2DZ9A

Crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with biotinyl-5'-amp, mutation d104a
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNAVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
total genus 70
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dz9A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dz9A01
4YRPA 1ASZA 3HFZB 4N0AC 1G5HA 1Y96A 4P71A 3GIBA 4WJ3M 4H2UA 2AKWA 3BFMA 3HXVA 2QHSA 3WQZA 4EMHA 5GMKi 1WYDA 5HGQA 1YFRA 1H4SA 1JJCB 2K57A 4M7DA 3TUPA 3M4GA 2CJ9A 4P3NA 4EMKB 2RHSB 5GAMg 1H4VB 1ASYA 5LJ5e 1ADJA 4M7AF 3P8YA 4M7AC 5GAN7 4C8QF 4J15A 3UH0A 3JCMV 2ZR3A 2I4LA 1BIAA 3HY1A 3A5YA 5GANf 3NELA 4PJOG 3M4PA 5K1PA 1N9WA 2Q7EA 4J6YA 1B70A 3V8KA 4PG3A 2I4NA 3RL6A 3V7SA 2ZT6A 2E64A 4PJOE 1NYRA 4H2TA 2RM4A 4C92B 2Y90A 5F5WA 2J3MA 1Z7MA 1H4TA 4CH6A 4M7AB 3RIRA 3R07A 4J6WA 1I4K1 3RGLA 3VBBA 4M7DD 4M78B 2RHSA 1QE0A 3V7RA 4YCUA 4YRTA 5GANg 4XU0A 3JCMP 4PJOC 4TQDA 1H4QA 2ALYB 3VQWA 4XTUA 4XTYA 4BWAA 2ZT7A 2ARUA 4M7AG 4K88A 2FB7A 4RCBA 2Q7HA 1X55A 1USYA 2ZIMA 2RD1A 2DXTA 1JRIA 4HVCA 1EVKA 5LJ5f 1IL2A 5GAN6 3HFVA 4UPAA 4JUVA 4TTVA 4C92E 2IY5A 3QUIA 2ZXFA 4XU1A 4X9CA 1N9RA 2DU5A 1B34A 4PJOA 4M7AE 5GANe 1NJ2A 1G51A 1EVLA 1VQZA 3FIFA 3JCMW 4M7DE 5GAOq 3HXXA 1KQ1A 4PNOA 2DEQA 2I4OA 3FJPA 3DSQA 4C92A 2DTHA 2VC8A 4KR3A 4BW9A 3QO5A 1BIBA 2RB6A 1W66A 4P3PA 1I5LA 5GAN4 4XEOA 4YRRA 1SERA 1N9SA 4M7DG 4K86A 1HTTA 3JCMe 4HWOA 4X9DA 5LJ5h 1J5WA 2E3CA 1PYSA 4YYEA 4P72C 2EJGA 4CS4A 1EFWA 5LJ5j 4XTZA 1HK9A 4G84A 3HFNA 5LJ5d 1NJ8A 3CMQA 2ZNJA 2ZZGA 4XTXA 1X2HA 2QHUA 1LOJA 4YREA 1B7YB 1ADYA 4X5OA 2DDZA 4HWSA 3REUA 4M75B 5GAOl 4C8QG 4EMKA 4RQEA 1TH7A 4JLIA 1BBWA 4M75F 2XGTA 3TEGA 1B34B 3L1AA 4PJOB 4P75C 1E1OA 1LYLA 3JCMb 2AMCA 2ZT8A 2IY5B 4P3OA 5K1XA 3A31A 2DZ9A 2ZIOA 12ASA 3V8LA 5GMKm 3MF1A 2DQ3A 2CIMA 4M78E 5LJ3e 4C92G 3A7AA 3JB9H 2C7IA 4YRNA 3JCMX 2ALYA 5GAN3 1U1TA 3RKXA 4NL3A 3ICAA 4H2XB 1M5Q1 4HA8A 4QVDA 4P74A 3W3SA 3BJUA 4J6XA 3RESA 3HXUA 1E22A 3QTCA 1ATIA 5GAOr 2DU7A 4M77A 3JCMf 4CH3A 3E9IA 4M7AA 4M77C 5GAOn 4A53A 4ZIBA 2Q5IA 3SWNA 5C52B 2E65A 5ELOA 3HY0A 4H2WA 2EAYA 5KNNA 1PYSB 1I8FA 2P0LA 4Q15A 2ZZEA 4YP0A 5GAN8 3JB9I 3HXYA 4TVWA 2RHQA 4XTVA 4YRMA 2ZTGA 2XTIA 1JBMA 3RACA 1B76A 4XEMA 1H641 3JCMh 4F7UE 4DPGA 4JRIA 4TVAB 4C8QE 3NEMA 1Z7NA 4XU2A 2Q5HA 2QTXA 3HFOA 5C51B 4MMKA 3IALA 3OD1A 4UP9A 3G1ZA 3PCOB 4M78F 1M8VA 1X54A 3HXZA 3SWNB 1EQRA 1X2GA 2P5IA 4M77F 5GANh 1G5IA 1SRYA 2G4CA 4NOYA 4YDQA 2AKWB 4M75E 4P74C 4YRGA 4P73A 1YCYA 5GAMh 4KQEA 2CGHA 2CJBA 4HT8A 4TWAA 3E9HA 3BW1A 4C8QA 4F7UB 3LC0A 4CH5A 2I2LA 4C8QB 4H2SA 1E24A 4OP0A 3LSSA 4L87A 4NCXA 2E1HA 3M4QA 4YPFA 3RUXA 3ERRA 3TEHB 4WI1A 3FB9A 4RMFA 3INZA 2ZCEA 2DJZA 2DXUA 2JN0A 2FYKA 2J3LA 1X56A 3A5ZA 2PMFA 2QHTA 3L4GB 4YRCA 2Q7GA 4H2YA 3HSBA 3QSUA 1KOGA 3PGGA 4F7UG 3MEYA 2DTOA 1I81A 4C92F 3JB9D 4OLFA 4RDXA 4RQFA 4QVCA 4XTWA 3QO3A 4M77G 5GMKl 1WQWA 2ZNIA 2DZCA 4G85A 1U1SA 4H02A 3V8JA 2CJAA 4Q6GA 3VQXA 5C53B 4YRLA 3UGQA 1B70B 2DQ0A 3P8VA 5GAOm 2EJFA 5LJ3f 4EMKC 3IG2A 4HT9A 4M75C 3JB9G 1LJOA 3RERA 4O2DA 2DKGA 4YRJA 4YROA 3V7CA 1HC7A 3PZCA 1KMNA 5LJ3d 4HWRA 2ARSA 2E10A 1KMMA 4M78D 2VXFA 2ZINA 2ZZFA 1X01A 4M77D 3P8TA 3HRKA 5LJ3g 4M7AD 1Y96B 3NETA 3VU3C 2E41A 4YCVA 5GAMd 4M7DB 1USYC 4F7UA 3L4GA 2E5AA 1E1TA 4CS3A 2ZR2A 3A7UA 4XQ3A 5GANj 1MGQA 4Y91A 1NNHA 2PMEA 4KR2A 1YFSA 2RA2A 4WF2A 3QNEA 4HWTA 1GGMA 3SWNC 2AMCB 3HFZA 3A32A 3REXA 5CAIA 4WJ4A 3UGTA 3JCMd 3NENA 4V2SA 4M78A 4J5YA 4MMLA 4TVYA 4XU3A 3EFSA 3BY7A 5GMKj 2ZT5A 4YRSA 1RIQA 5GMKh 1WNLA 3RKYA 4PJOD 4K87A 2YHTA 4HWPA 3L2ZA 4ZTUB 1C0AA 3QHSA 5GAMj 4CS2A 1NJ1A 5GAN2 1EIYB 4DQ2A 3PCOA 4A54A 5GANd 2ODRD 5GAN5 4YCWA 5GAOp 3HRIA 4M78C 4M75G 3JCMg 4TVAA 5GAMe 1NYQA 4YRQA 3VQVA 1YGBA 1SESA 1WQ7A 1WPYA 5LJ3j 1LNXA 4N0AA 3RKWA 1B8AA 2RHQB 4LNSA 5GMKe 4CH4A 11ASA 4M75D 2DTIA 3AHUA 1SETA 5DY9A 2YLBA 3IKMB 1D3BA 3HXWA 4PHCA 1JJCA 4UP7A 1QF6A 4H2VA 4YRFA 3JB9J 4P72A 4H2XA 4C92D 3JB9F 5LJ3h 1EOVA 4C8QC 3TEHA 2EJ9A 2ZGWA 3IKLA 4P71C 4M77B 4EO4A 1BBUA 1HXDA 3LSQA 3BDUA 3JCMc 5E3IA 2C8MA 3JCMJ 3JCMQ 2EL9A 1D3BB 4P73C 5ELNA 4M75A 2ARTA 4EX5A 4M7DC 5GAMf 4TQFA 4F7UF 2I4MA 3EFRA 2YLCA 2HNIA 3QO8A 1WLEA 3RF1A 4C92C 4M77E 3UFGA 1YFTA 4C8QD 1FYFA 4AH6A 4M78G 1B7YA 4ZTZB 1NJ5A 1EIYA 5I21A 3A7RA 4P75A 3MF2A 4RCCA 1WU7A 4YRIA 2EWNA 5LJ5g 4UP8A 3HTZA 4E51A 3SB2A 3A74A 1YB3A 1L0WA 2DVEA 3QO7A 4EMGA 2VXEA 1NJ6A 4M7DF 4NL2A 4YRKA 1KQ2A 2QHVA 3VQYA 2ODRC 3KFUA 4PJOF 3I7FA 4JRKA
chains in the Genus database with same CATH superfamily
1M3CA 1WIEA 1VQNQ 1G5HA 2NUPA 5CKBA 2AZVA 4H2UA 1YJWA 5J39A 2GNCA 1B7TA 3HXVA 2KNBB 2QHSA 1SPKA 1FMWA 4BE0A 1JJCB 2K57A 5I2SA 2KXDA 4BE2A 3TUPA 3G6ET 2RQRA 1YN8A 2LMJA 3CEYA 2YXYA 1H4VB 4KH1B 5A0GA 1C0MA 4OB2B 1ADJA 4M7AF 3DKMA 3P8YA 1M8MA 2WACA 3HTRA 1GFDA 4LVJA 1X43A 3Q1JA 4PFPA 3HY1A 3MEAA 2CT4A 1YI2A 2IVWA 2D6FA 4MDXA 1VQ8Q 1UEBA 4OGEA 5K1PA 3I9QA 2X3WD 1AWWA 3M0QA 2RO0A 3DB3A 2OTJT 1OX9A 3URGA 4FM4B 1M30A 2M16A 4H2TA 2LQ8A 2G3RA 1UB4A 3CCRQ 4A4GA 4CH6A 3RIRA 4J6WA 1AOJA 4ZGEB 4J9GA 4J9HA 3NFCA 4OMLA 4M7DD 1FYNA 3M0RA 3JCMP 1N6AA 2MAMA 2M0OA 3GBQA 4K88A 4M7AG 3S3OA 3EG9B 1JRIA 2Z0WA 1K0SA 5L8RE 4M4ZA 2RK1A 2IY5A 3S3MA 3QUIA 2ZXFA 4X9CA 4M7AE 2A28A 5J3BA 5GANe 4BE1A 1NJ2A 3NMZC 3WXMB 2ZPBB 1VQZA 3MJXA 2WSEE 5GAOq 3ZEHA 2PUKB 3DSQA 1VYVA 4DBHA 4JJNK 4KR3A 3QO5A 2RB6A 4P3PA 1GXIE 2ED0A 1PWTA 1VQKT 4M7DG 4LDWA 1J5WA 4ATOA 4JDSA 1EFWA 4G84A 3X28B 3CMQA 2AT1B 2F69A 1GBQA 3MEWA 1YJNT 4XTXA 4J8OA 1YIJT 4HVVA 3L2UA 2L3SA 2DDZA 3QG1A 4HWSA 5GAOl 1ZA2B 1ZQ1A 1BBWA 2CDTA 3QDFA 4PJOB 2C0IA 2DIGA 3JCMb 1G3TA 1VQ4Q 4P3OA 3UPUA 2DAQA 2F5KA 2E6ZA 2RHUA 1YJ9A 3CCET 3MCAB 3MHXA 12ASA 5GMKm 5D6YA 2CIMA 4J9EA 1OQKA 1K0XA 3A7AA 2X4WA 2RQVA 3JB9H 2C7IA 1VQLA 2DE0X 4TVRA 2ALYA 2PNIA 4H2XB 4QVDA 4CI0C 1BU1A 3HXUA 3VS4A 3CPWS 3QTCA 2DU7A 3JCMf 2JTMA 3E9IA 3GLXA 1Y0MA 2FVUA 2K3YA 2DERA 1X6BA 5CKHA 4ZIBA 1RACB 2O9SA 2PTKA 2Q5IA 3OBYA 3CC7A 3JSCA 4JS4A 1N8RU 3CMEA 3HY0A 4ELZC 3UA6A 3CBPA 4Q15A 4YP0A 3CCLT 1Y71A 2VASA 1QVGS 4KBMB 4TVWA 2QAZA 4YRMA 2AK5A 2ZTGA 5KE2A 3E9GA 2EYZA 1JBMA 3RACA 1YITA 8AT1B 1YIJQ 1HD3A 1RAGB 1YJNQ 1Z7NA 4XU2A 1NZ9A 4MMKA 3CCJA 3HXZA 1VQ9A 4PKCC 3N5BB 3UATA 3G71A 4M77F 1H8KA 1MMAA 2EBPA 3OB9A 1G83A 1E7OA 5EG2A 1ZA1B 2AKWB 3PIPA 1M90C 2P0KA 3BW1A 4C8QA 1D1AA 4C0FA 4H2SA 2HDAA 4OP0A 1QVPA 3LSSA 5KYYB 2QQSA 3H9NA 1MNEA 1PKTA 1OOTA 2JTEA 4RTXA 4RMFA 1E6HA 2ZCEA 3BE3A 1OU8A 2EKHA 3L2WA 4JJDA 2EPDA 3L4GB 4H2YA 1I07A 1I81A 3CPFA 4OLFA 4RQFA 1D0ZA 4QVCA 1MV3A 3QO3A 4M77G 5GMKl 2MIOA 4AFQC 3OYNA 2E4HA 1MMGA 3V8JA 1K73C 3PMTA 5C53B 4C0DB 4YRLA 1OZ2A 3PFSA 4JZ4A 3P8VA 2J05A 5GAOm 5LJ3f 3IG2A 4AMCA 4FW1A 1QKWA 1PHTA 4RTYA 4YRJA 1HC7A 2LCLA 2EYYA 1VA7A 4BUGA 3QWXX 4HWRA 2E10A 1YHQA 1T0HA 4DA4A 4GBQA 2ZZFA 1Q81C 3HRKA 4IKFA 1M90U 2NUPB 3CCMQ 3VU3C 3HP9A 5GAMd 1K1ZA 4E7SA 4CS3A 4RKUE 2XDDA 2QA4T 1U3OA 1VQ6A 2RI3A 2O9VA 2RH2A 1KC8R 5CCAA 3QXEB 1WA7A 2L3QA 4HWTA 2XG8D 3OW2A 3I5SA 1BI3A 2QQRA 3MO8A 1OU9A 3CMAT 1YHQT 1NEBA 4AFSC 5GJWB 2BE7D 2XICA 3EFSA 1SHFA 3X26B 3G71T 4QQ6A 4PJOD 3JRZA 2AKKA 2FPFA 2YHTA 5D6WA 3VUZA 3VS1A 1C0AA 1AD5A 1P92A 2Y4YA 1Q81U 5GAN2 2K5FA 4DQ2A 3MKDA 4A54A 4YCWA 4IUPA 5GAOp 3LX7A 4M78C 4M75G 3MPUB 3JCMg 5FLXE 2A08A 2X4YA 1BCOA 1ZSZC 4B9WA 2DL7A 3CCEA 4IUVA 2E6NA 2OTJQ 4LUEA 3VQVA 1SESA 2DYIA 1RLPC 2EVRA 1WPYA 2KT1A 1G8XA 1MMDA 4BB7A 3EGUA 4L59A 3LW5E 5A0LA 3AHUA 3GF5A 1X2QA 3OYFA 4RUGA 1AZGB 2H3EB 1Z9ZA 3CC7Q 2JTFA 2SRCA 2RPNA 1PG5B 1QW1A 4UP7A 4H2VA 2R5MA 4B9XA 2P0QA 4C92D 4IURA 3L2RA 1EOVA 3CC7T 3L42A 3IKLA 4P71C 4EO4A 4BY6C 3JV3A 1Q86R 3LSQA 3CCLQ 5E3IA 1KHIA 1RAFB 2VYTA 3JCMQ 1D3BB 2YRCA 4RTWA 4P73C 2RQWA 1WXTA 2J06A 1ZLMA 4EX5A 3VYGA 2A7YA 3G4ST 1VQ4A 2I4MA 1PNJA 3A8MB 3EFRA 5FROA 5DLOA 5HCKA 1VQPQ 3HRTA 2C06A 3PE0A 4IUTA 3RF1A 4C92C 2QXFA 4CC4B 4M78G 5CIUA 4E47A 1IHVA 1NJ5A 2O4XA 4R56A 5HK3A 2QA4A 4E7HA 1WYXA 3CCQT 3KBGA 3TEEA 2XKOC 1QMCA 5LJ5g 4UP8A 3G4SA 2LJ0A 1G3WA 5FU7B 1VQ4T 1VQOT 1L0WA 2KMTA 1SG5A 1VQNA 2COZA 3C12A 2HL3A 3CCVQ 1NJ6A 2LJ3A 1D09B 2HSPA 2QHVA 4ZNXA 1LPLA 3QWYA 5CR2A 2ODRC 3KFUA 4HVUA 2WSFE 2HBPA 2BTTA 1Z9QA 5D7UA 4JRKA 1ASZA 3GNFB 1XNIA 1TOVA 1Y96A 3GIBA 4WJ3M 5FWBA 4AG2C 4ORZA 3UT1A 1PSEA 1PD1A 3BFMA 1VQ8T 1YI2Q 4FSSA 4EMHA 1T3LA 1WYDA 2ESWA 4FT4A 4M7DA 1ACMB 2CJ9A 1GCQC 5GAMg 2QGGA 4ESRA 1WXUA 3G71Q 5LJ5e 2HQEA 4M7AC 1M3AA 5A2QE 4C8QF 2LTOA 1VQ7Q 1FX7A 3UH0A 2ZR3A 2RN8A 3SFMA 2I4LA 3A5YA 3A8LB 2F2XA 3M4PA 2QTVA 2JS2A 1IO6A 2RHXA 4KT0E 2CZ0B 2DILA 2ECZA 3NTIA 1VQ7A 3FEOA 3V8KA 3AT1B 2KT8A 4MZMA 3RL6A 2OI3A 1NYRA 2LQNA 2NWMA 2RM4A 3QZ5B 5IN1A 2Y90A 1W2BA 5F5WA 3TVTA 2KAFA 2X4XA 