2DYSH

Bovine heart cytochrome c oxidase modified by dccd
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
b'KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Structures and physiological roles of 13 integral lipids of bovine heart cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 25
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2006-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 2dysH00
3WG7H 3AG2H 1V54H 1OCZH 3ABKH 5IY5H 2EIMH 3AG3H 3ABLH 1OCRH 2DYRH 3AG4H 3ASNH 1OCCH 2EIKH 3ABMH 5B1AH 2EIJH 3ASOH 1OCOH 3AG1H 2EILH 5B1BH 2DYSH 2EINH 2OCCH 2ZXWH 3X2QH 2Y69H 1V55H 5B3SH
chains in the Genus database with same CATH superfamily
4IHXA 2VONA 4ZC3A 1YIJI 3H9GA 3WTSC 2XRLA 2HFHA 2ISYA 1OCPA 3DEWA 2DCEA 4J00A 4ZTJA 1K83J 2V26A 5J47A 4OIQF 2ZFWA 3E6DA 3GZ5A 1JE8A 1XCBA 3JSPA 4L9JA 2HTSA 4MIMA 3W2WA 2DW4A 4XLPF 1AU7A 2XB0X 2R5ZA 4A3FJ 5GPCA 2Y48A 2CQXA 2R7FA 1L3LA 2EV5A 4XKCA 1LFPA 5DCFA 1ETQA 1G3YA 1RZ4A 3ELKA 3TGNA 4OIPF 1TNSA 4A12A 1X4PA 3I4MJ 2V4JC 3PQJA 1KYZA 4A3DJ 4BUPA 1IUYA 2K9SA 1WJFA 3H36A 2LBFB 2NVUB 4CUGA 5ILVA 4IRHA 3EUAA 3TW6A 2PG4A 3OIPA 1MSEC 1SD7A 1QZYA 3K6GA 1IXSB 3KP6A 3VSKA 3K9TA 1ACIA 3MWMA 1A36A 1BIBA 4Z6YA 2V1UA 4ENJA 3H0DA 3MAJA 1QHHD 1R1TA 4FETA 1CF7A 3JAMK 1ZK8A 4E70A 4JX5A 4LMYA 2O9LA 5CKTA 5F04A 1BL0A 4L9VA 2YS9A 5LHIA 3VDXA 2L0KA 1U2WA 3H9JA 1C0WA 1Z1DA 3RJPA 5DUIA 2MH9A 3DPUA 3DKYA 3W2AA 4IRGA 2A69F 5GAGJ 1X1AA 3M4OJ 3I58A 1LFUP 3W3CA 1UFMA 2J5PA 1X58A 2F2EA 4ETSA 6PAXA 5D5VB 1BR1A 3KEQA 2LC2A 5HDGA 4HPQA 4B8XA 4BXFA 1DU0A 4MQVA 3RPQA 1R58A 5IP7J 3DBLB 4YRVA 1B8IB 5L3EA 1LUJB 1MBJA 3N05A 4MHGA 3RDIA 1OCTC 4IHTA 3ESWB 4ESBA 4KA4A 3VODA 3ZMZA 3QPHA 5C3EJ 2JUGA 4U7DA 3LL7A 1KYWA 4UUTA 5LHGA 2OUMA 3R4KA 3ISPA 2XC7A 5EEAA 4M3DA 3TEDA 1WKMA 2VT3A 2DQRA 1IN4A 2NNYA 1O3QA 2ZMEA 1YW9A 3M9AA 3DPLC 2EH3A 1JHHA 4AUXA 3TP3A 4CH7A 4HF1A 1TWFJ 2WV1A 3H3VK 1IXRC 4DZPA 3AG2H 2D2WA 1X1PA 2KZVA 2NS0A 2X1DA 3FK7A 3HOVJ 3IH4A 3VFZA 5F08A 2OPTA 3OYIA 3CMYA 1YLFA 1OR7C 1WFXA 2JTVA 1D8KA 1MH4A 2Y2ZA 1MBEA 3TP0A 1JHFA 1HKQA 1H89C 1OFCX 2L9NA 4J01A 4G12A 3FK6A 3QOEA 4I7HA 2QQAA 2P5KA 3CUQC 2VL8A 4ZDOA 3K70C 2ZO4A 2Z16A 3HBLA 3E5UA 1ITYA 1JT0A 1I50J 3HSEA 1G3TA 3CCRI 3S15J 2DTZA 4WXDA 3MZ8A 1YS6A 2V9VA 3HOSA 1UHSA 2QA4I 3HOZJ 5L3CA 4HV6A 4E7LA 2ID3A 1LDJA 2VXZA 2PLYA 2RV8A 4MQ9F 4C2MJ 2PMUA 3UKGA 3BC8A 3CQZJ 4LFUA 3BG7A 3K4NA 2STTA 4XIDA 4HQEA 2LR8A 3W2VA 3CCJI 2K40A 1WSUA 3BTCA 2ZCWA 1ODDA 1XPXA 4BY1J 3CMAI 1P6RA 2LH9A 2HVRA 1LPQA 3CTAA 3BZCA 4KISA 2HDWA 3W6VA 4EVIA 1Y8RB 1WGXA 1Z3YA 2CW8A 3CMMA 1FEXA 4HYEA 2LKXA 1MBHA 2HYJA 3IWFA 4NBQA 5ED4A 4GGGA 2NRAC 1XCVA 1O3SA 1LVKA 5HS8A 1Z05A 2AQFA 2GA2A 2XV4S 1LE8B 3WTYC 5JLXA 4HNUA 1X2MA 1R00A 4ENMA 4U7BA 1SFOJ 1WRJA 5JHFA 3ONQA 3WGIA 3F9KA 2DOFA 5F0CA 5BPDA 2IT0A 1PUFA 3ZMDA 1TQMA 1WJ5A 1FYKA 2VUMJ 4IVNA 2E71A 4HZFA 1W0TA 1APLC 3D5LA 4WCGA 1ENHA 2JSPA 2KQRA 2MABA 2VKVA 1OCZH 4B09A 4LLNA 3ZMTA 4EJOA 3HOUJ 2H09A 1YQAA 2Z33A 2TRTA 2L9VA 5FFZA 4KNYA 4PFOA 3F72A 2GQQA 4PSXA 4EATA 3T8RA 1I3AA 1TT5B 1Y39A 4IKFA 3FF5A 2W00A 1J9IA 2BZTA 4RA2A 2IS4A 4F93B 4IEJA 2Z9OA 2WWYA 2PI0A 3GTGJ 4D5CA 4YIRX 2L9SA 3LOCA 3RTRA 3BDDA 4O6JA 2E1OA 3OMYA 2LK2A 4V19K 1E3OC 5IYDJ 3KEOA 3ZGKA 1MMAA 2IW5A 4M9ZA 4Q4ZF 2UV1A 4KYWA 1F43A 3JTGA 1BA5A 2CUFA 4L0ZB 4HNVA 4ZH4F 3EUKL 5E3LA 5EZGA 3NAUA 5FKLA 1HKTA 3E7LA 1Z91A 3LFUA 3CDHA 3B6CA 2DOEA 4BDYA 3ZPLA 2A3SA 1DPUA 2ZBKA 5F6FA 3L1PA 5K5OA 1U5TB 4D7NA 2EPFA 1DP7P 3BG6A 4IO9F 2DU9A 3S2DJ 2R7VA 1B6AA 3OS2A 3QWLA 3LSGA 4ASNA 3GFLA 4XM3A 5CQGA 3FM3A 1WPKA 2EIMH 3M7GA 3A0HC 3FXLA 3C7JA 5LHHA 2E34A 3WTUC 5K1YA 4BEHA 1MZBA 2R4GA 1PP7U 1UB9A 2EZLA 2QQ9A 1UHWA 2E36A 4ZDLA 4KICA 3HSFA 2DPDA 1OYYA 1IDZA 2Z3YA 2ISZA 3PUFA 1ZREA 2I10A 4G6QA 3OY9A 2VJ4A 5M5YJ 1QVUA 3M8EA 1X3WB 2LMDA 1XMXA 2VPLA 2DDBA 2R93J 2GAUA 3IKVA 2X6XA 2UWMA 2KDOA 5LGUA 3DBRB 4IL6C 5EF6A 4XL9A 2FUG2 2LKPA 2NYXA 4LB5A 4XLNF 1S7AA 3SEQA 4Y13A 3OYBA 1T6SA 3L2WA 2ZXWH 2AHQA 3S1QJ 3H92A 1TW3A 1SC7A 2DJNA 4DBRA 4G94A 4HOBA 1W4MA 2K85A 4O3MA 1RESA 3MEXA 3JTHA 4KIBA 1EA3A 1N75A 4Y3OA 3B6AA 1XTAA 1B9NA 1ETOA 2BY0A 5FO5A 2M7AA 4NNJA 3QRFF 4PSWA 3HUGB 4C30A 3TW7A 2IVMA 3ASOH 5J8FA 1I3QJ 1RUOA 1ETKA 1RUNA 4TV7A 2KL4A 4YFXF 4QWQA 1QA6A 1K7AA 5F1RA 4MEYF 3H0GJ 2I5UA 2PJRA 2DXIA 1YW7A 3P9CA 1G3WA 2XPUA 1SAUA 3SJMA 1FP1D 1Q1HA 3R0JA 3V7CA 1CGPA 1XS9A 1K6YA 4PGGA 5FGMA 1OCCH 4HA8A 2MGQA 2A5WA 2DLLA 3FWEA 1GXPA 2KKOA 1GXQA 1A31A 5ILUA 2KIUA 1XC5A 4B44A 4ZJZA 3WGHA 5J1UA 3GXOA 1XSDA 1DP3A 3GTJJ 3QOPA 3H5NA 1XDSA 2JZYA 3CDLA 4E7KA 2G7HA 2IP2A 3RYPA 3FXQA 4HSTA 4LJZF 2FJ1A 4LIUA 2EFNA 1ZLJA 2CO5A 3OIOA 4M72A 4NDLA 1MJ9A 4H4KC 3FM5A 2H8WA 1T38A 3MCZA 1S3JA 2ESNA 4A6DA 3L9FA 2XAFA 4L18B 3VPRA 4MEXF 1X2NA 5DTDA 5E8GA 3C2GA 1H9TA 3ABMH 2EIJH 3BG3A 3BR0A 3OS1A 1IW7F 2IGKA 4EGZA 4KDPA 4B1RA 3BR5A 2JPBA 3CJRB 4YFNF 3NWTA 4FCYA 3BCBA 2OAZA 5IOYA 2CH0A 2DQLA 3A0BC 1RI7A 2DA7A 3A02A 3J81K 3TOAA 2QKMB 2KFDA 1ZGJA 2KT0A 3NQOA 4CGZA 2YU3A 4IHVA 1MIJA 2ZXHA 4YIFA 1PUEE 3S16J 2FE3A 2K3PA 3BT9A 1XSXA 3FXKA 3GBGA 4L9TA 3G3ZA 3GWZA 4A3MJ 1JXSA 3CESA 1TWCJ 3I64A 3J80K 2ZJ2A 2BV6A 5HLTA 2L5QA 4JYKA 3VB2A 4FTHA 1LJ9A 5BNGA 3GZ6A 1IRGA 1V5GA 1NHAA 1U0JA 2HQAA 5CLSA 4DNCA 2PMZA 1Q1VA 2JVGA 1D0YA 5GAHJ 1EJ9A 3A1YA 2ZJRF 2QQBA 1KONA 1FOKA 5DM6F 1XB4A 4FASD 5EG0B 3E0JB 2R7QA 3CUOA 4RBOA 1F36A 5LEKA 2XAJA 2E35A 2ID6A 5L3BA 3D5SC 1IDYA 2VQHA 4R8HA 1O3TA 4NB5A 1GUUA 2KHMA 2XKPA 3HGYA 1W36D 2KIFA 2QSHX 1FSHA 1NTCA 1Y0NA 3CCMI 4ZDPA 3F21A 3HJEA 5D6FA 4HX8A 4C2UA 4X6AJ 3CJNA 2VJJA 1K4SA 2PQ8A 1RKTA 2CQQA 5KCMA 1T0FC 3CC7I 4BBSJ 3WHCA 2A05A 2FX0A 4N0BA 1T2KA 1UELB 2HYFA 2NOJB 3CCSI 1UHMA 1F9NA 3GUDA 4M6VA 5BOXA 1MNEA 1BJAA 4XRFA 2DFIA 1SFKA 5IYBJ 2BGCA 2EBIA 4BJ5C 2F48A 2R0QC 2BHYA 3BJ6A 3LSMA 4RS8A 1RETA 3R0AA 4BS9A 4XKVA 4KIFA 1D1CA 3BCAA 5EGOA 2GZWA 5K7HA 4M74A 4ZYAA 4A3KJ 1JJ6C 3RYRA 2KIQA 4XMYA 1VQKI 2XRNA 2CSOA 2IGOA 1G6NA 3GLXA 2LSOA 4EM0B 3H1CA 5DV5A 4XOPA 4I0BA 3Q0UA 1YJ9I 2QQ8A 1FOWA 4KITB 3LSIA 4DBQA 2W24A 3OYNA 3I59A 2VKHA 1JGSA 2HQNA 5H20A 4OMYA 4BQQA 2E1CA 3IH3A 2FEZA 4XQFA 3I53A 5KNLA 4HX7A 3TL4X 3S1MJ 1R4MB 3TDZC 1XMKA 3PIPF 3JRIA 2QSFX 