2DYSH

Bovine heart cytochrome c oxidase modified by dccd
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Structures and physiological roles of 13 integral lipids of bovine heart cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 25
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2006-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 2dysH00
2EIMH 3AG2H 3ASNH 2OCCH 5B3SH 2EINH 1OCOH 2DYRH 3ASOH 3AG4H 3WG7H 1OCRH 3ABLH 2EIJH 1OCZH 5IY5H 3ABMH 3AG1H 3AG3H 5B1AH 2DYSH 1OCCH 3X2QH 1V54H 2EILH 1V55H 3ABKH 2ZXWH 5B1BH 2EIKH 2Y69H
chains in the Genus database with same CATH superfamily
1K78B 3UNGC 3ERMA 1KU3A 5DDGA 1RZ4A 4J00A 3HOYJ 5AONA 2F5DA 5ICGA 5FRMA 2GAUA 2VN2A 2V9KA 4KT5C 2R5ZA 2YU9J 5K7HA 2KPMA 4N9IA 3CJQB 1OCZH 3D0SA 3HGGA 3N4MA 3KP2A 2H6BA 2LDUA 2QA4I 1P4AA 4HYEA 3CJNA 1R4MB 3JSOA 2DJNA 2V1NA 1FT9A 2OA4A 4UUSA 2O8KA 4NC8A 4MHGA 2VPRA 2JA8J 3L2WA 1DPRA 3CP8A 4CCJA 1XGOA 3OYAA 4A93J 4XORA 3A2KA 1FWZA 5D5XB 1J59A 4XNFA 3ELKA 2Y0SA 4AIJA 2DT5A 2E1OA 3EPZA 2G7UA 3VYSB 2IBDA 2D2WA 1ZR4A 5EG0A 1UHWA 4EGZA 3LSTA 3BPXA 1RIOH 1FOXA 3M8EA 4K2EA 2FOKA 4A12A 3R0JA 1YTYA 1RI7A 3BTLA 3MKLA 5E3NA 3LWFA 1KQ0A 4B47A 3GFMA 3FXLA 3GCMA 3J7YJ 1BJAA 1ZYRF 3G1OA 4BL0B 5KCMA 4BQQA 2DQLA 3PSIA 2ZB9A 1IRZA 3DKYA 4IX7A 2JA6J 3HOUJ 2R7SA 2XKOA 4L9JA 2HDWA 5GPAA 1TNSA 5IT9Z 2IJLA 2HQRA 3GXOA 2GIVA 2X85A 4PJLA 3FM3A 4L5EA 1B72A 2FBKA 3RSNA 2ESNA 3KYCB 3J7ZI 1X1CA 3F8BA 1H89C 5K5OA 2B9SA 1O4XA 5IOYA 1U5TA 5BNGA 4HAMA 3Q3SA 3FXOA 4AIDA 3ML6A 2MG4A 2XPUA 2EFPA 4NNJA 3RI4A 2H94A 5B66C 5LBQA 3I0TA 3CCYA 4V2GA 2OZ6A 5E1XA 4WX9A 2EZHA 4BYYA 1MBEA 2A3SA 4CYDA 1H8AC 3C2GA 2EZLA 4GO1A 1E3HA 4H4KC 4UNOA 1ETVA 4A3DJ 2QLZA 2VONA 3DPLC 3BR1A 1X3ZB 3NWTA 1T0FC 1Y8QB 1JKPC 2EV5A 3RPUD 3ZQCA 3I9V2 2NOGA 3BQZA 4HNUA 5M5YJ 2XAUA 2PBIA 2M8EA 5GTHC 2KT0A 3ZGKA 4AVPA 3E5UA 3FZVA 2KISA 2XB5A 4KMUX 4M74A 3BG5A 3G4SI 1O3TA 4F7ZA 1QZZA 4MTDA 1LUJB 3MQ0A 4IVNA 2A07F 3S17J 1Y0NA 4OWRB 3A02A 1V5EA 1XSVA 4RMNA 1HXDA 1MDMB 4LOCA 1T33A 1JXSA 3L09A 1TZLA 1JE8A 5FFZA 1Z9CA 3QPLA 5EGOA 1XSXA 2JVHA 3QYFA 2RDPA 4JX6A 4YRVA 3CCSI 4I02A 2M9HA 4PJJA 1LE8A 2A68F 4C2MJ 1FX7A 4EEFG 3GZNB 3IRQA 4A3JJ 1IN6A 1RESA 2W85A 2XHKA 3F3XA 4NQWA 2AS5F 2YR2A 2CQXA 3HYIA 3HOXJ 4E6KG 2ADUA 1G3YA 2O5RA 3FKIJ 1W7PA 4IZZA 1AHDP 4B3AA 3S15J 3HZJA 3EETA 3HG9A 1FZPB 1CQTA 1IGNA 2QKLB 1XCVA 1V5GA 2L7KA 3BR5A 4XK4A 2V79A 4B43A 1VQPI 1S7OA 2M3AA 1JUMA 5A2QZ 2LF7A 4DYQA 1TWGJ 2NVUB 4PCQA 1GT0C 2EQRA 1UHMA 4KIFA 1MIJA 1B8IB 2WV1A 3MZ8A 3R61A 3FBIB 5E20A 4BXXJ 1TWAJ 2KFDA 3K2ZA 3KP5A 2LVSA 3ZMSA 4U7DA 3CCEI 2ZJRF 2Z3YA 1IJWC 3LSGA 3VYTB 4UY8I 4KMFA 1KYZA 1P4XA 2LYCA 4ENMA 2QF7A 4I09A 3SFIA 1W36D 1JTYA 3C1DA 1ORKA 3BJAA 5EYRA 2YUSA 4HBLA 1WJ5A 1YS6A 2CUZA 2MSYA 5DV5A 1JT6A 4X1EA 1CF7B 2EIKH 4LLGF 3S32A 3D5LA 2HVSA 3JW4A 1H9TA 1TBXA 2R4GA 4GDFA 1VQ8I 1ZKGA 1X3WB 2ISZA 2L9SA 5EEHA 5ICEA 3ZP5A 1YO5C 1ZTRA 2DDBA 1FEXA 1BA5A 1BN5A 4A2UA 4WF2A 3M7GA 1FSEA 1QRYA 2FBHA 4MLOA 4Q5SF 4JYKA 1PVEA 3CCQI 1OCRH 3BROA 2JA7J 2EH3A 3BR2A 4BQOA 2BXZA 1IN5A 2CUFA 2IS6A 2L2OA 1ETYA 1X3UA 2XSJC 2ELHA 3VEPA 1T38A 4B09A 1IF1A 1SMYF 4OINF 2K3FA 5M5WJ 3IH3A 3ASNH 5DYMA 4HPQA 3BG9A 1VQ9I 1ZG5A 2ACJA 5D8KB 3Q0VA 4XN3A 2MH9A 4ASNA 3RKWA 2WB1N 2CWEA 1HW2A 3OV8A 5C3EJ 2LLKA 4UXNA 2D5VA 1Z6RA 1VQKI 4P55A 5HDGA 2P5VA 4XKBA 1UELB 3SXYA 3K6GA 2VI6A 2JMWA 2VXZA 2IGKA 4O6JA 2LTPA 1DDNA 2E36A 1NK3P 1TQIA 4N0BA 3ZQHA 5GAGJ 1SFUA 4EGYA 1NG6A 2BVMA 1B9MA 2XRNA 3BY6A 4WXCA 3RPQA 3CLOA 3AL0B 3ZQLA 3L2QA 1UJ8A 2BGCA 3W6KB 4ETSA 4PJNA 1X2MA 3K9TA 4P9UA 1B4AA 1YITI 4FTHA 5E1ZB 5J8FA 4KICA 5E18F 5HS7A 1I3AA 3EUHA 1MNEA 1SVMA 5DS9A 2KRHA 2ME6A 2IA2A 1X58A 2XF5A 4A6DA 1RR7A 4A3LJ 5F6FA 2LF8A 1OJLA 4BHCA 1V3FA 4PGGA 1EV7A 3CUOA 5DEQA 5M5XJ 5AIPA 1D3YA 4EJOA 1I27A 3H3UA 2X1CA 2YX4A 1MSFC 1G59A 1JGSA 3AG3H 2Q8KA 2JK3A 1G2HA 2PMZA 4F91B 3HTSB 1WKMA 2DK5A 2LK2A 4L9VA 4XM3A 4CZCA 1IO2A 1KZHA 2R93J 1IV8A 5FKOA 3TO6A 3OYKA 2GIZA 3MAJA 4I0AA 4AIKA 2LH9A 1DU6A 4ZDOA 1KA8A 3FDYA 1UFMA 1IDZA 4HQMA 3CC2I 3CMYA 2C6YA 4ENNA 3IRRA 1ZLJA 3JAMZ 4IHSA 4A0YA 4HZFA 2JSPA 4B48A 5DM6F 3HTUA 3S3OA 1IV6A 3CO7C 1S6LA 2MC3A 3HSEA 1R49A 4D9JA 3I59B 3QPSA 5L3BA 1HLVA 3SHFA 3GWZA 4RB0A 3W2WA 2JQ7A 4MIMA 1GLNA 3KE2A 4E70A 2R7VA 1FMVA 5J4VA 2L01A 4KDPA 3HGYA 2RN7A 1S5LC 3CC4I 1ZH5A 1LPQA 3AG1H 3MN2A 1KU2A 4XOPA 4B8XA 4Q4ZF 3UKGA 2STWA 4G7OF 3K1PA 2K9LA 3L7WA 1EKEA 4YFNF 1JJ8C 3DPTA 1VFCA 3BZ6A 2L54A 3R6SA 1LDDA 4AVZA 2W7NA 1LNWA 3OYJA 3VWBA 1SFKA 5BMZA 2LKXA 3EQLF 3TP0A 4IHVA 2L4AA 2OF7A 3DKWA 4ZDPA 4ZYGA 1R7JA 1D8JA 2PFBA 3F6OA 3DBLB 2IRFG 4BDYA 3TGNA 1W5TA 1RRJA 4HSRA 2VBXA 5EEAA 3HRUA 1WH7A 3B6AA 4LK1F 3T8RA 2W00A 2R7WA 3S8PA 3HKZN 2K3PA 3LSRA 1W5SA 3O2PE 1JGGA 2XASA 4EVIA 4M3EA 3WTYC 1YHQI 1XMAA 3SEZA 3WHCA 4XRSG 5IT3A 2OPTA 3DF8A 3SZTA 2AHQA 4HV6A 3HSFA 3U21A 1QBJA 3PNYA 4AYBA 2NAZA 3A4CA 4BJTA 3CCMI 4BXUA 3J81K 5HLHA 4NHJA 2XGCA 2GA2A 1PDNC 3A1YA 2M1BA 4JK1X 1E0EA 2V9VA 3GTMJ 5M3FJ 4IHTA 3FMSA 4XLFA 4A5MA 1XMKA 5KAFC 4RGRA 1YFHA 1O3RA 2AQEA 2IAIA 1G3SA 2H8RA 1T08B 3CDLA 3D5RC 1ZHFA 3ZCOA 4RB2C 3B02A 1FC3A 2CUEA 4ENKA 3WODF 2DU9A 4B1RA 3O6BB 2X1DA 1EH8A 4RDUA 4C3IJ 1SD4A 4JOMA 3WTUC 2NYXA 3R0AA 5M3MJ 2IA1A 4OAYA 4I98B 1YIJI 3NQOA 5CJ9A 4CCLA 1LFPA 2MABA 4G12A 2HTJA 2HKXA 5LGTA 3K70C 1QVUA 5IYDJ 3QRFF 1XCBA 2AO9A 2RQPA 4MFDA 1Z7UA 4HG2A 3FISA 1T95A 1TWFJ 5F0HA 3V7RA 2O6GE 2P0WA 1J2XA 1GV5A 1Z3YA 5E3LA 5HS8A 3TOAA 4E4HA 2X6WA 2DA7A 1K6OA 4FX0A 5LEJA 1E17A 5D6EA 4CYCB 2DFIA 2L3DA 1S72I 2K9NA 3U1DA 4BBSJ 2BHYA 2NS8A 4MTEA 2DQRA 1BC7C 1ZRDA 2QSHX 1UMQA 2JA5J 1BJZA 3OIQA 4BY7J 3SZGA 4IRHA 4IPAA 1MJAA 1YW9A 1KU7A 3ZMVA 3HHGA 2EFQA 3NRVA 9ANTA 1FYKA 5IOZA 2Z2SB 3JRAA 3E0JB 2LMDA 2VLAA 4A3IJ 1HW1A 2M8GX 1PJRA 1EA3A 2X4HA 5FKNA 2R0QC 4CICA 3S1QJ 1VNDA 3LSPA 2E2IJ 5HDNA 1I3QJ 2FSWA 2HDDA 1OR7C 4XLHA 1TW3A 2A6EF 2E1NA 3DBRB 3KPHA 3RZOJ 2F48A 1T98A 3I59A 3LA7A 2KP6A 2VQGA 3HC7A 4BJ5C 3OS2A 2L9NA 2CSOA 2PG4A 4HV5A 4HX7A 1XB4A 3GW2A 4DYRA 1DP7P 3WGGA 5FB2A 1V4RA 1SMTA 1L3LA 2A5YB 1D8KA 2QYOA 3VOEA 2QEXI 3GTQJ 3M8FA 3OIPA 2M45A 3OYDA 3SFZA 1WI9A 1XG1A 2HZTA 5IYCJ 1VQ6I 2I8DA 1D1BA 2DFFA 2E1CA 1Z77A 