3H0IA 3R6OA 2LT1A 3TCJA 3CXCA 3CMAA 2FPDA 3WVEB 3R07A 3VBBA 4CC3A 4Z02A 4KRTA 4M78B 1RLQC 3EH2A 1QE0A 3FLGA 4YRTA 2ROLA 4C0GA 5GANg 2VGNA 5L23A 1WHHA 2AKLA 3FRNA 2FEIA 4TQDA 1H4QA 2ALYB 3VQWA 4BWAA 4DBFA 2K5IA 4JJCA 4XAXB 2ZIMA 1S72Q 2QK0A 4HVCA 2LVMA 1UFFA 3SD4A 4F04B 1EVKA 3MP6A 1H3ZA 1OULA 1N9RA 1UGQB 4PJOA 2YUOA 5LL6S 1TS9A 2L3PA 2M0YA 2C0TA 1YWPA 1AVZC 3FIFA 3QJ6A 2JMCA 4C5EA 3QBYA 1K9MR 3M56A 2LCCA 2V8KA 1KQ1A 1M1KC 2DEQA 2FO0A 2D1XA 1SKUB 2NUZA 2LNHB 4BW9A 2YSQA 1I5LA 2CUDA 4YRRA 4K86A 3TQ7P 3M55A 4HWOA 4J9BA 1OEBA 1SSFA 4CS4A 1ZUYA 5LJ5j 4J9DA 1HK9A 4ZN1A 4K11A 4YTLA 2GF7A 4Y92A 1IRXA 3OYBA 2DJQA 3RR6A 2FZKB 3TU4K 4YREA 5IHNA 4C5IA 4OB3B 2DXCA 4M75B 4RQEA 4JLIA 1UHFA 4M75F 1KD1R 2CZ7B 3TEGA 1B34B 4LVMA 1LYLA 2AMCA 2IY5B 1XOVA 3ER0A 2DZ9A 1KIKA 2DQ3A 5LJ3e 1PSFA 1U1TA 2YUPA 3RKXA 4NL3A 3W3SA 1M5Q1 1UHCA 4HA8A 4LUDA 3CC2A 4J6XA 1EFNA 1BB9A 2HAXA 2LC4A 3GP8A 4M77A 1D1CA 2K3XA 3MP1A 4E7ZA 2L8DA 1PC0A 1VQ6T 2HL5C 1IZ6A 1YI2T 4KGXB 4A53A 5IH2A 4KULA 3SWNA 6AT1B 2XD0A 2E65A 2DK3A 2EAYA 3CC4T 5KNNA 2BZYA 2V1RA 3META 4PK4A 1V29B 2CP5A 1D0XA 1G3SA 1YWOA 1MMNA 4XTVA 4QQGA 3CXCP 3G6EQ 1VQLQ 1UGRB 3MEVA 5KYUA 4JZ3A 4J7IA 4HCBA 3OBWA 1RAIB 4F7UE 2LX9A 4N4IA 4C8QE 1UGPB 2QEXQ 3EGXB 1ZSZB 3HFOA 5C51B 3LGLA 4GLKA 2ROTA 3PCOB 1Q95G 1VQ5Q 1QVFA 1X54A 1M4ZA 2XIDA 4LNPA 1VQMT 1EQRA 1C1AA 1OZ3A 1X2GA 2P5IA 2V8IA 4BACA 1BKBA 2ZAEA 4DOWA 3KFVA 3LH0A 3PNWC 4YDQA 3RMQA 1IB8A 2AHJB 2DL5A 2KY9A 3NPFA 2O2OA 5IAYA 1ZUKA 4P73A 1YCYA 5GAMh 1K76A 4KQEA 2CJBA 2PUOB 3E9HA 4F7UB 3LC0A 3I55A 1E24A 2XDBA 3OQ5A 4L87A 3OYHA 4E7KA 3M4QA 1ZSGA 4C5GA 4YPFA 3ERRA 4Z88A 1W2BS 2BZ8A 3U23A 2JN0A 2DM1A 3EFOB 2EGCA 5KE3A 2VKNA 2QHTA 4YRCA 5IHIA 1I1JA 1MUZA 2O88A 2RI2A 3CBMA 2MI6A 1UJ0A 8ATCB 4RDXA 3CC4Q 1R8OB 2DVJA 2OTLQ 1M2VB 2RMOA 3EAEA 1U1SA 2BUDA 1YHQQ 2CJAA 3VQXA 4RTTA 3M5AA 3P8HA 2DQ0A 1RI0A 3SHWA 2FRWA 4HT9A 2OTLA 2RHZA 1G3YA 2RF0A 4YROA 3V7CA 2Y4XA 4F17A 3CCVT 1KMNA 1R0CB 2RJDA 2X9HA 4JLGA 1BI1A 1X69A 2QG9B 4M78D 2R5AA 4M77D 2EQIA 3CCST 2OAUA 1USYC 2FZGB 3M0TA 2DL4A 4Y91A 4LD6A 4KR2A 1XJWB 2RJEA 3OYGA 1YFSA 2QEXA 3H0HA 2A0FB 2JNGA 3LLRA 3QNEA 5FU6B 3FJ5A 1JEGA 3I55Q 1WDXA 4CRIA 2AMCB 3LWIA 4PJNA 1PRMC 3REXA 4F14A 2YWWA 4WJ4A 4E7JA 3JCMd 2EYXA 3MEUA 4QQDA 4MMLA 1TUGB 3X20B 2KXCA 5GMKj 1T0JA 1X2KA 3QYHB 1WNLA 3RKYA 4PJMA 4HWPA 1RAEB 2D0QB 3L2ZA 2RJCA 3QHSA 3BDLA 1VOMA 4QKUA 5GANd 2KRNA 2HKNA 4ZGDB 4N4GA 2ODRD 2ZPHB 3HRIA 1YITQ 4TVAA 3CMEQ 1NYQA 3VKIA 1YGBA 3OYKA 1K9AA 1WQ7A 2DX1A 3F70A 1D1BA 3CD6Q 4Z8AA 4N0AA 2RHQB 4CH4A 1VQ9Q 1NLOC 1JXMA 4M75D 1X6GA 2DTIA 2KK4A 4LD9K 4FCYA 4MZTA 5DY9A 1OI1A 1XQHA 2J6OA 1GFCA 4A4HA 2CKKA 1Q7YC 3CD6T 3IKMB 1D3BA 3HXWA 4PHCA 2M51A 1JJCA 1TTHB 4EDUA 2LP5A 1QVGP 1QF6A 2EQKA 1ZHIA 3QIIA 3ZFJA 1KD1C 5LJ3h 2DRKA 2X51A 1YJ9Q 2EJ9A 2XDPA 4OGCA 4M77B 3X25B 1BBUA 5KYYA 1IGUA 1JB0E 1VQNT 2FRYA 4OMOA 2C8MA 5DLQE 3JCMJ 3EH1A 2EL9A 2MYSA 2AIRB 1QP2A 5KCOA 2ARTA 2FZCB 2DF6A 1OPLA 4LVKA 2YLCA 2EQJA 3DLMA 1VUBA 2HNIA 4VUBA 3QO8A 3HPWA 1VQLT 2JMAA 2E5KA 1YFTA 4RMOA 2L3RA 2QA4Q 1B7YA 3OSVA 2JT4A 2CSIA 2R57A 2HSEB 1UGVA 1WHGA 4P75A 4DEXA 1NM7A 1X27A 2RHYA 3A74A 1YB3A 1R0BG 1K73U 2FL7A 3SDZA 2GTOA 1YJNA 3QO7A 1SF9A 2ZPGB 2VXEA 4ANJA 2W0ZA 3RNJA 4J83A 2CS7A 1FWZA 1TU0B 2VVKA 4J7FA 4PJOF 3OYLA 2OAWA 2B8AA 3P8BB 1VQOQ 3HFZB 4N0AC 1SHGA 1VQ7T 1IGQA 4P71A 2E12A 4LVIA 3ME9A 3I55T 2F5TX 4FYVB 2K7AA 4RG8A 3WQZA 5GMKi 2ED1A 5HGQA 2JZ2A 1H4SA 2ENMA 2KYMA 1WFWA 1OYXA 2LQWA 4JRPA 1Q82C 4JJBA 3M4GA 4P3NA 4EMKB 2WSCE 2RHSB 1RL2A 4MDWA 2LQKA 2MOXA 2PZ1A 3OMGA 3OSSC 4J15A 4E2FB 1JJ2A 1BIAA 1K8AC 4PFZA 3VRYA 1VQKQ 4PJOG 1N9WA 2CT3A 2HBWA 3GOXA 2ZPIB 3WVDB 2CP3A 9ATCB 4OB0B 2I4NA 3I35A 3A5ZB 4PJOE 2KRSA 1VQKA 1LCKA 1KFZA 1YJWQ 2J3MA 5I22A 2RQUA 2IIMA 3REAB 2A36A 2VV5A 2MWOA 1I4K1 1K4US 2LRQA 3V7RA 4YCUA 5ECAA 1B3QA 4XU0A 2L2PA 4RG2A 2KQWA 3J80E 3A8GB 5CQYA 4XTYA 2ARUA 4L6V5 2Q7HA 1USYA 4QW2A 2DXTA 3CCUA 1IL2A 1HYOA 3LYIA 5GAN6 2GQIA 4JUVA 4TTVA 3O5ZA 2FG0A 4XU1A 1B34A 1W70A 1EVLA 4KGVB 1TG0A 2JJ9A 4HKEA 2YUQA 2ZPEB 2CP0A 3CCQA 3HRUA 4PNOA 2I4OA 3FJPA 2DTHA 2VC8A 4O5VA 1VQPT 1VYUA 2OTJA 1E6GA 1W66A 1VQOA 3E19A 5IHKA 1M27C 5GAN4 1NPPA 4XEOA 1SERA 2F1LA 2DBKA 3I56T 4X9DA 4BDYA 2E3CA 3M0UA 5D6XA 2J6FA 4YYEA 4P72C 2EJGA 1S72A 1Q86U 1JQQA 2HD0A 4XTZA 5EC7A 3NHNA 2NS6A 1WZOA 2JUFA 3CCRT 2QDLA 4IUQA 2ZZGA 1UDLA 4D8DA 4R55A 5CO7A 2QHUA 1WHMA 1LOJA 3CPWA 4J9FA 1JO8A 4EMKA 2JXBA 3PVLA 2YRDA 5HY6A 3L1AA 2XGTA 2ZT8A 2KYBA 3GNGA 2ZIOA 4P5NA 3E2UA 3CMET 5CQXA 3V8LA 1QQJA 4II1A 4C92G 2J7IA 2PQWA 3JCMX 3BJUA 1M90R 4A4KA 2CUBA 4LDXA 3S3NA 2L5QA 2EQMA 3QDRB 1ATIA 3MQZA 1NE8A 4LDVA 4HT4A 4M7AA 2CSQA 5GJVB 3TREA 4M77C 5HK0A 2PU9B 2DETA 1WLPB 4A4EA 5C52B 5ELOA 2V1QA 2DYBA 2VUBA 1VQMQ 3CCRA 3TSWA 2IG0A 3H6ZA 3I56Q 2P0LA 2NYSA 4OMFB 2MWPA 1C6VX 4ME7A 3RMSA 3JB9I 2OX7A 2GFUA 1W6XA 2A8EA 4HCKA 2YT6A 4XEMA 1H641 3JCMh 5KYWA 4ZGJB 4JRIA 4A4FA 2LZ6B 3EG0A 5FRMA 2QTXA 3P8DA 1QCNA 3IALA 3OD1A 4UP9A 3G1ZA 3SWNB 5KH6A 1G5IA 2VB6A 4NOYA 3OW2P 2YDLA 4MZPA 3DB4A 4PJLA 1BYMA 4ELYC 4IIMA 4OMPA 1N5ZA 5IXBA 2CGHA 4HT8A 4TWAA 1ABOA 2RNAA 4C8QB 2LCSA 1N8RC 2I0NA 2E1HA 3CQTA 4QVZA 3TEHB 4WI1A 3FB9A 1WGSA 2DXUA 2FYKA 2J3LA 3PVQA 1NG2A 1X56A 3A5ZA 2DNUA 1YIJA 3HSBA 3QSUA 1NYFA 1M2OA 4RTUA 3JB9D 2DLPA 1Y57A 4XTWA 1WQWA 4NS5A 1RADB 2CYZB 2K9GA 4PJJA 2DZCA 4ZN3A 4E7LA 4B6MA 3M4YA 4HCZA 1M1KR 3QPHA 4OB1B 4BI4A 1FXXA 3UGQA 2VWFA 2KI7A 4M75C 3VJPA 1LJOA 2DBMA 1Y07A 2R58A 1W4SA 4O2DA 3EFOA 5I11A 1Q82R 1U5SA 2ZINA 1G5VA 3P8TA 2DL8A 4M7AD 1PM3A 1A0NB 4YCVA 3PMIA 4F7UA 3L4GA 3EHQA 1E1TA 3A7UA 4XQ3A 3OS2A 1FMKA 1MGQA 3G7ZA 4JPBW 1NNHA 1GL5A 1S1NA 2PMEA 1TSFA 4WF2A 2ATCB 2K2MA 4AG1C 2CH4A 1KK7A 3SWNC 1PCXA 2V8JA 1CKAA 3HFZA 3S6WA 2P0PA 4A63B 1QP3A 2CZ6B 4EIKA 3UGTA 3HHTB 1S72T 2BE9B 2MF2A 3JAME 3NENA 4M78A 4J5YA 4FL6A 4XU3A 1N27A 3BY7A 4DOVA 1VQ9T 1KC8C 2YRVA 2ZT5A 1N8RR 2HCKA 2LX7A 1RIQA 4FYXB 3L2VA 2EYWA 5KYUB 4ZTUB 1QKXA 5GAMj 4CS2A 1NJ1A 3T9NA 3OS0A 1OPKA 2DD4A 2L89A 1EIYB 4FT2A 2DO3A 1BK2A 2JVVA 3CCMA 3EHRA 2DMOA 1QCOA 3A8OB 1BI2A 1H92A 5GAMe 3QKJA 5IXFA 2XU8A 4YRQA 3J81E 1EX4A 2COYA 2EQUA 5LJ3j 3HKSA 3NGPA 1LNXA 4QT7A 2RQTA 3CCQQ 3HRSA 3RKWA 1B8AA 1WHJA 4LNSA 4E6RA 3M59A 2P4RA 1KQSP 3UWNA 2D8HA 2RHIA 2YLBA 3QJYA 3FC3A 1VQ5T 2JM9A 5J26A 2DRMA 2M1HA 4YRFA 3UF4A 1KJWA 1WX6A 1MNDA 2M9UA 2ABLA 4C8QC 2HQXA 1VIFA 1UG1A 2EFIA 1M1GA 2GBQA 4LN2A 3BDUA 3EGDA 1RUWA 3M58A 5ELNA 2K4YA 3VS0A 4JS5A 3CC2Q 4M75A 4FYYB 1GRIA 2HEQA 2K6DA 3OYEA 1NEGA 3OYJA 1J3TA 1Q81R 2DPPB 2E70A 3CXCS 1YITT 3A1PA 3CC4A 3C0CA 1K9MC 1CSKA 1QVFS 2B86A 3PT9A 1KSWA 3G1JA 4OVAA 4M77E 2MCNA 2EW3A 3EGXA 4AH6A 1Q7YR 5AT1B 1G2BA 1W2BP 1VQ5A 1DJ7B 1RI9A 1WU7A 1AWXA 3M0SA 4OMMA 1SEMA 4YRIA 2EWNA 2K3BA 1SSHA 4E51A 2KBTA 1KD1U 1WJRA 1RAHB 1AEYA 2MPXC 3CPWP 4EMGA 3I56A 1OV3A 4BI8B 3OW2S 3GPLA 4M7DF 4YRKA 1PKSA 2PVGB 2XMFA 2C0OA 3VQYA 1GCQA 2JOYA 3THKA 2A37A 1UUEA 4DBQA 2QQBA 2LJ1A 2NUTB 5CVIA 2PVDB 1WI7A 1ZBJA 4OF1A 5CKEA 4BY6B 1WHKA 4YRPA 3E9FA 3VUBA 1PD0A 2AKWA 2E3HA 3ZL7C 2DIQA 1UJYA 3TSZA 2HMAA 1SRLA 1YFRA 5KYXB 4OMQA 1EIFA 3OA6A 1UGSB 4AFZC 3D7SB 1QLYA 1ASYA 5C0MA 5GAN7 2LT4A 2D8JA 3JCMV 4ZTFA 3CCMT 5GANf 3NELA 2Q7EA 5DM7R 4Z89A 4J6YA 3M54A 2COWA 4LVLA 1JXOA 1B70A 1TXQA 3A98A 4PG3A 3CCLA 1RAAB 4JRQA 3V7SA 2ZT6A 2E64A 4FIBA 3CCUQ 2GQVA 4OMNA 4C92B 1Z7MA 1M2VA 1H4TA 2DXBA 4M7AB 3RGLA 2RHSA 2D0NA 5HKCA 1VQ8A 3I5RA 4PJOC 2LDMA 2KRMA 3M0PA 3VS7A 1K73R 2GGRA 1NJIC 4XTUA 2ZT7A 3ULRB 2ZCFB 2FB7A 4RCBA 1K8AR 1X55A 2H8HA 2HKQB 2RD1A 3M57A 2X3XD 4EPCA 1KG1A 5LJ5f 1JJ2S 1TUCA 1WXBA 3HFVA 4UPAA 4C92E 3C4SA 2VGMA 1V76A 5CKDA 2DU5A 1KQSS 4PLLA 3VS2A 1G51A 1TWBA 3JCMW 3G4SQ 1YFNA 4M7DE 1KHCA 3REBB 4PFOA 3HXXA 2M02A 3LWHA 4C92A 1IREB 1YCSB 2OJ2A 1BIBA 4CC2A 3OYAA 2F2VA 1W1FA 3KUFA 2K79A 3EG3A 4Q5WA 2O4XB 1N9SA 2ZPFB 4WCIA 1HTTA 3JCMe 3CCEQ 3PTAA 1U06A 5LJ5h 2JW4A 1PYSA 3E1SA 3H0FA 4L5GA 2FPEA 3HFNA 5AYFA 5LJ5d 1NJ8A 4WTOB 3VS3A 1YNZA 3CD6A 2ZNJA 4HXJA 4D8KA 1X2HA 3CCUT 3UA7A 1B7YB 1ADYA 4X5OA 1BI0A 4AT1B 3REUA 4C8QG 1TH7A 2CH4W 7AT1B 4P75C 2D9TA 1E1OA 4LDUA 2O01E 5K1XA 1O75A 1UTIA 2HZYA 3OYMA 1NPRA 3OYCA 3A31A 3IQLA 4F16A 2BIVA 2NLUA 3MF1A 4M78E 2HQHA 1Q7YU 4YRNA 2GCXA 4LXCA 5GAN3 4P74A 3ICAA 3RESA 1E22A 4FSXA 2L0AA 2X35A 4O6JA 1ZX6A 2KE9A 4LDYA 5GAOr 4CH3A 1R77A 2NUTA 4XK8E 3CBOA 2KGTA 1I5OB 5GAOn 3CCSA 4H2WA 1PYSB 2FHDA 1I8FA 2ZZEA 1M1FA 3VV0A 2QQAA 2XI9A 5GAN8 3HXYA 3LGFA 2RHQA 5FWCA 3C95A 2DFUA 3VS5A 2XTIA 3C94A 2E3IA 4HVWA 1B76A 3DLLA 4DPGA 5M9OA 2DD5A 4TVAB 4R0KA 3NEMA 2Q5HA 2RK2A 5I2MA 1ZBXA 1KQSA 4FU6A 1ARKA 5CK9A 1HSQA 2F2WA 1GBRA 1B07A 4M78F 1M8VA 3RDVA 