 2EINE 5B1BE 1OCRE 2EIKE 3AG3E 1OCOE 1OCCE 2Y69E 5B3SE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIL E;  1V54 E;  5IY5 E;  3X2Q E;  2DYR E;  1V55 E;  1OCZ E;  2ZXW E;  5B1A E;  3AG4 E;  2OCC E;  2EIM E;  2EIJ E;  3AG2 E;  3ASO E;  2DYS E;  3AG1 E;  3ABK E;  3ABL E;  3ABM E;  3ASN E;  3WG7 E;  2EIN E;  5B1B E;  1OCR E;  2EIK E;  3AG3 E;  1OCO E;  1OCC E;  2Y69 E;  5B3S E; 
#chains in the Genus database with same CATH topology
 2HYZ A;  1N54 A;  4N5C A;  1V55 E;  1IQU A;  3LY8 A;  4KVO A;  2UY1 B;  4U7E B;  2EIM E;  2J9Q A;  1JCR A;  4GYY A;  4GTM A;  4GAA A;  5G04 J;  4MLP A;  4U0Z A;  3CVU A;  2HO1 A;  2OVF A;  2EIN E;  4K5B A;  4GA0 A;  4JA9 A;  2Y4T A;  4PH4 B;  4AY5 A;  3W9G A;  4ATG A;  4BES A;  5CCL A;  2QZA A;  3CVX A;  3TWQ A;  3SBS A;  4U96 D;  3QWP A;  3EHN A;  4N5Q A;  4OVV A;  3KSQ A;  3J5P A;  1WAO 1;  1N95 A;  3D9L A;  4AY6 A;  4ANX A;  2MYO A;  2L0I A;  1OWP A;  3TWX A;  1QBQ A;  2DWZ A;  3CR3 A;  3FHE A;  4MS6 A;  4L2L A;  4I1M A;  3FUH A;  5FZR A;  5FT9 A;  4ILH B;  3SD5 A;  2XCB A;  5DBK A;  5FQ7 A;  3MKQ A;  3UM2 A;  1S0P A;  4CGW A;  2KAT A;  3RKV A;  1KZP A;  3ASF A;  4Z68 A;  4I6E A;  3D3M A;  1MQS A;  2XGM A;  4AJW A;  3D9H A;  1FT1 A;  3HXD A;  4JXT A;  4K0R A;  1BPO A;  3ZHE A;  3FU3 A;  3HHM A;  4EEC A;  3AG3 E;  5CMY A;  4UI9 J;  2I1K A;  4GTQ A;  3UI2 A;  4U8H A;  2XPY A;  3FUD A;  2DYR E;  3Q75 A;  2JEK A;  3B7R L;  5EX0 A;  3JUI A;  3ESK A;  4I1A A;  1JCQ A;  3OAW A;  3DXK G;  4RQI A;  1IQR A;  1HO8 A;  2XPI A;  4HRM B;  1NI1 A;  3UM3 A;  3CK7 A;  1E7U A;  2J4B A;  4KZ0 A;  5G55 A;  4NAC A;  4CGV A;  3ZXS A;  5LFA A;  2VTB B;  3NOG D;  3MZL B;  3ASH A;  2P9U G;  2IEJ A;  3PUJ A;  3FUF A;  4BX9 A;  2B0O E;  2LSV A;  3S7J A;  4YDW A;  5D2M C;  2AXZ A;  4GU5 A;  1TNO A;  2I1J A;  3V2X A;  4HOT A;  3ABK E;  2KCK A;  3F6Q A;  4TUM A;  5CCM A;  3QK0 A;  4L1B A;  2QY7 A;  3ZIM A;  2PL2 A;  2WXK A;  2P9N G;  2WXI A;  3QWW A;  4BER A;  3K9I A;  