2DYSE

Bovine heart cytochrome c oxidase modified by dccd
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
105
structure length
105
Chain Sequence
b'HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Structures and physiological roles of 13 integral lipids of bovine heart cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 43
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2006-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2dysE00
2Y69E 1OCRE 2EIKE 2EIJE 3ASOE 1OCOE 3ASNE 3AG4E 1OCCE 2DYSE 5B1BE 2OCCE 1V54E 1V55E 2EINE 5IY5E 1OCZE 5B1AE 3ABME 3X2QE 2ZXWE 3ABKE 2EIME 3ABLE 3AG1E 3AG2E 3WG7E 5B3SE 2DYRE 3AG3E 2EILE
chains in the Genus database with same CATH superfamily
2P9UG 3SGHA 4HOSA 2IF4A 5A23A 3MZLB 2P9PG 2XENA 3OAWA 2J9QA 3L82A 3TG5A 4K5BA 2YQ8A 3OXGA 2IQCA 2RFAA 4JC8A 3TWTA 5J08A 2ZGDA 1BU9A 4KBQA 3B7TA 3QC1A 3Q7FA 3UIPC 4LUNU 3NBNB 3DEOA 2PQRA 4ILIA 1S64A 1N94A 3P2BA 3GYZA 2QC9A 2H6FA 1U3DA 2VGYA 1TNUA 4JD2G 1WDYA 4LRZA 3ASNE 4KZ0A 4N3BA 4I1OB 5G04C 1SA4A 2XEHA 3U3WA 5AQAA 3E30A 2AWIA 2GROB 1IXVA 4YDEA 2IOLA 3E33A 5B1AE 3PNLB 3LCAA 5LCWC 2YHEA 2J4BA 1IQRA 5ENTD 3ONKA 4APOA 2R5SA 4EQFA 4GTSA 3KS2A 3B7SA 4KYOB 2QYJA 4F3VA 5FJYA 5FTPA 4IRUA 1SVXA 4ANUA 3RU0A 3JYSA 2LO6A 1JCSA 5T3RA 1O1TA 3LY9A 4PS3A 3FUIA 4UQZA 4CYMD 1HG2A 2WXQA 3I3NA 3NAWA 2VGXA 3CVVA 3DSSA 1OWLA 1MHQA 4AY5A 4E85A 2DYSE 4GA0A 4XI9A 1IQUA 3UI2A 5AYWD 5BV0A 4GYWA 1HX8A 4QFVA 4LNBA 3CSFA 3ASGA 3PEVB 1FT1A 2B6CA 3MGBA 5B3SE 4URKA 2XS8A 1YMPA 4HS2A 4GTVA 1E8ZA 3FUJA 1YYHA 3CK7A 3ASOE 3AAAC 5FQ4A 2A5UA 1U2VG 4LG6A 1PY1A 4V3IA 5AIJA 4HXIA 5FZRA 3Q75A 4JA9A 2CHXA 2ZISA 5FZQA 2H6GA 4HLLA 5LOZA 5KJLA 2EIJE 2ZU6B 2UY1A 4OAVB 4I2WA 4BSZB 4QQIA 4G26A 4K5CA 1OXJA 5JA4D 2BKKB 2QFCA 1SA5A 3E32A 4L1BA 3TXNA 4B0ZA 3RK6A 3L22A 3NQPA 4HRNA 4JEHA 2R59A 2HO1A 3D9IA 2X6HA 3G2WA 1LD8A 3AG3E 4DPRA 3TWVA 1TN6A 1H2VC 1N0RA 2XCBA 3J5PA 3SY2A 2P9NG 1U3CA 1NFIE 5KJMA 1S70B 3SZ7A 4Q69A 4J8YA 4LSZE 5DIZA 3TWSA 3ZUVB 4HI8A 2KC7A 5JHBA 3CK9A 3RSEG 4L9PA 3AG1E 5CRUA 1E8XA 4I1MA 4HRLA 4WWPA 3CVLA 4J8SA 2P58C 2XGMA 2NC9A 4G2VA 1Q2ZA 3ZYMA 4AIFA 1E8YA 3BQOA 1OT8A 2X6KA 5FT9A 2LSVA 3G2UA 2J09A 3UM3A 2DZOA 4GMRA 2XPIA 2X6JA 4JW1A 4DLQA 3R7RA 5HI7A 4XZ4A 1BI8B 4DX6D 3IHYA 3D9MA 4B94A 2MHKA 4JL0A 2KBXA 3CHMA 3I5PA 4XE0A 1OWPA 3Q73A 3JQ1A 3FUKA 5KNGA 1HFAA 4G8KA 1X81A 4GTOA 1BLXB 2EIME 4K5AB 3CHSA 3D3MA 4AVXA 4GMLA 3GZ1A 1IYGA 1H6OA 4FLBA 4N5QA 3ESLA 2IJGX 4BX8A 4BY6A 2OV8A 3E4BA 1TN7A 1MJ0A 1JPLA 1OCOE 3IKOB 3RRNB 1B89A 1N4QA 3ONLA 3CKBA 2WXOA 2HYZA 2JABA 3Q7AA 2XRZA 1NL4A 1MQSA 4WWOA 2JLBA 4UQYA 3AS5A 4JA7A 2VSOE 5ENQD 3D9NA 3WXXA 3BG1B 3K9IA 2DWZA 4RG6A 2L6BA 1UJKA 4GYYA 3CVNA 3MCXA 3I4GA 4UI9C 1L5JA 4O6FA 1ZBPA 4YDYA 4JHRA 3EIQC 4J8FA 5CBNA 4DX5D 4OVVA 3R9MA 2LAHA 2Y4UA 1DCQA 2F8YA 4F1SA 5HQ8A 3R9AB 3IV0A 2WXPA 3UX4A 2VYIA 4C9BB 3HRAA 3FTXA 4ZHBA 3PDNA 1TJCA 3LY7A 2GRMA 3FUNA 3SBSA 5JJ6A 3PZ2A 2EQXA 4Y6WA 4BT9A 