1BBZA 2AZSA 3CCJQ 4BD3A 1NBEB 5GANh 4N4HA 1SRYA 1O9SA 2G4CA 1SRMA 3SEMA 1Q86C 2H3JA 4M75E 4P74C 4YRGA 2J6KA 2CP6A 2YUNA 1ABQA 4CH5A 1YJWT 2I2LA 3EGDB 3RBBB 4J9CA 2LNVA 4BDZA 1MHNA 4BI3A 4NCXA 3RUXA 4IIOA 3NTKA 2BZXA 3INZA 1AWJA 1FMVA 2DJZA 3G6EA 1AT1B 5CKFA 2OTLT 2PMFA 2X4JA 3VYHB 1I0CA 2Q7GA 3O8VA 1KOGA 3PGGA 4F7UG 3UDCA 2DTOA 3MEYA 3OYYA 4C92F 1QWEA 2ZNIA 3PIOA 4G85A 2QQ9A 1AZEA 4H02A 1KC8U 4RTZA 1ZUUA 4Q6GA 3OMCA 1AHJB 3LH5A 2QYZA 1B70B 1XTDA 1X75C 2EJFA 4EMKC 1GCPA 1LVKA 1MV0B 3EG1A 1QVGA 1RABB 3JB9G 4KGZB 3RERA 2JM8A 2DKGA 1UE9A 3PZCA 1QVFP 5LJ3d 3CMAQ 5A0DA 2ARSA 1KMMA 2VXFA 1X01A 2A3LA 5LJ3g 5FU7C 4C0ZA 1K9MU 1Y96B 4KH0B 2MK5A 3NETA 2E41A 5KYXA 3OY9A 4M7DB 1T3SA 1X6OA 2E5AA 5KCHA 3NTHA 2ZR2A 2QI2A 1VYTA 5GANj 3EG2A 1UECA 2DA9A 1WHLA 2RA2A 3EG9A 4UC4A 5C6SA 4D6WA 2SEMA 1GGMA 2XHCA 2P84A 3A32A 3M9QA 5CAIA 2CREA 1JU5C 4ZTJA 1NJIR 4V2SA 3FDRA 5FW9A 4TVYA 1VQMA 4GY5A 2KDSA 4YRSA 2CP7A 5GMKh 4K87A 1VQ6Q 1F1BB 4C5HA 3ZBDA 2KSSA 2EKOA 2O31A 3PCOA 5GAN5 3M53A 4IUUA 1ZSZA 4J9IA 1WJSA 3OS5A 2CP2A 2V26A 4Y28E 3H8ZA 4RTVA 3OS1A 2KEAA 1TUDA 2DL3A 3VS6A 5GMKe 2KROA 2EGEA 11ASA 1BCMA 1CKBA 3CC2T 1SETA 4LE9A 2K2VA 2KVQG 2QEXT 4DBRA 1YJ9T 5KYNA 1AWOA 3JB9J 4P72A 4H2XA 3KXTA 4C0DC 4E7IA 3JB9F 3MP8A 1K8AU 2RJFA 4AFUC 1U8RA 4X34A 3TEHA 2ZGWA 5FRNA 5FU6C 1HXDA 2RI5A 1VIEA 3JCMc 2DEUA 4CC7A 1H3HA 5IT9E 1YBYA 2EGAA 3J7AF 2E5QA 1YP5A 3H41A 4FYWB 2XK0A 4GLMA 3CCVA 1Q82U 4M7DC 3QZ9B 5GAMf 4TQFA 3QYGB 4F7UF 4DEYA 2MMPA 2JS0A 4PL6A 1QWFA 2CZ1B 4PLIA 1WLEA 2IPOB 1PRLC 1VQPA 1WJQA 3UFGA 3HL8A 4C8QD 1NJIU 3OYDA 1FYFA 4ZTZB 5KYWB 1M1KU 2EIFA 1JJ2P 1EIYA 3L2QA 5I21A 3A7RA 2GTJA 3MF2A 4HCCA 4RCCA 2EYQA 3R6NA 3OYIA 2QASA 3CCJT 4KUDK 1D0YA 2G6FX 3ASKA 3HTZA 2QDYB 3X24B 3SB2A 4KUIA 1IXDA 2GFAA 1M9SA 4X1VA 2W10A 1QCFA 2DVEA 1HJDA 3VRZA 1IHWA 2PVOB 1NYGA 1V1CA 4NL2A 2ZZDA 1KQ2A 1Y7XA 2K5LA 3A8HB 1OX8A 2P4TA 1M3BA 4FW2A 2BKDN 1NLPC 2KR3A 2QGFB 1EZZB 3CCSQ 3I7FA
chains in the Genus database with same CATH topology
1G5HA 5CKBA 4H2UA 1YJWA 5J39A 3HXVA 2QHSA 4BE0A 1JJCB 2K57A 5I2SA 4BE2A 3TUPA 3G6ET 3CEYA 1H4VB 5A0GA 4OB2B 1ADJA 4M7AF 3DKMA 3P8YA 2WACA 4LVJA 3Q1JA 3HY1A 3MEAA 1YI2A 2IVWA 2D6FA 4MDXA 1UEBA 4OGEA 5K1PA 2RO0A 3DB3A 2OTJT 3URGA 4FM4B 2M16A 4H2TA 2LQ8A 2G3RA 1UB4A 4A4GA 4CH6A 3RIRA 4J6WA 4ZGEB 3NFCA 4M7DD 3JCMP 1N6AA 2MAMA 2M0OA 4K88A 4M7AG 3S3OA 1JRIA 5L8RE 2RK1A 2IY5A 3S3MA 3QUIA 2ZXFA 4X9CA 4M7AE 4BE1A 5J3BA 5GANe 1NJ2A 3WXMB 2ZPBB 1VQZA 2WSEE 5GAOq 3ZEHA 2PUKB 3DSQA 4JJNK 4KR3A 3QO5A 2RB6A 4P3PA 1GXIE 1VQKT 4M7DG 4LDWA 1J5WA 4ATOA 4JDSA 1EFWA 4G84A 3X28B 3CMQA 2F69A 3MEWA 1YJNT 4XTXA 4J8OA 1YIJT 3L2UA 2DDZA 3QG1A 4HWSA 5GAOl 1ZQ1A 1BBWA 4PJOB 2DIGA 3JCMb 1G3TA 4P3OA 3UPUA 2DAQA 2F5KA 2E6ZA 2RHUA 1YJ9A 3CCET 3MCAB 3MHXA 12ASA 5GMKm 5D6YA 2CIMA 3A7AA 2X4WA 3JB9H 2C7IA 1VQLA 4TVRA 2ALYA 4H2XB 4QVDA 4CI0C 3HXUA 3CPWS 3QTCA 2DU7A 3JCMf 2JTMA 3E9IA 3GLXA 2FVUA 2K3YA 5CKHA 4ZIBA 2Q5IA 3OBYA 3CC7A 3JSCA 4JS4A 1N8RU 3CMEA 3HY0A 4ELZC 3CBPA 4Q15A 4YP0A 3CCLT 1Y71A 1QVGS 4KBMB 4TVWA 4YRMA 2ZTGA 5KE2A 3E9GA 1JBMA 3RACA 1YITA 1Z7NA 4XU2A 1NZ9A 4MMKA 3CCJA 3HXZA 1VQ9A 4PKCC 3N5BB 3G71A 4M77F 3OB9A 5EG2A 2AKWB 3PIPA 1M90C 2P0KA 3BW1A 4C8QA 4C0FA 4H2SA 4OP0A 3LSSA 1QVPA 2QQSA 4RMFA 2ZCEA 3L2WA 3L4GB 4H2YA 1I81A 3CPFA 4OLFA 4RQFA 4QVCA 3QO3A 4M77G 5GMKl 3OYNA 3V8JA 1K73C 3PMTA 5C53B 4C0DB 4YRLA 1OZ2A 3PFSA 3P8VA 5GAOm 5LJ3f 3IG2A 4YRJA 1HC7A 2LCLA 4BUGA 4HWRA 2E10A 1YHQA 4DA4A 2ZZFA 1Q81C 3HRKA 4IKFA 1M90U 3VU3C 3HP9A 5GAMd 4CS3A 4RKUE 2XDDA 2QA4T 1VQ6A 2RI3A 2RH2A 5CCAA 3QXEB 4HWTA 2XG8D 3OW2A 1BI3A 2QQRA 3MO8A 3CMAT 1YHQT 2XICA 3EFSA 3X26B 3G71T 4QQ6A 4PJOD 3JRZA 2YHTA 3VUZA 5D6WA 1C0AA 1P92A 2Y4YA 1Q81U 5GAN2 2K5FA 4DQ2A 4A54A 4YCWA 4IUPA 5GAOp 3LX7A 4M78C 4M75G 3JCMg 5FLXE 2X4YA 4B9WA 3CCEA 3VQVA 4IUVA 2E6NA 1SESA 1WPYA 4BB7A 4L59A 3LW5E 5A0LA 3AHUA 3GF5A 3OYFA 2JTFA 1QW1A 4UP7A 4H2VA 2R5MA 4B9XA 2P0QA 4C92D 4IURA 3L2RA 1EOVA 3CC7T 3L42A 3IKLA 4P71C 4EO4A 4BY6C 3LSQA 5E3IA 1KHIA 2VYTA 3JCMQ 1D3BB 4P73C 4EX5A 3VYGA 2A7YA 3G4ST 1VQ4A 2I4MA 3A8MB 3EFRA 5FROA 5DLOA 3HRTA 2C06A 4IUTA 3RF1A 4C92C 2QXFA 4M78G 5CIUA 4E47A 1NJ5A 2O4XA 4R56A 5HK3A 2QA4A 4E7HA 3CCQT 3KBGA 3TEEA 2XKOC 4UP8A 5LJ5g 3G4SA 5FU7B 1G3WA 1VQ4T 1VQOT 1L0WA 2KMTA 1VQNA 3C12A 1NJ6A 2QHVA 5CR2A 2ODRC 3KFUA 2WSFE 2HBPA 4JRKA 1ASZA 3GNFB 1XNIA 1Y96A 3GIBA 4WJ3M 3UT1A 1PSEA 3BFMA 1VQ8T 4EMHA 1WYDA 4FT4A 4M7DA 2CJ9A 5GAMg 5LJ5e 2HQEA 4M7AC 5A2QE 4C8QF 2LTOA 1FX7A 3UH0A 2ZR3A 3SFMA 2I4LA 3A5YA 3A8LB 3M4PA 2RHXA 4KT0E 2CZ0B 3NTIA 1VQ7A 3FEOA 3V8KA 4MZMA 3RL6A 1NYRA 2RM4A 3QZ5B 5IN1A 2Y90A 1W2BA 5F5WA 2KAFA 2X4XA 3R6OA 2LT1A 3TCJA 3CXCA 3R07A 3WVEB 3CMAA 3VBBA 4Z02A 4M78B 1QE0A 3FLGA 4YRTA 4C0GA 5GANg 2VGNA 3FRNA 4TQDA 1H4QA 2ALYB 3VQWA 4BWAA 2K5IA 4XAXB 2ZIMA 4HVCA 2LVMA 3SD4A 1EVKA 3MP6A 1H3ZA 1N9RA 1UGQB 4PJOA 5LL6S 3FIFA 3QJ6A 4C5EA 3QBYA 3M56A 2LCCA 2V8KA 1KQ1A 1M1KC 2DEQA 4BW9A 1I5LA 4YRRA 4K86A 3M55A 4HWOA 1SSFA 4CS4A 5LJ5j 1HK9A 4ZN1A 4YTLA 2GF7A 3OYBA 3TU4K 4YREA 4C5IA 4OB3B 2DXCA 4M75B 4RQEA 4JLIA 4M75F 2CZ7B 3TEGA 1B34B 4LVMA 1LYLA 2AMCA 2IY5B 1XOVA 3ER0A 2DZ9A 2DQ3A 5LJ3e 1PSFA 1U1TA 3RKXA 4NL3A 3W3SA 1M5Q1 4HA8A 3CC2A 4J6XA 2HAXA 2LC4A 3GP8A 4M77A 2K3XA 3MP1A 2L8DA 1VQ6T 1IZ6A 1YI2T 4A53A 4KULA 3SWNA 2XD0A 2E65A 2DK3A 2EAYA 3CC4T 5KNNA 3META 1V29B 1G3SA 4XTVA 4QQGA 1UGRB 3MEVA 4J7IA 4HCBA 3OBWA 4F7UE 2LX9A 4N4IA 4C8QE 1UGPB 3HFOA 5C51B 3LGLA 4GLKA 3PCOB 1QVFA 1X54A 1M4ZA 2XIDA 1VQMT 2P5IA 1EQRA 1X2GA 1OZ3A 2V8IA 4BACA 1BKBA 4DOWA 3PNWC 3LH0A 4YDQA 3RMQA 2AHJB 2KY9A 5IAYA 4P73A 1YCYA 5GAMh 4KQEA 2CJBA 2PUOB 3E9HA 4F7UB 3LC0A 3I55A 1E24A 2XDBA 3OQ5A 4L87A 3OYHA 4E7KA 3M4QA 4C5GA 4YPFA 3ERRA 1W2BS 2JN0A 5KE3A 2QHTA 4YRCA 2RI2A 3CBMA 2MI6A 4RDXA 1R8OB 3EAEA 1U1SA 2BUDA 2CJAA 3VQXA 3M5AA 3P8HA 2DQ0A 1RI0A 4HT9A 2OTLA 2RHZA 1G3YA 4YROA 3V7CA 2Y4XA 3CCVT 1KMNA 2RJDA 4JLGA 1BI1A 4M78D 2R5AA 4M77D 3CCST 2OAUA 1USYC 4Y91A 4LD6A 4KR2A 2RJEA 3OYGA 1YFSA 2QEXA 2JNGA 3LLRA 3QNEA 5FU6B 4CRIA 2AMCB 3LWIA 3REXA 4WJ4A 4E7JA 3JCMd 3MEUA 4QQDA 4MMLA 3X20B 5GMKj 3QYHB 1WNLA 3RKYA 4HWPA 3L2ZA 2D0QB 2RJCA 3QHSA 3BDLA 2ODRD 5GANd 4ZGDB 4N4GA 2ZPHB 3HRIA 4TVAA 1NYQA 3VKIA 1YGBA 3OYKA 1WQ7A 3F70A 4N0AA 2RHQB 4CH4A 4M75D 2DTIA 2KK4A 4LD9K 4MZTA 5DY9A 1OI1A 1XQHA 4A4HA 1Q7YC 2CKKA 3CD6T 3IKMB 1D3BA 3HXWA 4PHCA 1JJCA 4EDUA 1QF6A 2EQKA 1ZHIA 3QIIA 3ZFJA 1KD1C 5LJ3h 2EJ9A 2XDPA 4OGCA 4M77B 3X25B 1BBUA 1JB0E 1VQNT 2C8MA 5DLQE 3JCMJ 2EL9A 1QP2A 5KCOA 2ARTA 4LVKA 2YLCA 2EQJA 3DLMA 1VUBA 2HNIA 4VUBA 3QO8A 3HPWA 1VQLT 1YFTA 4RMOA 2L3RA 1B7YA 3OSVA 2R57A 4P75A 2RHYA 3A74A 1YB3A 1K73U 2FL7A 3SDZA 1YJNA 3QO7A 2ZPGB 2VXEA 4J83A 2CS7A 1FWZA 4J7FA 4PJOF 3OYLA 2B8AA 3P8BB 3HFZB 4N0AC 1VQ7T 4P71A 2E12A 4LVIA 3ME9A 3I55T 2F5TX 4RG8A 3WQZA 5GMKi 5HGQA 2JZ2A 1H4SA 4JRPA 1OYXA 1Q82C 3M4GA 4P3NA 4EMKB 2WSCE 2RHSB 1RL2A 4MDWA 2LQKA 3OMGA 3OSSC 4J15A 1JJ2A 1BIAA 1K8AC 4PJOG 1N9WA 3GOXA 2ZPIB 3WVDB 4OB0B 2I4NA 3A5ZB 4PJOE 1VQKA 2J3MA 2VV5A 2MWOA 1I4K1 2LRQA 3V7RA 4YCUA 4XU0A 4RG2A 2KQWA 3J80E 3A8GB 5CQYA 4XTYA 2ARUA 4L6V5 2Q7HA 1USYA 4QW2A 2DXTA 3CCUA 1IL2A 3LYIA 5GAN6 4JUVA 4TTVA 4XU1A 1B34A 1EVLA 4HKEA 2ZPEB 3CCQA 3HRUA 4PNOA 2I4OA 3FJPA 2DTHA 2VC8A 4O5VA 1VQPT 2OTJA 1W66A 1VQOA 3E19A 5GAN4 1NPPA 4XEOA 1SERA 3I56T 4X9DA 4BDYA 2E3CA 5D6XA 4YYEA 4P72C 2EJGA 1S72A 1Q86U 2HD0A 4XTZA 2NS6A 2JUFA 3CCRT 4IUQA 2ZZGA 4R55A 5CO7A 2QHUA 1LOJA 3CPWA 4EMKA 2XGTA 5HY6A 3L1AA 2ZT8A 3GNGA 2ZIOA 4P5NA 3CMET 5CQXA 3V8LA 4II1A 4C92G 2PQWA 3JCMX 3BJUA 4A4KA 4LDXA 3S3NA 2L5QA 2EQMA 3QDRB 1ATIA 3MQZA 1NE8A 4LDVA 4HT4A 4M7AA 3TREA 4M77C 5HK0A 2PU9B 4A4EA 5C52B 5ELOA 2VUBA 3CCRA 2IG0A 3H6ZA 2P0LA 4OMFB 2MWPA 4ME7A 3RMSA 3JB9I 2GFUA 2A8EA 4XEMA 1H641 3JCMh 4ZGJB 4JRIA 4A4FA 5FRMA 2QTXA 3P8DA 3IALA 3OD1A 4UP9A 3G1ZA 3SWNB 5KH6A 1G5IA 4NOYA 4MZPA 3DB4A 1BYMA 4ELYC 2CGHA 4HT8A 4TWAA 4C8QB 1N8RC 2E1HA 4QVZA 3TEHB 4WI1A 3FB9A 1WGSA 2DXUA 2FYKA 2J3LA 1X56A 3A5ZA 1YIJA 3HSBA 3QSUA 3JB9D 4XTWA 1WQWA 4NS5A 2CYZB 4ZN3A 4E7LA 2DZCA 3M4YA 4HCZA 3QPHA 4OB1B 4BI4A 1FXXA 3UGQA 4M75C 3VJPA 1LJOA 1Y07A 2R58A 1W4SA 4O2DA 2ZINA 1G5VA 3P8TA 4M7AD 4YCVA 3PMIA 4F7UA 3L4GA 1E1TA 3A7UA 4XQ3A 3OS2A 1MGQA 3G7ZA 1NNHA 2PMEA 4WF2A 3SWNC 2V8JA 3HFZA 3S6WA 2P0PA 1QP3A 2CZ6B 3UGTA 3HHTB 1S72T 3NENA 2MF2A 3JAME 4M78A 4J5YA 4FL6A 4XU3A 1N27A 3BY7A 4DOVA 1VQ9T 1KC8C 2YRVA 2ZT5A 1RIQA 3L2VA 4ZTUB 5GAMj 4CS2A 1NJ1A 3T9NA 3OS0A 2DD4A 2L89A 1EIYB 4FT2A 2DO3A 2JVVA 3CCMA 3A8OB 1BI2A 5GAMe 3QKJA 2XU8A 4YRQA 3J81E 2EQUA 5LJ3j 3HKSA 1LNXA 3HRSA 3RKWA 1B8AA 4LNSA 3M59A 3UWNA 2RHIA 2YLBA 3QJYA 3FC3A 