4J7W A;  1HU3 A;  3MX3 A;  3IXE A;  3B7U X;  1H0A A;  2F0Y A;  5BNW A;  2R03 A;  3ESL A;  3ZYQ A;  2XHE A;  4GTT A;  1OXJ A;  1V54 E;  1OWO A;  1P5Q A;  5AJL A;  4UWG A;  1E8X A;  4FJY A;  2IOS A;  3PZ4 A;  4X8Q A;  5JJ7 A;  1BU9 A;  2MHK A;  5KBA A;  4HI9 A;  1YMP A;  2ZU6 B;  2A5E A;  2X6J A;  3GZ2 A;  1U3C A;  4BTB A;  1HX8 A;  4G2V A;  2I2O A;  4FP7 A;  4ANV A;  2WXM A;  3FDH A;  5HS0 A;  5D0Q D;  3C72 A;  1ELR A;  5LCW J;  2FI7 A;  1WG0 A;  3NB2 A;  4JVS A;  3CKC A;  3JQ0 A;  5ARF A;  3EIQ C;  4MRU A;  1EF1 C;  1W3B A;  1EPU A;  3CSF A;  4OVU A;  4DPR A;  4B89 A;  5T8I A;  4IRU A;  3OXG A;  3Q15 A;  1GW6 A;  4DX1 A;  3B13 A;  3U64 A;  1MX6 A;  3MKR A;  4TXP A;  3QC1 A;  5FQ4 A;  1JUQ A;  2J4D A;  5FZQ A;  4WAF A;  4WND A;  4LNG A;  2WQ7 A;  4Y6C A;  3ULY A;  2FUL A;  3UUX A;  3L08 A;  2KZT B;  3FP3 A;  1SZ9 A;  5LX8 A;  1TNB A;  3ASG A;  2A4Z A;  1JPL A;  2LXM A;  3T8M A;  3APD A;  3EDT B;  4CT0 A;  4YVQ C;  3S2A A;  2H6H A;  2XEH A;  2IOL A;  3UTM A;  5EX3 A;  3FUK A;  4L2Y A;  5FQ8 A;  3G2W A;  2PQR A;  5BT1 A;  2WMN A;  1H19 A;  3B7B A;  4A55 A;  3RSE G;  3CGH A;  5E75 A;  3R7R A;  5H7P A;  4LEU A;  4MKT A;  2WXH A;  3CHQ A;  1UOH A;  2XCC A;  2HR2 A;  1XGW A;  3DST A;  3CK9 A;  3Q79 A;  2FO1 E;  4RG9 A;  4CEM A;  4EBA A;  3ABM E;  3FUN A;  5KNH D;  3Q73 A;  1N9A A;  4GCN A;  1JWF A;  3LCA A;  4UUC A;  2A5U A;  4I9C A;  4J0U A;  5AIJ A;  3L54 A;  1FVF A;  2AWI A;  4KT6 B;  3SO8 A;  4JL0 A;  3V31 A;  4Q94 A;  5FIO A;  3NZS A;  5AQA A;  1TNY A;  1E96 B;  3HXF A;  3Q7A A;  4J6I A;  3EJN A;  3CHP A;  4H7Y A;  4UQX A;  5CBO A;  2JAB A;  5M72 A;  4AOF A;  1Z6T A;  4DX5 D;  1H2U A;  3FUL A;  4HXI A;  2VGE A;  5T4Y A;  2CG2 A;  5KCM A;  3UT4 A;  2F8Y A;  4CZ2 D;  3MKQ B;  3PZ3 A;  2WPV A;  1IHB A;  5ENR D;  3UKR G;  2B6C A;  1PY1 A;  3ML9 A;  3PS6 A;  4WWP A;  2WXN A;  3V30 A;  3CK8 A;  2CFU A;  3LY7 A;  5CHE E;  2NSZ A;  3ZHE B;  3VLE A;  1KT1 A;  1BLX B;  4GTS A;  3KSL