3ZMUA 4JP0A 1FOWA 5GTIC 5FO5A 2GXGA 4KUMA 3T0YA 4KYWA 2DA4A 4M9XA 5LFAA 2AXLA 2VBWA 4ZDLA 2XSDC 3DV8A 1R9TJ 4EM2A 1WHUA 2F5FA 4YIFA 2VJIA 4IRIA 3LOCA 4FX4A 3N97A 3C3WA 3C2HA 4RBOA 2EIJH 2VQLA 5TJJA 4ON0A 3H5NA 4LLNA 2K02A 3OSFA 4HF0A 5HLIA 2XVCA 2CW7A 2DA6A 3H3VK 2IGOA 2FNPA 2W1OA 2LBFB 3KLNA 4M3GA 5LHHA 1W0UA 3EDPA 2FJ1A 2HWVA 2JWTA 5EEGA 4F52A 4BE2A 1J09A 5BS6A 1R58A 3MVPA 5FROA 4GRIA 3OYHA 2A5WA 1JJ6C 1MNMC 1UAAA 4ZTFA 3IH4A 2M4KA 2IT0A 4IQJA 1W5CC 1D0ZA 2CMPA 2KIFA 3HHHA 2KL4A 2VKDA 2VPLA 2M5WA 3W2AA 1TWCJ 2O8XA 5FLXK 1GHCA 1P9QC 3GO5A 5J8CA 3SYTA 3CCVI 1SC7A 2ZC2A 2OTJI 2V4JC 2HVRA 4HDUA 2CV2A 3REOA 2LOOA 2DMNA 2GQQA 2IXSA 4BAYA 4S05A 2UXNA 2LSOA 2RGVA 1R22A 3TQNA 4IKFA 1FJLA 2CU7A 3GTPJ 3RYPA 1E2XA 3PQJA 2Q0OA 5EJCA 1D5VA 1AWCA 3FKJA 3E6MA 2YSRA 4C2TA 2A05A 3ZQQA 2BY0A 4FETA 2ELJA 4LG0A 3DEWA 3Q9VA 5H20A 1FOKA 2COBA 3H92A 1Z3XA 1CGPA 3F0CA 2P6SA 2D45A 5IYBJ 2X6YA 2FBIA 4A3GJ 4C3JJ 3M1EA 2NVTJ 2OU2A 3LFKA 1NG7A 3CJTB 5IP7J 4U0YA 4M3DA 5J6XA 1IXRC 2QM3A 3KZZA 1XX5A 1NK2P 3KYDB 4G6DA 3RPUA 2L4MA 4QPOA 1AKHB 3GEZA 1J75A 3RKQA 1QU3A 1FOYA 3IC7A 2CJJA 3LFUA 4I6ZA 5HNHA 3MFKA 5C4XJ 3FXMA 5C44J 4UV8A 5AIQA 4MQ9F 2QSFX 2QZ8A 3WE2A 4DNCA 2P7CB 1BI3A 3QODA 3ABUA 3L2CA 4KT6A 2MGQA 3PL8A 2GM4A 5FRNA 2FOWA 5F0CA 1TQPA 3E6CC 3P9KA 2XAGA 3I53A 3JCUC 3F21A 3TW6A 3TO9A 4WK8F 1ZR2A 2HYGD 5B3SH 1YG2A 2R7UA 2QQBA 2MFZA 2B63J 1MSEC 2QQ9A 3K7AJ 2JZYA 3BZKA 4ZH4F 2LKSA 2R7FA 5F0FA 2VT3A 2ZBKA 2K9MA 5ILUA 3KFWX 1OPCA 2E2JJ 3HPHA 3GTGJ 3QYEA 2EZIA 2F4OB 4HLYA 3W3CA 4WWCA 4BU2A 2ZMEA 5D6FA 4CCKA 5DCFA 1IN8A 3JRGA 2PJPA 3ULQB 2HVQA 3CUQC 2NS7A 4JX4A 3L2UA 4R8HA 4P5OA 2HXOA 1G8XA 1GXQA 2QKMB 1WJDA 1PYVA 1SFXA 1OCPA 2BYVE 2FUG2 3E5XA 2HTSA 3FXRA 3QP5A 4HX8A 3GTLJ 1P4WA 2KLOA 2M34A 3J80K 1P7JA 5CLSA 1WVRA 4LIUA 1I6XA 4KJZA 3COAC 4XOTA 1R36A 2QCOA 4PFPA 3GFJA 3KETA 2MA3A 5GAEJ 3ZQ7A 1FBSA 2ME0A 2WB1A 3SEQA 4Z2YA 2J5PA 4P96A 3WTWC 5JVTA 1GUUA 1Z6TA 2MD5A 1F36A 2HXIA 2XAJA 3ONQA 3H9QA 1WJCA 5CYVA 4MQVA 2VT2A 4G9YA 3G2BA 2QSGX 5E3MA 4PZJA 4FISA 2FMYA 2L7MP 2K4JA 3BR6A 3FMRA 3I58A 5CVUA 1O3SA 3F9KA 2VOPA 5FKKA 2L02A 3GFIA 1K78A 2QBYB 4LGWA 1U6GA 2K5CA 4LB6B 1BR2A 4KN4X 1R4NB 1R00A 3K4LA 3TEDA 4CGZA 5LHGA 2MLGA 2XDVA 2NS0A 2FX0A 2Z9OA 2DA1A 3QP6A 2VASA 2CS3A 2WWYA 3ASOH 3CCLI 2K85A 1ZG1A 3K69A 5LGNA 2X48A 1Y8RB 3BR3A 3K2AA 3LSHA 3U9GA 4RM2A 1MMDA 2Y75A 3E97A 3W6JB 3JRDA 2K9SA 2OCEA 3TBIA 3HEFA 3L00A 5E79C 3PO3J 4BXFA 4BKXA 4EJWA 2PI0A 1GDTA 4E7IA 2QENA 3GF2A 3V8KA 3HXLA 2EB7A 3HJEA 2JPCA 2JRTA 2KRCA 3S93A 1G6NA 2KIUA 3F72A 4UVCA 4KFCA 1E3OC 1Y56A 1ON2A 2BZTA 3HIFA 1MMNA 4ZZLA 1ZARA 3KP7A 2UUZA 3A0HC 4D5FA 1H88C 5TGTA 2DA2A 2ZCWA 1YOVB 1VQMI 4DYCA 5ICFA 1UCRA 1X1PA 3IAM2 5CPRB 1FTZA 2CYYA 5BOXA 1UG0A 2XKPA 5JI6A 2LP0A 4B3XA 3IKVA 2G9WA 2OCCH 2R7QA 3KEOA 3OYNA 2ZSHB 5K7ZA 4OOIA 4RS8A 2MD0A 1U5TC 2X0LA 1EJ9A 4UV9A 2ZNZA 3CMMA 4E7JA 3HOWJ 4HQEA 1I50J 2EZKA 3ECHA 1BM9A 1YX3A 3HSRA 3ZMDA 2DYSH 2MBFA 4XBFA 2M30A 1F43A 1U9NA 1BI0A 2B7EA 3ROUA 2XC7A 4DJAA 2A6TA 1WPKA 4CZZA 1PUFB 1NHAA 3E3VA 1OYIA 3H9GA 2UZKA 1QPIA 2VL8A 3PIOF 2EA4A 2M7AA 4N4OB 2O9LA 1NTCA 1YRNB 2DJIA 1X1DA 2ZO4A 3DPUA 3VB2A 1XD7A 2X1EA 4X6AJ 3VODA 1KYWA 2OAZA 1S3JA 2CW8A 3IP4B 2LY2A 1OMIA 3ZRGA 1LB2A 2FA5A 3OR1C 4O5VA 1ODDA 3C18A 1N25A 3V8LA 3JRCA 1S7AA 4UUVA 2O3FA 3K4MA 2YU3A 3KP6A 3P7NA 2HQNA 1HCRA 2Z1DA 1HDPA 4F92B 1K79A 4HW0A 4Y17A 2XAQA 5BPDA 1FIPA 2H1KA 4MEXF 3K4BA 3QOPA 2E2HJ 4E7LA 2F5VA 1R5ID 5ICCA 2H09A 1R6RA 4PK4A 1RETA 1MBKA 4AC0A 4KITB 3OL3A 2FXAA 2GOMA 1IN7A 2W84A 2CQNA 3OSGA 3HKZA 5JR3A 3M1CA 1TP4A 3D5SC 4JQFA 5L3EA 2ELKA 2YX7A 2FE3A 2HU9A 1Y0UA 4X0GA 3P9IA 1WGXA 2M7BA 3A0BC 2HQ5A 4Y4RA 2O7OA 4RA2A 2AXTC 3JR9A 5E1WA 5DCMB 2L7ZA 5L3CA 3I4NJ 2DODA 1MDMA 3EYIA 3Q5FA 3I56I 3BZCA 2HR3A 4YG2F 1R1TA 3J7AO 5E8IA 2WAFA 2O61A 1NH3A 3RDIA 2V1XA 4A3EJ 4U87A 3IWFA 3K1MA 5FKLA 1MD0A 4IQ4A 1A31A 2OZUA 4U88A 1HKSA 1LDJA 4BS9A 1ETOA 1IUFA 2P4WA 1V54H 3L2RA 3OYLA 3RQ4A 1Z1DA 3PQKA 1F9NA 4HSTA 2R7OA 4Y15A 1T2KA 1HBXG 4EJUA 1ZRFA 2BY2A 1J0RA 2EBIA 3OYBA 1T56A 4ESFA 4IHXA 6PAXA 3E5QA 1JHHA 1R23A 2ZJQF 2R7ZJ 4BUPA 2JVGA 1YQAA 2PJRB 2PQ8A 3F23A 5C4JJ 4YFKF 5DD4A 4IRGA 1DQUA 1J5YA 3BG3A 1YJWI 3V7CA 4CH7A 2ESHA 4TV7A 3PIPF 3JREA 1LDKB 2Y9ZA 1X4PA 2F4MB 1LFBA 3E1SA 1OYYA 1MNDA 1Y6IA 1B8IA 1EH6A 2JUGA 2CRGA 3V8JA 5ERIA 3ISPA 4HOBA 3GMEA 4UUTA 1GV2A 2L7FP 2VC1A 4HEA2 2KQRA 2MLKA 1FNNA 3F8CA 3L1PA 1VF9A 2ZJPF 4RGXA 1WI3A 1TT0A 2WTEA 3CTAA 3F8NA 3M9AA 4XONA 4YIRX 3KP3A 4IHYA 2BW3B 5HS9A 2H27A 4UHTA 3A01B 2XGEA 2Q2EB 2DO7A 1GVJA 5EZHA 1K6YA 1RKWA 4LLLA 2RQQA 3FF5A 1CF7A 5EF6A 4RGSA 2EK5A 4BHPA 2BY3A 2LC2A 2EIMH 5IT9K 3WHBA 2WAQA 2KJBA 4DW6A 2W25A 5L3DA 2XGDA 3GLXA 3KCCA 3R4KA 4JX5A 4Q48A 5JFRA 1OCOH 2A6HF 3L9FA 2YPRA 4GCVA 1HC8A 2KIMA 4OMYA 4LMYA 1G4DA 3K10A 3TO7A 3ZMZA 2P8TA 3OYFA 3M8JA 5L3FA 3AG4H 1U8RA 2JA2A 4F93B 5E8GA 4MGRA 1IRFA 3TW7A 3IAS2 4QTRA 4J19A 2ID6A 3V42A 2P5LC 2M87A 5DM7F 1K7AA 1DUXC 1USSA 2YS9A 2IVMA 3CUQB 3FX3A 4RAZA 3I55I 4U0WA 3K70D 2UWMA 3CF2A 2FQ3A 2M4GA 4P1WA 1FP2A 1YRNA 5LGUA 2R92J 1HKTA 4N9HA 1LJ9A 1U2WA 2NXNB 2CG4A 3H9JA 1F4KA 4ZC3A 4G7HF 2EV0A 3U2RA 1UG2A 3HM5A 2IGMA 2R7TA 3ABLH 2XGXA 2EPFA 3FK6A 1OCCH 2JTVA 4XLAA 2BY1A 2XAFA 2Y0MA 4UVAA 4LIVA 1SAUA 1OQYA 2FQ4A 2BEOA 4PUSA 3ZOBA 2IGNA 4A69C 2ZXIA 1BIBA 3EUHC 3I4PA 3DTIA 2X51A 2Y69H 5K7FA 1EH7A 1ZG3A 4V19K 3H1CA 3NAUA 1Q1HA 4RAGA 2E19A 4W97A 2DMTA 2WAEA 2R5ZB 1JTXA 2G0EA 4QWQA 4HDVA 2V6EA 3HBLA 1S29A 3U1KA 3G3ZA 5E3OA 4XN0A 2W57A 4ZYDA 1IN4A 3FXJA 1QO0D 3KZIC 3M07A 1JKQC 3GFLA 3TP3A 3S3MA 5DCMA 4KIGA 4UUSB 3G73A 4S04A 1A6QA 3KEYA 4GYIA 1MBGA 1OISA 3K4CA 2E5NA 2LNBA 3HRMA 2WA0A 1K4TA 2V26A 2VXDA 2EA2A 2VBZA 3WE3A 3IUOA 4DQ2A 4M9ZA 4O3MA 3FK7A 4KN7X 3VDXA 1ERDA 3K0LA 4II3A 4AM3A 4V2FA 4CCMA 3JTHA 4XR6A 1ON1A 3BPVA 4GXOA 4HF1A 4CO8A 5J4YA 5JHFA 4IL6C 3HPGA 5EG0B 2QGUA 2K9QA 2VIXA 4BNCA 5A2QK 3UR3C 2FRHA 5DTDA 3B6CA 1MMSA 3D1NI 1TT5B 5FGMA 4PJ0C 3OYIA 1QHGA 3F22A 3H5AA 1A5JA 1W1WE 2AQFA 4DZPA 5FJ8J 2E35A 4FE4A 5ILVA 5LRSA 2COMA 2DOFA 3KP4A 2BBYA 1MZBA 4HLXA 4P9FA 1FY7A 2TRTA 3V4GA 4QSHA 5IY5H 4GYGA 2LREA 1MH4A 1FTTA 2CO5A 4A3CJ 3LAJA 3ZQFA 3QQAA 4D5CA 