2AXVA 2UY1B 3LYAA 3RKVA 3HXEA 3ZW3A 4UUCA 1E8WA 2A4ZA 2QYUA 5CMWA 1KZPA 2GW1A 4ACLA 3PEUB 3Q78A 3VLFA 5CEDB 3GZ2A 5KJKA 4L2LA 3HG0D 2LAIA 3NOGD 3PE4A 2J49A 4LEUA 2CG3A 2VSXE 3FHEA 5BXOA 2A5EA 1OCCE 4BSXA 3APFA 1D8EA 1OWMA 3JXJA 3S7JA 3AS4A 3TWRA 2ZXWE 3ABLE 4WUYA 1UG3A 2C0MA 2BF0X 3FH7A 3C98A 2WQHA 4MKTA 2I6HA 3HYMB 3AJIA 3N71A 1UN9A 5CCMA 1K3ZD 2PM6A 5G05C 3SD5A 5AN8A 3FP3A 3FUHA 4D10C 5M72A 5BT1A 4EECA 5CHEE 4DI4A 3KEZA 3QB2A 2LNIA 3Q79A 3DXMG 2AVPA 4B89A 3ASHA 2E2EA 2IFUA 4N5CA 4KT6B 3QWPA 4HOUA 3ULQA 1SZAA 3PE3A 2Y0BG 3ZXSA 2QZAA 3ZNGA 3U66A 2GRNB 5FIOA 2KATA 2X38A 1E7UA 4TXQA 3SI5A 4I17A 4GA1A 4K0RA 4AV7A 1N4PA 5A6CA 3Q49B 3CEQA 2GRQB 4FP7A 3AG4E 3Q15A 4CRWA 4B8CB 3QWWA 4XKBA 2OEWA 2DCPA 1H2TC 4Q94A 3W9GA 1TNOA 1Y6IA 4G25A 1XNFA 5CMYA 3AU5A 1FT2A 3ZRHA 3NF1A 5G04J 3E37A 4HQDA 3CIAA 4YDWA 3SO8A 3U4TA 2XEEA 3CGHA 2YHCA 4GZ3A 3CKCA 1Z3XA 4F53A 2OEVA 4UWGA 3UMVA 2GRRB 4C0EA 5HRYA 1G3NB 3TG4A 3W9FA 4CZ2D 3B7BA 2IONA 2RG8A 2XGSA 4BT8A 4DUIA 4HRMB 3JQ0A 2WB2A 2LXMA 4U0UA 1TNZA 4UI9K 2WXKA 4FLHA 2R03A 4MS6A 3V30A 1PC2A 5D2MC 2WXRA 4AP2A 3LPZA 4WWNA 2BTDA 2X6FA 4CGWA 2CG2A 4AY6A 3MA5A 3FU5A 3HVEB 3L13A 3FU3A 1JCRA 3LY8A 3BG0B 3CHRA 5ANLA 3Q9NC 3DWLG 4BX9A 3APDA 1HZ4A 2XQ0A 5FQ6A 2RFMA 3ISMC 3UM0A 2F37A 5D0OD 2DZNA 3ABKE 3AG2E 4XKCA 4E6HA 2KZTB 2VTBA 3GW4A 2WXLA 1H6PA 4ATGA 2IO2C 2J07A 2EIKE 4WNEA 4HFGA 4F7AA 3NZSA 2WXMA 4BTBA 5FZSA 3FY4A 3DSTA 4RLYA 5LX8A 3AS8A 1OWOA 3FUDA 3QK0A 2CFZA 3T5VA 1S0PA 3ZYLA 2EILE 2Y69E 2M63A 4U0SA 1HF8A 3RJVA 4DRXE 4XEIG 2V4HC 3DEPA 3T5XA 5DBKA 4GPMA 3QAQA 2I1KA 3RRMB 5EIBE 4UWLA 2MYOA 5J90A 4U63A 3LJNA 1TEZA 4I43A 3UT4A 2CFUA 4DK5A 3PVLA 3LXUX 3UXGA 1SQMA 3DSWA 2BUGA 1OCRE 2RD0A 2J08A 3SFXA 5CERB 3ML9A 4FC8A 3PH0C 5KJNA 4AEZC 4NIKA 2ZIRA 5IY5E 3MV2B 3ZXPA 2WXGA 4O1OA 2F0YA 4EBAA 5CRVA 3ZHEB 5E76A 3CVPA 3FH8A 2AXUA 1IHGA 3SFYA 2V8SE 3UKUG 5EKQD 3SFZA 4JHKA 3ESKA 4AJWA 3FDHA 4Q96A 1HU3A 4CEMA 4F6RD 4FA6A 4HOTA 2R02A 3CV0A 3CSTA 1N4RA 1N4SA 3BUAA 2WQ6A 4KVMA 5JJ7A 4CCAA 4A1GA 2HR2A 4XIFA 3VTXA 2L0IA 4JXTA 5EN5D 2I9CA 4HLEA 3OXFA 2XZDG 1GW6A 5AJDA 3HXDA 1KT1A 5T4YA 4UI9J 2NYJA 1JCQA 4U04A 2Y1LE 5AQ9A 1LD7A 4X8QA 3B13A 3EIJA 3TWQA 2WXIA 3NOCD 3C3QA 5BUZA 4I1AA 2ONDA 2NXPA 3PZ4A 5A7DB 3OTNA 3UT8A 1TYQG 5D66A 2IOSA 4NQ0A 1O5MA 1DNPA 3GZSA 3X2QE 5ENSD 1H0AA 1FVFA 2VTBB 2R2LA 1IHBA 2WM9A 1TR4A 1TN8A 3FTUA 4U7EB 2KCLA 4JVSA 2R05A 4GTRA 3EHRA 5BV1A 2WMNA 4L2YA 4ANWA 1V54E 5EIDA 3CK8A 3EHQA 4RQIA 5CBOA 3RO3A 4I9EA 2WXFA 2C0LA 3URZA 4L23A 1E90A 2VSNA 3D9LA 2P9KG 1E96B 5ANRA 3ENEA 1Z3YA 3QKYA 4HOQA 1K8KG 5C2YA 3UINC 1UN8A 3FWVA 2V4LA 1EF1C 3T8MA 4DX2A 3LS8A 5AJLA 3FUEA 2IO3C 1BPOA 4I9CA 3TAXA 3FU6A 3LJ3A 3PRZA 3O4ZA 4EZJA 2PZIA 2XGOA 1QBQA 2OCCE 2P9LG 3C72A 5G05J 1W3BA 3LVRE 4CDNA 3EU9A 4K03A 4TUUA 3KD7A 1KPSB 5HS0A 3PNTB 2MOWA 2CHZA 4M3OA 4ANVA 4IYPA 4J0UA 3UQ3A 3QWVA 3FUFA 2X3MA 3EUVA 3ZYQA 3HVEA 3IHVA 5HKPA 1DC2A 4BETA 3CHPA 2FO7A 2XHEA 3G2SA 4MBGA 3DSXA 