1VQ5T 5J26A 2M1HA 4YRFA 2M9UA 4C8QC 2HQXA 1VIFA 2EFIA 1M1GA 3BDUA 3M58A 5ELNA 2K4YA 4JS5A 4M75A 3OYEA 3OYJA 2DPPB 2E70A 3CXCS 1YITT 3CC4A 1K9MC 1QVFS 3PT9A 4OVAA 4M77E 4AH6A 1VQ5A 1DJ7B 1WU7A 4YRIA 2EWNA 4E51A 1KD1U 1WJRA 4EMGA 3I56A 4BI8B 3OW2S 3GPLA 4M7DF 4YRKA 2PVGB 3VQYA 2JOYA 2QQBA 5CVIA 2PVDB 4OF1A 5CKEA 4BY6B 4YRPA 3E9FA 3VUBA 2AKWA 2DIQA 1YFRA 1EIFA 3OA6A 1UGSB 1ASYA 5C0MA 5GAN7 2LT4A 3JCMV 4ZTFA 3CCMT 5GANf 3NELA 2Q7EA 5DM7R 4J6YA 3M54A 4LVLA 1B70A 4PG3A 3CCLA 4JRQA 3V7SA 2ZT6A 2E64A 4FIBA 2GQVA 4C92B 1Z7MA 1H4TA 2DXBA 4M7AB 3RGLA 2RHSA 5HKCA 1VQ8A 4PJOC 2LDMA 1NJIC 4XTUA 2ZT7A 2ZCFB 2FB7A 4RCBA 1X55A 3M57A 2RD1A 4EPCA 1KG1A 5LJ5f 1JJ2S 3HFVA 4UPAA 4C92E 3C4SA 2VGMA 5CKDA 2DU5A 1KQSS 4PLLA 1G51A 3JCMW 4M7DE 1KHCA 3HXXA 3LWHA 4C92A 1IREB 1BIBA 3OYAA 3KUFA 4Q5WA 2O4XB 1N9SA 2ZPFB 1HTTA 3JCMe 3PTAA 5LJ5h 1PYSA 3E1SA 4L5GA 3HFNA 5AYFA 5LJ5d 1NJ8A 2ZNJA 3CD6A 1X2HA 3CCUT 1B7YB 1ADYA 4X5OA 1BI0A 3REUA 4C8QG 1TH7A 4P75C 2D9TA 1E1OA 4LDUA 2O01E 5K1XA 1O75A 3OYMA 1NPRA 3OYCA 3A31A 2BIVA 2NLUA 3MF1A 4M78E 1Q7YU 4YRNA 2GCXA 5GAN3 4P74A 3ICAA 3RESA 1E22A 4FSXA 2X35A 4O6JA 5GAOr 4LDYA 4CH3A 4XK8E 3CBOA 5GAOn 3CCSA 4H2WA 1PYSB 2FHDA 1I8FA 2ZZEA 1M1FA 3VV0A 2QQAA 2XI9A 5GAN8 3HXYA 3LGFA 2RHQA 3C95A 2XTIA 3C94A 1B76A 3DLLA 4DPGA 5M9OA 2DD5A 4TVAB 3NEMA 2Q5HA 2RK2A 5I2MA 1ZBXA 1KQSA 4FU6A 5CK9A 4M78F 1M8VA 4BD3A 5GANh 4N4HA 1SRYA 1O9SA 2G4CA 1Q86C 2H3JA 4M75E 4P74C 4YRGA 4CH5A 1YJWT 2I2LA 2LNVA 4BDZA 1MHNA 4NCXA 4BI3A 3RUXA 3NTKA 3INZA 2DJZA 3G6EA 5CKFA 2OTLT 2PMFA 2X4JA 3VYHB 2Q7GA 3O8VA 1KOGA 3PGGA 4F7UG 3UDCA 2DTOA 3MEYA 3OYYA 4C92F 2ZNIA 3PIOA 4G85A 2QQ9A 4H02A 1KC8U 4Q6GA 3OMCA 1AHJB 1B70B 1XTDA 1X75C 2EJFA 4EMKC 1QVGA 3JB9G 3RERA 2DKGA 3PZCA 5LJ3d 5A0DA 2ARSA 1KMMA 2VXFA 1X01A 2A3LA 5LJ3g 5FU7C 4C0ZA 1K9MU 1Y96B 3NETA 2E41A 3OY9A 4M7DB 1X6OA 2E5AA 5KCHA 3NTHA 2ZR2A 2QI2A 5GANj 2RA2A 4UC4A 5C6SA 4D6WA 1GGMA 2XHCA 3A32A 3M9QA 5CAIA 4ZTJA 4V2SA 3FDRA 4TVYA 1VQMA 4GY5A 2KDSA 4YRSA 5GMKh 4K87A 4C5HA 3ZBDA 2KSSA 2EKOA 3PCOA 5GAN5 3M53A 4IUUA 1WJSA 3OS5A 4Y28E 3H8ZA 3OS1A 5GMKe 11ASA 3CC2T 1SETA 2K2VA 2KVQG 2QEXT 1YJ9T 3JB9J 4P72A 4H2XA 3KXTA 4C0DC 4E7IA 3JB9F 3MP8A 1K8AU 2RJFA 1U8RA 4X34A 3TEHA 2ZGWA 5FRNA 5FU6C 1HXDA 2RI5A 1VIEA 3JCMc 5IT9E 1YBYA 3J7AF 2E5QA 2XK0A 3CCVA 1Q82U 4M7DC 3QZ9B 5GAMf 4TQFA 3QYGB 4F7UF 2MMPA 4PL6A 2CZ1B 4PLIA 1WLEA 1VQPA 1WJQA 3UFGA 3HL8A 4C8QD 1NJIU 3OYDA 1FYFA 4ZTZB 1M1KU 2EIFA 1EIYA 3L2QA 5I21A 3A7RA 3MF2A 4HCCA 4RCCA 2EYQA 3OYIA 3CCJT 4KUDK 3ASKA 3HTZA 2QDYB 3X24B 3SB2A 4KUIA 2GFAA 1M9SA 2DVEA 2PVOB 4NL2A 2ZZDA 1KQ2A 1Y7XA 2K5LA 3A8HB 2P4TA 2BKDN 3I7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YRP A;  1ASZ A;  3HFZ B;  4N0A C;  1G5H A;  1Y96 A;  4P71 A;  3GIB A;  4WJ3 M;  4H2U A;  2AKW A;  3BFM A;  3HXV A;  2QHS A;  3WQZ A;  4EMH A;  5GMK i;  1WYD A;  5HGQ A;  1YFR A;  1H4S A;  1JJC B;  2K57 A;  4M7D A;  3TUP A;  3M4G A;  2CJ9 A;  4P3N A;  4EMK B;  2RHS B;  5GAM g;  1H4V B;  1ASY A;  5LJ5 e;  1ADJ A;  4M7A F;  3P8Y A;  4M7A C;  5GAN 7;  4C8Q F;  4J15 A;  3UH0 A;  3JCM V;  2ZR3 A;  2I4L A;  1BIA A;  3HY1 A;  3A5Y A;  5GAN f;  3NEL A;  4PJO G;  3M4P A;  5K1P A;  1N9W A;  2Q7E A;  4J6Y A;  1B70 A;  3V8K A;  4PG3 A;  2I4N A;  3RL6 A;  3V7S A;  2ZT6 A;  2E64 A;  4PJO E;  1NYR A;  4H2T A;  2RM4 A;  4C92 B;  2Y90 A;  5F5W A;  2J3M A;  1Z7M A;  1H4T A;  4CH6 A;  4M7A B;  3RIR A;  3R07 A;  4J6W A;  1I4K 1;  3RGL A;  3VBB A;  4M7D D;  4M78 B;  2RHS A;  1QE0 A;  3V7R A;  4YCU A;  4YRT A;  5GAN g;  4XU0 A;  3JCM P;  4PJO C;  4TQD A;  1H4Q A;  2ALY B;  3VQW A;  4XTU A;  4XTY A;  4BWA A;  2ZT7 A;  2ARU A;  4M7A G;  4K88 A;  2FB7 A;  4RCB A;  2Q7H A;  1X55 A;  1USY A;  2ZIM A;  2RD1 A;  2DXT A;  1JRI A;  4HVC A;  1EVK A;  5LJ5 f;  1IL2 A;  5GAN 6;  3HFV A;  4UPA A;  4JUV A;  4TTV A;  4C92 E;  2IY5 A;  3QUI A;  2ZXF A;  4XU1 A;  4X9C A;  1N9R A;  2DU5 A;  1B34 A;  4PJO A;  4M7A E;  5GAN e;  1NJ2 A;  1G51 A;  1EVL A;  1VQZ A;  3FIF A;  3JCM W;  4M7D E;  5GAO q;  3HXX A;  1KQ1 A;  4PNO A;  2DEQ A;  2I4O A;  3FJP A;  3DSQ A;  4C92 A;  2DTH A;  2VC8 A;  4KR3 A;  4BW9 A;  3QO5 A;  1BIB A;  2RB6 A;  1W66 A;  4P3P A;  1I5L A;  5GAN 4;  4XEO A;  4YRR A;  1SER A;  1N9S A;  4M7D G;  4K86 A;  1HTT A;  3JCM e;  4HWO A;  4X9D A;  5LJ5 h;  1J5W A;  2E3C A;  1PYS A;  4YYE A;  4P72 C;  2EJG A;  4CS4 A;  1EFW A;  5LJ5 j;  4XTZ A;  1HK9 A;  4G84 A;  3HFN A;  5LJ5 d;  1NJ8 A;  3CMQ A;  2ZNJ A;  2ZZG A;  4XTX A;  1X2H A;  2QHU A;  1LOJ A;  4YRE A;  1B7Y B;  1ADY A;  4X5O A;  2DDZ A;  4HWS A;  3REU A;  4M75 B;  5GAO l;  4C8Q G;  4EMK A;  4RQE A;  1TH7 A;  4JLI A;  1BBW A;  4M75 F;  2XGT A;  3TEG A;  1B34 B;  3L1A A;  4PJO B;  4P75 C;  1E1O A;  1LYL A;  3JCM b;  2AMC A;  2ZT8 A;  2IY5 B;  4P3O A;  5K1X A;  3A31 A;  2DZ9 A;  2ZIO A;  12AS A;  3V8L A;  5GMK m;  3MF1 A;  2DQ3 A;  2CIM A;  4M78 E;  5LJ3 e;  4C92 G;  3A7A A;  3JB9 H;  2C7I A;  4YRN A;  3JCM X;  2ALY A;  5GAN 3;  1U1T A;  3RKX A;  4NL3 A;  3ICA A;  4H2X B;  1M5Q 1;  4HA8 A;  4QVD A;  4P74 A;  3W3S A;  3BJU A;  4J6X A;  3RES A;  3HXU A;  1E22 A;  3QTC A;  1ATI A;  5GAO r;  2DU7 A;  4M77 A;  3JCM f;  4CH3 A;  3E9I A;  4M7A A;  4M77 C;  5GAO n;  4A53 A;  4ZIB A;  2Q5I A;  3SWN A;  5C52 B;  2E65 A;  5ELO A;  3HY0 A;  4H2W A;  2EAY A;  5KNN A;  1PYS B;  1I8F A;  2P0L A;  4Q15 A;  2ZZE A;  4YP0 A;  5GAN 8;  3JB9 I;  3HXY A;  4TVW A;  2RHQ A;  4XTV A;  4YRM A;  2ZTG A;  2XTI A;  1JBM A;  3RAC A;  1B76 A;  4XEM A;  1H64 1;  3JCM h;  4F7U E;  4DPG A;  4JRI A;  4TVA B;  4C8Q E;  3NEM A;  1Z7N A;  4XU2 A;  2Q5H A;  2QTX A;  3HFO A;  5C51 B;  4MMK A;  3IAL A;  3OD1 A;  4UP9 A;  3G1Z A;  3PCO B;  4M78 F;  1M8V A;  1X54 A;  3HXZ A;  3SWN B;  1EQR A;  1X2G A;  2P5I A;  4M77 F;  5GAN h;  1G5I A;  1SRY A;  2G4C A;  4NOY A;  4YDQ A;  2AKW B;  4M75 E;  4P74 C;  4YRG A;  4P73 A;  1YCY A;  5GAM h;  4KQE A;  2CGH A;  2CJB A;  4HT8 A;  4TWA A;  3E9H A;  3BW1 A;  4C8Q A;  4F7U B;  3LC0 A;  4CH5 A;  2I2L A;  4C8Q B;  4H2S A;  1E24 A;  4OP0 A;  3LSS A;  4L87 A;  4NCX A;  2E1H A;  3M4Q A;  4YPF A;  3RUX A;  3ERR A;  3TEH B;  4WI1 A;  3FB9 A;  4RMF A;  3INZ A;  2ZCE A;  2DJZ A;  2DXU A;  2JN0 A;  2FYK A;  2J3L A;  1X56 A;  3A5Z A;  2PMF A;  2QHT A;  3L4G B;  4YRC A;  2Q7G A;  4H2Y A;  3HSB A;  3QSU A;  1KOG A;  3PGG A;  4F7U G;  3MEY A;  2DTO A;  1I81 A;  4C92 F;  3JB9 D;  4OLF A;  4RDX A;  4RQF A;  4QVC A;  4XTW A;  3QO3 A;  4M77 G;  5GMK l;  1WQW A;  2ZNI A;  2DZC A;  4G85 A;  1U1S A;  4H02 A;  3V8J A;  2CJA A;  4Q6G A;  3VQX A;  5C53 B;  4YRL A;  3UGQ A;  1B70 B;  2DQ0 A;  3P8V A;  5GAO m;  2EJF A;  5LJ3 f;  4EMK C;  3IG2 A;  4HT9 A;  4M75 C;  3JB9 G;  1LJO A;  3RER A;  4O2D A;  2DKG A;  4YRJ A;  4YRO A;  3V7C A;  1HC7 A;  3PZC A;  1KMN A;  5LJ3 d;  4HWR A;  2ARS A;  2E10 A;  1KMM A;  4M78 D;  2VXF A;  2ZIN A;  2ZZF A;  1X01 A;  4M77 D;  3P8T A;  3HRK A;  5LJ3 g;  4M7A D;  1Y96 B;  3NET A;  3VU3 C;  2E41 A;  4YCV A;  5GAM d;  4M7D B;  1USY C;  4F7U A;  3L4G A;  2E5A A;  1E1T A;  4CS3 A;  2ZR2 A;  3A7U A;  4XQ3 A;  5GAN j;  1MGQ A;  4Y91 A;  1NNH A;  2PME A;  4KR2 A;  1YFS A;  2RA2 A;  4WF2 A;  3QNE A;  4HWT A;  1GGM A;  3SWN C;  2AMC B;  3HFZ A;  3A32 A;  3REX A;  5CAI A;  4WJ4 A;  3UGT A;  3JCM d;  3NEN A;  4V2S A;  4M78 A;  4J5Y A;  4MML A;  4TVY A;  4XU3 A;  3EFS A;  3BY7 A;  5GMK j;  2ZT5 A;  4YRS A;  1RIQ A;  5GMK h;  1WNL A;  3RKY A;  4PJO D;  4K87 A;  2YHT A;  4HWP A;  3L2Z A;  4ZTU B;  1C0A A;  3QHS A;  5GAM j;  4CS2 A;  1NJ1 A;  5GAN 2;  1EIY B;  4DQ2 A;  3PCO A;  4A54 A;  5GAN d;  2ODR D;  5GAN 5;  4YCW A;  5GAO p;  3HRI A;  4M78 C;  4M75 G;  3JCM g;  4TVA A;  5GAM e;  1NYQ A;  4YRQ A;  3VQV A;  1YGB A;  1SES A;  1WQ7 A;  1WPY A;  5LJ3 j;  1LNX A;  4N0A A;  3RKW A;  1B8A A;  2RHQ B;  4LNS A;  5GMK e;  4CH4 A;  11AS A;  4M75 D;  2DTI A;  3AHU A;  1SET A;  5DY9 A;  2YLB A;  3IKM B;  1D3B A;  3HXW A;  4PHC A;  1JJC A;  4UP7 A;  1QF6 A;  4H2V A;  4YRF A;  3JB9 J;  4P72 A;  4H2X A;  4C92 D;  3JB9 F;  5LJ3 h;  1EOV A;  4C8Q C;  3TEH A;  2EJ9 A;  2ZGW A;  3IKL A;  4P71 C;  4M77 B;  4EO4 A;  1BBU A;  1HXD A;  3LSQ A;  3BDU A;  3JCM c;  5E3I A;  2C8M A;  3JCM J;  3JCM Q;  2EL9 A;  1D3B B;  4P73 C;  5ELN A;  4M75 A;  2ART A;  4EX5 A;  4M7D C;  5GAM f;  4TQF A;  4F7U F;  2I4M A;  3EFR A;  2YLC A;  2HNI A;  3QO8 A;  1WLE A;  3RF1 A;  4C92 C;  4M77 E;  3UFG A;  1YFT A;  4C8Q D;  1FYF A;  4AH6 A;  4M78 G;  1B7Y A;  4ZTZ B;  1NJ5 A;  1EIY A;  5I21 A;  3A7R A;  4P75 A;  3MF2 A;  4RCC A;  1WU7 A;  4YRI A;  2EWN A;  5LJ5 g;  4UP8 A;  3HTZ A;  4E51 A;  3SB2 A;  3A74 A;  1YB3 A;  1L0W A;  2DVE A;  3QO7 A;  4EMG A;  2VXE A;  1NJ6 A;  4M7D F;  4NL2 A;  4YRK A;  1KQ2 A;  2QHV A;  3VQY A;  2ODR C;  3KFU A;  4PJO F;  3I7F A;  4JRK A; 