1WZ2A 2HPIA 1HSTA 3MWMA 2CGPA 3V7SA 1AOYA 1B72B 3OR2C 3ZQGA 4A3BJ 3GZ5A 2FD5A 5HVQC 1FP1D 3FWEA 2VODA 1U5TB 1X1AA 1MW7A 4G6TB 1N78A 3SZPA 5F1RA 3HUGB 4KNYA 2V9PA 3DTKA 3BCBA 2X6OA 3G1LA 5HLGA 4BH9A 1XS9A 1HF0A 4OIRF 1YW7A 5HLTA 3GBGA 3RKYA 4XICA 3TDZC 3MD2A 1HDDC 2Q2EA 2TDXA 1ZGWA 1A36A 2Q1ZB 1YW8A 1B9NA 3PJRA 1ZK8A 4BDZA 4OU0A 2Z16A 2XPWA 5K5QA 2L5QA 4NBQA 3S2HJ 3FXQA 1D1CA 2ETHA 1WCMJ 4GFBA 2R7RA 3MEXA 3QAHA 1QZEA 5KNLA 4A3MJ 4KISA 1M1EB 1MMGA 4RM3A 4FQGA 4PSWA 1UHSA 4E7HA 2OBPA 4HF2A 3N05A 4PGHA 2VOOA 3WG7H 5CVIA 3W6VA 2HNHA 2Z33A 4AWXB 3RYRA 1WJEA 2DTZA 1XSDA 4WCGA 3I71A 4HA8A 2D1HA 3F6VA 3NWSA 2IW5A 4M3FA 3VPRA 3CZ6A 3OYCA 4XSZF 1T0FA 1IRGA 2VKEA 2RKHA 1XGMA 2BE5F 4HNVA 2XF6A 4QLCU 4IO9F 2CV0A 2IP2A 3CD6I 1QHHD 4IOAF 2Y9YA 3ZR8X 2IEKA 4D1QA 4CSWA 3BLYA 5F27A 3G71I 4BY1J 2Y48A 5EGOB 2F5EA 2CV1A 2LFBA 2DMQA 1RKTA 2PLYA 4BJ6C 1LE8B 2OD5A 3QPHA 3JRBA 3G6EI 2KIQA 1WJAA 3PUFA 5D4SA 3S2WA 3BWGA 2EFWA 3DBHB 1QGPA 5KK1A 1X19A 3VYUB 3S1RJ 2V1DA 4NQWB 4R1HA 3T5XA 5CKTA 1X1BA 2ZKZA 4RGUA 2HPMA 1W7PB 1LKXA 1KONA 3O3KA 1GVDA 4ZTJA 3HB9A 4AIHA 5CVVA 2V7FA 3KEQA 3JSPA 4EV0A 3MKZA 5GPCA 3M3YJ 2HFHA 4YEJA 4D0PA 3W2VA 2XUBA 4PFOA 4RAYA 5FLMJ 5LRRA 3DTEA 2VJ5A 3S1NJ 1VQ7I 3SDBA 1ZN2A 1G3TA 3ABTA 3OIOA 4LFUA 4B44A 3GZ6A 1ZREA 2PMUA 4IXAA 3LSMA 5LLQA 4RLQA 1Y39A 1QQIA 4FE7A 3PNVA 2LD5A 2UXXA 2KRFA 5DUIA 2D1VA 2K86A 2VQCA 3O8GA 2GXAA 1DGRM 5CVRA 1WWXA 5D5UB 1XGNA 5E17F 3TL4X 2ZXJA 2HEOA 2MC4A 5JHUA 1ETXA 2R5YB 2E1MC 2OJED 3DFGA 1FBUA 3ABKH 5JLWA 4CYCA 1PP8F 1IAWA 4U0VA 2DMUA 3JAMK 1O7LA 2F6CA 4EJVA 1RUNA 2ICWG 3RQIA 3AKZA 5J1UA 4M3BA 2KMUA 2WY7Q 3MMYB 3DLLF 1I1GA 5H6QA 1QPMA 2DXIA 4ABZA 4NB5A 2HYJA 1A04A 5KVRA 2OQRA 3CDHA 4GGGA 1B59A 2HOAA 2ZSIB 2JSCA 4LJZF 2W82A 3ESWB 2KKOA 1WQ2A 3OOUA 4XRFA 2CW0F 3WU2C 4IJAA 3TMOA 1APLC 3JRHA 1RUOA 2GXBA 1A6IA 2CQ7A 1W0TA 3ZXSA 2M0CA 4A0ZA 1MBHA 1SAXA 1JKRC 4L18B 3HUGA 1ZRCA 4FASD 5KAIC 2WY8Q 3GX4X 2E60A 1I39A 4BHBA 2ID3A 1PP7U 1OFCX 4QIWN 4XQFA 1XPXA 4ZYEA 3OWTA 3OS0A 5H6RA 2HOTA 4BBRJ 5FLVA 3ZMTA 2LG4A 1O7FA 1POGA 4CCOA 2G7HA 3BTJA 2RAEA 3Q0UA 1HKQA 4F3QA 3MZYA 1R5HA 3HOSA 3M4OJ 1OCTC 1HQCA 2LY9A 3J81Z 1P92A 4FCYA 2L9RA 4ZZDA 3QPTA 1U8BA 4CXFA 1VQLI 3DKXA 4KIBA 3OY9A 2Y31A 1U78A 2MH2A 1FLIA 5J47A 4AD9A 1BW5A 3QU6A 2TCTA 1QVTA 4PJMA 1REPC 3BP8A 2GZWA 1ZAOA 2BOLA 1T8IA 1HSJA 5D5VB 1KQ9A 4NDLA 5HNFA 5D5WB 1D1AA 4I99C 2HS5A 3OL4A 2XAHA 2LBFA 3FBNB 4OIQF 2RNJA 4MO7A 1MMAA 3VFZA 3ECOA 2IS1A 2DFHA 1WJFA 1MBJA 3WG9A 4XIDA 1XDSA 1IG7A 2ZFWA 1T6SA 1S9HA 4LD5A 2DTRA 2F4IA 3EYYA 3CJRB 2A69F 2PMHA 2NNYA 1J7KA 5H2FC 4OIPF 1C0WA 2Y0SN 1S8NA 3IL2A 1VI0A 4L5IA 2PEXA 1BIAA 2EV6A 4LK0F 1B6AA 1OKRA 2DN0A 3H3ZA 4XKVA 1O3QA 1WH5A 1SD7A 2BHZA 4MNUA 4WXHA 3BOQA 2CFOA 3BT9A 4Y7NJ 1D5YA 1QNTA 3BJ6A 3BR0A 1FSHA 2O03A 2NVXJ 2VKHA 4A6EA 2DA5A 4YIIA 3WGHA 2EWNA 3EUAA 5HODA 3T1BA 1PUEE 3BDDA 4JBAA 2VQHA 4ESJA 5GADJ 3S1MJ 1I6HJ 2QUFA 2Y30A 2XROA 4I2OA 2QQ8A 3OMYA 2E71A 4C2UA 3FXUA 4U7BA 1V55H 2RC4A 3K4JA 1WFXA 2IPQX 1XMXA 1H0MA 3HDDA 1MJBA 1Z05A 1I1SA 2HZDA 2DPUA 3TOBA 2NRAC 1AKHA 2E7WA 4XLPF 4RB3C 2KZVA 4M6XA 1D0YA 3IV5A 4ENJA 3PFIA 3RKXA 3FHZA 5LEKA 1RR8C 2JN6A 3GLLA 5FD6A 2XIGA 4NUBA 2ZJ2A 1BR1A 1ETQA 4CDGA 2WADA 4ZYHA 2R5YA 3RZDJ 4E7KA 4A3KJ 1SVLA 5GAHJ 2ZXHA 1LVAA 3C7JA 1DGWY 3MKYB 3S2DJ 4XLEA 2ZMEC 1KQ8A 2XB0X 4EM0B 1YJ9I 3H36A 4PSXA 4XMYA 1LFUP 2VE9A 1W7PD 3LSIA 2MW8A 2HDCA 2VE8A 3CC7I 4CCNA 2F5CA 1FYMA 3BG6A 3JRFA 5B1AH 5IPAA 3PM1A 1HA8A 4BQAA 5EZGA 3SJMA 3P5JA 1SFOJ 3A03A 3KX2A 3ZN0A 2GBYA 5K1YA 5TISC 1JUSA 1MJ9A 4BEHB 1A35A 1BBYA 1V5FA 3HOTA 1DPUA 3DU6A 2E5ZA 3DCFA 4L0ZB 4J01A 2BVLA 2NVQJ 1F1ZA 2UV1A 2Z5UA 1W36C 4XLNF 2B0LA 2PX9A 2QQAA 2I10A 5F1JA 5F08A 3PFYA 2VJJA 3GTJJ 2K40A 3CMEI 2CFXA 2W48A 3I5UA 1WSUA 1BOAA 2M0MA 1P7IA 1X4OA 1ETWA 4EQQA 1TL8A 4IHWA 1S7EA 2OQGA 3I64A 3H5RA 1ENHA 4CA0A 5FLXZ 3CLQA 2O0YA 2KJCA 1XTAA 3RIRA 1STZA 3GTOJ 1RC9A 4Y52J 4XRMA 4Y33A 1WJBA 3BTCA 2ZNYA 3HL2A 4ZYAA 1YYVA 3GYHX 1VZ0A 4G94A 4FT8A 1ZQ3P 2J5OA 1JI8A 4L9TA 1H9GA 2CQKA 2RVCA 1IXCA 1QZYA 2R7DA 3WTZA 2QBYA 2DLLA 4G6QA 2DOEA 1D0XA 3QWLA 5F04A 3T8TA 1Z21A 1XGSA 2DMPA 3BTIA 3H0GJ 3CMAI 2RNGA 3GVAA 3HRSA 3OOPA 3VSKA 5CVJA 2EFOA 3FMQA 4YFXF 4LG3A 2F2EA 4LB5A 2GA1A 3FXKA 1SD5A 3RTRA 4E7ZA 2FEZA 1MGTA 4M73A 3BJOA 5J1YA 2V1UA 2Y2ZA 3KZYA 3O8HA 3LAPA 3WTTC 3HOVJ 2KZGA 1VQ5I 2KHMA 3VSLA 4Q47A 4HRIA 2E34A 1YIOA 1HOMA 1BI2A 3CP2A 3WGIA 3ZPLA 1ITYA 1J9IA 2IS4A 2NVYJ 1VTNC 2RV8A 5B1BH 3NEUA 1RPWA 2LKPA 4A5NA 1VQ4I 4M6YA 4PDKA 2HKOA 2P6TA 1P2FA 4ANJA 1R71A 1IXSB 2DW4A 1ZGAA 1GXPA 4CHUA 3KYLA 5DD8A 2H6CA 2VC0A 4I0BA 4AUXA 2VBYA 2JUCA 2LR8A 3KLOA 3H0DA 2DI3A 3F8FA 3VYRB 3QU3A 1BL0A 1HW5A 1TC3C 4HX4A 5J3LA 2FU4A 1DU0A 2E1MB 2K7LA 1BR4A 4RLFA 4XSXF 3WTXC 2IA0A 4MEYF 3CCRI 4AU7A 3ZN1A 4I7HA 1YE9A 3DLAA 2HI3A 1K83J 3DP7A 4C3HJ 2H8WA 4OAZA 1LEAA 5D8LB 3CCJI 1W4MA 1ZGJA 1TLHB 4R79A 2JPBA 2KDZA 2EINH 2X9DA 1JUPA 3PUBA 2CQQA 3CCUI 4LITA 2GLOA 1R1UA 3PNTA 2K4BA 2M2EA 3LA3A 4D7MA 3CF5F 4L0YB 3S16J 1TW2A 2ECBA 3MZHA 2QVOA 1FBQA 1YJNI 1OR7A 2DOAA 1Y1VJ 3G1MA 5LHIA 2LRDA 4A0XA 3FM5A 4C9YA 1PUFA 3TDUC 1TNTA 3K4KA 4N4NB 4DBQA 5FD5A 3Q0WA 4HNTA 4MFEA 1N75A 1ZLKA 3LSKA 2DYRH 3S3NA 2I5UA 2GOXB 2BXYA 3JRIA 1EF4A 4BE0A 3J80Z 1YS7A 5TRDA 2XPVA 1I5ZA 1RNLA 2ECCA 5L3GA 1BOBA 2PN6A 1UB9A 3AFHA 4C30A 2IS2A 4I76A 4IF4A 1P6RA 1WRJA 1IZ1A 1E3PA 3Q9SA 4G7ZF 3LQQA 3EUKL 1IDYA 4OMZA 4CUGA 4BEHA 3QYBA 4FHTA 3CESA 2N8GA 2Z99A 1IC8A 2R7XA 3IKTA 4I01A 3MKWB 3LL7A 1R5GA 2GWRA 2XRLA 3I4MJ 2WC2A 3IWZA 2JJ7A 5ILSA 3OYGA 2EFNA 5DUKA 5FFXA 5JVGF 3KIOA 3LMMA 1B1BA 3RJPA 2FNAA 2EJRA 3WU1B 3PO2J 1SEUA 3AAFA 1USTA 4BGDA 3CDIA 1SFEA 2NNNA 3K1NA 5IP6A 3L2VA 1UZCA 3LQRA 5BPIA 4DBRA 1G3WA 2DT7B 2QWWA 4XLCA 4EM1A 3OS1A 2OUMA 2PMZN 2BV6A 5D4RA 2KDOA 1JHFA 3GTKJ 3BG7A 3DXJF 3PSFA 4BE1A 1VQOI 5CQGA 4L9NA 2VB6A 2V6CA 4NC6A 3FHNA 4DZJA 2HYFA 4IEJA 4M6VA 3GUDA 4DIQA 1ZELA 1U3EM 4LG0B 4YELA 2X6XA 4BQNA 4ESBA 2FMLA 3IH2A 1QA6A 3QOEA 5F64A 4II2A 3OYMA 1XN7A 1Y1WJ 5EDNA 1MKMA 5FKMA 4D7NA 2ZXWH 2P5KA 3WU0A 5HOOA 2P7VB 1SANA 5B5EC 1VQNI 4OIOF 2XF7A 4Y13A 2VUMJ 3CQZJ 3J7AY 1X2NA 4UB8C 5K5RA 2CUJA 2WV0A 4ITVA 1XC5A 2L0KA 1YI2I 2VJ4A 