5G55A 1QZ2A 1UW4B 2P9IG 3KEAA 5EILA 2XZTG 1SW6A 1LTXA 5EX0A 3L54A 1LF8A 4U95D 5EYLA 1YA0A 4GPKA 1FCHA 1WG0A 2XRYA 3WG7E 4I2ZA 2KZTA 3QNKA 2Y4TA 1AWCB 1DCEA 1MX4A 3MJWA 2ILRA 4M7CA 4FU3A 3ZEFA 2H6IA 4DJAA 4DX1A 4GTMA 1YCSB 4LNUD 1N11A 4N39A 5EYPF 1O1SA 3TWXA 4HI9A 1D9SA 5FQ8A 3VLEA 5BXUA 4FADA 3TGOA 4N2QA 3CHOA 5ENPD 1H19A 4DLOA 2PL2A 2XPYA 3ABME 3I4RB 4L7TA 4YDOA 1KLXA 2WXHA 4ANXA 4XI0A 2FI7A 4WNDA 2LSUA 3Q5MA 3CQCB 3LDZA 2VSYA 4CT4A 1INZA 1ZB1A 4IN3B 3L6AA 4N3AA 5CECB 4IULA 4APFA 2YINA 2NSZA 2P2CP 3JCKC 3HDXA 3UT7A 3DXKG 4KVOA 3QARA 2F8XK 4FHKA 4GU5A 1JWFA 4TXRA 1ELWA 1RZ4A 4CDRA 3PUKA 4U07A 3CVWA 3ZHEA 3DPDA 5LCWJ 1X5BA 5LFAA 3PZDA 3CVUA 4G24A 4J8EA 4U0ZA 1K1BA 2LUHA 2KM4A 2Y3AA 2XS1A 5ENOD 3PREA 1HO8A 4TV3A 4Y6CA 4RG9A 4G8LA 3VTYA 4J7WA 1N52A 2HM8A 1VDYA 1QYMA 4P29A 3TJPA 4WNFA 4U8YD 2VQ2A 4O60A 4EZLA 1OWNA 2XPZA 4H7XA 2DYRE 1ELRA 3G2VA 2L9BA 1WY6A 1S63A 3FFLA 5EX3A 4GTTA 3P1UA 4JB8P 3HXBA 3DPYA 2ETCA 3CQGB 3PUJA 3BU8A 4GA2A 1NP7A 3LKUA 3DSUA 4YVQC 5H7PA 5JJTA 1N0QA 3ASFA 3DSVA 4DX7D 3ZYKA 3J5QB 3MKRA 4ACKA 4GZ5A 3O48A 2Q7FA 3LEWA 4KMOA 3CHQA 3IXEA 2GGFA 2ZGGA 5T8IA 4J8DA 4TXPA 5ENRD 3D9HA 4UWFA 3ZKJA 3TWUA 3R7QA 5JHAA 2KXPC 5AQBA 3RIBA 4FJYA 4HB5A 3D9OA 1WM5A 4YVOA 2VGEA 2CHWA 1TNBA 3CVYA 3CVXA 2OVFA 2OVBA 3CR3A 4O1PA 3U64A 3C3RA 3HXCA 3KAEA 2QY7A 4GTQA 5KNHD 4KZCA 1KT0A 3F6QA 4KXKB 2X6IA 3S2AA 3FTYA 3E34A 3IEGA 4U96D 4GYOA 2JEKA 4J6IA 3JXIA 1V55E 5AENA 3UTMA 3MEKA 2WQ7A 1EDUA 3FEYA 2C2LA 4BTAA 5BNWA 3FTVA 4ME2A 4CDMA 5AARA 3L9TA 4GZCA 2B0OE 5CCLA 2ETAA 3OXLA 3HXFA 4AM9A 4GCOA 3MKQB 3DRAA 4HNAD 5G2NA 3CLJA 1N54A 3EHNA 5LP0A 2H6HA 5BPPA 4BFRA 1N95A 3S7FA 3ULEG 3ZGQA 2V5QC 3QOUA 1O1RA 4PS7A 1NA3A 4YNDA 3SF4A 1Y8MA 3Q47B 4ZFHA 4JEUA 2HE0A 2BEDA 4A3TA 2R17C 2PQNA 3BEEA 1Z5SC 4TRQA 3KSLA 1RW2A 2FF4A 3TXMA 5C1DA 1A17A 1H6KA 1OUVA 2XCCA 1MZCA 2FEZA 4FHJA 3T9KA 3ULYA 4HORA 3V79K 1HS6A 4GZ6A 3RAUA 4N2SA 3B7UX 2RKKA 4MLPA 3FH5A 3S7DA 4UWKA 2BKGA 4ATZD 3UKRG 1FPPA 4UQXA 1MX6A 5ARFA 2XEVA 4BESA 4OAUC 4H7YA 3QJZA 2WMOA 4RVBA 2L0TB 3B7RL 3ZFWA 3LVQE 3IBEA 2KCKA 4R7LA 3FULA 1KZOA 3ZPJA 1HH8A 2AW6A 3JUIA 3L17A 1E7VA 1ZU2A 3HHMA 3FTWA 3G2TA 1MYOA 4EPZA 4C48B 2PM7A 4BWRA 4A55A 3ZIMA 1TJFA 3RO2A 4AXHA 2DVWA 1WAO1 5ITZF 3CVQA 3TL5A 1NZNA 2EINE 3FTSA 3T8KA 1NI1A 3ML8A 4NACA 3L08A 4G23A 1JUQA 3FUMA 1HG5A 2V5FA 2VGXB 5JMND 3FTZA 3RRUA 3D9JA 3HIZA 4GB9A 1QQEA 4PUCA 2I1JA 4XX5A 4EHMA 4WAFA 5EDSA 3APCA 4LNGA 3V2OA 1TNYA 4EBAG 3EHMA 3ZN3A 3SQVA 4FJZA 4GCNA 1HXIA 3SHFA 1H2UA 4A3VA 2YNQA 4HVBA 4C0MA 4G1TA 2IY0C 1AP7A 2DBAA 4HBDA 1P5QA 5CEAA 5FINA 2IU1A 4A1SA 3C5RA 4JZYA 2UWJG 1UOHA 5FQ7A 5KCMA 2FULA 4CT0A 4UWHA 1A5EA 4NRHB 4A63B 4GMJA 4B8AA 4F1PA 4CGVA 3NZUA 2MRIA 3U9WA 4TUMA 4JPSA 4GAAA 2OOEA 2L6JA 1FVHA 4LERA 1EYHA 2LXLA 4JHJA 3ZVVA 2FBNA 4ABNA 1SZ9A 3C3OA 4W9RA 5KWDA 2AJAA 4PS8A 3V31A 1Z6TA 3UPVA 1HE8A 2I2OA 5ARGA 1DVPA 2VJ8A 3JUEA 1IKND 2KCVA 4EZKA 3UUXA 4OYSA 3B95A 3EDTB 3NB2A 1JWGA 5KBAA 