#chains in the Genus database with same CATH topology
 1M3C A;  1WIE A;  1VQN Q;  1G5H A;  2NUP A;  5CKB A;  2AZV A;  4H2U A;  1YJW A;  5J39 A;  2GNC A;  1B7T A;  3HXV A;  2KNB B;  2QHS A;  1SPK A;  1FMW A;  4BE0 A;  1JJC B;  2K57 A;  5I2S A;  2KXD A;  4BE2 A;  3TUP A;  3G6E T;  2RQR A;  1YN8 A;  2LMJ A;  3CEY A;  2YXY A;  1H4V B;  4KH1 B;  5A0G A;  1C0M A;  4OB2 B;  1ADJ A;  4M7A F;  3DKM A;  3P8Y A;  1M8M A;  2WAC A;  3HTR A;  1GFD A;  4LVJ A;  1X43 A;  3Q1J A;  4PFP A;  3HY1 A;  3MEA A;  2CT4 A;  1YI2 A;  2IVW A;  2D6F A;  4MDX A;  1VQ8 Q;  1UEB A;  4OGE A;  5K1P A;  3I9Q A;  2X3W D;  1AWW A;  3M0Q A;  2RO0 A;  3DB3 A;  2OTJ T;  1OX9 A;  3URG A;  4FM4 B;  1M30 A;  2M16 A;  4H2T A;  2LQ8 A;  2G3R A;  1UB4 A;  3CCR Q;  4A4G A;  4CH6 A;  3RIR A;  4J6W A;  1AOJ A;  4ZGE B;  4J9G A;  4J9H A;  3NFC A;  4OML A;  4M7D D;  1FYN A;  3M0R A;  3JCM P;  1N6A A;  2MAM A;  2M0O A;  3GBQ A;  4K88 A;  4M7A G;  3S3O A;  3EG9 B;  1JRI A;  2Z0W A;  1K0S A;  5L8R E;  4M4Z A;  2RK1 A;  2IY5 A;  3S3M A;  3QUI A;  2ZXF A;  4X9C A;  4M7A E;  2A28 A;  5J3B A;  5GAN e;  4BE1 A;  1NJ2 A;  3NMZ C;  3WXM B;  2ZPB B;  1VQZ A;  3MJX A;  2WSE E;  5GAO q;  3ZEH A;  2PUK B;  3DSQ A;  1VYV A;  4DBH A;  4JJN K;  4KR3 A;  3QO5 A;  2RB6 A;  4P3P A;  1GXI E;  2ED0 A;  1PWT A;  1VQK T;  4M7D G;  4LDW A;  1J5W A;  4ATO A;  4JDS A;  1EFW A;  4G84 A;  3X28 B;  3CMQ A;  2AT1 B;  2F69 A;  1GBQ A;  3MEW A;  1YJN T;  4XTX A;  4J8O A;  1YIJ T;  4HVV A;  3L2U A;  2L3S A;  2DDZ A;  3QG1 A;  4HWS A;  5GAO l;  1ZA2 B;  1ZQ1 A;  1BBW A;  2CDT A;  3QDF A;  4PJO B;  2C0I A;  2DIG A;  3JCM b;  1G3T A;  1VQ4 Q;  4P3O A;  3UPU A;  2DAQ A;  2F5K A;  2E6Z A;  2RHU A;  1YJ9 A;  3CCE T;  3MCA B;  3MHX A;  12AS A;  5GMK m;  5D6Y A;  2CIM A;  4J9E A;  1OQK A;  1K0X A;  3A7A A;  2X4W A;  2RQV A;  3JB9 H;  2C7I A;  1VQL A;  2DE0 X;  4TVR A;  2ALY A;  2PNI A;  4H2X B;  4QVD A;  4CI0 C;  1BU1 A;  3HXU A;  3VS4 A;  3CPW S;  3QTC A;  2DU7 A;  3JCM f;  2JTM A;  3E9I A;  3GLX A;  1Y0M A;  2FVU A;  2K3Y A;  2DER A;  1X6B A;  5CKH A;  4ZIB A;  1RAC B;  2O9S A;  2PTK A;  2Q5I A;  3OBY A;  3CC7 A;  3JSC A;  4JS4 A;  1N8R U;  3CME A;  3HY0 A;  4ELZ C;  3UA6 A;  3CBP A;  4Q15 A;  4YP0 A;  3CCL T;  1Y71 A;  2VAS A;  1QVG S;  4KBM B;  4TVW A;  2QAZ A;  4YRM A;  2AK5 A;  2ZTG A;  5KE2 A;  3E9G A;  2EYZ A;  1JBM A;  3RAC A;  1YIT A;  8AT1 B;  1YIJ Q;  1HD3 A;  1RAG B;  1YJN Q;  1Z7N A;  4XU2 A;  1NZ9 A;  4MMK A;  3CCJ A;  3HXZ A;  1VQ9 A;  4PKC C;  3N5B B;  3UAT A;  3G71 A;  4M77 F;  1H8K A;  1MMA A;  2EBP A;  3OB9 A;  1G83 A;  1E7O A;  5EG2 A;  1ZA1 B;  2AKW B;  3PIP A;  1M90 C;  2P0K A;  3BW1 A;  4C8Q A;  1D1A A;  4C0F A;  4H2S A;  2HDA A;  4OP0 A;  1QVP A;  3LSS A;  5KYY B;  2QQS A;  3H9N A;  1MNE A;  1PKT A;  1OOT A;  2JTE A;  4RTX A;  4RMF A;  1E6H A;  2ZCE A;  3BE3 A;  1OU8 A;  2EKH A;  3L2W A;  4JJD A;  2EPD A;  3L4G B;  4H2Y A;  1I07 A;  1I81 A;  3CPF A;  4OLF A;  4RQF A;  1D0Z A;  4QVC A;  1MV3 A;  3QO3 A;  4M77 G;  5GMK l;  2MIO A;  4AFQ C;  3OYN A;  2E4H A;  1MMG A;  3V8J A;  1K73 C;  3PMT A;  5C53 B;  4C0D B;  4YRL A;  1OZ2 A;  3PFS A;  4JZ4 A;  3P8V A;  2J05 A;  5GAO m;  5LJ3 f;  3IG2 A;  4AMC A;  4FW1 A;  1QKW A;  1PHT A;  4RTY A;  4YRJ A;  1HC7 A;  2LCL A;  2EYY A;  1VA7 A;  4BUG A;  3QWX X;  4HWR A;  2E10 A;  1YHQ A;  1T0H A;  4DA4 A;  4GBQ A;  2ZZF A;  1Q81 C;  3HRK A;  4IKF A;  1M90 U;  2NUP B;  3CCM Q;  3VU3 C;  3HP9 A;  5GAM d;  1K1Z A;  4E7S A;  4CS3 A;  4RKU E;  2XDD A;  2QA4 T;  1U3O A;  1VQ6 A;  2RI3 A;  2O9V A;  2RH2 A;  1KC8 R;  5CCA A;  3QXE B;  1WA7 A;  2L3Q A;  4HWT A;  2XG8 D;  3OW2 A;  3I5S A;  1BI3 A;  2QQR A;  3MO8 A;  1OU9 A;  3CMA T;  1YHQ T;  1NEB A;  4AFS C;  5GJW B;  2BE7 D;  2XIC A;  3EFS A;  1SHF A;  3X26 B;  3G71 T;  4QQ6 A;  4PJO D;  3JRZ A;  2AKK A;  2FPF A;  2YHT A;  5D6W A;  3VUZ A;  3VS1 A;  1C0A A;  1AD5 A;  1P92 A;  2Y4Y A;  1Q81 U;  5GAN 2;  2K5F A;  4DQ2 A;  3MKD A;  4A54 A;  4YCW A;  4IUP A;  5GAO p;  3LX7 A;  4M78 C;  4M75 G;  3MPU B;  3JCM g;  5FLX E;  2A08 A;  2X4Y A;  1BCO A;  1ZSZ C;  4B9W A;  2DL7 A;  3CCE A;  4IUV A;  2E6N A;  2OTJ Q;  4LUE A;  3VQV A;  1SES A;  2DYI A;  1RLP C;  2EVR A;  1WPY A;  2KT1 A;  1G8X A;  1MMD A;  4BB7 A;  3EGU A;  4L59 A;  3LW5 E;  5A0L A;  3AHU A;  3GF5 A;  1X2Q A;  3OYF A;  4RUG A;  1AZG B;  2H3E B;  1Z9Z A;  3CC7 Q;  2JTF A;  2SRC A;  2RPN A;  1PG5 B;  1QW1 A;  4UP7 A;  4H2V A;  2R5M A;  4B9X A;  2P0Q A;  4C92 D;  4IUR A;  3L2R A;  1EOV A;  3CC7 T;  3L42 A;  3IKL A;  4P71 C;  4EO4 A;  4BY6 C;  3JV3 A;  1Q86 R;  3LSQ A;  3CCL Q;  5E3I A;  1KHI A;  1RAF B;  2VYT A;  3JCM Q;  1D3B B;  2YRC A;  4RTW A;  4P73 C;  2RQW A;  1WXT A;  2J06 A;  1ZLM A;  4EX5 A;  3VYG A;  2A7Y A;  3G4S T;  1VQ4 A;  2I4M A;  1PNJ A;  3A8M B;  3EFR A;  5FRO A;  5DLO A;  5HCK A;  1VQP Q;  3HRT A;  2C06 A;  3PE0 A;  4IUT A;  3RF1 A;  4C92 C;  2QXF A;  4CC4 B;  4M78 G;  5CIU A;  4E47 A;  1IHV A;  1NJ5 A;  2O4X A;  4R56 A;  5HK3 A;  2QA4 A;  4E7H A;  1WYX A;  3CCQ T;  3KBG A;  3TEE A;  2XKO C;  1QMC A;  5LJ5 g;  4UP8 A;  3G4S A;  2LJ0 A;  1G3W A;  5FU7 B;  1VQ4 T;  1VQO T;  1L0W A;  2KMT A;  1SG5 A;  1VQN A;  2COZ A;  3C12 A;  2HL3 A;  3CCV Q;  1NJ6 A;  2LJ3 A;  1D09 B;  2HSP A;  2QHV A;  4ZNX A;  1LPL A;  3QWY A;  5CR2 A;  2ODR C;  3KFU A;  4HVU A;  2WSF E;  2HBP A;  2BTT A;  1Z9Q A;  5D7U A;  4JRK A;  1ASZ A;  3GNF B;  1XNI A;  1TOV A;  1Y96 A;  3GIB A;  4WJ3 M;  5FWB A;  4AG2 C;  4ORZ A;  3UT1 A;  1PSE A;  1PD1 A;  3BFM A;  1VQ8 T;  1YI2 Q;  4FSS A;  4EMH A;  1T3L A;  1WYD A;  2ESW A;  4FT4 A;  4M7D A;  1ACM B;  2CJ9 A;  1GCQ C;  5GAM g;  2QGG A;  4ESR A;  1WXU A;  3G71 Q;  5LJ5 e;  2HQE A;  4M7A C;  1M3A A;  5A2Q E;  4C8Q F;  2LTO A;  1VQ7 Q;  1FX7 A;  3UH0 A;  2ZR3 A;  2RN8 A;  3SFM A;  2I4L A;  3A5Y A;  3A8L B;  2F2X A;  3M4P A;  2QTV A;  2JS2 A;  1IO6 A;  2RHX A;  4KT0 E;  2CZ0 B;  2DIL A;  2ECZ A;  3NTI A;  1VQ7 A;  3FEO A;  3V8K A;  3AT1 B;  2KT8 A;  4MZM A;  3RL6 A;  2OI3 A;  1NYR A;  2LQN A;  2NWM A;  2RM4 A;  3QZ5 B;  5IN1 A;  2Y90 A;  1W2B A;  5F5W A;  3TVT A;  2KAF A;  2X4X A;  3H0I A;  3R6O A;  2LT1 A;  3TCJ A;  3CXC A;  3CMA A;  2FPD A;  3WVE B;  3R07 A;  3VBB A;  4CC3 A;  4Z02 A;  4KRT A;  4M78 B;  1RLQ C;  3EH2 A;  1QE0 A;  3FLG A;  4YRT A;  2ROL A;  4C0G A;  5GAN g;  2VGN A;  5L23 A;  1WHH A;  2AKL A;  3FRN A;  2FEI A;  4TQD A;  1H4Q A;  2ALY B;  3VQW A;  4BWA A;  4DBF A;  2K5I A;  4JJC A;  4XAX B;  2ZIM A;  1S72 Q;  2QK0 A;  4HVC A;  2LVM A;  1UFF A;  3SD4 A;  4F04 B;  1EVK A;  3MP6 A;  1H3Z A;  1OUL A;  1N9R A;  1UGQ B;  4PJO A;  2YUO A;  5LL6 S;  1TS9 A;  2L3P A;  2M0Y A;  2C0T A;  1YWP A;  1AVZ C;  3FIF A;  3QJ6 A;  2JMC A;  4C5E A;  3QBY A;  1K9M R;  3M56 A;  2LCC A;  2V8K A;  1KQ1 A;  1M1K C;  2DEQ A;  2FO0 A;  2D1X A;  1SKU B;  2NUZ A;  2LNH B;  4BW9 A;  2YSQ A;  1I5L A;  2CUD A;  4YRR A;  4K86 A;  3TQ7 P;  3M55 A;  4HWO A;  4J9B A;  1OEB A;  1SSF A;  4CS4 A;  1ZUY A;  5LJ5 j;  4J9D A;  1HK9 A;  4ZN1 A;  4K11 A;  4YTL A;  2GF7 A;  4Y92 A;  1IRX A;  3OYB A;  2DJQ A;  3RR6 A;  2FZK B;  3TU4 K;  4YRE A;  5IHN A;  4C5I A;  4OB3 B;  2DXC A;  4M75 B;  4RQE A;  4JLI A;  1UHF A;  4M75 F;  1KD1 R;  2CZ7 B;  3TEG A;  1B34 B;  4LVM A;  1LYL A;  2AMC A;  2IY5 B;  1XOV A;  3ER0 A;  2DZ9 A;  1KIK A;  2DQ3 A;  5LJ3 e;  1PSF A;  1U1T A;  2YUP A;  3RKX A;  4NL3 A;  3W3S A;  1M5Q 1;  1UHC A;  4HA8 A;  4LUD A;  3CC2 A;  4J6X A;  1EFN A;  1BB9 A;  2HAX A;  2LC4 A;  3GP8 A;  4M77 A;  1D1C A;  2K3X A;  3MP1 A;  4E7Z A;  2L8D A;  1PC0 A;  1VQ6 T;  2HL5 C;  1IZ6 A;  1YI2 T;  4KGX B;  4A53 A;  5IH2 A;  4KUL A;  3SWN A;  6AT1 B;  2XD0 A;  2E65 A;  2DK3 A;  2EAY A;  3CC4 T;  5KNN A;  2BZY A;  2V1R A;  3MET A;  4PK4 A;  1V29 B;  2CP5 A;  1D0X A;  1G3S A;  1YWO A;  1MMN A;  4XTV A;  4QQG A;  3CXC P;  3G6E Q;  1VQL Q;  1UGR B;  3MEV A;  5KYU A;  4JZ3 A;  4J7I A;  4HCB A;  3OBW A;  1RAI B;  4F7U E;  2LX9 A;  4N4I A;  4C8Q E;  1UGP B;  2QEX Q;  3EGX B;  1ZSZ B;  3HFO A;  5C51 B;  3LGL A;  4GLK A;  2ROT A;  3PCO B;  1Q95 G;  1VQ5 Q;  1QVF A;  1X54 A;  1M4Z A;  2XID A;  4LNP A;  1VQM T;  1EQR A;  1C1A A;  1OZ3 A;  1X2G A;  2P5I A;  2V8I A;  4BAC A;  1BKB A;  2ZAE A;  4DOW A;  3KFV A;  3LH0 A;  3PNW C;  4YDQ A;  3RMQ A;  1IB8 A;  2AHJ B;  2DL5 A;  2KY9 A;  3NPF A;  2O2O A;  5IAY A;  1ZUK A;  4P73 A;  1YCY A;  5GAM h;  1K76 A;  4KQE A;  2CJB A;  2PUO B;  3E9H A;  4F7U B;  3LC0 A;  3I55 A;  1E24 A;  2XDB A;  3OQ5 A;  4L87 A;  3OYH A;  4E7K A;  3M4Q A;  1ZSG A;  4C5G A;  4YPF A;  3ERR A;  4Z88 A;  1W2B S;  2BZ8 A;  3U23 A;  2JN0 A;  2DM1 A;  3EFO B;  2EGC A;  5KE3 A;  2VKN A;  2QHT A;  4YRC A;  5IHI A;  1I1J A;  1MUZ A;  2O88 A;  2RI2 A;  3CBM A;  2MI6 A;  1UJ0 A;  8ATC B;  4RDX A;  3CC4 Q;  1R8O B;  2DVJ A;  2OTL Q;  1M2V B;  2RMO A;  3EAE A;  1U1S A;  2BUD A;  1YHQ Q;  2CJA A;  3VQX A;  4RTT A;  3M5A A;  3P8H A;  2DQ0 A;  1RI0 A;  3SHW A;  2FRW A;  4HT9 A;  2OTL A;  2RHZ A;  1G3Y A;  2RF0 A;  4YRO A;  3V7C A;  2Y4X A;  4F17 A;  3CCV T;  1KMN A;  1R0C B;  2RJD A;  2X9H A;  4JLG A;  1BI1 A;  1X69 A;  2QG9 B;  4M78 D;  2R5A A;  4M77 D;  2EQI A;  3CCS T;  2OAU A;  1USY C;  2FZG B;  3M0T A;  2DL4 A;  4Y91 A;  4LD6 A;  4KR2 A;  1XJW B;  2RJE A;  3OYG A;  1YFS A;  2QEX A;  3H0H A;  2A0F B;  2JNG A;  3LLR A;  3QNE A;  5FU6 B;  3FJ5 A;  1JEG A;  3I55 Q;  1WDX A;  4CRI A;  2AMC B;  3LWI A;  4PJN A;  1PRM C;  3REX A;  4F14 A;  2YWW A;  4WJ4 A;  4E7J A;  3JCM d;  2EYX A;  3MEU A;  4QQD A;  4MML A;  1TUG B;  3X20 B;  2KXC A;  5GMK j;  1T0J A;  1X2K A;  3QYH B;  1WNL A;  3RKY A;  4PJM A;  4HWP A;  1RAE B;  2D0Q B;  3L2Z A;  2RJC A;  3QHS A;  3BDL A;  1VOM A;  4QKU A;  5GAN d;  2KRN A;  2HKN A;  4ZGD B;  4N4G A;  2ODR D;  2ZPH B;  3HRI A;  1YIT Q;  4TVA A;  3CME Q;  1NYQ A;  3VKI A;  1YGB A;  3OYK A;  1K9A A;  1WQ7 A;  2DX1 A;  3F70 A;  1D1B A;  3CD6 Q;  4Z8A A;  4N0A A;  2RHQ B;  4CH4 A;  1VQ9 Q;  1NLO C;  1JXM A;  4M75 D;  1X6G A;  2DTI A;  2KK4 A;  4LD9 K;  4FCY A;  4MZT A;  5DY9 A;  1OI1 A;  1XQH A;  2J6O A;  1GFC A;  4A4H A;  2CKK A;  1Q7Y C;  3CD6 T;  3IKM B;  1D3B A;  3HXW A;  4PHC A;  2M51 A;  1JJC A;  1TTH B;  4EDU A;  2LP5 A;  1QVG P;  1QF6 A;  2EQK A;  1ZHI A;  3QII A;  3ZFJ A;  1KD1 C;  5LJ3 h;  2DRK A;  2X51 A;  1YJ9 Q;  2EJ9 A;  2XDP A;  4OGC A;  4M77 B;  3X25 B;  1BBU A;  5KYY A;  1IGU A;  1JB0 E;  1VQN T;  2FRY A;  4OMO A;  2C8M A;  5DLQ E;  3JCM J;  3EH1 A;  2EL9 A;  2MYS A;  2AIR B;  1QP2 A;  5KCO A;  2ART A;  2FZC B;  2DF6 A;  1OPL A;  4LVK A;  2YLC A;  2EQJ A;  3DLM A;  1VUB A;  2HNI A;  4VUB A;  3QO8 A;  3HPW A;  1VQL T;  2JMA A;  2E5K A;  1YFT A;  4RMO A;  2L3R A;  2QA4 Q;  1B7Y A;  3OSV A;  2JT4 A;  2CSI A;  2R57 A;  2HSE B;  1UGV A;  1WHG A;  4P75 A;  4DEX A;  1NM7 A;  1X27 A;  2RHY A;  3A74 A;  1YB3 A;  1R0B G;  1K73 U;  2FL7 A;  3SDZ A;  2GTO A;  1YJN A;  3QO7 A;  1SF9 A;  2ZPG B;  2VXE A;  4ANJ A;  2W0Z A;  3RNJ A;  4J83 A;  2CS7 A;  1FWZ A;  1TU0 B;  2VVK A;  4J7F A;  4PJO F;  3OYL A;  2OAW A;  2B8A A;  3P8B B;  1VQO Q;  3HFZ B;  4N0A C;  1SHG A;  1VQ7 T;  1IGQ A;  4P71 A;  2E12 A;  4LVI A;  3ME9 A;  3I55 T;  2F5T X;  4FYV B;  2K7A A;  4RG8 A;  3WQZ A;  5GMK i;  2ED1 A;  5HGQ A;  2JZ2 A;  1H4S A;  2ENM A;  2KYM A;  1WFW A;  1OYX A;  2LQW A;  4JRP A;  1Q82 C;  4JJB A;  3M4G A;  4P3N A;  4EMK B;  2WSC E;  2RHS B;  1RL2 A;  4MDW A;  2LQK A;  2MOX A;  2PZ1 A;  3OMG A;  3OSS C;  4J15 A;  4E2F B;  1JJ2 A;  1BIA A;  1K8A C;  4PFZ A;  3VRY A;  1VQK Q;  4PJO G;  1N9W A;  2CT3 A;  2HBW A;  3GOX A;  2ZPI B;  3WVD B;  2CP3 A;  9ATC B;  4OB0 B;  2I4N A;  3I35 A;  3A5Z B;  4PJO E;  2KRS A;  1VQK A;  1LCK A;  1KFZ A;  1YJW Q;  2J3M A;  5I22 A;  2RQU A;  2IIM A;  3REA B;  2A36 A;  2VV5 A;  2MWO A;  1I4K 1;  1K4U S;  2LRQ A;  3V7R A;  4YCU A;  5ECA A;  1B3Q A;  4XU0 A;  2L2P A;  4RG2 A;  2KQW A;  3J80 E;  3A8G B;  5CQY A;  4XTY A;  2ARU A;  4L6V 5;  2Q7H A;  1USY A;  4QW2 A;  2DXT A;  3CCU A;  1IL2 A;  1HYO A;  3LYI A;  5GAN 6;  2GQI A;  4JUV A;  4TTV A;  3O5Z A;  2FG0 A;  4XU1 A;  1B34 A;  1W70 A;  1EVL A;  4KGV B;  1TG0 A;  2JJ9 A;  4HKE A;  2YUQ A;  2ZPE B;  2CP0 A;  3CCQ A;  3HRU A;  4PNO A;  2I4O A;  3FJP A;  2DTH A;  2VC8 A;  4O5V A;  1VQP T;  1VYU A;  2OTJ A;  1E6G A;  1W66 A;  1VQO A;  3E19 A;  5IHK A;  1M27 C;  5GAN 4;  1NPP A;  4XEO A;  1SER A;  2F1L A;  2DBK A;  3I56 T;  4X9D A;  4BDY A;  2E3C A;  3M0U A;  5D6X A;  2J6F A;  4YYE A;  4P72 C;  2EJG A;  1S72 A;  1Q86 U;  1JQQ A;  2HD0 A;  4XTZ A;  5EC7 A;  3NHN A;  2NS6 A;  1WZO A;  2JUF A;  3CCR T;  2QDL A;  4IUQ A;  2ZZG A;  1UDL A;  4D8D A;  4R55 A;  5CO7 A;  2QHU A;  1WHM A;  1LOJ A;  3CPW A;  4J9F A;  1JO8 A;  4EMK A;  2JXB A;  3PVL A;  2YRD A;  5HY6 A;  3L1A A;  2XGT A;  2ZT8 A;  2KYB A;  3GNG A;  2ZIO A;  4P5N A;  3E2U A;  3CME T;  5CQX A;  3V8L A;  1QQJ A;  4II1 A;  4C92 G;  2J7I A;  2PQW A;  3JCM X;  3BJU A;  1M90 R;  4A4K A;  2CUB A;  4LDX A;  3S3N A;  2L5Q A;  2EQM A;  3QDR B;  1ATI A;  3MQZ A;  1NE8 A;  4LDV A;  4HT4 A;  4M7A A;  2CSQ A;  5GJV B;  3TRE A;  4M77 C;  5HK0 A;  2PU9 B;  2DET A;  1WLP B;  4A4E A;  5C52 B;  5ELO A;  2V1Q A;  2DYB A;  2VUB A;  1VQM Q;  3CCR A;  3TSW A;  2IG0 A;  3H6Z A;  3I56 Q;  2P0L A;  2NYS A;  4OMF B;  2MWP A;  1C6V X;  4ME7 A;  3RMS A;  3JB9 I;  2OX7 A;  2GFU A;  1W6X A;  2A8E A;  4HCK A;  2YT6 A;  4XEM A;  1H64 1;  3JCM h;  5KYW A;  4ZGJ B;  4JRI A;  4A4F A;  2LZ6 B;  3EG0 A;  5FRM A;  2QTX A;  3P8D A;  1QCN A;  3IAL A;  3OD1 A;  4UP9 A;  3G1Z A;  3SWN B;  5KH6 A;  1G5I A;  2VB6 A;  4NOY A;  3OW2 P;  2YDL A;  4MZP A;  3DB4 A;  4PJL A;  1BYM A;  4ELY C;  4IIM A;  4OMP A;  1N5Z A;  5IXB A;  2CGH A;  4HT8 A;  4TWA A;  1ABO A;  2RNA A;  4C8Q B;  2LCS A;  1N8R C;  2I0N A;  2E1H A;  3CQT A;  4QVZ A;  3TEH B;  4WI1 A;  3FB9 A;  1WGS A;  2DXU A;  2FYK A;  2J3L A;  3PVQ A;  1NG2 A;  1X56 A;  3A5Z A;  2DNU A;  1YIJ A;  3HSB A;  3QSU A;  1NYF A;  1M2O A;  4RTU A;  3JB9 D;  2DLP A;  1Y57 A;  4XTW A;  1WQW A;  4NS5 A;  1RAD B;  2CYZ B;  2K9G A;  4PJJ A;  2DZC A;  4ZN3 A;  4E7L A;  4B6M A;  3M4Y A;  4HCZ A;  1M1K R;  3QPH A;  4OB1 B;  4BI4 A;  1FXX A;  3UGQ A;  2VWF A;  2KI7 A;  4M75 C;  3VJP A;  1LJO A;  2DBM A;  1Y07 A;  2R58 A;  1W4S A;  4O2D A;  3EFO A;  5I11 A;  1Q82 R;  1U5S A;  2ZIN A;  1G5V A;  3P8T A;  2DL8 A;  4M7A D;  1PM3 A;  1A0N B;  4YCV A;  3PMI A;  4F7U A;  3L4G A;  3EHQ A;  1E1T A;  3A7U A;  4XQ3 A;  3OS2 A;  1FMK A;  1MGQ A;  3G7Z A;  4JPB W;  1NNH A;  1GL5 A;  1S1N A;  2PME A;  1TSF A;  4WF2 A;  2ATC B;  2K2M A;  4AG1 C;  2CH4 A;  1KK7 A;  3SWN C;  1PCX A;  2V8J A;  1CKA A;  3HFZ A;  3S6W A;  2P0P A;  4A63 B;  1QP3 A;  2CZ6 B;  4EIK A;  3UGT A;  3HHT B;  1S72 T;  2BE9 B;  2MF2 A;  3JAM E;  3NEN A;  4M78 A;  4J5Y A;  4FL6 A;  4XU3 A;  1N27 A;  3BY7 A;  4DOV A;  1VQ9 T;  1KC8 C;  2YRV A;  2ZT5 A;  1N8R R;  2HCK A;  2LX7 A;  1RIQ A;  4FYX B;  3L2V A;  2EYW A;  5KYU B;  4ZTU B;  1QKX A;  5GAM j;  4CS2 A;  1NJ1 A;  3T9N A;  3OS0 A;  1OPK A;  2DD4 A;  2L89 A;  1EIY B;  4FT2 A;  2DO3 A;  1BK2 A;  2JVV A;  3CCM A;  3EHR A;  2DMO A;  1QCO A;  3A8O B;  1BI2 A;  1H92 A;  5GAM e;  3QKJ A;  5IXF A;  2XU8 A;  4YRQ A;  3J81 E;  1EX4 A;  2COY A;  2EQU A;  5LJ3 j;  3HKS A;  3NGP A;  1LNX A;  4QT7 A;  2RQT A;  3CCQ Q;  3HRS A;  3RKW A;  1B8A A;  1WHJ A;  4LNS A;  4E6R A;  3M59 A;  2P4R A;  1KQS P;  3UWN A;  2D8H A;  2RHI A;  2YLB A;  3QJY A;  3FC3 A;  1VQ5 T;  2JM9 A;  5J26 A;  2DRM A;  2M1H A;  4YRF A;  3UF4 A;  1KJW A;  1WX6 A;  1MND A;  2M9U A;  2ABL A;  4C8Q C;  2HQX A;  1VIF A;  1UG1 A;  2EFI A;  1M1G A;  2GBQ A;  4LN2 A;  3BDU A;  3EGD A;  1RUW A;  3M58 A;  5ELN A;  2K4Y A;  3VS0 A;  4JS5 A;  3CC2 Q;  4M75 A;  4FYY B;  1GRI A;  2HEQ A;  2K6D A;  3OYE A;  1NEG A;  3OYJ A;  1J3T A;  1Q81 R;  2DPP B;  2E70 A;  3CXC S;  1YIT T;  3A1P A;  3CC4 A;  3C0C A;  1K9M C;  1CSK A;  1QVF S;  2B86 A;  3PT9 A;  1KSW A;  3G1J A;  4OVA A;  4M77 E;  2MCN A;  2EW3 A;  3EGX A;  4AH6 A;  1Q7Y R;  5AT1 B;  1G2B A;  1W2B P;  1VQ5 A;  1DJ7 B;  1RI9 A;  1WU7 A;  1AWX A;  3M0S A;  4OMM A;  1SEM A;  4YRI A;  2EWN A;  2K3B A;  1SSH A;  4E51 A;  2KBT A;  1KD1 U;  1WJR A;  1RAH B;  1AEY A;  2MPX C;  3CPW P;  4EMG A;  3I56 A;  1OV3 A;  4BI8 B;  3OW2 S;  3GPL A;  4M7D F;  4YRK A;  1PKS A;  2PVG B;  2XMF A;  2C0O A;  3VQY A;  1GCQ A;  2JOY A;  3THK A;  2A37 A;  1UUE A;  4DBQ A;  2QQB A;  2LJ1 A;  2NUT B;  5CVI A;  2PVD B;  1WI7 A;  1ZBJ A;  4OF1 A;  5CKE A;  4BY6 B;  1WHK A;  4YRP A;  3E9F A;  3VUB A;  1PD0 A;  2AKW A;  2E3H A;  3ZL7 C;  2DIQ A;  1UJY A;  3TSZ A;  2HMA A;  1SRL A;  1YFR A;  5KYX B;  4OMQ A;  1EIF A;  3OA6 A;  1UGS B;  4AFZ C;  3D7S B;  1QLY A;  1ASY A;  5C0M A;  5GAN 7;  2LT4 A;  2D8J A;  3JCM V;  4ZTF A;  3CCM T;  5GAN f;  3NEL A;  2Q7E A;  5DM7 R;  4Z89 