1Y6IA 2P5LC 5K5QA 1T08B 2Q2EA 5E17F 3OYLA 2GLOA 3DTKA 2A61A 2IGNA 4N9HA 4A3BJ 4C9YA 4EJUA 1K6OA 1E0EA 2IAIA 3GO5A 5TGTA 2B9SA 2JJ7A 2XASA 3BLYA 3PFIA 1WVRA 4W1UA 4CYCA 3TO6A 1Z7UA 2EA2A 3SDGA 4XORA 2WAQN 5KVRA 3DTEA 4ZTFA 1FIAA 2XIGA 3ZCOA 2XROA 1I6HJ 2VPRA 1AWCA 5M5WJ 1R1VA 1HSJA 5ICEA 2DA4A 5IP9J 2P6SA 3TKYA 4F3QA 3OYKA 1G4DA 3E6CC 2CFXA 3MMYB 3T0YA 3L2RA 3OYGA 3ML6A 5D4SA 2MC4A 5E79C 2DTRA 4HQMA 1KQ8A 5JI6A 2DA5A 2VXDA 2EFQA 2HPIA 3GTLJ 3LSKA 2OZ6A 2EIKH 1HCRA 4CXFA 1NG7A 5AIPA 5KK1A 2RAEA 1P7IA 3DPTA 2BW3A 3COAC 2MA3A 3LQQA 2VC1A 4Y15A 4ZZDA 2EFWA 1SFUA 3J81Z 2EILH 1JKQC 5HS9A 4RAFA 4G6DA 1IGNA 1ETWA 3IUOA 2A68F 3C18A 2L01A 1IO2A 4Y33A 3L00A 3V4GA 2RNGA 3HL2A 4L0YB 3FXOA 1AKHA 3S2WA 1T98A 3QU3A 2W84A 3QPTA 4OU0A 4N4NB 4X0GA 1R5HA 3I9V2 3TMOA 3J80Z 2GXAA 4G7HF 1VQMI 1FP2A 4IF4A 2JMWA 4WX9A 3OR2C 5B5EC 5JR3A 3OYCA 1T39A 2VODA 2E5ZA 1TTYA 3PIOF 1X1DA 4BE0A 2FRHA 3MZHA 3E5XA 3HC7A 3DF8A 4A2UA 2EWNA 4KMUX 1DGWY 1BOAA 2Y31A 2X48A 1PYVA 2EZIA 1RNLA 2E7XA 2O3FA 3LSHA 3N97A 2MFZA 2PJPA 5CVUA 1TP4A 3DXJF 2LNBA 3FXMA 4A3JJ 4DYRA 3BQZA 1VQ5I 1H9GA 4P1WA 2CW0F 3BOQA 2K9NA 3K2AA 4BY7J 2XAGA 4XBFA 4QPOA 4AVPA 2H8RA 4I99C 3DLAA 3RPUD 3GTPJ 4A93J 3G1LA 2FA5A 1ZAOA 1MMDA 2Y69H 3HOXJ 3LA3A 2CV0A 5BS6A 2M0MA 4FHTA 4OOIA 5DS9A 2CGPA 4RB1A 5CQEA 1DU6A 3HHGA 1ZRDA 3F22A 2O0YA 5CVRA 3D1NI 2JRTA 4GRIA 3KIOA 2OTLI 2DT7B 4BJ6C 2L4AA 4DQ2A 1WZ2A 1QVTA 1B4AA 3BROA 1TWAJ 4P5OA 3TOBA 5CVVA 1P4AA 4L5JA 4A3IJ 2MD5A 2VQCA 2XAHA 1FT9A 2LREA 1X1CA 1X4OA 2B0LA 4CO8A 2RQQA 4I02A 2H27A 4KFCA 2VB6A 4UXNA 3BZ6A 2E2JJ 2YUSA 4RAYA 5D5UB 3EDPA 1V54H 2GOXB 2WTEA 2NS8A 5EEGA 2DMQA 2DMUA 2M4KA 5F0FA 1PP8F 3UR3C 3O8HA 4UB6C 1KQ9A 1F5TA 1TLHB 2VOOA 2EFOA 1AA7A 2MH2A 4IRIA 4A6EA 4CZZA 2I8DA 4ANJA 1W36C 2R5YB 1VQLI 2P7CB 1I5ZA 1AOYA 2FOWA 1QU3A 2DJIA 4XKBA 1IUFA 2W48A 2FF4A 3F8MA 2IXSA 2CUEA 2P81A 1VQ7I 3HM5A 2V6CA 5L3GA 1J2XA 2V9PA 1QHGA 4M3GA 2E1NA 4XOTA 3PM1A 5CVJA 4P9UA 5AONA 4DOZA 3BJAA 5DCMB 3QYBA 3VWBA 3OSGA 3DKWA 2BVMA 2X0LA 1T56A 2ZKZA 3K1MA 3ZRGA 2ECCA 4DYCA 1S7OA 3CCLI 3O3KA 1IC8A 3LWFA 4EMSA 2CV2A 3VEPA 1ZYRF 1HF0A 1PVEA 3F23A 2WAEA 9ANTA 5FRNA 1S7EA 3IWZA 1YRNA 1O57A 5EZHA 5J4YA 2XAQA 1P2FA 1VQOI 4MFEA 1VQ8I 4GFBA 3IRRA 3S3NA 3ZMVA 2YU9J 1P4WA 1DUXC 5FKKA 2KMUA 1DPRA 3S32A 3Q0VA 1BM9A 1E3HA 2KPMA 3SZTA 1YX5A 5HNHA 2QSGX 1ZQ3P 1ZGWA 5J1RA 4XICA 1K61A 3OWTA 2ETHA 3GTKJ 4RB3C 2XUBA 2HOAA 4D7MA 2W57A 1QZZA 5ICCA 4GDFA 2M8EA 3FXJA 4AVZA 4ESJA 3OYHA 4I09A 4NQWB 3BP8A 5EJCA 2Y9ZA 2LKSA 4UUVA 1YG2A 2OD5A 3OYDA 2Z99A 4BDZA 1JKOC 1WCMJ 2UXXA 1U6GA 5E8IA 4QSHA 1IF1A 1XGMA 4QTRA 4KT6A 1Z9CA 3PO3J 1X3UA 4YEJA 5FLVA 5KHDA 3I0TA 3BG9A 2MG4A 1UG2A 4PJLA 3CDIA 1TW2A 5KAFC 2LD5A 4HRIA 4HNTA 4G7ZF 1Z6TA 3WHBA 2GXBA 3CCYA 2L7KA 2HI3A 4G9YA 4FQGA 4D9JA 4OMZA 2HYGD 3E5QA 3W6JB 1K79A 1A35A 5GPAA 2CUJA 3A01A 2ME0A 3CUQA 4BNCA 3NRVA 1BJZA 1HDPA 2LVSA 4CICA 3U2RA 4CA0A 1TZLA 5DEQA 1GVDA 4P96A 4AIKA 3F6VA 4BYYA 1IJWC 2MSYA 1T33A 2VBWA 1MMSA 1E2XA 1LDDA 1YFHA 4EGYA 1RC9A 2DFFA 1USTA 1QPMA 2LY9A 1D8JA 1YO5C 3CP8A 4OAYA 1B72B 5HVQC 3PO2J 3LFKA 4KJZA 3F0CA 3BJOA 4PDKA 5FKOA 1YOVB 2IA1A 2GIZA 4A3CJ 2R7WA 1R7JA 3KX2A 3HTSB 4IHSA 3SFZA 2F5DA 2X6WA 3IAM2 3HOTA 2G9WA 2R7ZJ 5BMZA 1UG0A 2EK5A 2QBYB 1Z3XA 3FIWA 1S9HA 4M71A 1TQPA 1V4RA 3A4CA 5FB2A 3WODF 3HHHA 3L7WA 4ITVA 2DMNA 2F5FA 1V55H 4XSZF 1K78B 3ZMSA 3HZJA 2W7NA 2MW8A 1F1ZA 2RGVA 3JRBA 5IY5H 2NVQJ 2M9HA 1AHDP 2V6EA 4B48A 3DP7A 4WWCA 1YI2I 4Q47A 2KZGA 3I56I 3L2UA 4L9NA 5J6XA 3M1CA 4D0PA 1ZG3A 2O03A 3OYEA 2KP6A 2M3AA 2WC2A 3KCCA 2H6CA 4RAGA 1YHQI 4AU7A 1UZCA 2KRFA 1ZGAA 3Q9SA 3L2QA 3N4MA 2OZUA 4A3EJ 3PFYA 4RB2C 4I6ZA 4M3FA 1G59A 2PFBA 3QYFA 1R1UA 2R5ZB 1W7PA 1BBYA 1EKEA 2X51A 3V7RA 2IPQX 4AYBN 5HDKA 1OCRH 2DODA 2KIMA 3CJQB 4HX4A 1ZR4A 4BXXJ 5H2FC 2K27A 5BPIA 4UVAA 1IAWA 1OYIA 2FQ4A 1EH8A 2PBIA 2WBMA 3L09A 3VYSB 3ZQIA 4AD9A 1U3EM 2GM4A 1HKSA 2KRCA 3AG1H 4PUSA 1REPC 3WTXC 2E2HJ 4BU2A 5C44J 3I4PA 3CF5F 2M5WA 4ENNA 4RGUA 1VQ9I 4ZYHA 1VQ4I 4KN7X 2JWTA 3BTLA 1CF7B 3PQKA 5ICFA 5HLGA 2RVCA 2X9DA 3IP4B 3VOEA 2CYYA 3KLOA 2DPUA 3U21A 2HKOA 3M07A 1SMYF 2O6GE 4MTDA 1MH3A 2VE9A 2ZB9A 4IOCF 2A07F 1YJWI 1G3SA 4DW6A 2X1EA 2A5YB 1IZ1A 1HW1A 2VQLA 4RDUA 2QENA 3PNYA 1YIOA 2FNAA 3IHUA 2O7OA 3CMEI 3DBHB 1I6XA 1PJRA 2R7OA 3ABUA 3WTTC 4HF2A 3FBNB 4HBLA 2OC6A 1GLNA 3ZP5A 1FTTA 1IN5A 1FSEA 2RQPA 3K4MA 3OL3A 4RLFA 5E3MA 4UUSA 4BGDA 4LG3A 3CO7C 1VQNI 1Z21A 4OINF 1XN7A 1P4XA 4F91B 1H0MA 3DQVC 1Y56A 2A6EF 5LGNA 3HOYJ 1QZEA 2ZMEB 4HG2A 2F4OB 2XAUA 2EV6A 1ERDA 2V1NA 5D6EA 3FMQA 2CRGA 1YTYA 1U8RA 3GTMJ 3BR2A 1D1AA 3K4JA 1GVJA 2CQ7A 5LRSA 1M1EB 4U87A 3GVAA 3F6OA 3CO6C 2BY2A 2BY1A 1E3PA 2CQNA 3FKJA 5L3DA 2XHKA 2IGMA 3LA2A 3WTZA 4XN0A 3DCFA 3FX3A 2R7TA 1HXDA 3DV8A 5IPAA 3FXRA 2IEKA 3F8FA 4I0AA 3WU0A 3K1NA 1MDMA 4OWRB 4LK1F 2DN0A 5HS7A 1FYMA 1MNMC 4M3EA 1R49A 4JX4A 3U1DA 1JUMA 4PGHA 1MBKA 1GDTA 1W1WE 2GIVA 3H35A 2OA4A 1JKPC 3I71A 2E1MB 3AAFA 2JPCA 4XSXF 3S8PA 4L5IA 1GT0C 3P9IA 4XK4A 2DA3A 3GEZA 2Q8KA 3AL0C 1HW2A 3JRHA 3E97A 2M45A 3ROUA 3CCEI 3REOA 3DEEA 5ICGA 3H5RA 4B3AA 4AIHA 4II2A 3GYHX 1VQPI 2Q0OA 1ZRCA 3PSFA 5LLQA 2KDZA 3DFGA 3CCUI 1NK2P 1A04A 1A5JA 5CYVA 4NUBA 2IS1A 3FHNA 5JHUA 3GFMA 3D0SA 3Q9VA 2FNPA 2UZKA 4ZYGA 3E1SA 1YW8A 2DK5A 1GV5A 2EJRA 1SFEA 2AXLA 3KPHA 5D5WB 1ORKA 1P9QC 3O8GA 4BHBA 1FC3A 2COMA 3KE2A 2P0WA 1QRYA 1ULYA 3G1OA 3R6SA 4BAYA 1EF4A 2FXAA 3CP2A 4U0WA 1PUFB 1HQCA 4B3XA 1ONVA 3F8NA 3JCUC 1EH6A 4C2TA 1DDNA 2JA2A 1LVAA 4CCKA 5ERIA 4QPQA 4DZJA 1ETYA 2LBFA 2K5CA 4WXCA 5GP9A 2HNHA 1R22A 2DT6A 1MJAA 3EQLF 1DQUA 1BOBA 4A0XA 4C3JJ 2HS5A 3HEFA 3WGGA 2JA5J 3LA7A 5B1AH 3RI4A 1KU9A 2K4BA 4DJAA 2HVQA 4Q48A 1OCOH 2GXGA 4RLQA 3I4NJ 5FLXK 2LF8A 1J7KA 3WE2A 5HLHA 1ON1A 5GAEJ 3BTIA 3U9GA 1FLIA 2PX9A 3DU5A 3OYMA 4E6KG 4QLCU 2N8GA 4JK1X 4I98B 1R6RA 4BACA 2QM3A 3FZVA 4RM3A 4GXOA 3GTQJ 1IV6A 1IRZA 5DYMA 4PCQA 2HDCA 2VI6A 2FQ3A 1LEAA 5D8LB 3OOPA 2W85A 1V5FA 5CJ9A 1XSVA 3K4BA 5H6RA 1WJEA 4BQAA 3IAS2 2QEXI 4KMFA 5IT3A 4CYDA 5A2QK 4PJJA 2M2EA 1SMTA 2BHZA 5F0HA 3K69A 1B8IA 2FSWA 4RM2A 2WB1N 1KQ0A 2E5NA 4PZJA 4N9IA 4PJ0C 4M9SA 2IA2A 1BR2A 1IRFA 4B4CA 3H9QA 3IV5A 4IQ4A 1ZRFA 1UMQA 4IOAF 2L9RA 3SZGA 4F7ZA 