A;  5EIB E;  3CHS A;  3N71 A;  4J8Y A;  2ETA A;  5JA4 D;  3BU8 A;  4JZY A;  3Q4A B;  2R59 A;  1SZA A;  4I9E A;  4BSX A;  2ZGG A;  1SQM A;  3FUM A;  4Q69 A;  1OWN A;  3E34 A;  4G26 A;  3CIA A;  4HS2 A;  3PRZ A;  4NQ0 A;  1OCC E;  3MV2 B;  5AAO A;  4HBD A;  2E2E A;  4FLH A;  4I43 A;  3FFL A;  3CHR A;  3QDN A;  2J8S D;  4HOR A;  4K5A B;  3TWW A;  5G04 C;  3T9K A;  4GZ3 A;  4NIK A;  3PEU B;  3MYV A;  4ANU A;  4G23 A;  2XEN A;  1AP7 A;  3KS2 A;  1FPP A;  5AJD A;  3ZUV B;  1N11 A;  4G8L A;  3CKB A;  3TXN A;  4MBG A;  4OAV B;  2KZT A;  2BKG A;  5AN8 A;  3QJZ A;  3DSV A;  4JEU A;  1X5B A;  2OND A;  3Q49 B;  4LSZ E;  4HLL A;  4JHR A;  2QFC A;  3Q7F A;  4CRW A;  3EU9 A;  1VDY A;  3DRA A;  3E30 A;  4YVO A;  4AXH A;  3FH5 A;  3LVQ E;  3FEX A;  3ZYK A;  2IY0 C;  5HQ8 A;  4Q96 A;  4ILI A;  5E76 A;  1UG3 A;  3JUE A;  4A1G A;  1X81 A;  4GMR A;  1OY3 D;  5FTP A;  4N39 A;  2V4L A;  4A63 B;  3UPV A;  3KAE A;  1TNU A;  3U4T A;  2V5F A;  3CST A;  1G3N B;  4TV3 A;  4UI9 C;  2GGF A;  5ENO D;  5ANR A;  2C0M A;  3SGH A;  5ENT D;  4C0E A;  3IHY A;  1A5E A;  2DYS E;  2V5Q C;  2XS1 A;  3OXL A;  1TR4 A;  4I6G A;  3VTX A;  4CYM D;  4DRX E;  4HRN A;  3AU4 A;  2IO3 C;  2WXQ A;  3ZU7 B;  2X6F A;  4WNF A;  4UWK A;  1OWM A;  3PH0 C;  4JD2 G;  3CHO A;  4I2Z A;  2ETB A;  5JHA A;  2PZI A;  4I1O B;  3VTY A;  4OYS A;  4RLY A;  2IJG X;  3GYZ A;  4C48 B;  4HNA D;  3I5P A;  3T5V A;  1D9S A;  3G2S A;  4DX7 D;  3KEA A;  4H7X A;  4AM9 A;  1IKN D;  4N3A A;  2NXP A;  3HVE B;  3LY9 A;  3KD7 A;  1E8Y A;  3D9K A;  4O1O A;  2J08 A;  4L9P A;  2DVW A;  2IF4 A;  4F3V A;  5A23 A;  3BUA A;  3SF4 A;  4GPK A;  1O1S A;  4GTP A;  2ZIR A;  3LYA A;  4EBA G;  3QAR A;  3ASD A;  1YCS B;  4ABN A;  4ANW A;  1H6K A;  3DWL G;  4PS7 A;  4O60 A;  1Z5S C;  3CHM A;  3D9N A;  1Z3X A;  3FUE A;  4APO A;  1BI8 B;  5BV1 A;  5JMN D;  4XX5 A;  3ZGQ A;  2WXP A;  3UM1 A;  3AU5 A;  4QQI A;  3TG5 A;  4FC8 A;  4DJA A;  4UQY A;  1N4Q A;  2AW6 A;  3AG1 E;  