A;  4J6Y A;  3M54 A;  2COW A;  4LVL A;  1JXO A;  1B70 A;  1TXQ A;  3A98 A;  4PG3 A;  3CCL A;  1RAA B;  4JRQ A;  3V7S A;  2ZT6 A;  2E64 A;  4FIB A;  3CCU Q;  2GQV A;  4OMN A;  4C92 B;  1Z7M A;  1M2V A;  1H4T A;  2DXB A;  4M7A B;  3RGL A;  2RHS A;  2D0N A;  5HKC A;  1VQ8 A;  3I5R A;  4PJO C;  2LDM A;  2KRM A;  3M0P A;  3VS7 A;  1K73 R;  2GGR A;  1NJI C;  4XTU A;  2ZT7 A;  3ULR B;  2ZCF B;  2FB7 A;  4RCB A;  1K8A R;  1X55 A;  2H8H A;  2HKQ B;  2RD1 A;  3M57 A;  2X3X D;  4EPC A;  1KG1 A;  5LJ5 f;  1JJ2 S;  1TUC A;  1WXB A;  3HFV A;  4UPA A;  4C92 E;  3C4S A;  2VGM A;  1V76 A;  5CKD A;  2DU5 A;  1KQS S;  4PLL A;  3VS2 A;  1G51 A;  1TWB A;  3JCM W;  3G4S Q;  1YFN A;  4M7D E;  1KHC A;  3REB B;  4PFO A;  3HXX A;  2M02 A;  3LWH A;  4C92 A;  1IRE B;  1YCS B;  2OJ2 A;  1BIB A;  4CC2 A;  3OYA A;  2F2V A;  1W1F A;  3KUF A;  2K79 A;  3EG3 A;  4Q5W A;  2O4X B;  1N9S A;  2ZPF B;  4WCI A;  1HTT A;  3JCM e;  3CCE Q;  3PTA A;  1U06 A;  5LJ5 h;  2JW4 A;  1PYS A;  3E1S A;  3H0F A;  4L5G A;  2FPE A;  3HFN A;  5AYF A;  5LJ5 d;  1NJ8 A;  4WTO B;  3VS3 A;  1YNZ A;  3CD6 A;  2ZNJ A;  4HXJ A;  4D8K A;  1X2H A;  3CCU T;  3UA7 A;  1B7Y B;  1ADY A;  4X5O A;  1BI0 A;  4AT1 B;  3REU A;  4C8Q G;  1TH7 A;  2CH4 W;  7AT1 B;  4P75 C;  2D9T A;  1E1O A;  4LDU A;  2O01 E;  5K1X A;  1O75 A;  1UTI A;  2HZY A;  3OYM A;  1NPR A;  3OYC A;  3A31 A;  3IQL A;  4F16 A;  2BIV A;  2NLU A;  3MF1 A;  4M78 E;  2HQH A;  1Q7Y U;  4YRN A;  2GCX A;  4LXC A;  5GAN 3;  4P74 A;  3ICA A;  3RES A;  1E22 A;  4FSX A;  2L0A A;  2X35 A;  4O6J A;  1ZX6 A;  2KE9 A;  4LDY A;  5GAO r;  4CH3 A;  1R77 A;  2NUT A;  4XK8 E;  3CBO A;  2KGT A;  1I5O B;  5GAO n;  3CCS A;  4H2W A;  1PYS B;  2FHD A;  1I8F A;  2ZZE A;  1M1F A;  3VV0 A;  2QQA A;  2XI9 A;  5GAN 8;  3HXY A;  3LGF A;  2RHQ A;  5FWC A;  3C95 A;  2DFU A;  3VS5 A;  2XTI A;  3C94 A;  2E3I A;  4HVW A;  1B76 A;  3DLL A;  4DPG A;  5M9O A;  2DD5 A;  4TVA B;  4R0K A;  3NEM A;  2Q5H A;  2RK2 A;  5I2M A;  1ZBX A;  1KQS A;  4FU6 A;  1ARK A;  5CK9 A;  1HSQ A;  2F2W A;  1GBR A;  1B07 A;  4M78 F;  1M8V A;  3RDV A;  1BBZ A;  2AZS A;  3CCJ Q;  4BD3 A;  1NBE B;  5GAN h;  4N4H A;  1SRY A;  1O9S A;  2G4C A;  1SRM A;  3SEM A;  1Q86 C;  2H3J A;  4M75 E;  4P74 C;  4YRG A;  2J6K A;  2CP6 A;  2YUN A;  1ABQ A;  4CH5 A;  1YJW T;  2I2L A;  3EGD B;  3RBB B;  4J9C A;  2LNV A;  4BDZ A;  1MHN A;  4BI3 A;  4NCX A;  3RUX A;  4IIO A;  3NTK A;  2BZX A;  3INZ A;  1AWJ A;  1FMV A;  2DJZ A;  3G6E A;  1AT1 B;  5CKF A;  2OTL T;  2PMF A;  2X4J A;  3VYH B;  1I0C A;  2Q7G A;  3O8V A;  1KOG A;  3PGG A;  4F7U G;  3UDC A;  2DTO A;  3MEY A;  3OYY A;  4C92 F;  1QWE A;  2ZNI A;  3PIO A;  4G85 A;  2QQ9 A;  1AZE A;  4H02 A;  1KC8 U;  4RTZ A;  1ZUU A;  4Q6G A;  3OMC A;  1AHJ B;  3LH5 A;  2QYZ A;  1B70 B;  1XTD A;  1X75 C;  2EJF A;  4EMK C;  1GCP A;  1LVK A;  1MV0 B;  3EG1 A;  1QVG A;  1RAB B;  3JB9 G;  4KGZ B;  3RER A;  2JM8 A;  2DKG A;  1UE9 A;  3PZC A;  1QVF P;  5LJ3 d;  3CMA Q;  5A0D A;  2ARS A;  1KMM A;  2VXF A;  1X01 A;  2A3L A;  5LJ3 g;  5FU7 C;  4C0Z A;  1K9M U;  1Y96 B;  4KH0 B;  2MK5 A;  3NET A;  2E41 A;  5KYX A;  3OY9 A;  4M7D B;  1T3S A;  1X6O A;  2E5A A;  5KCH A;  3NTH A;  2ZR2 A;  2QI2 A;  1VYT A;  5GAN j;  3EG2 A;  1UEC A;  2DA9 A;  1WHL A;  2RA2 A;  3EG9 A;  4UC4 A;  5C6S A;  4D6W A;  2SEM A;  1GGM A;  2XHC A;  2P84 A;  3A32 A;  3M9Q A;  5CAI A;  2CRE A;  1JU5 C;  4ZTJ A;  1NJI R;  4V2S A;  3FDR A;  5FW9 A;  4TVY A;  1VQM A;  4GY5 A;  2KDS A;  4YRS A;  2CP7 A;  5GMK h;  4K87 A;  1VQ6 Q;  1F1B B;  4C5H A;  3ZBD A;  2KSS A;  2EKO A;  2O31 A;  3PCO A;  5GAN 5;  3M53 A;  4IUU A;  1ZSZ A;  4J9I A;  1WJS A;  3OS5 A;  2CP2 A;  2V26 A;  4Y28 E;  3H8Z A;  4RTV A;  3OS1 A;  2KEA A;  1TUD A;  2DL3 A;  3VS6 A;  5GMK e;  2KRO A;  2EGE A;  11AS A;  1BCM A;  1CKB A;  3CC2 T;  1SET A;  4LE9 A;  2K2V A;  2KVQ G;  2QEX T;  4DBR A;  1YJ9 T;  5KYN A;  1AWO A;  3JB9 J;  4P72 A;  4H2X A;  3KXT A;  4C0D C;  4E7I A;  3JB9 F;  3MP8 A;  1K8A U;  2RJF A;  4AFU C;  1U8R A;  4X34 A;  3TEH A;  2ZGW A;  5FRN A;  5FU6 C;  1HXD A;  2RI5 A;  1VIE A;  3JCM c;  2DEU A;  4CC7 A;  1H3H A;  5IT9 E;  1YBY A;  2EGA A;  3J7A F;  2E5Q A;  1YP5 A;  3H41 A;  4FYW B;  2XK0 A;  4GLM A;  3CCV A;  1Q82 U;  4M7D C;  3QZ9 B;  5GAM f;  4TQF A;  3QYG B;  4F7U F;  4DEY A;  2MMP A;  2JS0 A;  4PL6 A;  1QWF A;  2CZ1 B;  4PLI A;  1WLE A;  2IPO B;  1PRL C;  1VQP A;  1WJQ A;  3UFG A;  3HL8 A;  4C8Q D;  1NJI U;  3OYD A;  1FYF A;  4ZTZ B;  5KYW B;  1M1K U;  2EIF A;  1JJ2 P;  1EIY A;  3L2Q A;  5I21 A;  3A7R A;  2GTJ A;  3MF2 A;  4HCC A;  4RCC A;  2EYQ A;  3R6N A;  3OYI A;  2QAS A;  3CCJ T;  4KUD K;  1D0Y A;  2G6F X;  3ASK A;  3HTZ A;  2QDY B;  3X24 B;  3SB2 A;  4KUI A;  1IXD A;  2GFA A;  1M9S A;  4X1V A;  2W10 A;  1QCF A;  2DVE A;  1HJD A;  3VRZ A;  1IHW A;  2PVO B;  1NYG A;  1V1C A;  4NL2 A;  2ZZD A;  1KQ2 A;  1Y7X A;  2K5L A;  3A8H B;  1OX8 A;  2P4T A;  1M3B A;  4FW2 A;  2BKD N;  1NLP C;  2KR3 A;  2QGF B;  1EZZ B;  3CCS Q;  3I7F A; 
#chains in the Genus database with same CATH homology
 1G5H A;  5CKB A;  4H2U A;  1YJW A;  5J39 A;  3HXV A;  2QHS A;  4BE0 A;  1JJC B;  2K57 A;  5I2S A;  4BE2 A;  3TUP A;  3G6E T;  3CEY A;  1H4V B;  5A0G A;  4OB2 B;  1ADJ A;  4M7A F;  3DKM A;  3P8Y A;  2WAC A;  4LVJ A;  3Q1J A;  3HY1 A;  3MEA A;  1YI2 A;  2IVW A;  2D6F A;  4MDX A;  1UEB A;  4OGE A;  5K1P A;  2RO0 A;  3DB3 A;  2OTJ T;  3URG A;  4FM4 B;  2M16 A;  4H2T A;  2LQ8 A;  2G3R A;  1UB4 A;  4A4G A;  4CH6 A;  3RIR A;  4J6W A;  4ZGE B;  3NFC A;  4M7D D;  3JCM P;  1N6A A;  2MAM A;  2M0O A;  4K88 A;  4M7A G;  3S3O A;  1JRI A;  5L8R E;  2RK1 A;  2IY5 A;  3S3M A;  3QUI A;  2ZXF A;  4X9C A;  4M7A E;  4BE1 A;  5J3B A;  5GAN e;  1NJ2 A;  3WXM B;  2ZPB B;  1VQZ A;  2WSE E;  5GAO q;  3ZEH A;  2PUK B;  3DSQ A;  4JJN K;  4KR3 A;  3QO5 A;  2RB6 A;  4P3P A;  1GXI E;  1VQK T;  4M7D G;  4LDW A;  1J5W A;  4ATO A;  4JDS A;  1EFW A;  4G84 A;  3X28 B;  3CMQ A;  2F69 A;  3MEW A;  1YJN T;  4XTX A;  4J8O A;  1YIJ T;  3L2U A;  2DDZ A;  3QG1 A;  4HWS A;  5GAO l;  1ZQ1 A;  1BBW A;  4PJO B;  2DIG A;  3JCM b;  1G3T A;  4P3O A;  3UPU A;  2DAQ A;  2F5K A;  2E6Z A;  2RHU A;  1YJ9 A;  3CCE T;  3MCA B;  3MHX A;  12AS A;  5GMK m;  5D6Y A;  2CIM A;  3A7A A;  2X4W A;  3JB9 H;  2C7I A;  1VQL A;  4TVR A;  2ALY A;  4H2X B;  4QVD A;  4CI0 C;  3HXU A;  3CPW S;  3QTC A;  2DU7 A;  3JCM f;  2JTM A;  3E9I A;  3GLX A;  2FVU A;  2K3Y A;  5CKH A;  4ZIB A;  2Q5I A;  3OBY A;  3CC7 A;  3JSC A;  4JS4 A;  1N8R U;  3CME A;  3HY0 A;  4ELZ C;  3CBP A;  4Q15 A;  4YP0 A;  3CCL T;  1Y71 A;  1QVG S;  4KBM B;  4TVW A;  4YRM A;  2ZTG A;  5KE2 A;  3E9G A;  1JBM A;  3RAC A;  1YIT A;  1Z7N A;  4XU2 A;  1NZ9 A;  4MMK A;  3CCJ A;  3HXZ A;  1VQ9 A;  4PKC C;  3N5B B;  3G71 A;  4M77 F;  3OB9 A;  5EG2 A;  2AKW B;  3PIP A;  1M90 C;  2P0K A;  3BW1 A;  4C8Q A;  4C0F A;  4H2S A;  4OP0 A;  3LSS A;  1QVP A;  2QQS A;  4RMF A;  2ZCE A;  3L2W A;  3L4G B;  4H2Y A;  1I81 A;  3CPF A;  4OLF A;  4RQF A;  4QVC A;  3QO3 A;  4M77 G;  5GMK l;  3OYN A;  3V8J A;  1K73 C;  3PMT A;  5C53 B;  4C0D B;  4YRL A;  1OZ2 A;  3PFS A;  3P8V A;  5GAO m;  5LJ3 f;  3IG2 A;  4YRJ A;  1HC7 A;  2LCL A;  4BUG A;  4HWR A;  2E10 A;  1YHQ A;  4DA4 A;  2ZZF A;  1Q81 C;  3HRK A;  4IKF A;  1M90 U;  3VU3 C;  3HP9 A;  5GAM d;  4CS3 A;  4RKU E;  2XDD A;  2QA4 T;  1VQ6 A;  2RI3 A;  2RH2 A;  5CCA A;  3QXE B;  4HWT A;  2XG8 D;  3OW2 A;  1BI3 A;  2QQR A;  3MO8 A;  3CMA T;  1YHQ T;  2XIC A;  3EFS A;  3X26 B;  3G71 T;  4QQ6 A;  4PJO D;  3JRZ A;  2YHT A;  3VUZ A;  5D6W A;  1C0A A;  1P92 A;  2Y4Y A;  1Q81 U;  5GAN 2;  2K5F A;  4DQ2 A;  4A54 A;  4YCW A;  4IUP A;  5GAO p;  3LX7 A;  4M78 C;  4M75 G;  3JCM g;  5FLX E;  2X4Y A;  4B9W A;  3CCE A;  3VQV A;  4IUV A;  2E6N A;  1SES A;  1WPY A;  4BB7 A;  4L59 A;  3LW5 E;  5A0L A;  3AHU A;  3GF5 A;  3OYF A;  2JTF A;  1QW1 A;  4UP7 A;  4H2V A;  2R5M A;  4B9X A;  2P0Q A;  4C92 D;  4IUR A;  3L2R A;  1EOV A;  3CC7 T;  3L42 A;  3IKL A;  4P71 C;  4EO4 A;  4BY6 C;  3LSQ A;  5E3I A;  1KHI A;  2VYT A;  3JCM Q;  1D3B B;  4P73 C;  4EX5 A;  3VYG A;  2A7Y A;  3G4S T;  1VQ4 A;  2I4M A;  3A8M B;  3EFR A;  5FRO A;  5DLO A;  3HRT A;  2C06 A;  4IUT A;  3RF1 A;  4C92 C;  2QXF A;  4M78 G;  5CIU A;  4E47 A;  1NJ5 A;  2O4X A;  4R56 A;  5HK3 A;  2QA4 A;  4E7H A;  3CCQ T;  3KBG A;  3TEE A;  2XKO C;  4UP8 A;  5LJ5 g;  3G4S A;  5FU7 B;  1G3W A;  1VQ4 T;  1VQO T;  1L0W A;  2KMT A;  1VQN A;  3C12 A;  1NJ6 A;  2QHV A;  5CR2 A;  2ODR C;  3KFU A;  2WSF E;  