2PJRA 1MH3A 3DEEA 4NC7A 5GP9A 2LY1A 1JKOC 4A3FJ 1MBFA 2JRMA 2K27A 3DWLE 3I54A 3MCZA 3E7LA 1FIAA 2HGCA 3ABMH 2W24A 3P9CA 3ZQIA 1BI1A 4EJTA 1Z0XA 2H1LA 4Y3OA 5BQTA 5J40A 5KHDA 3TKYA 1U0JA 4UB6C 2CH0A 3H35A 3LNQA 3LA2A 4M71A 3LSJA 1IRXA 4M72A 4XKWA 2W4SA 2A61A 2DK8A 2RREA 4WXDA 3DEUA 3E6BA 2OV7A 1OYWA 2WAQN 4IOCF 4XL9A 1BW6A 2HQAA 1K4SA 5JLXA 1Z7LA 4DGWB 3BC8A 4F55A 4XKCA 2BW3A 1ACIA 3A01A 4H0EA 3X2QH 1DP3A 3K4NA 1T39A 1OLTA 2ISYA 4L5JA 3WTSC 1K61A 2ZMEB 4E7SA 3BQYA 1IW7F 3OYEA 2DDAA 2WBMA 1LVKA 1YX5A 5CQEA 3C2BA 1XDUA 1N77A 1YLFA 1TWHJ 5J1RA 3B73A 4EATA 2HOEA 3RCOA 2NOJB 2E7XA 2R3SA 3E6DA 3ERED 1KU9A 3FIWA 4DOZA 4KA4A 2STTA 1L0OC 3SDGA 4S0HB 3DU5A 4AYBN 2DFEA 2XV4S 3R60A 3BCAA 4Z6YA 1Q1VA 2P81A 1TTYA 1SD6A 4EMSA 4UVBA 2JT1A 5ED4A 4BACA 3WTVC 2OC6A 3DQVC 3I3LA 3CUQA 4RB1A 2DT6A 4RAFA 1ETKA 3HRTA 3AG2H 1ULYA 4G8XA 2DCEA 2MYSA 5LD2C 1R1VA 1FYLA 4ZJZA 5HDKA 4M9SA 3S14J 1JT0A 4QPQA 1F5TA 3F8MA 2DBBA 1AA7A 2L9VA 3SQNA 1TQMA 2ZFUA 2HOSA 2DA3A 3NARA 3CO6C 2DPDA 3HOZJ 1FMWA 1LEBA 4B4CA 4W1UA 1SVOA 1IUYA 3AL0C 1FPQA 2VKVA 2DAOA 2OTLI 1Z91A 3JTGA 1U9OA 2FF4A 1O57A 4XRSA 2EILH 1ONVA 1AU7A 1KGSA 1BC8C 1Z67A 3IHUA 1LQ1A 5IP9J
chains in the Genus database with same CATH topology
2EIMH 3AG2H 3ASNH 2OCCH 5B3SH 2EINH 1OCOH 2DYRH 3ASOH 3AG4H 3WG7H 1OCRH 3ABLH 2EIJH 1OCZH 5IY5H 3ABMH 3AG1H 3AG3H 5B1AH 2DYSH 1OCCH 3X2QH 1V54H 2EILH 1V55H 3ABKH 2ZXWH 5B1BH 2EIKH 2Y69H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIM H;  3AG2 H;  3ASN H;  2OCC H;  5B3S H;  2EIN H;  1OCO H;  2DYR H;  3ASO H;  3AG4 H;  3WG7 H;  1OCR H;  3ABL H;  2EIJ H;  1OCZ H;  5IY5 H;  3ABM H;  3AG1 H;  3AG3 H;  5B1A H;  2DYS H;  1OCC H;  3X2Q H;  1V54 H;  2EIL H;  1V55 H;  3ABK H;  2ZXW H;  5B1B H;  2EIK H;  2Y69 H; 
#chains in the Genus database with same CATH topology
 1K78 B;  3UNG C;  3ERM A;  1KU3 A;  5DDG A;  1RZ4 A;  4J00 A;  3HOY J;  5AON A;  2F5D A;  5ICG A;  5FRM A;  2GAU A;  2VN2 A;  2V9K A;  4KT5 C;  2R5Z A;  2YU9 J;  5K7H A;  2KPM A;  4N9I A;  3CJQ B;  1OCZ H;  3D0S A;  3HGG A;  3N4M A;  3KP2 A;  2H6B A;  2LDU A;  2QA4 I;  1P4A A;  4HYE A;  3CJN A;  1R4M B;  3JSO A;  2DJN A;  2V1N A;  1FT9 A;  2OA4 A;  4UUS A;  2O8K A;  4NC8 A;  4MHG A;  2VPR A;  2JA8 J;  3L2W A;  1DPR A;  3CP8 A;  4CCJ A;  1XGO A;  3OYA A;  4A93 J;  4XOR A;  3A2K A;  1FWZ A;  5D5X B;  1J59 A;  4XNF A;  3ELK A;  2Y0S A;  4AIJ A;  2DT5 A;  2E1O A;  3EPZ A;  2G7U A;  3VYS B;  2IBD A;  2D2W A;  1ZR4 A;  5EG0 A;  1UHW A;  4EGZ A;  3LST A;  3BPX A;  1RIO H;  1FOX A;  3M8E A;  4K2E A;  2FOK A;  4A12 A;  3R0J A;  1YTY A;  1RI7 A;  3BTL A;  3MKL A;  5E3N A;  3LWF A;  1KQ0 A;  4B47 A;  3GFM A;  3FXL A;  3GCM A;  3J7Y J;  1BJA A;  1ZYR F;  3G1O A;  4BL0 B;  5KCM A;  4BQQ A;  2DQL A;  3PSI A;  2ZB9 A;  1IRZ A;  3DKY A;  4IX7 A;  2JA6 J;  3HOU J;  2R7S A;  2XKO A;  4L9J A;  2HDW A;  5GPA A;  1TNS A;  5IT9 Z;  2IJL A;  2HQR A;  3GXO A;  2GIV A;  2X85 A;  4PJL A;  3FM3 A;  4L5E A;  1B72 A;  2FBK A;  3RSN A;  2ESN A;  3KYC B;  3J7Z I;  1X1C A;  3F8B A;  1H89 C;  5K5O A;  2B9S A;  1O4X A;  5IOY A;  1U5T A;  5BNG A;  4HAM A;  3Q3S A;  3FXO A;  4AID A;  3ML6 A;  2MG4 A;  2XPU A;  2EFP A;  4NNJ A;  3RI4 A;  2H94 A;  5B66 C;  5LBQ A;  3I0T A;  3CCY A;  4V2G A;  2OZ6 A;  5E1X A;  4WX9 A;  2EZH A;  4BYY A;  1MBE A;  2A3S A;  4CYD A;  1H8A C;  3C2G A;  2EZL A;  4GO1 A;  1E3H A;  4H4K C;  4UNO A;  1ETV A;  4A3D J;  2QLZ A;  2VON A;  3DPL C;  3BR1 A;  1X3Z B;  3NWT A;  1T0F C;  1Y8Q B;  1JKP C;  2EV5 A;  3RPU D;  3ZQC A;  3I9V 2;  2NOG A;  3BQZ A;  4HNU A;  5M5Y J;  2XAU A;  2PBI A;  2M8E A;  5GTH C;  2KT0 A;  3ZGK A;  4AVP A;  3E5U A;  3FZV A;  2KIS A;  2XB5 A;  4KMU X;  4M74 A;  3BG5 A;  3G4S I;  1O3T A;  4F7Z A;  1QZZ A;  4MTD A;  1LUJ B;  3MQ0 A;  4IVN A;  2A07 F;  3S17 J;  1Y0N A;  4OWR B;  3A02 A;  1V5E A;  1XSV A;  4RMN A;  1HXD A;  1MDM B;  4LOC A;  1T33 A;  1JXS A;  3L09 A;  1TZL A;  1JE8 A;  5FFZ A;  1Z9C A;  3QPL A;  5EGO A;  1XSX A;  2JVH A;  3QYF A;  2RDP A;  4JX6 A;  4YRV A;  3CCS I;  4I02 A;  2M9H A;  4PJJ A;  1LE8 A;  2A68 F;  4C2M J;  1FX7 A;  4EEF G;  3GZN B;  3IRQ A;  4A3J J;  1IN6 A;  1RES A;  2W85 A;  2XHK A;  3F3X A;  4NQW A;  2AS5 F;  2YR2 A;  2CQX A;  3HYI A;  3HOX J;  4E6K G;  2ADU A;  1G3Y A;  2O5R A;  3FKI J;  1W7P A;  4IZZ A;  1AHD P;  4B3A A;  3S15 J;  3HZJ A;  3EET A;  3HG9 A;  1FZP B;  1CQT A;  1IGN A;  2QKL B;  1XCV A;  1V5G A;  2L7K A;  3BR5 A;  4XK4 A;  2V79 A;  4B43 A;  1VQP I;  1S7O A;  2M3A A;  1JUM A;  5A2Q Z;  2LF7 A;  4DYQ A;  1TWG J;  2NVU B;  4PCQ A;  1GT0 C;  2EQR A;  1UHM A;  4KIF A;  1MIJ A;  1B8I B;  2WV1 A;  3MZ8 A;  3R61 A;  3FBI B;  5E20 A;  4BXX J;  1TWA J;  2KFD A;  3K2Z A;  3KP5 A;  2LVS A;  3ZMS A;  4U7D A;  3CCE I;  2ZJR F;  2Z3Y A;  1IJW C;  3LSG A;  3VYT B;  4UY8 I;  4KMF A;  1KYZ A;  1P4X A;  2LYC A;  4ENM A;  2QF7 A;  4I09 A;  3SFI A;  1W36 D;  1JTY A;  3C1D A;  1ORK A;  3BJA A;  5EYR A;  2YUS A;  4HBL A;  1WJ5 A;  1YS6 A;  2CUZ A;  2MSY A;  5DV5 A;  1JT6 A;  4X1E A;  1CF7 B;  2EIK H;  4LLG F;  3S32 A;  3D5L A;  2HVS A;  3JW4 A;  1H9T A;  1TBX A;  2R4G A;  4GDF A;  1VQ8 I;  1ZKG A;  1X3W B;  2ISZ A;  2L9S A;  5EEH A;  5ICE A;  3ZP5 A;  1YO5 C;  1ZTR A;  2DDB A;  1FEX A;  1BA5 A;  1BN5 A;  4A2U A;  4WF2 A;  3M7G A;  1FSE A;  1QRY A;  2FBH A;  4MLO A;  4Q5S F;  4JYK A;  1PVE A;  3CCQ I;  1OCR H;  3BRO A;  2JA7 J;  2EH3 A;  3BR2 A;  4BQO A;  2BXZ A;  1IN5 A;  2CUF A;  2IS6 A;  2L2O A;  1ETY A;  1X3U A;  2XSJ C;  2ELH A;  3VEP A;  1T38 A;  4B09 A;  1IF1 A;  1SMY F;  4OIN F;  2K3F A;  5M5W J;  3IH3 A;  3ASN H;  5DYM A;  4HPQ A;  3BG9 A;  1VQ9 I;  1ZG5 A;  2ACJ A;  5D8K B;  3Q0V A;  4XN3 A;  2MH9 A;  4ASN A;  3RKW A;  2WB1 N;  2CWE A;  1HW2 A;  3OV8 A;  5C3E J;  2LLK A;  4UXN A;  2D5V A;  1Z6R A;  1VQK I;  4P55 A;  5HDG A;  2P5V A;  4XKB A;  1UEL B;  3SXY A;  3K6G A;  2VI6 A;  2JMW A;  2VXZ A;  2IGK A;  4O6J A;  2LTP A;  1DDN A;  2E36 A;  1NK3 P;  1TQI A;  4N0B A;  3ZQH A;  5GAG J;  1SFU A;  4EGY A;  1NG6 A;  2BVM A;  1B9M A;  2XRN A;  3BY6 A;  4WXC A;  3RPQ A;  3CLO A;  3AL0 