4E7JA 3EUHA 3EYIA 2BE5F 3DEUA 3JR9A 2R7UA 1NG6A 1SAXA 4FT8A 4BEHB 5IP6A 2BEOA 1T0FA 3MKWB 3GFIA 4FE7A 1R5ID 2DMTA 2VQGA 1OYWA 1MD0A 4Y7NJ 5HODA 2V79A 2XKOA 2GOMA 4CHUA 4CCMA 1ZHFA 5DD8A 2W25A 3KFWX 4HLXA 3P5JA 4K2EA 3NWSA 2UUZA 4XN3A 3TO9A 1BN5A 2A6TA 1QO0D 4M9XA 4MO7A 3WU2C 3OYJA 4U0VA 2NNNA 2ZFUA 2JT1A 1MMNA 1RR8C 1QNTA 3ZMUA 2PMHA 1FX7A 4LG0A 1U78A 2VT2A 2QUFA 1NK3P 4IX7A 2E2IJ 3LSJA 3EETA 4IPAA 4JQFA 1LQ1A 1U9NA 2VASA 2XGDA 3Q3SA 1E17A 1YX3A 4GO1A 5IYCJ 3V8KA 3CLQA 1MGTA 2GWRA 3TQNA 2ELKA 2WY8Q 4UHTA 1HOMA 2F5CA 3AG3H 3FISA 2MLKA 1P7JA 2CW7A 1W5SA 3HGGA 3RKXA 5FRMA 4XNFA 1I1GA 2VBXA 4LITA 3ULQB 4X1EA 3NEUA 4G6TB 2EZKA 2HQ5A 3MKLA 2RN7A 4HDVA 4BXUA 1D3YA 2BBYA 3QPLA 3V42A 2LLKA 4BHCA 1LE8A 1TWHJ 2COBA 2DK8A 3LQRA 3FMRA 2HQRA 4CSWA 2PJRB 4ZYEA 2XB5A 1I39A 1XGSA 2P4WA 3WG9A 1YITI 1ZARA 1XX5A 3S3OA 3S3MA 4ON0A 2JRMA 5FKMA 1RKWA 2JVHA 1SEUA 1X1BA 1BC7C 3OR1C 3SFIA 1N78A 2IA0A 1POGA 1X19A 4DGWB 3ZQFA 1FPQA 4BQOA 4A5MA 2VKDA 5LGTA 3JSOA 2VOPA 3HOWJ 2HTJA 1JTYA 3O6BB 4OAZA 4EEFG 5B3SH 1Z0XA 3HSRA 1LDKB 3SYTA 3J7AY 2DT5A 4HAMA 2K9QA 1SVOA 4AM3A 1NH3A 3K4CA 2QF7A 3K7AJ 2JA8J 2NVTJ 1JUPA 2IJLA 4Y52J 4UNOA 1L0OC 5FLXZ 5DM7F 2Q1ZB 3PUBA 4A3LJ 1DGRM 4CCJA 4DYQA 3MN2A 3RQIA 1PDNC 2IBDA 2AQEA 1WHUA 1G8XA 1GHCA 1W7PD 1IG7A 3GTOJ 5E20A 3K0LA 1SD4A 4RGRA 4L5EA 3LSRA 2IRFG 3F8CA 4M6XA 2NS7A 3T5XA 2ZSHB 4ENKA 3KYLA 1J75A 4E7SA 1RRJA 2Y0MA 2YX4A 3BG5A 4Y17A 2G7UA 4XLFA 4YG2F 1I1SA 4JX6A 4A0YA 4HDUA 4UV9A 2HPMA 5A2QZ 1WH5A 4GYIA 5FD5A 3AL0B 2DA6A 1U5TA 3BY6A 3QODA 5CPRB 1SD6A 2Y9YA 1QQIA 4F55A 3CCQI 2M7BA 1W5CC 2R7SA 5FFXA 2WB1A 3OOUA 4G8XA 3DU6A 1O7FA 4I01A 1IV8A 4XLEA 4BJTA 4UVCA 1HDDC 2ZC2A 4GYGA 5GTHC 3CLOA 1EV7A 3L2CA 1FBSA 4UVBA 1J0RA 2JUCA 4II3A 2QCOA 3GX4X 2NVYJ 3K4KA 4XRSG 1WJBA 5LFAA 2OV7A 3F3XA 3R61A 2AS5F 2P7VB 2BYVE 2R7DA 2CS3A 3JRGA 3HG9A 2W82A 3WTWC 2V7FA 4GCVA 1KU3A 2HVSA 2STWA 3JRCA 1IRXA 3IRQA 1LB2A 2M8GX 2ZMEC 3QAHA 4XLHA 2YPRA 3CF2A 1BI0A 2AO9A 1WQ2A 3K1PA 2F4IA 4XLCA 3FMSA 5E1WA 3JREA 2LF7A 5H6QA 1FBQA 3K4LA 3F8BA 5AIQA 2IS2A 2R7RA 1F4KA 2X85A 3LAPA 3BPXA 2WAQA 3GMEA 3G71I 1TNTA 3V8LA 1WI3A 2Z1DA 1UCRA 5EGOB 2CMPA 1JGGA 1FZPB 2E7WA 3ABKH 4XR6A 3RKYA 4A3GJ 3WTVC 2VBYA 1MNDA 1D1BA 1FMWA 1ZG1A 2F6CA 3ASNH 3HUGA 4BL0B 2KLOA 3B73A 1VTNC 2JK3A 2DA2A 5EEHA 5DD4A 1OISA 2M87A 3AKZA 2E1MC 2L3DA 4MGRA 1ZN2A 3ZR8X 4FX0A 3C2HA 1B1BA 4B47A 5FKNA 4LLLA 2FMLA 3LSTA 1XGOA 2IS6A 1BI2A 3ZQLA 1MBFA 3HKZN 3I59B 2O5RA 2ZXIA 3P7NA 1WI9A 3OYFA 3CJTB 1MJBA 1LEBA 4S0HB 2LY1A 4HW0A 2EZHA 2HZTA 3MZYA 4CCNA 1HA8A 1S8NA 5TJJA 1FTZA 2Q2EB 3I55I 2L54A 1XD7A 1A6QA 5M5XJ 4S05A 5DUKA 1N77A 1O4XA 5JLWA 3T8TA 2Y30A 2P8TA 4IXAA 1Z7LA 1BC8C 2DFHA 2QVOA 2MBFA 2CFOA 3UNGC 3HYIA 3I3LA 4CYCB 4HSRA 1WJDA 3QPSA 5K7ZA 4LG0B 2FU4A 2R92J 1W0UA 1OR7A 2CUZA 3QYEA 2W4SA 2XPVA 3ECHA 1FOXA 2DI3A 3RQ4A 2CU7A 4F52A 4N4OB 5HLIA 1IN6A 1ETXA 2QLZA 3LNQA 4C3IJ 1JTXA 2WADA 2Z2SB 2OQRA 4G7OF 4QIWN 3PNVA 5F1JA 4RAZA 2XGCA 2FBKA 5FLMJ 3VSLA 3ZXSA 2H6BA 2M30A 2BW3B 2EB7A 2HDDA 2EINH 5DDGA 3IL2A 3J7YJ 2OCCH 2XF7A 4M3BA 3S93A 3JRDA 1QPIA 5E18F 2DOAA 4OIRF 3GZNB 3EYYA 4NHJA 1I27A 1WWXA 2V9KA 3GCMA 3RSNA 2VJ5A 1RR7A 1ZELA 2EA4A 3QP5A 4YFKF 1AKHB 4HLYA 1XMAA 1BIAA 2YR2A 3HTUA 5M3FJ 3GFJA 1XG1A 1QGPA 2VN2A 2G0EA 2AXTC 1BR4A 5E3OA 5E1ZB 3ABTA 2QKLB 2O8XA 3RIRA 3ZOBA 1X3ZB 4ABZA 2ADUA 5F64A 2VIXA 2M1BA 2NXNB 4U0YA 3IH2A 1Z6RA 5EG0A 2RKHA 3FXUA 4A5NA 1SVMA 4B43A 1OPCA 3MVPA 4YELA 3U1KA 1LKXA 3SQNA 1J09A 1U8BA 2YX7A 2K9MA 1BW5A 3DLLF 4E7IA 5K5RA 1VNDA 5J40A 5E3NA 4OIOF 3OSFA 2NAZA 2VLAA 5J4VA 3JAMZ 1WJAA 3G6EI 4MNUA 3E3VA 3K2ZA 2DBBA 3KP5A 5IT9K 3ZQ7A 1OQYA 1R23A 2M34A 2NOGA 1HLVA 2MYSA 2PN6A 1B59A 2KISA 2VC0A 3HRSA 4YIIA 2D45A 1GV2A 1XGNA 1T8IA 4MFDA 2W1OA 1D0XA 2O61A 1R4NB 4D1QA 1H88C 1T95A 2CJJA 2VE8A 4O5VA 3VYRB 2H94A 3KP4A 2DO7A 3KZYA 3ERED 2K7LA 4LGWA 2LFBA 3M3YJ 2GBYA 2FD5A 3DWLE 3K10A 2PMZN 1SANA 2ZXJA 2VKEA 2L7FP 4P9FA 3VYTB 4W97A 2CV1A 3CC2I 2ACJA 2E19A 3CD6I 3RPUA 3R60A 2XGXA 1CQTA 2Z5UA 3G1MA 3V7SA 2B63J 1TC3C 3Q5FA 2H1KA 4PFPA 1ZKGA 5BQTA 1LNWA 3BR3A 3OL4A 4UB8C 3KETA 2YSRA 4LK0F 3S17J 4LIVA 1EH7A 5F27A 1ZH5A 1FBUA 5B1BH 2HZDA 2WY7Q 2PEXA 3GF2A 5JVGF 3HKZA 1Y0UA 5LEJA 1J5YA 2K4JA 3M8FA 4MTEA 4AC0A 2ELHA 3ZN0A 3KEYA 2TCTA 1BI1A 3QQAA 3BR1A 3M1EA 4JBAA 3MKZA 1S29A 3G4SI 4EJWA 4E4HA 3HPGA 1STZA 2MC3A 4KIGA 2DFEA 3IKTA 3HDDA 1HC8A 2RC4A 1ZG5A 2BXYA 3WE3A 2QZ8A 4PK4A 1YRNB 2CWEA 3ECOA 3C1DA 3MFKA 1HSTA 4IQJA 4CCLA 5GTIC 2D1VA 4RMNA 4J19A 3OV8A 1XDUA 5EDNA 2LOOA 3KLNA 5E1XA 1ZR2A 1KU7A 2LG4A 3W6KB 3KYCB 3LAJA 2J5OA 1UJ8A 4FE4A 2GA1A 4XLAA 4XRSA 1SFXA 4MLOA 5L3FA 4BE2A 2D1HA 2XVCA 3E6BA 2HU9A 1IN8A 2WAFA 1Z67A 3HB9A 2HR3A 5K7FA 1JJ8C 3HXLA 2K3FA 1YYVA 3GW2A 3SHFA 2OTJI 3MQ0A 3ZQQA 5JVTA 4V2GA 3H5AA 2WA0A 3QP6A 3JRAA 2ZNZA 2DYRH 2FBIA 3EPZA 4M6YA 4UV8A 4BHPA 4D5FA 1OMIA 4F92B 3ZQHA 2MLGA 3QU6A 1JI8A 2B7EA 3M8JA 4ZZLA 2BVLA 3BZKA 2DYSH 2P5VA 1ZTRA 1FNNA 2FOKA 3HRMA 3I54A 3DTIA 3S1NJ 4I76A 1VF9A 3FHZA 5LRRA 1OKRA 4Z2YA 4EJVA 2X6OA 3Q0WA 4H0EA 4HF0A 1Z77A 1HW5A 1KGSA 1N25A 4M73A 2LY2A 1RPWA 3CCVI 5IT9Z 1KU2A 4I2OA 2ZSIB 1TWGJ 3MD2A 5HDNA 5TRDA 2LYCA 1ZLKA 3A01B 3CUQB 1QBJA 2ZJPF 4IJAA 2R7XA 4EJTA 2RNJA 2QGUA 2OQGA 1TL8A 2E60A 5KAIC 3OYAA 3D5RC 2L7ZA 4Y4RA 2Y0SN 3TBIA 3E6MA 4WF2A 3ZQGA 4IHYA 4ZYDA 2KJBA 3MKYB 2M4GA 3HIFA 4JP0A 1FYLA 4PJMA 3L2VA 2VJIA 1R5GA 3BWGA 1B9MA 4C3HJ 3AG4H 2CG4A 3KP2A 3BTJA 4AYBA 4V2FA 2JN6A 5C4JJ 2HEOA 1VZ0A 2HOTA 3PJRA 3HPHA 2C6YA 3OS0A 3SEZA 1BW6A 3RKQA 3HRUA 4PJNA 1U9OA 3VYUB 3TO7A 4DIQA 2LRDA 3X2QH 2JA6J 2RDPA 1TQIA 2DA1A 5LD2C 1OJLA 3S1RJ 1RIOH 4IHWA 1S72I 4Q5SF 4RGXA 1Y1VJ 5HOOA 2L02A 3AFHA 3A03A 2Y75A 3B02A 2VBZA 2DMPA 5J8CA 3OIQA 2F4MB 2R5YA 1FJLA 3A2KA 2BY3A 4KN4X 2K86A 3H3UA 3KZZA 4UY8I 4WXHA 1JKRC 2P6TA 1SD5A 2DAOA 1JT6A 5JFRA 3PL8A 4LLGF 4LD5A 3C2BA 3TDUC 4BE1A 3CC4I 3EUHC 1KZHA 3SXYA 2HXIA 5GADJ 4CZCA 2XF5A 1K4TA 2NVXJ 1Y8QB 3WG7H 5DCMA 2H1LA 2R3SA 4KT5C 3JRFA 1IXCA 2XPWA 4RGSA 3NARA 1FWZA 3ABLH 3T1BA 1MMGA 3H3ZA 3JW4A 1ETVA 5FD6A 1W7PB 2LDUA 4HV5A 3RZDJ 3FBIB 2ICWG 1FMVA 2V1XA 4EV0A 4WK8F 4LOCA 1YS7A 2MD0A 2XSJC 3KP7A 1FY7A 1TBXA 1R9TJ 3LSPA 1USSA 1LFBA 3DKXA 4XRMA 1O7LA 