5JJ6 A;  3VLD A;  2XGS A;  1QZ2 A;  2HM8 A;  2AXV A;  5JHB A;  3RJV A;  4JC8 A;  4IN3 B;  4JW1 A;  4ZFH A;  2WM9 A;  4HOQ A;  5EYL A;  4ACK A;  1SW6 A;  1OCZ E;  2PNN A;  2XRZ A;  4FA6 A;  1Y6I A;  3SQV A;  1MZC A;  4B93 B;  4I6J A;  3FTY A;  2FO7 A;  4U07 A;  1U3D A;  5LCW C;  3HYM B;  4CDM A;  3S7B A;  3C3O A;  2X6I A;  2PM7 A;  4HOS A;  3PRE A;  3PDN A;  3TWU A;  1DVP A;  2C0L A;  1TNZ A;  4V3I A;  3SNX A;  1TN7 A;  4IUL A;  4JPS A;  4URK A;  2VSX E;  1E7V A;  5EID A;  2KC7 A;  5B3S E;  3EUV A;  3TWT A;  3HRA A;  2BKK B;  4UWH A;  2WQ6 A;  4CDR A;  2R5S A;  1K3Z D;  1LTX A;  3FTW A;  3Q9N C;  1B89 A;  5C2Y A;  4ME2 A;  3IKO B;  5BPP A;  3D9M A;  1TN6 A;  2F37 A;  1NP7 A;  3MV3 B;  3ZKJ A;  3OTN A;  3UQ3 A;  3ZFW A;  4K03 A;  3DSS A;  3Q5M A;  1MHQ A;  3RAU A;  3V2O A;  3ZEF A;  1N4S A;  3UMV A;  2KCL A;  4EZJ A;  2Y4U A;  5AQ9 A;  1U2V G;  5KNG A;  2J07 A;  5CMW A;  2NC9 A;  4J8D A;  2X6H A;  4Y6W A;  1SVX A;  3D9I A;  3DEO A;  3NQP A;  4GA1 A;  3TAX A;  3CVW A;  4GYW A;  1UN8 A;  4BET A;  2RFA A;  2LSU A;  4G1T A;  3HXB A;  2MRI A;  3NZU A;  2DCP A;  1EDU A;  3ULE G;  3CVY A;  2IQC A;  3OXF A;  1KPS B;  4WUY A;  4W9R A;  3UXG A;  3EHM A;  3HVE A;  4B8C B;  2H6G A;  3CQG B;  1UJK A;  1ZBP A;  4XI0 A;  3S7F A;  3DPD A;  3DPY A;  3RK6 A;  4WNG A;  2GRQ B;  3L17 A;  2XPZ A;  3FUJ A;  3RRU A;  4FAD A;  4UQZ A;  3CVN A;  3UKU G;  3ZXP A;  2OOE A;  4DLQ A;  4DI4 A;  3GW4 A;  5EKQ D;  2XZT G;  2VGY A;  1INZ A;  3WXX A;  4F53 A;  1NA3 A;  3V79 K;  3SHF A;  2YQ8 A;  4F7A A;  2CHZ A;  3P1U A;  4EZL A;  5HI7 A;  3UT8 A;  5ENS D;  4CCA A;  1AWC B;  3JXI A;  3RRM B;  1ZB1 A;  2XEE A;  2ZIS A;  4P29 A;  3D9P A;  1DC2 A;  2GRO B;  4G25 A;  4J8S A;  4KBQ A;  1E90 A;  1HXI A;  3FU5 A;  4LER A;  3ZVV A;  3ZYL A;  4HQD A;  2I6H A;  4GYO A;  3FUI A;  1OWL A;  1YA0 A;  1IHG A;  3T8K A;  2WXO A;  3JXJ A;  2L6B A;  4E85 A;  3CVL A;  4UI9 K;  1NA0 A;  1FVH A;  1QNF A;  2WXJ A;  1S63 A;  4GTO A;  