B;  3ZQL A;  3L2Q A;  1UJ8 A;  2BGC A;  3W6K B;  4ETS A;  4PJN A;  1X2M A;  3K9T A;  4P9U A;  1B4A A;  1YIT I;  4FTH A;  5E1Z B;  5J8F A;  4KIC A;  5E18 F;  5HS7 A;  1I3A A;  3EUH A;  1MNE A;  1SVM A;  5DS9 A;  2KRH A;  2ME6 A;  2IA2 A;  1X58 A;  2XF5 A;  4A6D A;  1RR7 A;  4A3L J;  5F6F A;  2LF8 A;  1OJL A;  4BHC A;  1V3F A;  4PGG A;  1EV7 A;  3CUO A;  5DEQ A;  5M5X J;  5AIP A;  1D3Y A;  4EJO A;  1I27 A;  3H3U A;  2X1C A;  2YX4 A;  1MSF C;  1G59 A;  1JGS A;  3AG3 H;  2Q8K A;  2JK3 A;  1G2H A;  2PMZ A;  4F91 B;  3HTS B;  1WKM A;  2DK5 A;  2LK2 A;  4L9V A;  4XM3 A;  4CZC A;  1IO2 A;  1KZH A;  2R93 J;  1IV8 A;  5FKO A;  3TO6 A;  3OYK A;  2GIZ A;  3MAJ A;  4I0A A;  4AIK A;  2LH9 A;  1DU6 A;  4ZDO A;  1KA8 A;  3FDY A;  1UFM A;  1IDZ A;  4HQM A;  3CC2 I;  3CMY A;  2C6Y A;  4ENN A;  3IRR A;  1ZLJ A;  3JAM Z;  4IHS A;  4A0Y A;  4HZF A;  2JSP A;  4B48 A;  5DM6 F;  3HTU A;  3S3O A;  1IV6 A;  3CO7 C;  1S6L A;  2MC3 A;  3HSE A;  1R49 A;  4D9J A;  3I59 B;  3QPS A;  5L3B A;  1HLV A;  3SHF A;  3GWZ A;  4RB0 A;  3W2W A;  2JQ7 A;  4MIM A;  1GLN A;  3KE2 A;  4E70 A;  2R7V A;  1FMV A;  5J4V A;  2L01 A;  4KDP A;  3HGY A;  2RN7 A;  1S5L C;  3CC4 I;  1ZH5 A;  1LPQ A;  3AG1 H;  3MN2 A;  1KU2 A;  4XOP A;  4B8X A;  4Q4Z F;  3UKG A;  2STW A;  4G7O F;  3K1P A;  2K9L A;  3L7W A;  1EKE A;  4YFN F;  1JJ8 C;  3DPT A;  1VFC A;  3BZ6 A;  2L54 A;  3R6S A;  1LDD A;  4AVZ A;  2W7N A;  1LNW A;  3OYJ A;  3VWB A;  1SFK A;  5BMZ A;  2LKX A;  3EQL F;  3TP0 A;  4IHV A;  2L4A A;  2OF7 A;  3DKW A;  4ZDP A;  4ZYG A;  1R7J A;  1D8J A;  2PFB A;  3F6O A;  3DBL B;  2IRF G;  4BDY A;  3TGN A;  1W5T A;  1RRJ A;  4HSR A;  2VBX A;  5EEA A;  3HRU A;  1WH7 A;  3B6A A;  4LK1 F;  3T8R A;  2W00 A;  2R7W A;  3S8P A;  3HKZ N;  2K3P A;  3LSR A;  1W5S A;  3O2P E;  1JGG A;  2XAS A;  4EVI A;  4M3E A;  3WTY C;  1YHQ I;  1XMA A;  3SEZ A;  3WHC A;  4XRS G;  5IT3 A;  2OPT A;  3DF8 A;  3SZT A;  2AHQ A;  4HV6 A;  3HSF A;  3U21 A;  1QBJ A;  3PNY A;  4AYB A;  2NAZ A;  3A4C A;  4BJT A;  3CCM I;  4BXU A;  3J81 K;  5HLH A;  4NHJ A;  2XGC A;  2GA2 A;  1PDN C;  3A1Y A;  2M1B A;  4JK1 X;  1E0E A;  2V9V A;  3GTM J;  5M3F J;  4IHT A;  3FMS A;  4XLF A;  4A5M A;  1XMK A;  5KAF C;  4RGR A;  1YFH A;  1O3R A;  2AQE A;  2IAI A;  1G3S A;  2H8R A;  1T08 B;  3CDL A;  3D5R C;  1ZHF A;  3ZCO A;  4RB2 C;  3B02 A;  1FC3 A;  2CUE A;  4ENK A;  3WOD F;  2DU9 A;  4B1R A;  3O6B B;  2X1D A;  1EH8 A;  4RDU A;  4C3I J;  1SD4 A;  4JOM A;  3WTU C;  2NYX A;  3R0A A;  5M3M J;  2IA1 A;  4OAY A;  4I98 B;  1YIJ I;  3NQO A;  5CJ9 A;  4CCL A;  1LFP A;  2MAB A;  4G12 A;  2HTJ A;  2HKX A;  5LGT A;  3K70 C;  1QVU A;  5IYD J;  3QRF F;  1XCB A;  2AO9 A;  2RQP A;  4MFD A;  1Z7U A;  4HG2 A;  3FIS A;  1T95 A;  1TWF J;  5F0H A;  3V7R A;  2O6G E;  2P0W A;  1J2X A;  1GV5 A;  1Z3Y A;  5E3L A;  5HS8 A;  3TOA A;  4E4H A;  2X6W A;  2DA7 A;  1K6O A;  4FX0 A;  5LEJ A;  1E17 A;  5D6E A;  4CYC B;  2DFI A;  2L3D A;  1S72 I;  2K9N A;  3U1D A;  4BBS J;  2BHY A;  2NS8 A;  4MTE A;  2DQR A;  1BC7 C;  1ZRD A;  2QSH X;  1UMQ A;  2JA5 J;  1BJZ A;  3OIQ A;  4BY7 J;  3SZG A;  4IRH A;  4IPA A;  1MJA A;  1YW9 A;  1KU7 A;  3ZMV A;  3HHG A;  2EFQ A;  3NRV A;  9ANT A;  1FYK A;  5IOZ A;  2Z2S B;  3JRA A;  3E0J B;  2LMD A;  2VLA A;  4A3I J;  1HW1 A;  2M8G X;  1PJR A;  1EA3 A;  2X4H A;  5FKN A;  2R0Q C;  4CIC A;  3S1Q J;  1VND A;  3LSP A;  2E2I J;  5HDN A;  1I3Q J;  2FSW A;  2HDD A;  1OR7 C;  4XLH A;  1TW3 A;  2A6E F;  2E1N A;  3DBR B;  3KPH A;  3RZO J;  2F48 A;  1T98 A;  3I59 A;  3LA7 A;  2KP6 A;  2VQG A;  3HC7 A;  4BJ5 C;  3OS2 A;  2L9N A;  2CSO A;  2PG4 A;  4HV5 A;  4HX7 A;  1XB4 A;  3GW2 A;  4DYR A;  1DP7 P;  3WGG A;  5FB2 A;  1V4R A;  1SMT A;  1L3L A;  2A5Y B;  1D8K A;  2QYO A;  3VOE A;  2QEX I;  3GTQ J;  3M8F A;  3OIP A;  2M45 A;  3OYD A;  3SFZ A;  1WI9 A;  1XG1 A;  2HZT A;  5IYC J;  1VQ6 I;  2I8D A;  1D1B A;  2DFF A;  2E1C A;  1Z77 A;  3ZMU A;  4JP0 A;  1FOW A;  5GTI C;  5FO5 A;  2GXG A;  4KUM A;  3T0Y A;  4KYW A;  2DA4 A;  4M9X A;  5LFA A;  2AXL A;  2VBW A;  4ZDL A;  2XSD C;  3DV8 A;  1R9T J;  4EM2 A;  1WHU A;  2F5F A;  4YIF A;  2VJI A;  4IRI A;  3LOC A;  4FX4 A;  3N97 A;  3C3W A;  3C2H A;  4RBO A;  2EIJ H;  2VQL A;  5TJJ A;  4ON0 A;  3H5N A;  4LLN A;  2K02 A;  3OSF A;  4HF0 A;  5HLI A;  2XVC A;  2CW7 A;  2DA6 A;  3H3V K;  2IGO A;  2FNP A;  2W1O A;  2LBF B;  3KLN A;  4M3G A;  5LHH A;  1W0U A;  3EDP A;  2FJ1 A;  2HWV A;  2JWT A;  5EEG A;  4F52 A;  4BE2 A;  1J09 A;  5BS6 A;  1R58 A;  3MVP A;  5FRO A;  4GRI A;  3OYH A;  2A5W A;  1JJ6 C;  1MNM C;  1UAA A;  4ZTF A;  3IH4 A;  2M4K A;  2IT0 A;  4IQJ A;  1W5C C;  1D0Z A;  2CMP A;  2KIF A;  3HHH A;  2KL4 A;  2VKD A;  2VPL A;  2M5W A;  3W2A A;  1TWC J;  2O8X A;  5FLX K;  1GHC A;  1P9Q C;  3GO5 A;  5J8C A;  3SYT A;  3CCV I;  1SC7 A;  2ZC2 A;  2OTJ I;  2V4J C;  2HVR A;  4HDU A;  2CV2 A;  3REO A;  2LOO A;  2DMN A;  2GQQ A;  2IXS A;  4BAY A;  4S05 A;  2UXN A;  2LSO A;  2RGV A;  1R22 A;  3TQN A;  4IKF A;  1FJL A;  2CU7 A;  3GTP J;  3RYP A;  1E2X A;  3PQJ A;  2Q0O A;  5EJC A;  1D5V A;  1AWC A;  3FKJ A;  3E6M A;  2YSR A;  4C2T A;  2A05 A;  3ZQQ A;  2BY0 A;  4FET A;  2ELJ A;  4LG0 A;  3DEW A;  3Q9V A;  5H20 A;  1FOK A;  2COB A;  3H92 A;  1Z3X A;  1CGP A;  3F0C A;  2P6S A;  2D45 A;  5IYB J;  2X6Y A;  2FBI A;  4A3G J;  4C3J J;  3M1E A;  2NVT J;  2OU2 A;  3LFK A;  1NG7 A;  3CJT B;  5IP7 J;  4U0Y A;  4M3D A;  5J6X A;  1IXR C;  2QM3 A;  3KZZ A;  1XX5 A;  1NK2 P;  3KYD B;  4G6D A;  3RPU A;  2L4M A;  4QPO A;  1AKH B;  3GEZ A;  1J75 A;  3RKQ A;  1QU3 A;  1FOY A;  3IC7 A;  2CJJ A;  3LFU A;  4I6Z A;  5HNH A;  3MFK A;  5C4X J;  3FXM A;  5C44 J;  4UV8 A;  5AIQ A;  4MQ9 F;  2QSF X;  2QZ8 A;  3WE2 A;  4DNC A;  2P7C B;  1BI3 A;  3QOD A;  3ABU A;  3L2C A;  4KT6 A;  2MGQ A;  3PL8 A;  2GM4 A;  5FRN A;  2FOW A;  5F0C A;  1TQP A;  3E6C C;  3P9K A;  2XAG A;  3I53 A;  3JCU C;  3F21 A;  3TW6 A;  3TO9 A;  4WK8 F;  1ZR2 A;  2HYG D;  5B3S H;  1YG2 A;  2R7U A;  2QQB A;  2MFZ A;  2B63 J;  1MSE C;  2QQ9 A;  3K7A J;  2JZY A;  3BZK A;  4ZH4 F;  2LKS A;  2R7F A;  5F0F A;  