3KZIC 3RKWA 2JQ7A 1V3FA 5IOZA 4S04A 4CCOA 2X1CA 2HWVA 2M0CA 2HOEA 1TT0A 5D4RA 2HXOA 2LP0A 4E7HA 1MW7A 3G2BA 4NC7A 1OLTA 3HRTA 4EM1A 2ME6A 3WU1B 3GLLA 1YJNI 4A69C 3J7AO 1R36A 1HBXG 3C3WA 2LTPA 4XKWA 2BXZA 2X4HA 3S2HJ 3BPVA 2RREA 2FMYA 4AIJA 3S14J 1VFCA 2KRHA 1VQ6I 4A0ZA 2OF7A 3CZ6A 5EYRA 1UAAA 4NQWA 1YE9A 3PNTA 4RB0A 3J7ZI 3G73A 3K70D 1IN7A 1P92A 3P9KA 1V5EA 4HEA2 4XONA 1D5YA 2FBHA 4AIDA 5B66C 1MSFC 1A6IA 3FKIJ 4FISA 3ZN1A 2JSCA 5FROA 2WV0A 1D5VA 2OBPA 4UUSB 1Y1WJ 5TISC 1J59A 2F5VA 2F5EA 2TDXA 2CQKA 2HKXA 3BR6A 1H8AC 4P55A 1D0ZA 2L7MP 1S6LA 2A6HF 3LMMA 3SDBA 2K9LA 2JA7J 3KP3A 3KYDB 3O2PE 3ERMA 2OU2A 2XSDC 2ZJQF 1MKMA 2L2OA 1G2HA 2UXNA 1R71A 5CVIA 3IC7A 1W5TA 5C4XJ 5LBQA 1O3RA 4KUMA 2OJED 1S5LC 2EV0A 2QWWA 4JOMA 4EM2A 2X6YA 1WJCA 1ON2A 2ZNYA 5ILSA 4BKXA 1KA8A 2L4MA 4NC6A 1VI0A 1JUSA 1MBGA 2QYOA 3RCOA 2KJCA 2HOSA 4LB6B 4AWXB 2ECBA 4E7ZA 5FJ8J 3RZOJ 3SZPA 5M3MJ 1B72A 2Y0SA 2D5VA 5J3LA 1SVLA 5D5XB 4BQNA 4CDGA 2XDVA 2XGEA 4FX4A 2ELJA 2HGCA 2OCEA 4IZZA 3FDYA 4BH9A 2EFPA 3ZQCA 1MDMB 1FOYA 4R79A 2O8KA 4NC8A 1BI3A 1WH7A 2QBYA 2XF6A 3BQYA 4BBRJ 4EQQA 2EQRA 1FIPA 3PSIA 4R1HA 5D8KB 2DDAA 4U88A 5HNFA 2ESHA 1K78A 2BOLA 5J1YA 4ESFA 2K02A 3I5UA 2V1DA 3V8JA 1U5TC
chains in the Genus database with same CATH topology
3WG7H 3AG2H 1V54H 1OCZH 3ABKH 5IY5H 2EIMH 3AG3H 3ABLH 1OCRH 2DYRH 3AG4H 3ASNH 1OCCH 2EIKH 3ABMH 5B1AH 2EIJH 3ASOH 1OCOH 3AG1H 2EILH 5B1BH 2DYSH 2EINH 2OCCH 2ZXWH 3X2QH 2Y69H 1V55H 5B3SH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WG7 H;  3AG2 H;  1V54 H;  1OCZ H;  3ABK H;  5IY5 H;  2EIM H;  3AG3 H;  3ABL H;  1OCR H;  2DYR H;  3AG4 H;  3ASN H;  1OCC H;  2EIK H;  3ABM H;  5B1A H;  2EIJ H;  3ASO H;  1OCO H;  3AG1 H;  2EIL H;  5B1B H;  2DYS H;  2EIN H;  2OCC H;  2ZXW H;  3X2Q H;  2Y69 H;  1V55 H;  5B3S H; 
#chains in the Genus database with same CATH topology
 4IHX A;  2VON A;  4ZC3 A;  1YIJ I;  3H9G A;  3WTS C;  2XRL A;  2HFH A;  2ISY A;  1OCP A;  3DEW A;  2DCE A;  4J00 A;  4ZTJ A;  1K83 J;  2V26 A;  5J47 A;  4OIQ F;  2ZFW A;  3E6D A;  3GZ5 A;  1JE8 A;  1XCB A;  3JSP A;  4L9J A;  2HTS A;  4MIM A;  3W2W A;  2DW4 A;  4XLP F;  1AU7 A;  2XB0 X;  2R5Z A;  4A3F J;  5GPC A;  2Y48 A;  2CQX A;  2R7F A;  1L3L A;  2EV5 A;  4XKC A;  1LFP A;  5DCF A;  1ETQ A;  1G3Y A;  1RZ4 A;  3ELK A;  3TGN A;  4OIP F;  1TNS A;  4A12 A;  1X4P A;  3I4M J;  2V4J C;  3PQJ A;  1KYZ A;  4A3D J;  4BUP A;  1IUY A;  2K9S A;  1WJF A;  3H36 A;  2LBF B;  2NVU B;  4CUG A;  5ILV A;  4IRH A;  3EUA A;  3TW6 A;  2PG4 A;  3OIP A;  1MSE C;  1SD7 A;  1QZY A;  3K6G A;  1IXS B;  3KP6 A;  3VSK A;  3K9T A;  1ACI A;  3MWM A;  1A36 A;  1BIB A;  4Z6Y A;  2V1U A;  4ENJ A;  3H0D A;  3MAJ A;  1QHH D;  1R1T A;  4FET A;  1CF7 A;  3JAM K;  1ZK8 A;  4E70 A;  4JX5 A;  4LMY A;  2O9L A;  5CKT A;  5F04 A;  1BL0 A;  4L9V A;  2YS9 A;  5LHI A;  3VDX A;  2L0K A;  1U2W A;  3H9J A;  1C0W A;  1Z1D A;  3RJP A;  5DUI A;  2MH9 A;  3DPU A;  3DKY A;  3W2A A;  4IRG A;  2A69 F;  5GAG J;  1X1A A;  3M4O J;  3I58 A;  1LFU P;  3W3C A;  1UFM A;  2J5P A;  1X58 A;  2F2E A;  4ETS A;  6PAX A;  5D5V B;  1BR1 A;  3KEQ A;  2LC2 A;  5HDG A;  4HPQ A;  4B8X A;  4BXF A;  1DU0 A;  4MQV A;  3RPQ A;  1R58 A;  5IP7 J;  3DBL B;  4YRV A;  1B8I B;  5L3E A;  1LUJ B;  1MBJ A;  3N05 A;  4MHG A;  3RDI A;  1OCT C;  4IHT A;  3ESW B;  4ESB A;  4KA4 A;  3VOD A;  3ZMZ A;  3QPH A;  5C3E J;  2JUG A;  4U7D A;  3LL7 A;  1KYW A;  4UUT A;  5LHG A;  2OUM A;  3R4K A;  3ISP A;  2XC7 A;  5EEA A;  4M3D A;  3TED A;  1WKM A;  2VT3 A;  2DQR A;  1IN4 A;  2NNY A;  1O3Q A;  2ZME A;  1YW9 A;  3M9A A;  3DPL C;  2EH3 A;  1JHH A;  4AUX A;  3TP3 A;  4CH7 A;  4HF1 A;  1TWF J;  2WV1 A;  3H3V K;  1IXR C;  4DZP A;  3AG2 H;  2D2W A;  1X1P A;  2KZV A;  2NS0 A;  2X1D A;  3FK7 A;  3HOV J;  3IH4 A;  3VFZ A;  5F08 A;  2OPT A;  3OYI A;  3CMY A;  1YLF A;  1OR7 C;  1WFX A;  2JTV A;  1D8K A;  1MH4 A;  2Y2Z A;  1MBE A;  3TP0 A;  1JHF A;  1HKQ A;  1H89 C;  1OFC X;  2L9N A;  4J01 A;  4G12 A;  3FK6 A;  3QOE A;  4I7H A;  2QQA A;  2P5K A;  3CUQ C;  2VL8 A;  4ZDO A;  3K70 C;  2ZO4 A;  2Z16 A;  3HBL A;  3E5U A;  1ITY A;  1JT0 A;  1I50 J;  3HSE A;  1G3T A;  3CCR I;  3S15 J;  2DTZ A;  4WXD A;  3MZ8 A;  1YS6 A;  2V9V A;  3HOS A;  1UHS A;  2QA4 I;  3HOZ J;  5L3C A;  4HV6 A;  4E7L A;  2ID3 A;  1LDJ A;  2VXZ A;  2PLY A;  2RV8 A;  4MQ9 F;  4C2M J;  2PMU A;  3UKG A;  3BC8 A;  3CQZ J;  4LFU A;  3BG7 A;  3K4N A;  2STT A;  4XID A;  4HQE A;  2LR8 A;  3W2V A;  3CCJ I;  2K40 A;  1WSU A;  3BTC A;  2ZCW A;  1ODD A;  1XPX A;  4BY1 J;  3CMA I;  1P6R A;  2LH9 A;  2HVR A;  1LPQ A;  3CTA A;  3BZC A;  4KIS A;  2HDW A;  3W6V A;  4EVI A;  1Y8R B;  1WGX A;  1Z3Y A;  2CW8 A;  3CMM A;  1FEX A;  4HYE A;  2LKX A;  1MBH A;  2HYJ A;  3IWF A;  4NBQ A;  5ED4 A;  4GGG A;  2NRA C;  1XCV A;  1O3S A;  1LVK A;  5HS8 A;  1Z05 A;  2AQF A;  2GA2 A;  2XV4 S;  1LE8 B;  3WTY C;  5JLX A;  4HNU A;  1X2M A;  1R00 A;  4ENM A;  4U7B A;  1SFO J;  1WRJ A;  5JHF A;  3ONQ A;  3WGI A;  3F9K A;  2DOF A;  5F0C A;  5BPD A;  2IT0 A;  1PUF A;  3ZMD A;  1TQM A;  1WJ5 A;  1FYK A;  2VUM J;  4IVN A;  2E71 A;  4HZF A;  1W0T A;  1APL C;  3D5L A;  4WCG A;  1ENH A;  2JSP A;  2KQR A;  2MAB A;  2VKV A;  1OCZ H;  4B09 A;  4LLN A;  3ZMT A;  4EJO A;  3HOU J;  2H09 A;  1YQA A;  2Z33 A;  2TRT A;  2L9V A;  5FFZ A;  4KNY A;  4PFO A;  3F72 A;  2GQQ A;  4PSX A;  4EAT A;  3T8R A;  1I3A A;  1TT5 B;  1Y39 A;  4IKF A;  3FF5 A;  2W00 A;  1J9I A;  2BZT A;  4RA2 A;  2IS4 A;  4F93 B;  4IEJ A;  2Z9O A;  2WWY A;  2PI0 A;  3GTG J;  4D5C A;  4YIR X;  2L9S A;  3LOC A;  3RTR A;  3BDD A;  4O6J A;  2E1O A;  3OMY A;  2LK2 A;  4V19 K;  1E3O C;  5IYD J;  3KEO A;  3ZGK A;  1MMA A;  2IW5 A;  4M9Z A;  4Q4Z F;  2UV1 A;  4KYW A;  1F43 A;  3JTG A;  1BA5 A;  2CUF A;  4L0Z B;  4HNV A;  4ZH4 F;  3EUK L;  5E3L A;  5EZG A;  3NAU A;  5FKL A;  1HKT A;  3E7L A;  1Z91 A;  3LFU A;  3CDH A;  3B6C A;  2DOE A;  4BDY A;  3ZPL A;  2A3S A;  1DPU A;  2ZBK A;  5F6F A;  3L1P A;  5K5O A;  1U5T B;  4D7N A;  2EPF A;  1DP7 P;  3BG6 A;  4IO9 F;  2DU9 A;  3S2D J;  2R7V A;  1B6A A;  3OS2 A;  3QWL A;  3LSG A;  4ASN A;  3GFL