1BI7B 2IEJA 5ENNA 5AAOA 3PZ1A 2GRLA 3TWWA 4ILGA 5BW8C 4Z68A 4WNGA 4I6EA 1BD8A 5AQ7A 3L16A 5B1BE 2WXJA 4I6JA 3FEXA 3QDNA 2J8SD 4RSYA 3VLDA 4OVUA 4DI3A 2P9SG 3D9KA 4BERA 2WXNA 1N9AA 3KSQA 3ZU7B 1MX2A 4U8HA 1PAQA 3PS6A 2E0IA 3UIOC 3UM1A 3MX3A 1EPUA 3MYVA 3SBTB 3FU0A 4FULA 2ETBA 3Q9UC 3D9PA 4I6GA 4PH4B 3ASDA 1NA0A 1D8DA 1XGWA 3AU4A 4PDXA 3MKQA 2WVIA 1OCZE 4B93B 2GRPB 3SNXA 3DBSA 2FO1E 3PZ3A 4N3CA 4LCTA 4U8VD 4NURA 2V0PA 1ELKA 5E75A 1QNFA 3S7BA 3EJNA 4G11A 1UJJA 2WPVA 3EU5A 4BEPA 3UM2A 5FWQA 4ILHB 3Q4AB 2J4DA 3V2XA 4AOFA 2AXZA 4GTPA 3MV3B 1OY3D 2PNNA 1K1AA 4GZDA 2DIWA 5D0QD 4MRUA
chains in the Genus database with same CATH topology
2Y69E 1OCRE 2EIKE 2EIJE 3ASOE 1OCOE 3ASNE 3AG4E 1OCCE 2DYSE 5B1BE 2OCCE 1V54E 1V55E 2EINE 5IY5E 1OCZE 5B1AE 3ABME 3X2QE 2ZXWE 3ABKE 2EIME 3ABLE 3AG1E 3AG2E 3WG7E 5B3SE 2DYRE 3AG3E 2EILE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y69 E;  1OCR E;  2EIK E;  2EIJ E;  3ASO E;  1OCO E;  3ASN E;  3AG4 E;  1OCC E;  2DYS E;  5B1B E;  2OCC E;  1V54 E;  1V55 E;  2EIN E;  5IY5 E;  1OCZ E;  5B1A E;  3ABM E;  3X2Q E;  2ZXW E;  3ABK E;  2EIM E;  3ABL E;  3AG1 E;  3AG2 E;  3WG7 E;  5B3S E;  2DYR E;  3AG3 E;  2EIL E; 
#chains in the Genus database with same CATH topology
 2P9U G;  3SGH A;  4HOS A;  2IF4 A;  5A23 A;  3MZL B;  2P9P G;  2XEN A;  3OAW A;  2J9Q A;  3L82 A;  3TG5 A;  4K5B A;  2YQ8 A;  3OXG A;  2IQC A;  2RFA A;  4JC8 A;  3TWT A;  5J08 A;  2ZGD A;  1BU9 A;  4KBQ A;  3B7T A;  3QC1 A;  3Q7F A;  3UIP C;  4LUN U;  3NBN B;  3DEO A;  2PQR A;  4ILI A;  1S64 A;  1N94 A;  3P2B A;  3GYZ A;  2QC9 A;  2H6F A;  1U3D A;  2VGY A;  1TNU A;  4JD2 G;  1WDY A;  4LRZ A;  3ASN E;  4KZ0 A;  4N3B A;  4I1O B;  5G04 C;  1SA4 A;  2XEH A;  3U3W A;  5AQA A;  3E30 A;  2AWI A;  2GRO B;  1IXV A;  4YDE A;  2IOL A;  3E33 A;  5B1A E;  3PNL B;  3LCA A;  5LCW C;  2YHE A;  2J4B A;  1IQR A;  5ENT D;  3ONK A;  4APO A;  2R5S A;  4EQF A;  4GTS A;  3KS2 A;  3B7S A;  4KYO B;  2QYJ A;  4F3V A;  5FJY A;  5FTP A;  4IRU A;  1SVX A;  4ANU A;  3RU0 A;  3JYS A;  2LO6 A;  1JCS A;  5T3R A;  1O1T A;  3LY9 A;  4PS3 A;  3FUI A;  4UQZ A;  4CYM D;  1HG2 A;  2WXQ A;  3I3N A;  3NAW A;  2VGX A;  3CVV A;  3DSS A;  1OWL A;  1MHQ A;  4AY5 A;  4E85 A;  2DYS E;  4GA0 A;  4XI9 A;  1IQU A;  3UI2 A;  5AYW D;  5BV0 A;  4GYW A;  1HX8 A;  4QFV A;  4LNB A;  3CSF A;  3ASG A;  3PEV B;  1FT1 A;  2B6C A;  3MGB A;  5B3S E;  4URK A;  2XS8 A;  1YMP A;  4HS2 A;  4GTV A;  1E8Z A;  3FUJ A;  1YYH A;  3CK7 A;  3ASO E;  3AAA C;  5FQ4 A;  2A5U A;  1U2V G;  4LG6 A;  1PY1 A;  4V3I A;  5AIJ A;  4HXI A;  5FZR A;  3Q75 A;  4JA9 A;  2CHX A;  2ZIS A;  5FZQ A;  2H6G A;  4HLL A;  5LOZ A;  5KJL A;  2EIJ E;  2ZU6 B;  2UY1 A;  4OAV B;  4I2W A;  4BSZ B;  4QQI A;  4G26 A;  4K5C A;  1OXJ A;  5JA4 D;  2BKK B;  2QFC A;  1SA5 A;  3E32 A;  4L1B A;  3TXN A;  4B0Z A;  3RK6 A;  3L22 A;  3NQP A;  4HRN A;  4JEH A;  2R59 A;  2HO1 A;  3D9I A;  2X6H A;  3G2W A;  1LD8 A;  3AG3 E;  4DPR A;  3TWV A;  1TN6 A;  1H2V C;  1N0R A;  2XCB A;  3J5P A;  3SY2 A;  2P9N G;  1U3C A;  1NFI E;  5KJM A;  1S70 B;  3SZ7 A;  4Q69 A;  4J8Y A;  4LSZ E;  5DIZ A;  3TWS A;  3ZUV B;  4HI8 A;  2KC7 A;  5JHB A;  3CK9 A;  3RSE G;  4L9P A;  3AG1 E;  5CRU A;  1E8X A;  4I1M A;  4HRL A;  4WWP A;  3CVL A;  4J8S A;  2P58 C;  2XGM A;  2NC9 A;  4G2V A;  1Q2Z A;  3ZYM A;  4AIF A;  1E8Y A;  3BQO A;  1OT8 A;  2X6K A;  5FT9 A;  2LSV A;  3G2U A;  2J09 A;  3UM3 A;  2DZO A;  4GMR A;  2XPI A;  2X6J A;  4JW1 A;  4DLQ A;  3R7R A;  5HI7 A;  4XZ4 A;  1BI8 B;  4DX6 D;  3IHY A;  3D9M A;  4B94 A;  2MHK A;  4JL0 A;  2KBX A;  3CHM A;  3I5P A;  4XE0 A;  1OWP A;  3Q73 A;  3JQ1 A;  3FUK A;  5KNG A;  1HFA A;  4G8K A;  1X81 A;  4GTO A;  1BLX B;  2EIM E;  4K5A B;  3CHS A;  3D3M A;  4AVX A;  4GML A;  3GZ1 A;  1IYG A;  1H6O A;  4FLB A;  4N5Q A;  3ESL A;  2IJG X;  4BX8 A;  4BY6 A;  2OV8 A;  3E4B A;  1TN7 A;  1MJ0 A;  1JPL A;  1OCO E;  3IKO B;  3RRN B;  1B89 A;  1N4Q A;  3ONL A;  3CKB A;  2WXO A;  2HYZ A;  2JAB A;  3Q7A A;  2XRZ A;  1NL4 A;  1MQS A;  4WWO A;  2JLB A;  4UQY A;  3AS5 A;  4JA7 A;  2VSO E;  5ENQ D;  3D9N A;  3WXX A;  3BG1 B;  3K9I A;  2DWZ A;  4RG6 A;  2L6B A;  1UJK A;  4GYY A;  3CVN A;  3MCX A;  3I4G A;  4UI9 C;  1L5J A;  4O6F A;  1ZBP A;  4YDY A;  4JHR A;  3EIQ C;  4J8F A;  5CBN A;  4DX5 D;  4OVV A;  3R9M A;  2LAH A;  2Y4U A;  1DCQ A;  2F8Y A;  4F1S A;  5HQ8 A;  3R9A B;  3IV0 A;  2WXP A;  3UX4 A;  2VYI A;  4C9B B;  3HRA A;  3FTX A;  4ZHB A;  3PDN A;  1TJC A;  3LY7 A;  2GRM A;  3FUN A;  3SBS A;  5JJ6 A;  3PZ2 A;  2EQX A;  4Y6W A;  4BT9 A;  2AXV A;  2UY1 B;  3LYA A;  3RKV A;  3HXE A;  3ZW3 A;  4UUC A;  1E8W A;  2A4Z A;  2QYU A;  5CMW A;  1KZP A;  2GW1 A;  4ACL A;  3PEU B;  3Q78 A;  3VLF A;  5CED B;  3GZ2 A;  5KJK A;  4L2L A;  3HG0 D;  2LAI A;  3NOG D;  3PE4 A;  2J49 A;  4LEU A;  2CG3 A;  2VSX E;  3FHE A;  5BXO A;  2A5E A;  1OCC E;  4BSX A;  3APF A;  1D8E A;  1OWM A;  3JXJ A;  3S7J A;  3AS4 A;  3TWR A;  2ZXW E;  3ABL E;  4WUY A;  1UG3 A;  2C0M A;  2BF0 X;  3FH7 A;  3C98 A;  2WQH A;  4MKT A;  2I6H A;  3HYM B;  3AJI A;  3N71 A;  1UN9 A;  5CCM A;  1K3Z D;  2PM6 A;  5G05 C;  3SD5 A;  5AN8 A;  3FP3 A;  3FUH A;  4D10 C;  5M72 A;  5BT1 A;  4EEC A;  5CHE E;  4DI4 A;  3KEZ A;  3QB2 A;  2LNI A;  3Q79 A;  3DXM G;  2AVP A;  4B89 A;  3ASH A;  2E2E A;  2IFU A;  4N5C A;  4KT6 B;  3QWP A;  4HOU A;  3ULQ A;  1SZA A;  3PE3 A;  2Y0B G;  3ZXS A;  2QZA A;  3ZNG A;  3U66 A;  2GRN B;  5FIO A;  2KAT A;  2X38 A;  1E7U A;  4TXQ A;  3SI5 A;  4I17 A;  4GA1 A;  4K0R A;  4AV7 A;  1N4P A;  5A6C A;  3Q49 B;  3CEQ A;  2GRQ B;  4FP7 A;  3AG4 E;  3Q15 A;  4CRW A;  4B8C B;  3QWW A;  4XKB A;  2OEW A;  2DCP A;  1H2T C;  4Q94 A;  3W9G A;  1TNO A;  1Y6I A;  4G25 A;  1XNF A;  5CMY A;  3AU5 A;  1FT2 A;  3ZRH A;  3NF1 A;  5G04 J;  3E37 A;  4HQD A;  3CIA A;  4YDW A;  3SO8 A;  3U4T A;  2XEE A;  3CGH A;  2YHC A;  4GZ3 A;  