2VT3 A;  2ZBK A;  2K9M A;  5ILU A;  3KFW X;  1OPC A;  2E2J J;  3HPH A;  3GTG J;  3QYE A;  2EZI A;  2F4O B;  4HLY A;  3W3C A;  4WWC A;  4BU2 A;  2ZME A;  5D6F A;  4CCK A;  5DCF A;  1IN8 A;  3JRG A;  2PJP A;  3ULQ B;  2HVQ A;  3CUQ C;  2NS7 A;  4JX4 A;  3L2U A;  4R8H A;  4P5O A;  2HXO A;  1G8X A;  1GXQ A;  2QKM B;  1WJD A;  1PYV A;  1SFX A;  1OCP A;  2BYV E;  2FUG 2;  3E5X A;  2HTS A;  3FXR A;  3QP5 A;  4HX8 A;  3GTL J;  1P4W A;  2KLO A;  2M34 A;  3J80 K;  1P7J A;  5CLS A;  1WVR A;  4LIU A;  1I6X A;  4KJZ A;  3COA C;  4XOT A;  1R36 A;  2QCO A;  4PFP A;  3GFJ A;  3KET A;  2MA3 A;  5GAE J;  3ZQ7 A;  1FBS A;  2ME0 A;  2WB1 A;  3SEQ A;  4Z2Y A;  2J5P A;  4P96 A;  3WTW C;  5JVT A;  1GUU A;  1Z6T A;  2MD5 A;  1F36 A;  2HXI A;  2XAJ A;  3ONQ A;  3H9Q A;  1WJC A;  5CYV A;  4MQV A;  2VT2 A;  4G9Y A;  3G2B A;  2QSG X;  5E3M A;  4PZJ A;  4FIS A;  2FMY A;  2L7M P;  2K4J A;  3BR6 A;  3FMR A;  3I58 A;  5CVU A;  1O3S A;  3F9K A;  2VOP A;  5FKK A;  2L02 A;  3GFI A;  1K78 A;  2QBY B;  4LGW A;  1U6G A;  2K5C A;  4LB6 B;  1BR2 A;  4KN4 X;  1R4N B;  1R00 A;  3K4L A;  3TED A;  4CGZ A;  5LHG A;  2MLG A;  2XDV A;  2NS0 A;  2FX0 A;  2Z9O A;  2DA1 A;  3QP6 A;  2VAS A;  2CS3 A;  2WWY A;  3ASO H;  3CCL I;  2K85 A;  1ZG1 A;  3K69 A;  5LGN A;  2X48 A;  1Y8R B;  3BR3 A;  3K2A A;  3LSH A;  3U9G A;  4RM2 A;  1MMD A;  2Y75 A;  3E97 A;  3W6J B;  3JRD A;  2K9S A;  2OCE A;  3TBI A;  3HEF A;  3L00 A;  5E79 C;  3PO3 J;  4BXF A;  4BKX A;  4EJW A;  2PI0 A;  1GDT A;  4E7I A;  2QEN A;  3GF2 A;  3V8K A;  3HXL A;  2EB7 A;  3HJE A;  2JPC A;  2JRT A;  2KRC A;  3S93 A;  1G6N A;  2KIU A;  3F72 A;  4UVC A;  4KFC A;  1E3O C;  1Y56 A;  1ON2 A;  2BZT A;  3HIF A;  1MMN A;  4ZZL A;  1ZAR A;  3KP7 A;  2UUZ A;  3A0H C;  4D5F A;  1H88 C;  5TGT A;  2DA2 A;  2ZCW A;  1YOV B;  1VQM I;  4DYC A;  5ICF A;  1UCR A;  1X1P A;  3IAM 2;  5CPR B;  1FTZ A;  2CYY A;  5BOX A;  1UG0 A;  2XKP A;  5JI6 A;  2LP0 A;  4B3X A;  3IKV A;  2G9W A;  2OCC H;  2R7Q A;  3KEO A;  3OYN A;  2ZSH B;  5K7Z A;  4OOI A;  4RS8 A;  2MD0 A;  1U5T C;  2X0L A;  1EJ9 A;  4UV9 A;  2ZNZ A;  3CMM A;  4E7J A;  3HOW J;  4HQE A;  1I50 J;  2EZK A;  3ECH A;  1BM9 A;  1YX3 A;  3HSR A;  3ZMD A;  2DYS H;  2MBF A;  4XBF A;  2M30 A;  1F43 A;  1U9N A;  1BI0 A;  2B7E A;  3ROU A;  2XC7 A;  4DJA A;  2A6T A;  1WPK A;  4CZZ A;  1PUF B;  1NHA A;  3E3V A;  1OYI A;  3H9G A;  2UZK A;  1QPI A;  2VL8 A;  3PIO F;  2EA4 A;  2M7A A;  4N4O B;  2O9L A;  1NTC A;  1YRN B;  2DJI A;  1X1D A;  2ZO4 A;  3DPU A;  3VB2 A;  1XD7 A;  2X1E A;  4X6A J;  3VOD A;  1KYW A;  2OAZ A;  1S3J A;  2CW8 A;  3IP4 B;  2LY2 A;  1OMI A;  3ZRG A;  1LB2 A;  2FA5 A;  3OR1 C;  4O5V A;  1ODD A;  3C18 A;  1N25 A;  3V8L A;  3JRC A;  1S7A A;  4UUV A;  2O3F A;  3K4M A;  2YU3 A;  3KP6 A;  3P7N A;  2HQN A;  1HCR A;  2Z1D A;  1HDP A;  4F92 B;  1K79 A;  4HW0 A;  4Y17 A;  2XAQ A;  5BPD A;  1FIP A;  2H1K A;  4MEX F;  3K4B A;  3QOP A;  2E2H J;  4E7L A;  2F5V A;  1R5I D;  5ICC A;  2H09 A;  1R6R A;  4PK4 A;  1RET A;  1MBK A;  4AC0 A;  4KIT B;  3OL3 A;  2FXA A;  2GOM A;  1IN7 A;  2W84 A;  2CQN A;  3OSG A;  3HKZ A;  5JR3 A;  3M1C A;  1TP4 A;  3D5S C;  4JQF A;  5L3E A;  2ELK A;  2YX7 A;  2FE3 A;  2HU9 A;  1Y0U A;  4X0G A;  3P9I A;  1WGX A;  2M7B A;  3A0B C;  2HQ5 A;  4Y4R A;  2O7O A;  4RA2 A;  2AXT C;  3JR9 A;  5E1W A;  5DCM B;  2L7Z A;  5L3C A;  3I4N J;  2DOD A;  1MDM A;  3EYI A;  3Q5F A;  3I56 I;  3BZC A;  2HR3 A;  4YG2 F;  1R1T A;  3J7A O;  5E8I A;  2WAF A;  2O61 A;  1NH3 A;  3RDI A;  2V1X A;  4A3E J;  4U87 A;  3IWF A;  3K1M A;  5FKL A;  1MD0 A;  4IQ4 A;  1A31 A;  2OZU A;  4U88 A;  1HKS A;  1LDJ A;  4BS9 A;  1ETO A;  1IUF A;  2P4W A;  1V54 H;  3L2R A;  3OYL A;  3RQ4 A;  1Z1D A;  3PQK A;  1F9N A;  4HST A;  2R7O A;  4Y15 A;  1T2K A;  1HBX G;  4EJU A;  1ZRF A;  2BY2 A;  1J0R A;  2EBI A;  3OYB A;  1T56 A;  4ESF A;  4IHX A;  6PAX A;  3E5Q A;  1JHH A;  1R23 A;  2ZJQ F;  2R7Z J;  4BUP A;  2JVG A;  1YQA A;  2PJR B;  2PQ8 A;  3F23 A;  5C4J J;  4YFK F;  5DD4 A;  4IRG A;  1DQU A;  1J5Y A;  3BG3 A;  1YJW I;  3V7C A;  4CH7 A;  2ESH A;  4TV7 A;  3PIP F;  3JRE A;  1LDK B;  2Y9Z A;  1X4P A;  2F4M B;  1LFB A;  3E1S A;  1OYY A;  1MND A;  1Y6I A;  1B8I A;  1EH6 A;  2JUG A;  2CRG A;  3V8J A;  5ERI A;  3ISP A;  4HOB A;  3GME A;  4UUT A;  1GV2 A;  2L7F P;  2VC1 A;  4HEA 2;  2KQR A;  2MLK A;  1FNN A;  3F8C A;  3L1P A;  1VF9 A;  2ZJP F;  4RGX A;  1WI3 A;  1TT0 A;  2WTE A;  3CTA A;  3F8N A;  3M9A A;  4XON A;  4YIR X;  3KP3 A;  4IHY A;  2BW3 B;  5HS9 A;  2H27 A;  4UHT A;  3A01 B;  2XGE A;  2Q2E B;  2DO7 A;  1GVJ A;  5EZH A;  1K6Y A;  1RKW A;  4LLL A;  2RQQ A;  3FF5 A;  1CF7 A;  5EF6 A;  4RGS A;  2EK5 A;  4BHP A;  2BY3 A;  2LC2 A;  2EIM H;  5IT9 K;  3WHB A;  2WAQ A;  2KJB A;  4DW6 A;  2W25 A;  5L3D A;  2XGD A;  3GLX A;  3KCC A;  3R4K A;  4JX5 A;  4Q48 A;  5JFR A;  1OCO H;  2A6H F;  3L9F A;  2YPR A;  4GCV A;  1HC8 A;  2KIM A;  4OMY A;  4LMY A;  1G4D A;  3K10 A;  3TO7 A;  3ZMZ A;  2P8T A;  3OYF A;  3M8J A;  5L3F A;  3AG4 H;  1U8R A;  2JA2 A;  4F93 B;  5E8G A;  4MGR A;  1IRF A;  3TW7 A;  3IAS 2;  4QTR A;  4J19 A;  2ID6 A;  3V42 A;  2P5L C;  2M87 A;  5DM7 F;  1K7A A;  1DUX C;  1USS A;  2YS9 A;  2IVM A;  3CUQ B;  3FX3 A;  4RAZ A;  3I55 I;  4U0W A;  3K70 D;  2UWM A;  3CF2 A;  2FQ3 A;  2M4G A;  4P1W A;  1FP2 A;  1YRN A;  5LGU A;  2R92 J;  1HKT A;  4N9H A;  1LJ9 A;  1U2W A;  2NXN B;  2CG4 A;  3H9J A;  1F4K A;  4ZC3 A;  4G7H F;  2EV0 A;  3U2R A;  1UG2 A;  3HM5 A;  2IGM A;  2R7T A;  3ABL H;  2XGX A;  2EPF A;  3FK6 A;  1OCC H;  2JTV A;  4XLA A;  2BY1 A;  2XAF A;  2Y0M A;  4UVA A;  4LIV A;  1SAU A;  1OQY A;  2FQ4 A;  2BEO A;  4PUS A;  3ZOB A;  2IGN A;  4A69 C;  2ZXI A;  1BIB A;  3EUH C;  3I4P A;  3DTI A;  2X51 A;  2Y69 H;  5K7F A;  1EH7 A;  1ZG3 A;  4V19 K;  3H1C A;  3NAU A;  1Q1H A;  4RAG A;  2E19 A;  4W97 A;  2DMT A;  2WAE A;  2R5Z B;  1JTX A;  2G0E A;  4QWQ A;  4HDV A;  2V6E A;  3HBL A;  1S29 A;  3U1K A;  3G3Z A;  5E3O A;  4XN0 A;  2W57 A;  4ZYD A;  1IN4 A;  3FXJ A;  1QO0 D;  3KZI C;  3M07 A;  1JKQ C;  3GFL A;  3TP3 A;  3S3M A;  5DCM A;  4KIG