3AG2 E;  4HI8 A;  3QKY A;  3PNT B;  3C5R A;  2WXL A;  2VQ2 A;  3FTX A;  3FH8 A;  5D0O D;  4I17 A;  1PC2 A;  4E6H A;  2XQ0 A;  4N3C A;  3URZ A;  2EIJ E;  4BWR A;  2VGX B;  3QAQ A;  2QC9 A;  3LPZ A;  1N4R A;  3DBS A;  5KWD A;  3TG4 A;  4A3T A;  4WNE A;  2H6I A;  4DI3 A;  2GRM A;  3LVR E;  5ENQ D;  2VSY A;  4KXK B;  3SFX A;  3AAA C;  3SY2 A;  3ONK A;  2OCC E;  3U9W A;  1TN8 A;  2XS8 A;  3E33 A;  3ZYM A;  3WG7 E;  5BV0 A;  3E32 A;  2MOW A;  3CVQ A;  2V4H C;  2QYJ A;  3RRN B;  3L9T A;  5CRU A;  4GCO A;  1TJF A;  4K5C A;  2RD0 A;  1MYO A;  3UIO C;  4CT4 A;  1E8Z A;  4YND A;  2KXP C;  4FUL A;  4IYP A;  1LF8 A;  4U63 A;  2RG8 A;  3ZPJ A;  5KJK A;  4RSY A;  4AP2 A;  3NF1 A;  3RO3 A;  3PZ1 A;  4CDN A;  4N2Q A;  2R2L A;  3GZ1 A;  1XNF A;  4OAU C;  2WQH A;  3C3R A;  3C98 A;  3G2V A;  5A6C A;  3QNK A;  4DX6 D;  1KZO A;  2H6F A;  3ZRH A;  4ACL A;  5AQ7 A;  5IY5 E;  2DBA A;  5G05 J;  2R17 C;  2FEZ A;  4B94 A;  3T5X A;  3RO2 A;  4U0S A;  2R02 A;  2NYJ A;  1UJJ A;  3TWR A;  1FCH A;  4AEZ C;  5C1D A;  2VSO E;  4N3B A;  2UWJ G;  4GA2 A;  1SA4 A;  3B7T A;  3NBN B;  2FF4 A;  4DLO A;  3AS4 A;  3R7Q A;  3TL5 A;  4B8A A;  5CER B;  5BXU A;  4TXR A;  5CED B;  2P9I G;  5EDS A;  4L7T A;  1JWG A;  5J90 A;  3EU5 A;  4HVB A;  4WWN A;  3BG0 B;  2P9S G;  1MX2 A;  2XRY A;  3U3W A;  3W9F A;  3PE4 A;  1QYM A;  4G24 A;  1O1T A;  3JCK C;  4RG6 A;  3CEQ A;  4A1S A;  4KYO B;  3LJ3 A;  2BF0 X;  1IXV A;  3RIB A;  5KJL A;  1K1B A;  4J8F A;  4BT9 A;  3CLJ A;  3MJW A;  2RFM A;  4I2W A;  5EN5 D;  5AEN A;  1HFA A;  1NFI E;  5FJY A;  5D66 A;  2KM4 A;  1UW4 B;  1HF8 A;  1JCS A;  4C0M A;  3BEE A;  2X6K A;  3HDX A;  3E4B A;  1MJ0 A;  2X3M A;  2KBX A;  3IV0 A;  5B1B E;  3FTU A;  3LJN A;  1WDY A;  2RKK A;  3I3N A;  3MGB A;  4DX2 A;  3MEK A;  3FTS A;  3AG4 E;  4DUI A;  3ASO E;  2VGX A;  3PZD A;  3IHV A;  3ASN E;  2GRL A;  2ILR A;  2LXL A;  1HG5 A;  3NOC D;  2LAH A;  2BED A;  2GRN B;  1OT8 A;  1L5J A;  4R7L A;  4BEP A;  4NUR