A;  4XM3 A;  5CQG A;  3FM3 A;  1WPK A;  2EIM H;  3M7G A;  3A0H C;  3FXL A;  3C7J A;  5LHH A;  2E34 A;  3WTU C;  5K1Y A;  4BEH A;  1MZB A;  2R4G A;  1PP7 U;  1UB9 A;  2EZL A;  2QQ9 A;  1UHW A;  2E36 A;  4ZDL A;  4KIC A;  3HSF A;  2DPD A;  1OYY A;  1IDZ A;  2Z3Y A;  2ISZ A;  3PUF A;  1ZRE A;  2I10 A;  4G6Q A;  3OY9 A;  2VJ4 A;  5M5Y J;  1QVU A;  3M8E A;  1X3W B;  2LMD A;  1XMX A;  2VPL A;  2DDB A;  2R93 J;  2GAU A;  3IKV A;  2X6X A;  2UWM A;  2KDO A;  5LGU A;  3DBR B;  4IL6 C;  5EF6 A;  4XL9 A;  2FUG 2;  2LKP A;  2NYX A;  4LB5 A;  4XLN F;  1S7A A;  3SEQ A;  4Y13 A;  3OYB A;  1T6S A;  3L2W A;  2ZXW H;  2AHQ A;  3S1Q J;  3H92 A;  1TW3 A;  1SC7 A;  2DJN A;  4DBR A;  4G94 A;  4HOB A;  1W4M A;  2K85 A;  4O3M A;  1RES A;  3MEX A;  3JTH A;  4KIB A;  1EA3 A;  1N75 A;  4Y3O A;  3B6A A;  1XTA A;  1B9N A;  1ETO A;  2BY0 A;  5FO5 A;  2M7A A;  4NNJ A;  3QRF F;  4PSW A;  3HUG B;  4C30 A;  3TW7 A;  2IVM A;  3ASO H;  5J8F A;  1I3Q J;  1RUO A;  1ETK A;  1RUN A;  4TV7 A;  2KL4 A;  4YFX F;  4QWQ A;  1QA6 A;  1K7A A;  5F1R A;  4MEY F;  3H0G J;  2I5U A;  2PJR A;  2DXI A;  1YW7 A;  3P9C A;  1G3W A;  2XPU A;  1SAU A;  3SJM A;  1FP1 D;  1Q1H A;  3R0J A;  3V7C A;  1CGP A;  1XS9 A;  1K6Y A;  4PGG A;  5FGM A;  1OCC H;  4HA8 A;  2MGQ A;  2A5W A;  2DLL A;  3FWE A;  1GXP A;  2KKO A;  1GXQ A;  1A31 A;  5ILU A;  2KIU A;  1XC5 A;  4B44 A;  4ZJZ A;  3WGH A;  5J1U A;  3GXO A;  1XSD A;  1DP3 A;  3GTJ J;  3QOP A;  3H5N A;  1XDS A;  2JZY A;  3CDL A;  4E7K A;  2G7H A;  2IP2 A;  3RYP A;  3FXQ A;  4HST A;  4LJZ F;  2FJ1 A;  4LIU A;  2EFN A;  1ZLJ A;  2CO5 A;  3OIO A;  4M72 A;  4NDL A;  1MJ9 A;  4H4K C;  3FM5 A;  2H8W A;  1T38 A;  3MCZ A;  1S3J A;  2ESN A;  4A6D A;  3L9F A;  2XAF A;  4L18 B;  3VPR A;  4MEX F;  1X2N A;  5DTD A;  5E8G A;  3C2G A;  1H9T A;  3ABM H;  2EIJ H;  3BG3 A;  3BR0 A;  3OS1 A;  1IW7 F;  2IGK A;  4EGZ A;  4KDP A;  4B1R A;  3BR5 A;  2JPB A;  3CJR B;  4YFN F;  3NWT A;  4FCY A;  3BCB A;  2OAZ A;  5IOY A;  2CH0 A;  2DQL A;  3A0B C;  1RI7 A;  2DA7 A;  3A02 A;  3J81 K;  3TOA A;  2QKM B;  2KFD A;  1ZGJ A;  2KT0 A;  3NQO A;  4CGZ A;  2YU3 A;  4IHV A;  1MIJ A;  2ZXH A;  4YIF A;  1PUE E;  3S16 J;  2FE3 A;  2K3P A;  3BT9 A;  1XSX A;  3FXK A;  3GBG A;  4L9T A;  3G3Z A;  3GWZ A;  4A3M J;  1JXS A;  3CES A;  1TWC J;  3I64 A;  3J80 K;  2ZJ2 A;  2BV6 A;  5HLT A;  2L5Q A;  4JYK A;  3VB2 A;  4FTH A;  1LJ9 A;  5BNG A;  3GZ6 A;  1IRG A;  1V5G A;  1NHA A;  1U0J A;  2HQA A;  5CLS A;  4DNC A;  2PMZ A;  1Q1V A;  2JVG A;  1D0Y A;  5GAH J;  1EJ9 A;  3A1Y A;  2ZJR F;  2QQB A;  1KON A;  1FOK A;  5DM6 F;  1XB4 A;  4FAS D;  5EG0 B;  3E0J B;  2R7Q A;  3CUO A;  4RBO A;  1F36 A;  5LEK A;  2XAJ A;  2E35 A;  2ID6 A;  5L3B A;  3D5S C;  1IDY A;  2VQH A;  4R8H A;  1O3T A;  4NB5 A;  1GUU A;  2KHM A;  2XKP A;  3HGY A;  1W36 D;  2KIF A;  2QSH X;  1FSH A;  1NTC A;  1Y0N A;  3CCM I;  4ZDP A;  3F21 A;  3HJE A;  5D6F A;  4HX8 A;  4C2U A;  4X6A J;  3CJN A;  2VJJ A;  1K4S A;  2PQ8 A;  1RKT A;  2CQQ A;  5KCM A;  1T0F C;  3CC7 I;  4BBS J;  3WHC A;  2A05 A;  2FX0 A;  4N0B A;  1T2K A;  1UEL B;  2HYF A;  2NOJ B;  3CCS I;  1UHM A;  1F9N A;  3GUD A;  4M6V A;  5BOX A;  1MNE A;  1BJA A;  4XRF A;  2DFI A;  1SFK A;  5IYB J;  2BGC A;  2EBI A;  4BJ5 C;  2F48 A;  2R0Q C;  2BHY A;  3BJ6 A;  3LSM A;  4RS8 A;  1RET A;  3R0A A;  4BS9 A;  4XKV A;  4KIF A;  1D1C A;  3BCA A;  5EGO A;  2GZW A;  5K7H A;  4M74 A;  4ZYA A;  4A3K J;  1JJ6 C;  3RYR A;  2KIQ A;  4XMY A;  1VQK I;  2XRN A;  2CSO A;  2IGO A;  1G6N A;  3GLX A;  2LSO A;  4EM0 B;  3H1C A;  5DV5 A;  4XOP A;  4I0B A;  3Q0U A;  1YJ9 I;  2QQ8 A;  1FOW A;  4KIT B;  3LSI A;  4DBQ A;  2W24 A;  3OYN A;  3I59 A;  2VKH A;  1JGS A;  2HQN A;  5H20 A;  4OMY A;  4BQQ A;  2E1C A;  3IH3 A;  2FEZ A;  4XQF A;  3I53 A;  5KNL A;  4HX7 A;  3TL4 X;  3S1M J;  1R4M B;  3TDZ C;  1XMK A;  3PIP F;  3JRI A;  2QSF X;  1Y6I A;  2P5L C;  5K5Q A;  1T08 B;  2Q2E A;  5E17 F;  3OYL A;  2GLO A;  3DTK A;  2A61 A;  2IGN A;  4N9H A;  4A3B J;  4C9Y A;  4EJU A;  1K6O A;  1E0E A;  2IAI A;  3GO5 A;  5TGT A;  2B9S A;  2JJ7 A;  2XAS A;  3BLY A;  3PFI A;  1WVR A;  4W1U A;  4CYC A;  3TO6 A;  1Z7U A;  2EA2 A;  3SDG A;  4XOR A;  2WAQ N;  5KVR A;  3DTE A;  4ZTF A;  1FIA A;  2XIG A;  3ZCO A;  2XRO A;  1I6H J;  2VPR A;  1AWC A;  5M5W J;  1R1V A;  1HSJ A;  5ICE A;  2DA4 A;  5IP9 J;  2P6S A;  3TKY A;  4F3Q A;  3OYK A;  1G4D A;  3E6C C;  2CFX A;  3MMY B;  3T0Y A;  3L2R A;  3OYG A;  3ML6 A;  5D4S A;  2MC4 A;  5E79 C;  2DTR A;  4HQM A;  1KQ8 A;  5JI6 A;  2DA5 A;  2VXD A;  2EFQ A;  2HPI A;  3GTL J;  3LSK A;  2OZ6 A;  2EIK H;  1HCR A;  4CXF A;  1NG7 A;  5AIP A;  5KK1 A;  2RAE A;  1P7I A;  3DPT A;  2BW3 A;  3COA C;  2MA3 A;  3LQQ A;  2VC1 A;  4Y15 A;  4ZZD A;  2EFW A;  1SFU A;  3J81 Z;  2EIL H;  1JKQ C;  5HS9 A;  4RAF A;  4G6D A;  1IGN A;  1ETW A;  3IUO A;  2A68 F;  3C18 A;  2L01 A;  1IO2 A;  4Y33 A;  3L00 A;  3V4G A;  2RNG A;  3HL2 A;  4L0Y B;  3FXO A;  1AKH A;  3S2W A;  1T98 A;  3QU3 A;  2W84 A;  3QPT A;  4OU0 A;  4N4N B;  4X0G A;  1R5H A;  3I9V 2;  3TMO A;  3J80 Z;  2GXA A;  4G7H F;  1VQM I;  1FP2 A;  4IF4 A;  2JMW A;  4WX9 A;  3OR2 C;  5B5E C;  5JR3 A;  3OYC A;  1T39 A;  2VOD A;  2E5Z A;  1TTY A;  3PIO F;  1X1D A;  4BE0 A;  2FRH A;  3MZH A;  3E5X A;  3HC7 A;  3DF8 A;  4A2U A;  2EWN A;  4KMU X;  1DGW Y;  1BOA A;  2Y31 A;  2X48 A;  1PYV A;  2EZI A;  1RNL A;  2E7X A;  2O3F A;  3LSH A;  3N97 A;  2MFZ A;  2PJP A;  5CVU A;  1TP4 A;  3DXJ F;  2LNB A;  3FXM A;  4A3J J;  4DYR A;  3BQZ A;  1VQ5 I;  1H9G A;  4P1W A;  2CW0 F;  3BOQ A;  2K9N A;  3K2A A;  4BY7 J;  2XAG A;  4XBF A;  4QPO A;  4AVP A;  2H8R A;  4I99 C;  3DLA A;  3RPU D;  3GTP J;  4A93 J;  3G1L A;  2FA5 A;  1ZAO A;  1MMD A;  2Y69 H;  3HOX J;  3LA3 A;  2CV0 A;  5BS6 A;  2M0M A;  4FHT A;  4OOI A;  5DS9 A;  2CGP A;  4RB1 A;  5CQE A;  1DU6 A;  3HHG A;  1ZRD A;  3F22 A;  2O0Y A;  5CVR A;  3D1N I;  2JRT A;  4GRI A;  3KIO A;  2OTL I;  2DT7 B;  4BJ6 C;  2L4A A;  4DQ2 A;  1WZ2 A;  1QVT A;  1B4A A;  3BRO A;  1TWA J;  4P5O A;  3TOB A;  5CVV A;  1P4A A;  4L5J A;  4A3I J;  2MD5 A;  2VQC A;  2XAH A;  1FT9 A;  2LRE A;  1X1C A;  1X4O A;  2B0L A;  4CO8 A;  2RQQ A;  4I02 A;  2H27 A;  4KFC A;  2VB6 A;  4UXN A;  3BZ6 A;  2E2J J;  2YUS A;  4RAY A;  5D5U B;  3EDP A;  1V54 H;  2GOX B;  2WTE A;  2NS8 A;  5EEG A;  2DMQ A;  2DMU A;  2M4K A;  5F0F A;  1PP8 F;  3UR3 C;  3O8H A;  4UB6 C;  1KQ9 A;  1F5T A;  1TLH B;  2VOO A;  2EFO A;  1AA7 A;  2MH2 A;  4IRI A;  4A6E A;  4CZZ A;  2I8D A;  4ANJ A;  1W36 C;  2R5Y B;  1VQL I;  2P7C B;  1I5Z A;  1AOY A;  2FOW A;  1QU3 A;  2DJI A;  4XKB A;  1IUF A;  2W48 A;  2FF4 A;  3F8M A;  2IXS A;  2CUE A;  2P81 A;  1VQ7 I;  3HM5 A;  2V6C A;  5L3G A;  1J2X A;  2V9P A;  1QHG A;  4M3G A;  2E1N A;  4XOT A;  3PM1 A;  5CVJ A;  4P9U A;  5AON A;  4DOZ A;  3BJA A;  5DCM B;  3QYB A;  3VWB A;  3OSG A;  3DKW A;  2BVM A;  2X0L A;  1T56 A;  2ZKZ A;  3K1M A;  3ZRG A;  2ECC A;  4DYC A;  1S7O A;  3CCL I;  3O3K A;  1IC8 A;  3LWF A;  4EMS A;  2CV2 A;  3VEP A;  1ZYR F;  1HF0 A;  1PVE A;  3F23 A;  2WAE A;  9ANT A;  5FRN A;  1S7E A;  3IWZ A;  1YRN A;  1O57 A;  5EZH A;  5J4Y A;  2XAQ A;  1P2F A;  1VQO I;  4MFE A;  1VQ8 I;  4GFB A;  3IRR A;  3S3N A;  3ZMV A;  2YU9 J;  1P4W A;  1DUX C;  5FKK A;  2KMU A;  1DPR A;  3S32 A;  3Q0V A;  1BM9 A;  1E3H A;  2KPM A;  3SZT A;  1YX5 A;  5HNH A;  2QSG X;  1ZQ3 P;  1ZGW A;  5J1R A;  4XIC A;  1K61 A;  3OWT A;  2ETH A;  3GTK J;  4RB3 C;  2XUB A;  2HOA A;  4D7M A;  2W57 A;  1QZZ A;  5ICC A;  4GDF A;  2M8E A;  3FXJ A;  4AVZ A;  4ESJ A;  3OYH A;  4I09 A;  4NQW B;  3BP8 A;  5EJC A;  2Y9Z A;  2LKS A;  4UUV A;  1YG2 A;  2OD5 A;  3OYD A;  2Z99 A;  4BDZ A;  1JKO C;  1WCM J;  2UXX A;  1U6G A;  5E8I A;  4QSH A;  1IF1 A;  1XGM A;  4QTR A;  4KT6 A;  1Z9C A;  3PO3 J;  1X3U A;  4YEJ A;  5FLV A;  5KHD A;  3I0T A;  3BG9 A;  2MG4 A;  1UG2 A;  4PJL A;  3CDI A;  1TW2 A;  5KAF C;  2LD5 A;  4HRI A;  4HNT A;  4G7Z F;  1Z6T A;  3WHB A;  2GXB A;  3CCY A;  2L7K A;  2HI3 A;  4G9Y A;  4FQG A;  4D9J A;  4OMZ A;  2HYG D;  3E5Q A;  3W6J B;  1K79 A;  1A35 A;  5GPA A;  2CUJ A;  3A01 A;  2ME0 A;  3CUQ A;  4BNC A;  3NRV A;  1BJZ A;  1HDP A;  2LVS A;  4CIC A;  3U2R A;  4CA0 A;  1TZL A;  5DEQ A;  1GVD A;  4P96 A;  4AIK A;  3F6V A;  4BYY A;  1IJW C;  2MSY A;  1T33 A;  2VBW A;  1MMS A;  1E2X A;  1LDD A;  1YFH A;  4EGY A;  1RC9 A;  2DFF A;  1UST A;  1QPM A;  2LY9 A;  1D8J A;  1YO5 C;  3CP8 A;  4OAY A;  1B72 B;  5HVQ C;  3PO2 J;  3LFK A;  4KJZ A;  3F0C A;  3BJO A;  4PDK A;  5FKO A;  1YOV B;  2IA1 A;  2GIZ A;  4A3C J;  2R7W A;  1R7J A;  3KX2 A;  3HTS B;  4IHS A;  3SFZ A;  2F5D A;  2X6W A;  3IAM 2;  3HOT A;  2G9W A;  2R7Z J;  5BMZ A;  1UG0 A;  2EK5 A;  2QBY B;  1Z3X A;  3FIW A;  1S9H A;  4M71 A;  1TQP A;  1V4R A;  3A4C A;  5FB2 A;  3WOD F;  3HHH A;  3L7W A;  4ITV A;  2DMN A;  2F5F A;  1V55 H;  4XSZ F;  1K78 B;  3ZMS A;  3HZJ A;  2W7N A;  2MW8 A;  1F1Z A;  2RGV A;  3JRB A;  5IY5 H;  2NVQ J;  2M9H A;  1AHD P;  2V6E A;  4B48 A;  3DP7 A;  4WWC A;  1YI2 I;  4Q47 A;  2KZG A;  3I56 I;  3L2U A;  4L9N A;  5J6X A;  3M1C A;  4D0P A;  1ZG3 A;  2O03 A;  3OYE A;  2KP6 A;  2M3A A;  2WC2 A;  3KCC A;  2H6C A;  4RAG A;  1YHQ I;  4AU7 A;  1UZC A;  2KRF A;  1ZGA A;  3Q9S A;  3L2Q A;  3N4M A;  2OZU A;  4A3E J;  3PFY A;  4RB2 C;  4I6Z A;  4M3F A;  1G59 A;  2PFB A;  3QYF A;  1R1U A;  2R5Z B;  1W7P A;  1BBY A;  1EKE A;  2X51 A;  3V7R A;  2IPQ X;  4AYB N;  5HDK A;  1OCR H;  2DOD A;  2KIM A;  3CJQ B;  4HX4 A;  1ZR4 A;  4BXX J;  5H2F C;  2K27 A;  5BPI A;  4UVA A;  1IAW A;  1OYI A;  2FQ4 A;  1EH8 A;  2PBI A;  2WBM A;  3L09 A;  3VYS B;  3ZQI A;  4AD9 A;  1U3E M;  2GM4 A;  1HKS A;  2KRC A;  3AG1 H;  4PUS A;  1REP C;  3WTX C;  2E2H J;  4BU2 A;  5C44 J;  3I4P A;  3CF5 F;  2M5W A;  4ENN A;  4RGU A;  1VQ9 I;  4ZYH A;  1VQ4 I;  4KN7 X;  2JWT A;  3BTL A;  1CF7 B;  3PQK A;  5ICF A;  5HLG A;  2RVC A;  2X9D A;  3IP4 B;  3VOE A;  2CYY A;  3KLO A;  2DPU A;  3U21 A;  2HKO A;  3M07 A;  1SMY F;  2O6G E;  4MTD A;  1MH3 A;  2VE9 A;  2ZB9 A;  4IOC F;  2A07 F;  1YJW I;  1G3S A;  4DW6 A;  2X1E A;  2A5Y B;  1IZ1 A;  1HW1 A;  2VQL A;  4RDU A;  2QEN A;  3PNY A;  1YIO A;  2FNA A;  3IHU A;  2O7O A;  3CME I;  3DBH B;  1I6X A;  1PJR A;  2R7O A;  3ABU A;  3WTT C;  4HF2 A;  3FBN B;  4HBL A;  2OC6 A;  1GLN A;  3ZP5 A;  1FTT A;  1IN5 A;  1FSE A;  2RQP A;  3K4M A;  3OL3 A;  4RLF A;  5E3M A;  4UUS A;  4BGD A;  4LG3 A;  3CO7 C;  1VQN I;  1Z21 A;  4OIN F;  1XN7 A;  1P4X A;  4F91 B;  1H0M A;  3DQV C;  1Y56 A;  2A6E F;  5LGN A;  3HOY J;  1QZE A;  2ZME B;  4HG2 A;  2F4O B;  2XAU A;  2EV6 A;  1ERD A;  2V1N A;  5D6E A;  3FMQ A;  2CRG A;  1YTY A;  1U8R A;  3GTM J;  3BR2 A;  1D1A A;  3K4J A;  1GVJ A;  2CQ7 A;  5LRS A;  1M1E B;  4U87 A;  3GVA A;  3F6O A;  3CO6 C;  2BY2 A;  2BY1 A;  1E3P A;  2CQN A;  3FKJ A;  5L3D A;  2XHK A;  2IGM A;  3LA2 A;  3WTZ A;  4XN0 A;  3DCF A;  3FX3 A;  2R7T A;  1HXD A;  3DV8 A;  5IPA A;  3FXR A;  2IEK A;  3F8F A;  4I0A A;  3WU0 A;  3K1N A;  1MDM A;  4OWR B;  4LK1 F;  2DN0 A;  5HS7 A;  1FYM A;  1MNM C;  4M3E A;  1R49 A;  4JX4 A;  3U1D A;  1JUM A;  4PGH A;  1MBK A;  1GDT A;  1W1W E;  2GIV A;  3H35 A;  2OA4 A;  1JKP C;  3I71 A;  2E1M B;  3AAF A;  2JPC A;  4XSX F;  3S8P A;  4L5I A;  1GT0 C;  3P9I A;  4XK4 A;  2DA3 A;  3GEZ A;  2Q8K A;  3AL0 C;  1HW2 A;  3JRH A;  3E97 A;  2M45 A;  3ROU A;  3CCE I;  3REO A;  3DEE A;  5ICG A;  3H5R A;  4B3A A;  4AIH A;  4II2 A;  3GYH X;  1VQP I;  2Q0O A;  1ZRC A;  3PSF A;  5LLQ A;  2KDZ A;  3DFG A;  3CCU I;  1NK2 P;  1A04 A;  1A5J A;  5CYV A;  4NUB A;  2IS1 A;  3FHN A;  5JHU A;  3GFM A;  3D0S A;  3Q9V A;  2FNP A;  2UZK A;  4ZYG A;  3E1S A;  1YW8 A;  2DK5 A;  1GV5 A;  2EJR A;  1SFE A;  2AXL A;  3KPH A;  5D5W B;  1ORK A;  1P9Q C;  3O8G A;  4BHB A;  1FC3 A;  2COM A;  3KE2 A;  2P0W A;  1QRY A;  1ULY A;  3G1O A;  3R6S A;  4BAY A;  1EF4 A;  2FXA A;  3CP2 A;  4U0W A;  1PUF B;  1HQC A;  4B3X A;  1ONV A;  3F8N A;  3JCU C;  1EH6 A;  4C2T A;  1DDN A;  2JA2 A;  1LVA A;  4CCK A;  5ERI A;  4QPQ A;  4DZJ A;  1ETY A;  2LBF A;  2K5C A;  4WXC A;  5GP9 A;  2HNH A;  1R22 A;  2DT6 A;  1MJA A;  3EQL F;  1DQU A;  1BOB A;  4A0X A;  4C3J J;  2HS5 A;  3HEF A;  3WGG A;  2JA5 J;  3LA7 A;  5B1A H;  