A;  4UUS B;  3G73 A;  4S04 A;  1A6Q A;  3KEY A;  4GYI A;  1MBG A;  1OIS A;  3K4C A;  2E5N A;  2LNB A;  3HRM A;  2WA0 A;  1K4T A;  2V26 A;  2VXD A;  2EA2 A;  2VBZ A;  3WE3 A;  3IUO A;  4DQ2 A;  4M9Z A;  4O3M A;  3FK7 A;  4KN7 X;  3VDX A;  1ERD A;  3K0L A;  4II3 A;  4AM3 A;  4V2F A;  4CCM A;  3JTH A;  4XR6 A;  1ON1 A;  3BPV A;  4GXO A;  4HF1 A;  4CO8 A;  5J4Y A;  5JHF A;  4IL6 C;  3HPG A;  5EG0 B;  2QGU A;  2K9Q A;  2VIX A;  4BNC A;  5A2Q K;  3UR3 C;  2FRH A;  5DTD A;  3B6C A;  1MMS A;  3D1N I;  1TT5 B;  5FGM A;  4PJ0 C;  3OYI A;  1QHG A;  3F22 A;  3H5A A;  1A5J A;  1W1W E;  2AQF A;  4DZP A;  5FJ8 J;  2E35 A;  4FE4 A;  5ILV A;  5LRS A;  2COM A;  2DOF A;  3KP4 A;  2BBY A;  1MZB A;  4HLX A;  4P9F A;  1FY7 A;  2TRT A;  3V4G A;  4QSH A;  5IY5 H;  4GYG A;  2LRE A;  1MH4 A;  1FTT A;  2CO5 A;  4A3C J;  3LAJ A;  3ZQF A;  3QQA A;  4D5C A;  1WZ2 A;  2HPI A;  1HST A;  3MWM A;  2CGP A;  3V7S A;  1AOY A;  1B72 B;  3OR2 C;  3ZQG A;  4A3B J;  3GZ5 A;  2FD5 A;  5HVQ C;  1FP1 D;  3FWE A;  2VOD A;  1U5T B;  1X1A A;  1MW7 A;  4G6T B;  1N78 A;  3SZP A;  5F1R A;  3HUG B;  4KNY A;  2V9P A;  3DTK A;  3BCB A;  2X6O A;  3G1L A;  5HLG A;  4BH9 A;  1XS9 A;  1HF0 A;  4OIR F;  1YW7 A;  5HLT A;  3GBG A;  3RKY A;  4XIC A;  3TDZ C;  3MD2 A;  1HDD C;  2Q2E A;  2TDX A;  1ZGW A;  1A36 A;  2Q1Z B;  1YW8 A;  1B9N A;  3PJR A;  1ZK8 A;  4BDZ A;  4OU0 A;  2Z16 A;  2XPW A;  5K5Q A;  2L5Q A;  4NBQ A;  3S2H J;  3FXQ A;  1D1C A;  2ETH A;  1WCM J;  4GFB A;  2R7R A;  3MEX A;  3QAH A;  1QZE A;  5KNL A;  4A3M J;  4KIS A;  1M1E B;  1MMG A;  4RM3 A;  4FQG A;  4PSW A;  1UHS A;  4E7H A;  2OBP A;  4HF2 A;  3N05 A;  4PGH A;  2VOO A;  3WG7 H;  5CVI A;  3W6V A;  2HNH A;  2Z33 A;  4AWX B;  3RYR A;  1WJE A;  2DTZ A;  1XSD A;  4WCG A;  3I71 A;  4HA8 A;  2D1H A;  3F6V A;  3NWS A;  2IW5 A;  4M3F A;  3VPR A;  3CZ6 A;  3OYC A;  4XSZ F;  1T0F A;  1IRG A;  2VKE A;  2RKH A;  1XGM A;  2BE5 F;  4HNV A;  2XF6 A;  4QLC U;  4IO9 F;  2CV0 A;  2IP2 A;  3CD6 I;  1QHH D;  4IOA F;  2Y9Y A;  3ZR8 X;  2IEK A;  4D1Q A;  4CSW A;  3BLY A;  5F27 A;  3G71 I;  4BY1 J;  2Y48 A;  5EGO B;  2F5E A;  2CV1 A;  2LFB A;  2DMQ A;  1RKT A;  2PLY A;  4BJ6 C;  1LE8 B;  2OD5 A;  3QPH A;  3JRB A;  3G6E I;  2KIQ A;  1WJA A;  3PUF A;  5D4S A;  3S2W A;  3BWG A;  2EFW A;  3DBH B;  1QGP A;  5KK1 A;  1X19 A;  3VYU B;  3S1R J;  2V1D A;  4NQW B;  4R1H A;  3T5X A;  5CKT A;  1X1B A;  2ZKZ A;  4RGU A;  2HPM A;  1W7P B;  1LKX A;  1KON A;  3O3K A;  1GVD A;  4ZTJ A;  3HB9 A;  4AIH A;  5CVV A;  2V7F A;  3KEQ A;  3JSP A;  4EV0 A;  3MKZ A;  5GPC A;  3M3Y J;  2HFH A;  4YEJ A;  4D0P A;  3W2V A;  2XUB A;  4PFO A;  4RAY A;  5FLM J;  5LRR A;  3DTE A;  2VJ5 A;  3S1N J;  1VQ7 I;  3SDB A;  1ZN2 A;  1G3T A;  3ABT A;  3OIO A;  4LFU A;  4B44 A;  3GZ6 A;  1ZRE A;  2PMU A;  4IXA A;  3LSM A;  5LLQ A;  4RLQ A;  1Y39 A;  1QQI A;  4FE7 A;  3PNV A;  2LD5 A;  2UXX A;  2KRF A;  5DUI A;  2D1V A;  2K86 A;  2VQC A;  3O8G A;  2GXA A;  1DGR M;  5CVR A;  1WWX A;  5D5U B;  1XGN A;  5E17 F;  3TL4 X;  2ZXJ A;  2HEO A;  2MC4 A;  5JHU A;  1ETX A;  2R5Y B;  2E1M C;  2OJE D;  3DFG A;  1FBU A;  3ABK H;  5JLW A;  4CYC A;  1PP8 F;  1IAW A;  4U0V A;  2DMU A;  3JAM K;  1O7L A;  2F6C A;  4EJV A;  1RUN A;  2ICW G;  3RQI A;  3AKZ A;  5J1U A;  4M3B A;  2KMU A;  2WY7 Q;  3MMY B;  3DLL F;  1I1G A;  5H6Q A;  1QPM A;  2DXI A;  4ABZ A;  4NB5 A;  2HYJ A;  1A04 A;  5KVR A;  2OQR A;  3CDH A;  4GGG A;  1B59 A;  2HOA A;  2ZSI B;  2JSC A;  4LJZ F;  2W82 A;  3ESW B;  2KKO A;  1WQ2 A;  3OOU A;  4XRF A;  2CW0 F;  3WU2 C;  4IJA A;  3TMO A;  1APL C;  3JRH A;  1RUO A;  2GXB A;  1A6I A;  2CQ7 A;  1W0T A;  3ZXS A;  2M0C A;  4A0Z A;  1MBH A;  1SAX A;  1JKR C;  4L18 B;  3HUG A;  1ZRC A;  4FAS D;  5KAI C;  2WY8 Q;  3GX4 X;  2E60 A;  1I39 A;  4BHB A;  2ID3 A;  1PP7 U;  1OFC X;  4QIW N;  4XQF A;  1XPX A;  4ZYE A;  3OWT A;  3OS0 A;  5H6R A;  2HOT A;  4BBR J;  5FLV A;  3ZMT A;  2LG4 A;  1O7F A;  1POG A;  4CCO A;  2G7H A;  3BTJ A;  2RAE A;  3Q0U A;  1HKQ A;  4F3Q A;  3MZY A;  1R5H A;  3HOS A;  3M4O J;  1OCT C;  1HQC A;  2LY9 A;  3J81 Z;  1P92 A;  4FCY A;  2L9R A;  4ZZD A;  3QPT A;  1U8B A;  4CXF A;  1VQL I;  3DKX A;  4KIB A;  3OY9 A;  2Y31 A;  1U78 A;  2MH2 A;  1FLI A;  5J47 A;  4AD9 A;  1BW5 A;  3QU6 A;  2TCT A;  1QVT A;  4PJM A;  1REP C;  3BP8 A;  2GZW A;  1ZAO A;  2BOL A;  1T8I A;  1HSJ A;  5D5V B;  1KQ9 A;  4NDL A;  5HNF A;  5D5W B;  1D1A A;  4I99 C;  2HS5 A;  3OL4 A;  2XAH A;  2LBF A;  3FBN B;  4OIQ F;  2RNJ A;  4MO7 A;  1MMA A;  3VFZ A;  3ECO A;  2IS1 A;  2DFH A;  1WJF A;  1MBJ A;  3WG9 A;  4XID A;  1XDS A;  1IG7 A;  2ZFW A;  1T6S A;  1S9H A;  4LD5 A;  2DTR A;  2F4I A;  3EYY A;  3CJR B;  2A69 F;  2PMH A;  2NNY A;  1J7K A;  5H2F C;  4OIP F;  1C0W A;  2Y0S N;  1S8N A;  3IL2 A;  1VI0 A;  4L5I A;  2PEX A;  1BIA A;  2EV6 A;  4LK0 F;  1B6A A;  1OKR A;  2DN0 A;  3H3Z A;  4XKV A;  1O3Q A;  1WH5 A;  1SD7 A;  2BHZ A;  4MNU A;  4WXH A;  3BOQ A;  2CFO A;  3BT9 A;  4Y7N J;  1D5Y A;  1QNT A;  3BJ6 A;  3BR0 A;  1FSH A;  2O03 A;  2NVX J;  2VKH A;  4A6E A;  2DA5 A;  4YII A;  3WGH A;  2EWN A;  3EUA A;  5HOD A;  3T1B A;  1PUE E;  3BDD A;  4JBA A;  2VQH A;  4ESJ A;  5GAD J;  3S1M J;  1I6H J;  2QUF A;  2Y30 A;  2XRO A;  4I2O A;  2QQ8 A;  3OMY A;  2E71 A;  4C2U A;  3FXU A;  4U7B A;  1V55 H;  2RC4 A;  3K4J A;  1WFX A;  2IPQ X;  1XMX A;  1H0M A;  3HDD A;  1MJB A;  1Z05 A;  1I1S A;  2HZD A;  2DPU A;  3TOB A;  2NRA C;  1AKH A;  2E7W A;  4XLP F;  4RB3 C;  2KZV A;  4M6X A;  1D0Y A;  3IV5 A;  4ENJ A;  3PFI A;  3RKX A;  3FHZ A;  5LEK A;  1RR8 C;  2JN6 A;  3GLL A;  5FD6 A;  2XIG A;  4NUB A;  2ZJ2 A;  1BR1 A;  1ETQ A;  4CDG A;  2WAD A;  4ZYH A;  2R5Y A;  3RZD J;  4E7K A;  4A3K J;  1SVL A;  5GAH J;  2ZXH A;  1LVA A;  3C7J A;  1DGW Y;  3MKY B;  3S2D J;  4XLE A;  2ZME C;  1KQ8 A;  2XB0 X;  4EM0 B;  1YJ9 I;  3H36 A;  4PSX A;  4XMY A;  1LFU P;  2VE9 A;  1W7P D;  3LSI A;  2MW8 A;  2HDC A;  2VE8 A;  3CC7 I;  4CCN A;  2F5C A;  1FYM A;  3BG6 A;  3JRF A;  5B1A H;  5IPA A;  3PM1 A;  1HA8 A;  4BQA A;  5EZG A;  3SJM A;  3P5J A;  1SFO J;  3A03 A;  3KX2 