A;  3Q47 B;  3FEY A;  4GB9 A;  4JEH A;  1E8W A;  2V0P A;  3FU6 A;  4HOU A;  4JHK A;  3PUK A;  2ETC A;  1FT2 A;  3CV0 A;  3APC A;  3DSU A;  4HFG A;  2WMO A;  3UIP C;  4BTA A;  4XIF A;  2YIN A;  2Q7F A;  1RW2 A;  3C3Q A;  5JJT A;  3HIZ A;  5BW8 C;  4GTV A;  1DCE A;  3EIJ A;  3UIN C;  2CHW A;  2FBN A;  3LEW A;  4NRH B;  3E37 A;  2EIK E;  4XZ4 A;  2LNI A;  1H2T C;  3MA5 A;  3B95 A;  1A17 A;  5A7D B;  5HKP A;  2WXR A;  4KMO A;  4O6F A;  4FU3 A;  4G8K A;  2VSN A;  4AIF A;  4U95 D;  1Q2Z A;  5FZS A;  1LD8 A;  3O4Z A;  1ELK A;  4XKC A;  3FU0 A;  2KCV A;  1O1R A;  1WY6 A;  3TJP A;  3FWV A;  3ZN3 A;  2GW1 A;  2AVP A;  3BG1 B;  4GZC A;  4TXQ A;  3X2Q E;  3CVP A;  3UX4 A;  2JLB A;  2OV8 A;  4EPZ A;  2Y0B G;  1EYH A;  3L22 A;  1Z3Y A;  4RVB A;  3PEV B;  2EQX A;  2WXF A;  4L23 A;  4EQF A;  1HE8 A;  1TYQ G;  5BXO A;  3GZS A;  3G2T A;  4GTR A;  1H2V C;  3L13 A;  3EHR A;  3TWS A;  4AV7 A;  4U8V D;  3TWV A;  3B7S A;  1MX4 A;  4JB8 P;  3J5Q B;  2BUG A;  2WVI A;  2YHC A;  2M63 A;  1NZN A;  3IEG A;  4DK5 A;  5CEA A;  3DEP A;  3CVV A;  4U04 A;  4EZK A;  5ARG A;  3L16 A;  4UWL A;  3FTZ A;  4UWF A;  5ENN A;  5CEC B;  4GZ6 A;  1OUV A;  4BY6 A;  2UY1 A;  5ITZ F;  5T3R A;  4HLE A;  2WXG A;  1HS6 A;  3P2B A;  5BUZ A;  2Y3A A;  4PUC A;  3FH7 A;  5FQ6 A;  3EHQ A;  4BX8 A;  2OEV A;  2WB2 A;  4FLB A;  3I4G A;  4YDE A;  4TRQ A;  3ZNG A;  4ATZ D;  1IYG A;  3BQO A;  4M3O A;  3G2U A;  3QOU A;  2HE0 A;  2P9K G;  5AYW D;  1ZU2 A;  3R9M A;  3PE3 A;  1WM5 A;  3I4R B;  4LNU D;  4N2S A;  1N0R A;  4GML A;  3SI5 A;  4U0U A;  4XEI G;  4XKB A;  3JQ1 A;  4AVX A;  1K1A A;  2GRP B;  3KEZ A;  2OVB A;  3PVL A;  1KT0 A;  2P58 C;  2QYU A;  3VLF A;  3UT7 A;  2XZD G;  3QB2 A;  2AXU A;  4BSZ B;  2CFZ A;  4FJZ A;  3SFZ A;  1UN9 A;  3D9O A;  1BI7 B;  1HG2 A;  3AJI A;  2PQN A;  1HH8 A;  4LNB A;  1TEZ A;  2LO6 A;  3SFY A;  1Y8M A;  4LCT A;  3O48 A;  3ABL E;  1S70 B;  3DSX A;  1QQE A;  4JA7 A;  3TXM A;  4F1P A;  1H6P A;  2ZXW E;  4F1S