3RI4 A;  1KU9 A;  2K4B A;  4DJA A;  2HVQ A;  4Q48 A;  1OCO H;  2GXG A;  4RLQ A;  3I4N J;  5FLX K;  2LF8 A;  1J7K A;  3WE2 A;  5HLH A;  1ON1 A;  5GAE J;  3BTI A;  3U9G A;  1FLI A;  2PX9 A;  3DU5 A;  3OYM A;  4E6K G;  4QLC U;  2N8G A;  4JK1 X;  4I98 B;  1R6R A;  4BAC A;  2QM3 A;  3FZV A;  4RM3 A;  4GXO A;  3GTQ J;  1IV6 A;  1IRZ A;  5DYM A;  4PCQ A;  2HDC A;  2VI6 A;  2FQ3 A;  1LEA A;  5D8L B;  3OOP A;  2W85 A;  1V5F A;  5CJ9 A;  1XSV A;  3K4B A;  5H6R A;  1WJE A;  4BQA A;  3IAS 2;  2QEX I;  4KMF A;  5IT3 A;  4CYD A;  5A2Q K;  4PJJ A;  2M2E A;  1SMT A;  2BHZ A;  5F0H A;  3K69 A;  1B8I A;  2FSW A;  4RM2 A;  2WB1 N;  1KQ0 A;  2E5N A;  4PZJ A;  4N9I A;  4PJ0 C;  4M9S A;  2IA2 A;  1BR2 A;  1IRF A;  4B4C A;  3H9Q A;  3IV5 A;  4IQ4 A;  1ZRF A;  1UMQ A;  4IOA F;  2L9R A;  3SZG A;  4F7Z A;  4E7J A;  3EUH A;  3EYI A;  2BE5 F;  3DEU A;  3JR9 A;  2R7U A;  1NG6 A;  1SAX A;  4FT8 A;  4BEH B;  5IP6 A;  2BEO A;  1T0F A;  3MKW B;  3GFI A;  4FE7 A;  1R5I D;  2DMT A;  2VQG A;  1OYW A;  1MD0 A;  4Y7N J;  5HOD A;  2V79 A;  2XKO A;  2GOM A;  4CHU A;  4CCM A;  1ZHF A;  5DD8 A;  2W25 A;  3KFW X;  4HLX A;  3P5J A;  4K2E A;  3NWS A;  2UUZ A;  4XN3 A;  3TO9 A;  1BN5 A;  2A6T A;  1QO0 D;  4M9X A;  4MO7 A;  3WU2 C;  3OYJ A;  4U0V A;  2NNN A;  2ZFU A;  2JT1 A;  1MMN A;  1RR8 C;  1QNT A;  3ZMU A;  2PMH A;  1FX7 A;  4LG0 A;  1U78 A;  2VT2 A;  2QUF A;  1NK3 P;  4IX7 A;  2E2I J;  3LSJ A;  3EET A;  4IPA A;  4JQF A;  1LQ1 A;  1U9N A;  2VAS A;  2XGD A;  3Q3S A;  1E17 A;  1YX3 A;  4GO1 A;  5IYC J;  3V8K A;  3CLQ A;  1MGT A;  2GWR A;  3TQN A;  2ELK A;  2WY8 Q;  4UHT A;  1HOM A;  2F5C A;  3AG3 H;  3FIS A;  2MLK A;  1P7J A;  2CW7 A;  1W5S A;  3HGG A;  3RKX A;  5FRM A;  4XNF A;  1I1G A;  2VBX A;  4LIT A;  3ULQ B;  4X1E A;  3NEU A;  4G6T B;  2EZK A;  2HQ5 A;  3MKL A;  2RN7 A;  4HDV A;  4BXU A;  1D3Y A;  2BBY A;  3QPL A;  3V42 A;  2LLK A;  4BHC A;  1LE8 A;  1TWH J;  2COB A;  2DK8 A;  3LQR A;  3FMR A;  2HQR A;  4CSW A;  2PJR B;  4ZYE A;  2XB5 A;  1I39 A;  1XGS A;  2P4W A;  3WG9 A;  1YIT I;  1ZAR A;  1XX5 A;  3S3O A;  3S3M A;  4ON0 A;  2JRM A;  5FKM A;  1RKW A;  2JVH A;  1SEU A;  1X1B A;  1BC7 C;  3OR1 C;  3SFI A;  1N78 A;  2IA0 A;  1POG A;  1X19 A;  4DGW B;  3ZQF A;  1FPQ A;  4BQO A;  4A5M A;  2VKD A;  5LGT A;  3JSO A;  2VOP A;  3HOW J;  2HTJ A;  1JTY A;  3O6B B;  4OAZ A;  4EEF G;  5B3S H;  1Z0X A;  3HSR A;  1LDK B;  3SYT A;  3J7A Y;  2DT5 A;  4HAM A;  2K9Q A;  1SVO A;  4AM3 A;  1NH3 A;  3K4C A;  2QF7 A;  3K7A J;  2JA8 J;  2NVT J;  1JUP A;  2IJL A;  4Y52 J;  4UNO A;  1L0O C;  5FLX Z;  5DM7 F;  2Q1Z B;  3PUB A;  4A3L J;  1DGR M;  4CCJ A;  4DYQ A;  3MN2 A;  3RQI A;  1PDN C;  2IBD A;  2AQE A;  1WHU A;  1G8X A;  1GHC A;  1W7P D;  1IG7 A;  3GTO J;  5E20 A;  3K0L A;  1SD4 A;  4RGR A;  4L5E A;  3LSR A;  2IRF G;  3F8C A;  4M6X A;  2NS7 A;  3T5X A;  2ZSH B;  4ENK A;  3KYL A;  1J75 A;  4E7S A;  1RRJ A;  2Y0M A;  2YX4 A;  3BG5 A;  4Y17 A;  2G7U A;  4XLF A;  4YG2 F;  1I1S A;  4JX6 A;  4A0Y A;  4HDU A;  4UV9 A;  2HPM A;  5A2Q Z;  1WH5 A;  4GYI A;  5FD5 A;  3AL0 B;  2DA6 A;  1U5T A;  3BY6 A;  3QOD A;  5CPR B;  1SD6 A;  2Y9Y A;  1QQI A;  4F55 A;  3CCQ I;  2M7B A;  1W5C C;  2R7S A;  5FFX A;  2WB1 A;  3OOU A;  4G8X A;  3DU6 A;  1O7F A;  4I01 A;  1IV8 A;  4XLE A;  4BJT A;  4UVC A;  1HDD C;  2ZC2 A;  4GYG A;  5GTH C;  3CLO A;  1EV7 A;  3L2C A;  1FBS A;  4UVB A;  1J0R A;  2JUC A;  4II3 A;  2QCO A;  3GX4 X;  2NVY J;  3K4K A;  4XRS G;  1WJB A;  5LFA A;  2OV7 A;  3F3X A;  3R61 A;  2AS5 F;  2P7V B;  2BYV E;  2R7D A;  2CS3 A;  3JRG A;  3HG9 A;  2W82 A;  3WTW C;  2V7F A;  4GCV A;  1KU3 A;  2HVS A;  2STW A;  3JRC A;  1IRX A;  3IRQ A;  1LB2 A;  2M8G X;  2ZME C;  3QAH A;  4XLH A;  2YPR A;  3CF2 A;  1BI0 A;  2AO9 A;  1WQ2 A;  3K1P A;  2F4I A;  4XLC A;  3FMS A;  5E1W A;  3JRE A;  2LF7 A;  5H6Q A;  1FBQ A;  3K4L A;  3F8B A;  5AIQ A;  2IS2 A;  2R7R A;  1F4K A;  2X85 A;  3LAP A;  3BPX A;  2WAQ A;  3GME A;  3G71 I;  1TNT A;  3V8L A;  1WI3 A;  2Z1D A;  1UCR A;  5EGO B;  2CMP A;  1JGG A;  1FZP B;  2E7W A;  3ABK H;  4XR6 A;  3RKY A;  4A3G J;  3WTV C;  2VBY A;  1MND A;  1D1B A;  1FMW A;  1ZG1 A;  2F6C A;  3ASN H;  3HUG A;  4BL0 B;  2KLO A;  3B73 A;  1VTN C;  2JK3 A;  2DA2 A;  5EEH A;  5DD4 A;  1OIS A;  2M87 A;  3AKZ A;  2E1M C;  2L3D A;  4MGR A;  1ZN2 A;  3ZR8 X;  4FX0 A;  3C2H A;  1B1B A;  4B47 A;  5FKN A;  4LLL A;  2FML A;  3LST A;  1XGO A;  2IS6 A;  1BI2 A;  3ZQL A;  1MBF A;  3HKZ N;  3I59 B;  2O5R A;  2ZXI A;  3P7N A;  1WI9 A;  3OYF A;  3CJT B;  1MJB A;  1LEB A;  4S0H B;  2LY1 A;  4HW0 A;  2EZH A;  2HZT A;  3MZY A;  4CCN A;  1HA8 A;  1S8N A;  5TJJ A;  1FTZ A;  2Q2E B;  3I55 I;  2L54 A;  1XD7 A;  1A6Q A;  5M5X J;  4S05 A;  5DUK A;  1N77 A;  1O4X A;  5JLW A;  3T8T A;  2Y30 A;  2P8T A;  4IXA A;  1Z7L A;  1BC8 C;  2DFH A;  2QVO A;  2MBF A;  2CFO A;  3UNG C;  3HYI A;  3I3L A;  4CYC B;  4HSR A;  1WJD A;  3QPS A;  5K7Z A;  4LG0 B;  2FU4 A;  2R92 J;  1W0U A;  1OR7 A;  2CUZ A;  3QYE A;  2W4S A;  2XPV A;  3ECH A;  1FOX A;  2DI3 A;  3RQ4 A;  2CU7 A;  4F52 A;  4N4O B;  5HLI A;  1IN6 A;  1ETX A;  2QLZ A;  3LNQ A;  4C3I J;  1JTX A;  2WAD A;  2Z2S B;  2OQR A;  4G7O F;  4QIW N;  3PNV A;  5F1J A;  4RAZ A;  2XGC A;  2FBK A;  5FLM J;  3VSL A;  3ZXS A;  2H6B A;  2M30 A;  2BW3 B;  2EB7 A;  2HDD A;  2EIN H;  5DDG A;  3IL2 A;  3J7Y J;  2OCC H;  2XF7 A;  4M3B A;  3S93 A;  3JRD A;  1QPI A;  5E18 F;  2DOA A;  4OIR F;  3GZN B;  3EYY A;  4NHJ A;  1I27 A;  1WWX A;  2V9K A;  3GCM A;  3RSN A;  2VJ5 A;  1RR7 A;  1ZEL A;  2EA4 A;  3QP5 A;  4YFK F;  1AKH B;  4HLY A;  1XMA A;  1BIA A;  2YR2 A;  3HTU A;  5M3F J;  3GFJ A;  1XG1 A;  1QGP A;  2VN2 A;  2G0E A;  2AXT C;  1BR4 A;  5E3O A;  5E1Z B;  3ABT A;  2QKL B;  2O8X A;  3RIR A;  3ZOB A;  1X3Z B;  4ABZ A;  2ADU A;  5F64 A;  2VIX A;  2M1B A;  2NXN B;  4U0Y A;  3IH2 A;  1Z6R A;  5EG0 A;  2RKH A;  3FXU A;  4A5N A;  1SVM A;  4B43 A;  1OPC A;  3MVP A;  4YEL A;  3U1K A;  1LKX A;  3SQN A;  1J09 A;  1U8B A;  2YX7 A;  2K9M A;  1BW5 A;  3DLL F;  4E7I A;  5K5R A;  1VND A;  5J40 A;  5E3N A;  4OIO F;  3OSF A;  2NAZ A;  