3CKC A;  1Z3X A;  4F53 A;  2OEV A;  4UWG A;  3UMV A;  2GRR B;  4C0E A;  5HRY A;  1G3N B;  3TG4 A;  3W9F A;  4CZ2 D;  3B7B A;  2ION A;  2RG8 A;  2XGS A;  4BT8 A;  4DUI A;  4HRM B;  3JQ0 A;  2WB2 A;  2LXM A;  4U0U A;  1TNZ A;  4UI9 K;  2WXK A;  4FLH A;  2R03 A;  4MS6 A;  3V30 A;  1PC2 A;  5D2M C;  2WXR A;  4AP2 A;  3LPZ A;  4WWN A;  2BTD A;  2X6F A;  4CGW A;  2CG2 A;  4AY6 A;  3MA5 A;  3FU5 A;  3HVE B;  3L13 A;  3FU3 A;  1JCR A;  3LY8 A;  3BG0 B;  3CHR A;  5ANL A;  3Q9N C;  3DWL G;  4BX9 A;  3APD A;  1HZ4 A;  2XQ0 A;  5FQ6 A;  2RFM A;  3ISM C;  3UM0 A;  2F37 A;  5D0O D;  2DZN A;  3ABK E;  3AG2 E;  4XKC A;  4E6H A;  2KZT B;  2VTB A;  3GW4 A;  2WXL A;  1H6P A;  4ATG A;  2IO2 C;  2J07 A;  2EIK E;  4WNE A;  4HFG A;  4F7A A;  3NZS A;  2WXM A;  4BTB A;  5FZS A;  3FY4 A;  3DST A;  4RLY A;  5LX8 A;  3AS8 A;  1OWO A;  3FUD A;  3QK0 A;  2CFZ A;  3T5V A;  1S0P A;  3ZYL A;  2EIL E;  2Y69 E;  2M63 A;  4U0S A;  1HF8 A;  3RJV A;  4DRX E;  4XEI G;  2V4H C;  3DEP A;  3T5X A;  5DBK A;  4GPM A;  3QAQ A;  2I1K A;  3RRM B;  5EIB E;  4UWL A;  2MYO A;  5J90 A;  4U63 A;  3LJN A;  1TEZ A;  4I43 A;  3UT4 A;  2CFU A;  4DK5 A;  3PVL A;  3LXU X;  3UXG A;  1SQM A;  3DSW A;  2BUG A;  1OCR E;  2RD0 A;  2J08 A;  3SFX A;  5CER B;  3ML9 A;  4FC8 A;  3PH0 C;  5KJN A;  4AEZ C;  4NIK A;  2ZIR A;  5IY5 E;  3MV2 B;  3ZXP A;  2WXG A;  4O1O A;  2F0Y A;  4EBA A;  5CRV A;  3ZHE B;  5E76 A;  3CVP A;  3FH8 A;  2AXU A;  1IHG A;  3SFY A;  2V8S E;  3UKU G;  5EKQ D;  3SFZ A;  4JHK A;  3ESK A;  4AJW A;  3FDH A;  4Q96 A;  1HU3 A;  4CEM A;  4F6R D;  4FA6 A;  4HOT A;  2R02 A;  3CV0 A;  3CST A;  1N4R A;  1N4S A;  3BUA A;  2WQ6 A;  4KVM A;  5JJ7 A;  4CCA A;  4A1G A;  2HR2 A;  4XIF A;  3VTX A;  2L0I A;  4JXT A;  5EN5 D;  2I9C A;  4HLE A;  3OXF A;  2XZD G;  1GW6 A;  5AJD A;  3HXD A;  1KT1 A;  5T4Y A;  4UI9 J;  2NYJ A;  1JCQ A;  4U04 A;  2Y1L E;  5AQ9 A;  1LD7 A;  4X8Q A;  3B13 A;  3EIJ A;  3TWQ A;  2WXI A;  3NOC D;  3C3Q A;  5BUZ A;  4I1A A;  2OND A;  2NXP A;  3PZ4 A;  5A7D B;  3OTN A;  3UT8 A;  1TYQ G;  5D66 A;  2IOS A;  4NQ0 A;  1O5M A;  1DNP A;  3GZS A;  3X2Q E;  5ENS D;  1H0A A;  1FVF A;  2VTB B;  2R2L A;  1IHB A;  2WM9 A;  1TR4 A;  1TN8 A;  3FTU A;  4U7E B;  2KCL A;  4JVS A;  2R05 A;  4GTR A;  3EHR A;  5BV1 A;  2WMN A;  4L2Y A;  4ANW A;  1V54 E;  5EID A;  3CK8 A;  3EHQ A;  4RQI A;  5CBO A;  3RO3 A;  4I9E A;  2WXF A;  2C0L A;  3URZ A;  4L23 A;  1E90 A;  2VSN A;  3D9L A;  2P9K G;  1E96 B;  5ANR A;  3ENE A;  1Z3Y A;  3QKY A;  4HOQ A;  1K8K G;  5C2Y A;  3UIN C;  1UN8 A;  3FWV A;  2V4L A;  1EF1 C;  3T8M A;  4DX2 A;  3LS8 A;  5AJL A;  3FUE A;  2IO3 C;  1BPO A;  4I9C A;  3TAX A;  3FU6 A;  3LJ3 A;  3PRZ A;  3O4Z A;  4EZJ A;  2PZI A;  2XGO A;  1QBQ A;  2OCC E;  2P9L G;  3C72 A;  5G05 J;  1W3B A;  3LVR E;  4CDN A;  3EU9 A;  4K03 A;  4TUU A;  3KD7 A;  1KPS B;  5HS0 A;  3PNT B;  2MOW A;  2CHZ A;  4M3O A;  4ANV A;  4IYP A;  4J0U A;  3UQ3 