A;  4LG6 A;  1N94 A;  2YHE A;  2VJ8 A;  3LS8 A;  5EIL A;  2VTB A;  2CG3 A;  2XEV A;  3U66 A;  5J08 A;  1KLX A;  1DCQ A;  3HXC A;  2ZGD A;  5HRY A;  1YYH A;  2I9C A;  2DZO A;  5G2N A;  4YDY A;  1K8K G;  5B1A E;  2LAI A;  3Q9U C;  4LUN U;  2L6J A;  3JYS A;  1PAQ A;  4KZC A;  3ENE A;  4JHJ A;  2Y1L E;  3Q78 A;  1NL4 A;  3TGO A;  2OEW A;  3DSW A;  2F8X K;  4U8Y D;  2L9B A;  4GZ5 A;  5FWQ A;  5KJM A;  4G11 A;  2YNQ A;  3HG0 D;  3ZW3 A;  3PZ2 A;  1SA5 A;  1HZ4 A;  4BT8 A;  1D8D A;  4XE0 A;  4GPM A;  5LP0 A;  4EHM A;  2XGO A;  4TUU A;  2DIW A;  2V8S E;  3AS5 A;  2J09 A;  4BFR A;  3DXM G;  3L6A A;  5G05 C;  2IO2 C;  3D9J A;  4YDO A;  4D10 C;  4O1P A;  5AAR A;  4GZD A;  1N4P A;  2R05 A;  3APF A;  3UM0 A;  3FTV A;  2GRR B;  2DZN A;  4ZHB A;  1DNP A;  3L82 A;  2E0I A;  5ENP D;  1N52 A;  2IFU A;  2PM6 A;  4FHJ A;  3RU0 A;  1D8E A;  5LOZ A;  3ULQ A;  4LRZ A;  5ANL A;  2P9P G;  4KVM A;  3CQC B;  3IBE A;  3ML8 A;  4WWO A;  4GMJ A;  2Y69 E;  4ILG A;  2EIL E;  3LDZ A;  5CRV A;  1ELW A;  1LD7 A;  1TJC A;  3LKU A;  4J8E A;  5AQB A;  1O5M A;  4XI9 A;  4HB5 A;  3AS8 A;  3ISM C;  2CHX A;  3LXU X;  2P2C P;  3PNL B;  5FIN A;  2C2L A;  3R9A B;  4PS3 A;  3SBT B;  1OCO E;  2AJA A;  5KJN A;  1H6O A;  1RZ4 A;  2X38 A;  1S64 A;  4C9B B;  4QFV A;  4A3V A;  3QWV A;  4HRL A;  3FY4 A;  4PDX A;  2BTD A;  4M7C A;  1BD8 A;  4FHK A;  2J49 A;  2ION A;  3SZ7 A;  4APF A;  1N0Q A;  2P9L G;  2L0T B;  4PS8 A;  5CBN A;  2LUH A;  4B0Z A;  3MCX A;  1OCR E;  3HXE A;  5EYP F;  3NAW A;  3ONL A;  2VYI A;  4F6R D;  3S7D A;  2IU1 A;  5DIZ A; 
#chains in the Genus database with same CATH homology
 2EIL E;  1V54 E;  5IY5 E;  3X2Q E;  2DYR E;  1V55 E;  1OCZ E;  2ZXW E;  5B1A E;  3AG4 E;  2OCC E;  2EIM E;  2EIJ E;  3AG2 E;  3ASO E;  2DYS E;  3AG1 E;  3ABK E;  3ABL E;  3ABM E;  3ASN E;  3WG7 E;  2EIN E;  5B1B E;  1OCR E;  2EIK E;  3AG3 E;  1OCO E;  1OCC E;  2Y69 E;  5B3S E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...