2VLA A;  5J4V A;  3JAM Z;  1WJA A;  3G6E I;  4MNU A;  3E3V A;  3K2Z A;  2DBB A;  3KP5 A;  5IT9 K;  3ZQ7 A;  1OQY A;  1R23 A;  2M34 A;  2NOG A;  1HLV A;  2MYS A;  2PN6 A;  1B59 A;  2KIS A;  2VC0 A;  3HRS A;  4YII A;  2D45 A;  1GV2 A;  1XGN A;  1T8I A;  4MFD A;  2W1O A;  1D0X A;  2O61 A;  1R4N B;  4D1Q A;  1H88 C;  1T95 A;  2CJJ A;  2VE8 A;  4O5V A;  3VYR B;  2H94 A;  3KP4 A;  2DO7 A;  3KZY A;  3ERE D;  2K7L A;  4LGW A;  2LFB A;  3M3Y J;  2GBY A;  2FD5 A;  3DWL E;  3K10 A;  2PMZ N;  1SAN A;  2ZXJ A;  2VKE A;  2L7F P;  4P9F A;  3VYT B;  4W97 A;  2CV1 A;  3CC2 I;  2ACJ A;  2E19 A;  3CD6 I;  3RPU A;  3R60 A;  2XGX A;  1CQT A;  2Z5U A;  3G1M A;  3V7S A;  2B63 J;  1TC3 C;  3Q5F A;  2H1K A;  4PFP A;  1ZKG A;  5BQT A;  1LNW A;  3BR3 A;  3OL4 A;  4UB8 C;  3KET A;  2YSR A;  4LK0 F;  3S17 J;  4LIV A;  1EH7 A;  5F27 A;  1ZH5 A;  1FBU A;  5B1B H;  2HZD A;  2WY7 Q;  2PEX A;  3GF2 A;  5JVG F;  3HKZ A;  1Y0U A;  5LEJ A;  1J5Y A;  2K4J A;  3M8F A;  4MTE A;  4AC0 A;  2ELH A;  3ZN0 A;  3KEY A;  2TCT A;  1BI1 A;  3QQA A;  3BR1 A;  3M1E A;  4JBA A;  3MKZ A;  1S29 A;  3G4S I;  4EJW A;  4E4H A;  3HPG A;  1STZ A;  2MC3 A;  4KIG A;  2DFE A;  3IKT A;  3HDD A;  1HC8 A;  2RC4 A;  1ZG5 A;  2BXY A;  3WE3 A;  2QZ8 A;  4PK4 A;  1YRN B;  2CWE A;  3ECO A;  3C1D A;  3MFK A;  1HST A;  4IQJ A;  4CCL A;  5GTI C;  2D1V A;  4RMN A;  4J19 A;  3OV8 A;  1XDU A;  5EDN A;  2LOO A;  3KLN A;  5E1X A;  1ZR2 A;  1KU7 A;  2LG4 A;  3W6K B;  3KYC B;  3LAJ A;  2J5O A;  1UJ8 A;  4FE4 A;  2GA1 A;  4XLA A;  4XRS A;  1SFX A;  4MLO A;  5L3F A;  4BE2 A;  2D1H A;  2XVC A;  3E6B A;  2HU9 A;  1IN8 A;  2WAF A;  1Z67 A;  3HB9 A;  2HR3 A;  5K7F A;  1JJ8 C;  3HXL A;  2K3F A;  1YYV A;  3GW2 A;  3SHF A;  2OTJ I;  3MQ0 A;  3ZQQ A;  5JVT A;  4V2G A;  3H5A A;  2WA0 A;  3QP6 A;  3JRA A;  2ZNZ A;  2DYR H;  2FBI A;  3EPZ A;  4M6Y A;  4UV8 A;  4BHP A;  4D5F A;  1OMI A;  4F92 B;  3ZQH A;  2MLG A;  3QU6 A;  1JI8 A;  2B7E A;  3M8J A;  4ZZL A;  2BVL A;  3BZK A;  2DYS H;  2P5V A;  1ZTR A;  1FNN A;  2FOK A;  3HRM A;  3I54 A;  3DTI A;  3S1N J;  4I76 A;  1VF9 A;  3FHZ A;  5LRR A;  1OKR A;  4Z2Y A;  4EJV A;  2X6O A;  3Q0W A;  4H0E A;  4HF0 A;  1Z77 A;  1HW5 A;  1KGS A;  1N25 A;  4M73 A;  2LY2 A;  1RPW A;  3CCV I;  5IT9 Z;  1KU2 A;  4I2O A;  2ZSI B;  1TWG J;  3MD2 A;  5HDN A;  5TRD A;  2LYC A;  1ZLK A;  3A01 B;  3CUQ B;  1QBJ A;  2ZJP F;  4IJA A;  2R7X A;  4EJT A;  2RNJ A;  2QGU A;  2OQG A;  1TL8 A;  2E60 A;  5KAI C;  3OYA A;  3D5R C;  2L7Z A;  4Y4R A;  2Y0S N;  3TBI A;  3E6M A;  4WF2 A;  3ZQG A;  4IHY A;  4ZYD A;  2KJB A;  3MKY B;  2M4G A;  3HIF A;  4JP0 A;  1FYL A;  4PJM A;  3L2V A;  2VJI A;  1R5G A;  3BWG A;  1B9M A;  4C3H J;  3AG4 H;  2CG4 A;  3KP2 A;  3BTJ A;  4AYB A;  4V2F A;  2JN6 A;  5C4J J;  2HEO A;  1VZ0 A;  2HOT A;  3PJR A;  3HPH A;  2C6Y A;  3OS0 A;  3SEZ A;  1BW6 A;  3RKQ A;  3HRU A;  4PJN A;  1U9O A;  3VYU B;  3TO7 A;  4DIQ A;  2LRD A;  3X2Q H;  2JA6 J;  2RDP A;  1TQI A;  2DA1 A;  5LD2 C;  1OJL A;  3S1R J;  1RIO H;  4IHW A;  1S72 I;  4Q5S F;  4RGX A;  1Y1V J;  5HOO A;  2L02 A;  3AFH A;  3A03 A;  2Y75 A;  3B02 A;  2VBZ A;  2DMP A;  5J8C A;  3OIQ A;  2F4M B;  2R5Y A;  1FJL A;  3A2K A;  2BY3 A;  4KN4 X;  2K86 A;  3H3U A;  3KZZ A;  4UY8 I;  4WXH A;  1JKR C;  2P6T A;  1SD5 A;  2DAO A;  1JT6 A;  5JFR A;  3PL8 A;  4LLG F;  4LD5 A;  3C2B A;  3TDU C;  4BE1 A;  3CC4 I;  3EUH C;  1KZH A;  3SXY A;  2HXI A;  5GAD J;  4CZC A;  2XF5 A;  1K4T A;  2NVX J;  1Y8Q B;  3WG7 H;  5DCM A;  2H1L A;  2R3S A;  4KT5 C;  3JRF A;  1IXC A;  2XPW A;  4RGS A;  3NAR A;  1FWZ A;  3ABL H;  3T1B A;  1MMG A;  3H3Z A;  3JW4 A;  1ETV A;  5FD6 A;  1W7P B;  2LDU A;  4HV5 A;  3RZD J;  3FBI B;  2ICW G;  1FMV A;  2V1X A;  4EV0 A;  4WK8 F;  4LOC A;  1YS7 A;  2MD0 A;  2XSJ C;  3KP7 A;  1FY7 A;  1TBX A;  1R9T J;  3LSP A;  1USS A;  1LFB A;  3DKX A;  4XRM A;  1O7L A;  3KZI C;  3RKW A;  2JQ7 A;  1V3F A;  5IOZ A;  4S04 A;  4CCO A;  2X1C A;  2HWV A;  2M0C A;  2HOE A;  1TT0 A;  5D4R A;  2HXO A;  2LP0 A;  4E7H A;  1MW7 A;  3G2B A;  4NC7 A;  1OLT A;  3HRT A;  4EM1 A;  2ME6 A;  3WU1 B;  3GLL A;  1YJN I;  4A69 C;  3J7A O;  1R36 A;  1HBX G;  3C3W A;  2LTP A;  4XKW A;  2BXZ A;  2X4H A;  3S2H J;  3BPV A;  2RRE A;  2FMY A;  4AIJ A;  3S14 J;  1VFC A;  2KRH A;  1VQ6 I;  4A0Z A;  2OF7 A;  3CZ6 A;  5EYR A;  1UAA A;  4NQW A;  1YE9 A;  3PNT A;  4RB0 A;  3J7Z I;  3G73 A;  3K70 D;  1IN7 A;  1P92 A;  3P9K A;  1V5E A;  4HEA 2;  4XON A;  1D5Y A;  2FBH A;  4AID A;  5B66 C;  1MSF C;  1A6I A;  3FKI J;  4FIS A;  3ZN1 A;  2JSC A;  5FRO A;  2WV0 A;  1D5V A;  2OBP A;  4UUS B;  1Y1W J;  5TIS C;  1J59 A;  2F5V A;  2F5E A;  2TDX A;  2CQK A;  2HKX A;  3BR6 A;  1H8A C;  4P55 A;  1D0Z A;  2L7M P;  1S6L A;  2A6H F;  3LMM A;  3SDB A;  2K9L A;  2JA7 J;  3KP3 A;  3KYD B;  3O2P E;  3ERM A;  2OU2 A;  2XSD C;  2ZJQ F;  1MKM A;  2L2O A;  1G2H A;  2UXN A;  1R71 A;  5CVI A;  3IC7 A;  1W5T A;  5C4X J;  5LBQ A;  1O3R A;  4KUM A;  2OJE D;  1S5L C;  2EV0 A;  2QWW A;  4JOM A;  4EM2 A;  2X6Y A;  1WJC A;  1ON2 A;  2ZNY A;  5ILS A;  4BKX A;  1KA8 A;  2L4M A;  4NC6 A;  1VI0 A;  1JUS A;  1MBG A;  2QYO A;  3RCO A;  2KJC A;  2HOS A;  4LB6 B;  4AWX B;  2ECB A;  4E7Z A;  5FJ8 J;  3RZO J;  3SZP A;  5M3M J;  1B72 A;  2Y0S A;  2D5V A;  5J3L A;  1SVL A;  5D5X B;  4BQN A;  4CDG A;  2XDV A;  2XGE A;  4FX4 A;  2ELJ A;  2HGC A;  2OCE A;  4IZZ A;  3FDY A;  4BH9 A;  2EFP A;  3ZQC A;  1MDM B;  1FOY A;  4R79 A;  2O8K A;  4NC8 A;  1BI3 A;  1WH7 A;  2QBY A;  2XF6 A;  3BQY A;  4BBR J;  4EQQ A;  2EQR A;  1FIP A;  3PSI A;  4R1H A;  5D8K B;  2DDA A;  4U88 A;  5HNF A;  2ESH A;  1K78 A;  2BOL A;  5J1Y A;  4ESF A;  2K02 A;  3I5U A;  2V1D A;  3V8J A;  1U5T C; 
#chains in the Genus database with same CATH homology
 3WG7 H;  3AG2 H;  1V54 H;  1OCZ H;  3ABK H;  5IY5 H;  2EIM H;  3AG3 H;  3ABL H;  1OCR H;  2DYR H;  3AG4 H;  3ASN H;  1OCC H;  2EIK H;  3ABM H;  5B1A H;  2EIJ H;  3ASO H;  1OCO H;  3AG1 H;  2EIL H;  5B1B H;  2DYS H;  2EIN H;  2OCC H;  2ZXW H;  3X2Q H;  2Y69 H;  1V55 H;  5B3S H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...