A;  3QWV A;  3FUF A;  2X3M A;  3EUV A;  3ZYQ A;  3HVE A;  3IHV A;  5HKP A;  1DC2 A;  4BET A;  3CHP A;  2FO7 A;  2XHE A;  3G2S A;  4MBG A;  3DSX A;  5G55 A;  1QZ2 A;  1UW4 B;  2P9I G;  3KEA A;  5EIL A;  2XZT G;  1SW6 A;  1LTX A;  5EX0 A;  3L54 A;  1LF8 A;  4U95 D;  5EYL A;  1YA0 A;  4GPK A;  1FCH A;  1WG0 A;  2XRY A;  3WG7 E;  4I2Z A;  2KZT A;  3QNK A;  2Y4T A;  1AWC B;  1DCE A;  1MX4 A;  3MJW A;  2ILR A;  4M7C A;  4FU3 A;  3ZEF A;  2H6I A;  4DJA A;  4DX1 A;  4GTM A;  1YCS B;  4LNU D;  1N11 A;  4N39 A;  5EYP F;  1O1S A;  3TWX A;  4HI9 A;  1D9S A;  5FQ8 A;  3VLE A;  5BXU A;  4FAD A;  3TGO A;  4N2Q A;  3CHO A;  5ENP D;  1H19 A;  4DLO A;  2PL2 A;  2XPY A;  3ABM E;  3I4R B;  4L7T A;  4YDO A;  1KLX A;  2WXH A;  4ANX A;  4XI0 A;  2FI7 A;  4WND A;  2LSU A;  3Q5M A;  3CQC B;  3LDZ A;  2VSY A;  4CT4 A;  1INZ A;  1ZB1 A;  4IN3 B;  3L6A A;  4N3A A;  5CEC B;  4IUL A;  4APF A;  2YIN A;  2NSZ A;  2P2C P;  3JCK C;  3HDX A;  3UT7 A;  3DXK G;  4KVO A;  3QAR A;  2F8X K;  4FHK A;  4GU5 A;  1JWF A;  4TXR A;  1ELW A;  1RZ4 A;  4CDR A;  3PUK A;  4U07 A;  3CVW A;  3ZHE A;  3DPD A;  5LCW J;  1X5B A;  5LFA A;  3PZD A;  3CVU A;  4G24 A;  4J8E A;  4U0Z A;  1K1B A;  2LUH A;  2KM4 A;  2Y3A A;  2XS1 A;  5ENO D;  3PRE A;  1HO8 A;  4TV3 A;  4Y6C A;  4RG9 A;  4G8L A;  3VTY A;  4J7W A;  1N52 A;  2HM8 A;  1VDY A;  1QYM A;  4P29 A;  3TJP A;  4WNF A;  4U8Y D;  2VQ2 A;  4O60 A;  4EZL A;  1OWN A;  2XPZ A;  4H7X A;  2DYR E;  1ELR A;  3G2V A;  2L9B A;  1WY6 A;  1S63 A;  3FFL A;  5EX3 A;  4GTT A;  3P1U A;  4JB8 P;  3HXB A;  3DPY A;  2ETC A;  3CQG B;  3PUJ A;  3BU8 A;  4GA2 A;  1NP7 A;  3LKU A;  3DSU A;  4YVQ C;  5H7P A;  5JJT A;  1N0Q A;  3ASF A;  3DSV A;  4DX7 D;  3ZYK A;  3J5Q B;  3MKR A;  4ACK A;  4GZ5 A;  3O48 A;  2Q7F A;  3LEW A;  4KMO A;  3CHQ A;  3IXE A;  2GGF A;  2ZGG A;  5T8I A;  4J8D A;  4TXP A;  5ENR D;  3D9H A;  4UWF A;  3ZKJ A;  3TWU A;  3R7Q A;  5JHA A;  2KXP C;  5AQB A;  3RIB A;  4FJY A;  4HB5 A;  3D9O A;  1WM5 A;  4YVO A;  2VGE A;  2CHW A;  1TNB A;  3CVY A;  3CVX A;  2OVF A;  2OVB A;  3CR3 A;  4O1P A;  3U64 A;  3C3R A;  3HXC A;  3KAE A;  2QY7 A;  4GTQ A;  5KNH D;  4KZC A;  1KT0 A;  3F6Q A;  4KXK B;  2X6I A;  3S2A A;  3FTY A;  3E34 A;  3IEG A;  4U96 D;  4GYO A;  2JEK A;  4J6I A;  3JXI A;  1V55 E;  5AEN A;  3UTM A;  3MEK A;  2WQ7 A;  1EDU A;  3FEY A;  2C2L A;  4BTA A;  5BNW A;  3FTV A;  4ME2 A;  4CDM A;  5AAR A;  3L9T A;  4GZC A;  2B0O E;  5CCL A;  2ETA A;  3OXL A;  3HXF A;  4AM9 A;  4GCO A;  3MKQ B;  3DRA A;  4HNA D;  5G2N A;  3CLJ A;  1N54 A;  3EHN A;  5LP0 A;  2H6H A;  5BPP A;  4BFR A;  1N95 A;  3S7F A;  3ULE G;  3ZGQ A;  2V5Q C;  3QOU A;  1O1R A;  4PS7 A;  1NA3 A;  4YND A;  3SF4 A;  1Y8M A;  3Q47 B;  4ZFH A;  4JEU A;  2HE0 A;  2BED A;  4A3T A;  2R17 C;  2PQN A;  3BEE A;  1Z5S C;  4TRQ A;  3KSL A;  1RW2 A;  2FF4 A;  3TXM A;  5C1D A;  1A17 A;  1H6K A;  1OUV A;  2XCC A;  1MZC A;  2FEZ A;  4FHJ A;  3T9K A;  3ULY A;  4HOR A;  3V79 K;  1HS6 A;  4GZ6 A;  3RAU A;  4N2S A;  3B7U X;  2RKK A;  4MLP A;  3FH5 A;  3S7D A;  4UWK A;  2BKG A;  4ATZ D;  3UKR G;  1FPP A;  4UQX A;  1MX6 A;  5ARF A;  2XEV A;  4BES A;  4OAU C;  4H7Y A;  3QJZ A;  2WMO A;  4RVB A;  2L0T B;  3B7R L;  3ZFW A;  3LVQ E;  3IBE A;  2KCK A;  4R7L A;  3FUL A;  1KZO A;  3ZPJ A;  1HH8 A;  2AW6 A;  3JUI A;  3L17 A;  1E7V A;  1ZU2 A;  3HHM A;  3FTW A;  3G2T A;  1MYO A;  4EPZ A;  4C48 B;  2PM7 A;  4BWR A;  4A55 A;  3ZIM A;  1TJF A;  3RO2 A;  4AXH A;  2DVW A;  1WAO 1;  5ITZ F;  3CVQ A;  3TL5 A;  1NZN A;  2EIN E;  3FTS A;  3T8K A;  1NI1 A;  3ML8 A;  4NAC A;  3L08 A;  4G23 A;  1JUQ A;  3FUM A;  1HG5 A;  2V5F A;  2VGX B;  5JMN D;  3FTZ A;  3RRU A;  3D9J A;  3HIZ A;  4GB9 A;  1QQE A;  4PUC A;  2I1J A;  4XX5 A;  4EHM A;  4WAF A;  5EDS A;  3APC A;  4LNG A;  3V2O A;  1TNY A;  4EBA G;  3EHM A;  3ZN3 A;  3SQV A;  4FJZ A;  4GCN A;  1HXI A;  3SHF A;  1H2U A;  4A3V A;  2YNQ A;  4HVB A;  4C0M A;  4G1T A;  2IY0 C;  1AP7 A;  2DBA A;  4HBD A;  1P5Q A;  5CEA A;  5FIN A;  2IU1 A;  4A1S A;  3C5R A;  4JZY A;  2UWJ G;  1UOH A;  5FQ7 A;  5KCM A;  2FUL A;  4CT0 A;  4UWH A;  1A5E A;  4NRH B;  4A63 B;  4GMJ A;  4B8A A;  4F1P A;  4CGV A;  3NZU A;  2MRI A;  3U9W A;  4TUM A;  4JPS A;  4GAA A;  2OOE A;  2L6J A;  1FVH A;  4LER A;  1EYH A;  2LXL A;  4JHJ A;  3ZVV A;  2FBN A;  4ABN A;  1SZ9 A;  3C3O A;  4W9R A;  5KWD A;  2AJA A;  4PS8 A;  3V31 A;  1Z6T A;  3UPV A;  1HE8 A;  2I2O A;  5ARG A;  1DVP A;  2VJ8 A;  3JUE A;  1IKN D;  2KCV A;  4EZK A;  3UUX A;  4OYS A;  3B95 A;  3EDT B;  3NB2 A;  1JWG A;  5KBA A;  1BI7 B;  2IEJ A;  5ENN A;  5AAO A;  3PZ1 A;  2GRL A;  3TWW A;  4ILG A;  5BW8 C;  4Z68 A;  4WNG A;  4I6E A;  1BD8 A;  5AQ7 A;  3L16 A;  5B1B E;  2WXJ A;  4I6J A;  3FEX A;  3QDN A;  2J8S D;  4RSY A;  3VLD A;  4OVU A;  4DI3 A;  2P9S G;  3D9K A;  4BER A;  2WXN A;  1N9A A;  3KSQ A;  3ZU7 B;  1MX2 A;  4U8H A;  1PAQ A;  3PS6 A;  2E0I A;  3UIO C;  3UM1 A;  3MX3 A;  1EPU A;  3MYV A;  3SBT B;  3FU0 A;  4FUL A;  2ETB A;  3Q9U C;  3D9P A;  4I6G A;  4PH4 B;  3ASD A;  1NA0 A;  1D8D A;  1XGW A;  3AU4 A;  4PDX A;  3MKQ A;  2WVI A;  1OCZ E;  4B93 B;  2GRP B;  3SNX A;  3DBS A;  2FO1 E;  3PZ3 A;  4N3C A;  4LCT A;  4U8V D;  4NUR A;  2V0P A;  1ELK A;  5E75 A;  1QNF A;  3S7B A;  3EJN A;  4G11 A;  1UJJ A;  2WPV A;  3EU5 A;  4BEP A;  3UM2 A;  5FWQ A;  4ILH B;  3Q4A B;  2J4D A;  3V2X A;  4AOF A;  2AXZ A;  4GTP A;  3MV3 B;  1OY3 D;  2PNN A;  1K1A A;  4GZD A;  2DIW A;  5D0Q D;  4MRU A; 
#chains in the Genus database with same CATH homology
 2Y69 E;  1OCR E;  2EIK E;  2EIJ E;  3ASO E;  1OCO E;  3ASN E;  3AG4 E;  1OCC E;  2DYS E;  5B1B E;  2OCC E;  1V54 E;  1V55 E;  2EIN E;  5IY5 E;  1OCZ E;  5B1A E;  3ABM E;  3X2Q E;  2ZXW E;  3ABK E;  2EIM E;  3ABL E;  3AG1 E;  3AG2 E;  3WG7 E;  5B3S E;  2DYR E;  3AG3 E;  2EIL E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...