A;  3ZN0 A;  2GBY A;  5K1Y A;  5TIS C;  1JUS A;  1MJ9 A;  4BEH B;  1A35 A;  1BBY A;  1V5F A;  3HOT A;  1DPU A;  3DU6 A;  2E5Z A;  3DCF A;  4L0Z B;  4J01 A;  2BVL A;  2NVQ J;  1F1Z A;  2UV1 A;  2Z5U A;  1W36 C;  4XLN F;  2B0L A;  2PX9 A;  2QQA A;  2I10 A;  5F1J A;  5F08 A;  3PFY A;  2VJJ A;  3GTJ J;  2K40 A;  3CME I;  2CFX A;  2W48 A;  3I5U A;  1WSU A;  1BOA A;  2M0M A;  1P7I A;  1X4O A;  1ETW A;  4EQQ A;  1TL8 A;  4IHW A;  1S7E A;  2OQG A;  3I64 A;  3H5R A;  1ENH A;  4CA0 A;  5FLX Z;  3CLQ A;  2O0Y A;  2KJC A;  1XTA A;  3RIR A;  1STZ A;  3GTO J;  1RC9 A;  4Y52 J;  4XRM A;  4Y33 A;  1WJB A;  3BTC A;  2ZNY A;  3HL2 A;  4ZYA A;  1YYV A;  3GYH X;  1VZ0 A;  4G94 A;  4FT8 A;  1ZQ3 P;  2J5O A;  1JI8 A;  4L9T A;  1H9G A;  2CQK A;  2RVC A;  1IXC A;  1QZY A;  2R7D A;  3WTZ A;  2QBY A;  2DLL A;  4G6Q A;  2DOE A;  1D0X A;  3QWL A;  5F04 A;  3T8T A;  1Z21 A;  1XGS A;  2DMP A;  3BTI A;  3H0G J;  3CMA I;  2RNG A;  3GVA A;  3HRS A;  3OOP A;  3VSK A;  5CVJ A;  2EFO A;  3FMQ A;  4YFX F;  4LG3 A;  2F2E A;  4LB5 A;  2GA1 A;  3FXK A;  1SD5 A;  3RTR A;  4E7Z A;  2FEZ A;  1MGT A;  4M73 A;  3BJO A;  5J1Y A;  2V1U A;  2Y2Z A;  3KZY A;  3O8H A;  3LAP A;  3WTT C;  3HOV J;  2KZG A;  1VQ5 I;  2KHM A;  3VSL A;  4Q47 A;  4HRI A;  2E34 A;  1YIO A;  1HOM A;  1BI2 A;  3CP2 A;  3WGI A;  3ZPL A;  1ITY A;  1J9I A;  2IS4 A;  2NVY J;  1VTN C;  2RV8 A;  5B1B H;  3NEU A;  1RPW A;  2LKP A;  4A5N A;  1VQ4 I;  4M6Y A;  4PDK A;  2HKO A;  2P6T A;  1P2F A;  4ANJ A;  1R71 A;  1IXS B;  2DW4 A;  1ZGA A;  1GXP A;  4CHU A;  3KYL A;  5DD8 A;  2H6C A;  2VC0 A;  4I0B A;  4AUX A;  2VBY A;  2JUC A;  2LR8 A;  3KLO A;  3H0D A;  2DI3 A;  3F8F A;  3VYR B;  3QU3 A;  1BL0 A;  1HW5 A;  1TC3 C;  4HX4 A;  5J3L A;  2FU4 A;  1DU0 A;  2E1M B;  2K7L A;  1BR4 A;  4RLF A;  4XSX F;  3WTX C;  2IA0 A;  4MEY F;  3CCR I;  4AU7 A;  3ZN1 A;  4I7H A;  1YE9 A;  3DLA A;  2HI3 A;  1K83 J;  3DP7 A;  4C3H J;  2H8W A;  4OAZ A;  1LEA A;  5D8L B;  3CCJ I;  1W4M A;  1ZGJ A;  1TLH B;  4R79 A;  2JPB A;  2KDZ A;  2EIN H;  2X9D A;  1JUP A;  3PUB A;  2CQQ A;  3CCU I;  4LIT A;  2GLO A;  1R1U A;  3PNT A;  2K4B A;  2M2E A;  3LA3 A;  4D7M A;  3CF5 F;  4L0Y B;  3S16 J;  1TW2 A;  2ECB A;  3MZH A;  2QVO A;  1FBQ A;  1YJN I;  1OR7 A;  2DOA A;  1Y1V J;  3G1M A;  5LHI A;  2LRD A;  4A0X A;  3FM5 A;  4C9Y A;  1PUF A;  3TDU C;  1TNT A;  3K4K A;  4N4N B;  4DBQ A;  5FD5 A;  3Q0W A;  4HNT A;  4MFE A;  1N75 A;  1ZLK A;  3LSK A;  2DYR H;  3S3N A;  2I5U A;  2GOX B;  2BXY A;  3JRI A;  1EF4 A;  4BE0 A;  3J80 Z;  1YS7 A;  5TRD A;  2XPV A;  1I5Z A;  1RNL A;  2ECC A;  5L3G A;  1BOB A;  2PN6 A;  1UB9 A;  3AFH A;  4C30 A;  2IS2 A;  4I76 A;  4IF4 A;  1P6R A;  1WRJ A;  1IZ1 A;  1E3P A;  3Q9S A;  4G7Z F;  3LQQ A;  3EUK L;  1IDY A;  4OMZ A;  4CUG A;  4BEH A;  3QYB A;  4FHT A;  3CES A;  2N8G A;  2Z99 A;  1IC8 A;  2R7X A;  3IKT A;  4I01 A;  3MKW B;  3LL7 A;  1R5G A;  2GWR A;  2XRL A;  3I4M J;  2WC2 A;  3IWZ A;  2JJ7 A;  5ILS A;  3OYG A;  2EFN A;  5DUK A;  5FFX A;  5JVG F;  3KIO A;  3LMM A;  1B1B A;  3RJP A;  2FNA A;  2EJR A;  3WU1 B;  3PO2 J;  1SEU A;  3AAF A;  1UST A;  4BGD A;  3CDI A;  1SFE A;  2NNN A;  3K1N A;  5IP6 A;  3L2V A;  1UZC A;  3LQR A;  5BPI A;  4DBR A;  1G3W A;  2DT7 B;  2QWW A;  4XLC A;  4EM1 A;  3OS1 A;  2OUM A;  2PMZ N;  2BV6 A;  5D4R A;  2KDO A;  1JHF A;  3GTK J;  3BG7 A;  3DXJ F;  3PSF A;  4BE1 A;  1VQO I;  5CQG A;  4L9N A;  2VB6 A;  2V6C A;  4NC6 A;  3FHN A;  4DZJ A;  2HYF A;  4IEJ A;  4M6V A;  3GUD A;  4DIQ A;  1ZEL A;  1U3E M;  4LG0 B;  4YEL A;  2X6X A;  4BQN A;  4ESB A;  2FML A;  3IH2 A;  1QA6 A;  3QOE A;  5F64 A;  4II2 A;  3OYM A;  1XN7 A;  1Y1W J;  5EDN A;  1MKM A;  5FKM A;  4D7N A;  2ZXW H;  2P5K A;  3WU0 A;  5HOO A;  2P7V B;  1SAN A;  5B5E C;  1VQN I;  4OIO F;  2XF7 A;  4Y13 A;  2VUM J;  3CQZ J;  3J7A Y;  1X2N A;  4UB8 C;  5K5R A;  2CUJ A;  2WV0 A;  4ITV A;  1XC5 A;  2L0K A;  1YI2 I;  2VJ4 A;  2PJR A;  1MH3 A;  3DEE A;  4NC7 A;  5GP9 A;  2LY1 A;  1JKO C;  4A3F J;  1MBF A;  2JRM A;  2K27 A;  3DWL E;  3I54 A;  3MCZ A;  3E7L A;  1FIA A;  2HGC A;  3ABM H;  2W24 A;  3P9C A;  3ZQI A;  1BI1 A;  4EJT A;  1Z0X A;  2H1L A;  4Y3O A;  5BQT A;  5J40 A;  5KHD A;  3TKY A;  1U0J A;  4UB6 C;  2CH0 A;  3H35 A;  3LNQ A;  3LA2 A;  4M71 A;  3LSJ A;  1IRX A;  4M72 A;  4XKW A;  2W4S A;  2A61 A;  2DK8 A;  2RRE A;  4WXD A;  3DEU A;  3E6B A;  2OV7 A;  1OYW A;  2WAQ N;  4IOC F;  4XL9 A;  1BW6 A;  2HQA A;  1K4S A;  5JLX A;  1Z7L A;  4DGW B;  3BC8 A;  4F55 A;  4XKC A;  2BW3 A;  1ACI A;  3A01 A;  4H0E A;  3X2Q H;  1DP3 A;  3K4N A;  1T39 A;  1OLT A;  2ISY A;  4L5J A;  3WTS C;  1K61 A;  2ZME B;  4E7S A;  3BQY A;  1IW7 F;  3OYE A;  2DDA A;  2WBM A;  1LVK A;  1YX5 A;  5CQE A;  3C2B A;  1XDU A;  1N77 A;  1YLF A;  1TWH J;  5J1R A;  3B73 A;  4EAT A;  2HOE A;  3RCO A;  2NOJ B;  2E7X A;  2R3S A;  3E6D A;  3ERE D;  1KU9 A;  3FIW A;  4DOZ A;  4KA4 A;  2STT A;  1L0O C;  3SDG A;  4S0H B;  3DU5 A;  4AYB N;  2DFE A;  2XV4 S;  3R60 A;  3BCA A;  4Z6Y A;  1Q1V A;  2P81 A;  1TTY A;  1SD6 A;  4EMS A;  4UVB A;  2JT1 A;  5ED4 A;  4BAC A;  3WTV C;  2OC6 A;  3DQV C;  3I3L A;  3CUQ A;  4RB1 A;  2DT6 A;  4RAF A;  1ETK A;  3HRT A;  3AG2 H;  1ULY A;  4G8X A;  2DCE A;  2MYS A;  5LD2 C;  1R1V A;  1FYL A;  4ZJZ A;  5HDK A;  4M9S A;  3S14 J;  1JT0 A;  4QPQ A;  1F5T A;  3F8M A;  2DBB A;  1AA7 A;  2L9V A;  3SQN A;  1TQM A;  2ZFU A;  2HOS A;  2DA3 A;  3NAR A;  3CO6 C;  2DPD A;  3HOZ J;  1FMW A;  1LEB A;  4B4C A;  4W1U A;  1SVO A;  1IUY A;  3AL0 C;  1FPQ A;  2VKV A;  2DAO A;  2OTL I;  1Z91 A;  3JTG A;  1U9O A;  2FF4 A;  1O57 A;  4XRS A;  2EIL H;  1ONV A;  1AU7 A;  1KGS A;  1BC8 C;  1Z67 A;  3IHU A;  1LQ1 A;  5IP9 J; 
#chains in the Genus database with same CATH homology
 2EIM H;  3AG2 H;  3ASN H;  2OCC H;  5B3S H;  2EIN H;  1OCO H;  2DYR H;  3ASO H;  3AG4 H;  3WG7 H;  1OCR H;  3ABL H;  2EIJ H;  1OCZ H;  5IY5 H;  3ABM H;  3AG1 H;  3AG3 H;  5B1A H;  2DYS H;  1OCC H;  3X2Q H;  1V54 H;  2EIL H;  1V55 H;  3ABK H;  2ZXW H;  5B1B H;  2EIK H;  2Y69 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...