2HBP A;  4JRK A;  1ASZ A;  3GNF B;  1XNI A;  1Y96 A;  3GIB A;  4WJ3 M;  3UT1 A;  1PSE A;  3BFM A;  1VQ8 T;  4EMH A;  1WYD A;  4FT4 A;  4M7D A;  2CJ9 A;  5GAM g;  5LJ5 e;  2HQE A;  4M7A C;  5A2Q E;  4C8Q F;  2LTO A;  1FX7 A;  3UH0 A;  2ZR3 A;  3SFM A;  2I4L A;  3A5Y A;  3A8L B;  3M4P A;  2RHX A;  4KT0 E;  2CZ0 B;  3NTI A;  1VQ7 A;  3FEO A;  3V8K A;  4MZM A;  3RL6 A;  1NYR A;  2RM4 A;  3QZ5 B;  5IN1 A;  2Y90 A;  1W2B A;  5F5W A;  2KAF A;  2X4X A;  3R6O A;  2LT1 A;  3TCJ A;  3CXC A;  3R07 A;  3WVE B;  3CMA A;  3VBB A;  4Z02 A;  4M78 B;  1QE0 A;  3FLG A;  4YRT A;  4C0G A;  5GAN g;  2VGN A;  3FRN A;  4TQD A;  1H4Q A;  2ALY B;  3VQW A;  4BWA A;  2K5I A;  4XAX B;  2ZIM A;  4HVC A;  2LVM A;  3SD4 A;  1EVK A;  3MP6 A;  1H3Z A;  1N9R A;  1UGQ B;  4PJO A;  5LL6 S;  3FIF A;  3QJ6 A;  4C5E A;  3QBY A;  3M56 A;  2LCC A;  2V8K A;  1KQ1 A;  1M1K C;  2DEQ A;  4BW9 A;  1I5L A;  4YRR A;  4K86 A;  3M55 A;  4HWO A;  1SSF A;  4CS4 A;  5LJ5 j;  1HK9 A;  4ZN1 A;  4YTL A;  2GF7 A;  3OYB A;  3TU4 K;  4YRE A;  4C5I A;  4OB3 B;  2DXC A;  4M75 B;  4RQE A;  4JLI A;  4M75 F;  2CZ7 B;  3TEG A;  1B34 B;  4LVM A;  1LYL A;  2AMC A;  2IY5 B;  1XOV A;  3ER0 A;  2DZ9 A;  2DQ3 A;  5LJ3 e;  1PSF A;  1U1T A;  3RKX A;  4NL3 A;  3W3S A;  1M5Q 1;  4HA8 A;  3CC2 A;  4J6X A;  2HAX A;  2LC4 A;  3GP8 A;  4M77 A;  2K3X A;  3MP1 A;  2L8D A;  1VQ6 T;  1IZ6 A;  1YI2 T;  4A53 A;  4KUL A;  3SWN A;  2XD0 A;  2E65 A;  2DK3 A;  2EAY A;  3CC4 T;  5KNN A;  3MET A;  1V29 B;  1G3S A;  4XTV A;  4QQG A;  1UGR B;  3MEV A;  4J7I A;  4HCB A;  3OBW A;  4F7U E;  2LX9 A;  4N4I A;  4C8Q E;  1UGP B;  3HFO A;  5C51 B;  3LGL A;  4GLK A;  3PCO B;  1QVF A;  1X54 A;  1M4Z A;  2XID A;  1VQM T;  2P5I A;  1EQR A;  1X2G A;  1OZ3 A;  2V8I A;  4BAC A;  1BKB A;  4DOW A;  3PNW C;  3LH0 A;  4YDQ A;  3RMQ A;  2AHJ B;  2KY9 A;  5IAY A;  4P73 A;  1YCY A;  5GAM h;  4KQE A;  2CJB A;  2PUO B;  3E9H A;  4F7U B;  3LC0 A;  3I55 A;  1E24 A;  2XDB A;  3OQ5 A;  4L87 A;  3OYH A;  4E7K A;  3M4Q A;  4C5G A;  4YPF A;  3ERR A;  1W2B S;  2JN0 A;  5KE3 A;  2QHT A;  4YRC A;  2RI2 A;  3CBM A;  2MI6 A;  4RDX A;  1R8O B;  3EAE A;  1U1S A;  2BUD A;  2CJA A;  3VQX A;  3M5A A;  3P8H A;  2DQ0 A;  1RI0 A;  4HT9 A;  2OTL A;  2RHZ A;  1G3Y A;  4YRO A;  3V7C A;  2Y4X A;  3CCV T;  1KMN A;  2RJD A;  4JLG A;  1BI1 A;  4M78 D;  2R5A A;  4M77 D;  3CCS T;  2OAU A;  1USY C;  4Y91 A;  4LD6 A;  4KR2 A;  2RJE A;  3OYG A;  1YFS A;  2QEX A;  2JNG A;  3LLR A;  3QNE A;  5FU6 B;  4CRI A;  2AMC B;  3LWI A;  3REX A;  4WJ4 A;  4E7J A;  3JCM d;  3MEU A;  4QQD A;  4MML A;  3X20 B;  5GMK j;  3QYH B;  1WNL A;  3RKY A;  4HWP A;  3L2Z A;  2D0Q B;  2RJC A;  3QHS A;  3BDL A;  2ODR D;  5GAN d;  4ZGD B;  4N4G A;  2ZPH B;  3HRI A;  4TVA A;  1NYQ A;  3VKI A;  1YGB A;  3OYK A;  1WQ7 A;  3F70 A;  4N0A A;  2RHQ B;  4CH4 A;  4M75 D;  2DTI A;  2KK4 A;  4LD9 K;  4MZT A;  5DY9 A;  1OI1 A;  1XQH A;  4A4H A;  1Q7Y C;  2CKK A;  3CD6 T;  3IKM B;  1D3B A;  3HXW A;  4PHC A;  1JJC A;  4EDU A;  1QF6 A;  2EQK A;  1ZHI A;  3QII A;  3ZFJ A;  1KD1 C;  5LJ3 h;  2EJ9 A;  2XDP A;  4OGC A;  4M77 B;  3X25 B;  1BBU A;  1JB0 E;  1VQN T;  2C8M A;  5DLQ E;  3JCM J;  2EL9 A;  1QP2 A;  5KCO A;  2ART A;  4LVK A;  2YLC A;  2EQJ A;  3DLM A;  1VUB A;  2HNI A;  4VUB A;  3QO8 A;  3HPW A;  1VQL T;  1YFT A;  4RMO A;  2L3R A;  1B7Y A;  3OSV A;  2R57 A;  4P75 A;  2RHY A;  3A74 A;  1YB3 A;  1K73 U;  2FL7 A;  3SDZ A;  1YJN A;  3QO7 A;  2ZPG B;  2VXE A;  4J83 A;  2CS7 A;  1FWZ A;  4J7F A;  4PJO F;  3OYL A;  2B8A A;  3P8B B;  3HFZ B;  4N0A C;  1VQ7 T;  4P71 A;  2E12 A;  4LVI A;  3ME9 A;  3I55 T;  2F5T X;  4RG8 A;  3WQZ A;  5GMK i;  5HGQ A;  2JZ2 A;  1H4S A;  4JRP A;  1OYX A;  1Q82 C;  3M4G A;  4P3N A;  4EMK B;  2WSC E;  2RHS B;  1RL2 A;  4MDW A;  2LQK A;  3OMG A;  3OSS C;  4J15 A;  1JJ2 A;  1BIA A;  1K8A C;  4PJO G;  1N9W A;  3GOX A;  2ZPI B;  3WVD B;  4OB0 B;  2I4N A;  3A5Z B;  4PJO E;  1VQK A;  2J3M A;  2VV5 A;  2MWO A;  1I4K 1;  2LRQ A;  3V7R A;  4YCU A;  4XU0 A;  4RG2 A;  2KQW A;  3J80 E;  3A8G B;  5CQY A;  4XTY A;  2ARU A;  4L6V 5;  2Q7H A;  1USY A;  4QW2 A;  2DXT A;  3CCU A;  1IL2 A;  3LYI A;  5GAN 6;  4JUV A;  4TTV A;  4XU1 A;  1B34 A;  1EVL A;  4HKE A;  2ZPE B;  3CCQ A;  3HRU A;  4PNO A;  2I4O A;  3FJP A;  2DTH A;  2VC8 A;  4O5V A;  1VQP T;  2OTJ A;  1W66 A;  1VQO A;  3E19 A;  5GAN 4;  1NPP A;  4XEO A;  1SER A;  3I56 T;  4X9D A;  4BDY A;  2E3C A;  5D6X A;  4YYE A;  4P72 C;  2EJG A;  1S72 A;  1Q86 U;  2HD0 A;  4XTZ A;  2NS6 A;  2JUF A;  3CCR T;  4IUQ A;  2ZZG A;  4R55 A;  5CO7 A;  2QHU A;  1LOJ A;  3CPW A;  4EMK A;  2XGT A;  5HY6 A;  3L1A A;  2ZT8 A;  3GNG A;  2ZIO A;  4P5N A;  3CME T;  5CQX A;  3V8L A;  4II1 A;  4C92 G;  2PQW A;  3JCM X;  3BJU A;  4A4K A;  4LDX A;  3S3N A;  2L5Q A;  2EQM A;  3QDR B;  1ATI A;  3MQZ A;  1NE8 A;  4LDV A;  4HT4 A;  4M7A A;  3TRE A;  4M77 C;  5HK0 A;  2PU9 B;  4A4E A;  5C52 B;  5ELO A;  2VUB A;  3CCR A;  2IG0 A;  3H6Z A;  2P0L A;  4OMF B;  2MWP A;  4ME7 A;  3RMS A;  3JB9 I;  2GFU A;  2A8E A;  4XEM A;  1H64 1;  3JCM h;  4ZGJ B;  4JRI A;  4A4F A;  5FRM A;  2QTX A;  3P8D A;  3IAL A;  3OD1 A;  4UP9 A;  3G1Z A;  3SWN B;  5KH6 A;  1G5I A;  4NOY A;  4MZP A;  3DB4 A;  1BYM A;  4ELY C;  2CGH A;  4HT8 A;  4TWA A;  4C8Q B;  1N8R C;  2E1H A;  4QVZ A;  3TEH B;  4WI1 A;  3FB9 A;  1WGS A;  2DXU A;  2FYK A;  2J3L A;  1X56 A;  3A5Z A;  1YIJ A;  3HSB A;  3QSU A;  3JB9 D;  4XTW A;  1WQW A;  4NS5 A;  2CYZ B;  4ZN3 A;  4E7L A;  2DZC A;  3M4Y A;  4HCZ A;  3QPH A;  4OB1 B;  4BI4 A;  1FXX A;  3UGQ A;  4M75 C;  3VJP A;  1LJO A;  1Y07 A;  2R58 A;  1W4S A;  4O2D A;  2ZIN A;  1G5V A;  3P8T A;  4M7A D;  4YCV A;  3PMI A;  4F7U A;  3L4G A;  1E1T A;  3A7U A;  4XQ3 A;  3OS2 A;  1MGQ A;  3G7Z A;  1NNH A;  2PME A;  4WF2 A;  3SWN C;  2V8J A;  3HFZ A;  3S6W A;  2P0P A;  1QP3 A;  2CZ6 B;  3UGT A;  3HHT B;  1S72 T;  3NEN A;  2MF2 A;  3JAM E;  4M78 A;  4J5Y A;  4FL6 A;  4XU3 A;  1N27 A;  3BY7 A;  4DOV A;  1VQ9 T;  1KC8 C;  2YRV A;  2ZT5 A;  1RIQ A;  3L2V A;  4ZTU B;  5GAM j;  4CS2 A;  1NJ1 A;  3T9N A;  3OS0 A;  2DD4 A;  2L89 A;  1EIY B;  4FT2 A;  2DO3 A;  2JVV A;  3CCM A;  3A8O B;  1BI2 A;  5GAM e;  3QKJ A;  2XU8 A;  4YRQ A;  3J81 E;  2EQU A;  5LJ3 j;  3HKS A;  1LNX A;  3HRS A;  3RKW A;  1B8A A;  4LNS A;  3M59 A;  3UWN A;  2RHI A;  2YLB A;  3QJY A;  3FC3 A;  1VQ5 T;  5J26 A;  2M1H A;  4YRF A;  2M9U A;  4C8Q C;  2HQX A;  1VIF A;  2EFI A;  1M1G A;  3BDU A;  3M58 A;  5ELN A;  2K4Y A;  4JS5 A;  4M75 A;  3OYE A;  3OYJ A;  2DPP B;  2E70 A;  3CXC S;  1YIT T;  3CC4 A;  1K9M C;  1QVF S;  3PT9 A;  4OVA A;  4M77 E;  4AH6 A;  1VQ5 A;  1DJ7 B;  1WU7 A;  4YRI A;  2EWN A;  4E51 A;  1KD1 U;  1WJR A;  4EMG A;  3I56 A;  4BI8 B;  3OW2 S;  3GPL A;  4M7D F;  4YRK A;  2PVG B;  3VQY A;  2JOY A;  2QQB A;  5CVI A;  2PVD B;  4OF1 A;  5CKE A;  4BY6 B;  4YRP A;  3E9F A;  3VUB A;  2AKW A;  2DIQ A;  1YFR A;  1EIF A;  3OA6 A;  1UGS B;  1ASY A;  5C0M A;  5GAN 7;  2LT4 A;  3JCM V;  4ZTF A;  3CCM T;  5GAN f;  3NEL A;  2Q7E A;  5DM7 R;  4J6Y A;  3M54 A;  4LVL A;  1B70 A;  4PG3 A;  3CCL A;  4JRQ A;  3V7S A;  2ZT6 A;  2E64 A;  4FIB A;  2GQV A;  4C92 B;  1Z7M A;  1H4T A;  2DXB A;  4M7A B;  3RGL A;  2RHS A;  5HKC A;  1VQ8 A;  4PJO C;  2LDM A;  1NJI C;  4XTU A;  2ZT7 A;  2ZCF B;  2FB7 A;  4RCB A;  1X55 A;  3M57 A;  2RD1 A;  4EPC A;  1KG1 A;  5LJ5 f;  1JJ2 S;  3HFV A;  4UPA A;  4C92 E;  3C4S A;  2VGM A;  5CKD A;  2DU5 A;  1KQS S;  4PLL A;  1G51 A;  3JCM W;  4M7D E;  1KHC A;  3HXX A;  3LWH A;  4C92 A;  1IRE B;  1BIB A;  3OYA A;  3KUF A;  4Q5W A;  2O4X B;  1N9S A;  2ZPF B;  1HTT A;  3JCM e;  3PTA A;  5LJ5 h;  1PYS A;  3E1S A;  4L5G A;  3HFN A;  5AYF A;  5LJ5 d;  1NJ8 A;  2ZNJ A;  3CD6 A;  1X2H A;  3CCU T;  1B7Y B;  1ADY A;  4X5O A;  1BI0 A;  3REU A;  4C8Q G;  1TH7 A;  4P75 C;  2D9T A;  1E1O A;  4LDU A;  2O01 E;  5K1X A;  1O75 A;  3OYM A;  1NPR A;  3OYC A;  3A31 A;  2BIV A;  2NLU A;  3MF1 A;  4M78 E;  1Q7Y U;  4YRN A;  2GCX A;  5GAN 3;  4P74 A;  3ICA A;  3RES A;  1E22 A;  4FSX A;  2X35 A;  4O6J A;  5GAO r;  4LDY A;  4CH3 A;  4XK8 E;  3CBO A;  5GAO n;  3CCS A;  4H2W A;  1PYS B;  2FHD A;  1I8F A;  2ZZE A;  1M1F A;  3VV0 A;  2QQA A;  2XI9 A;  5GAN 8;  3HXY A;  3LGF A;  2RHQ A;  3C95 A;  2XTI A;  3C94 A;  1B76 A;  3DLL A;  4DPG A;  5M9O A;  2DD5 A;  4TVA B;  3NEM A;  2Q5H A;  2RK2 A;  5I2M A;  1ZBX A;  1KQS A;  4FU6 A;  5CK9 A;  4M78 F;  1M8V A;  4BD3 A;  5GAN h;  4N4H A;  1SRY A;  1O9S A;  2G4C A;  1Q86 C;  2H3J A;  4M75 E;  4P74 C;  4YRG A;  4CH5 A;  1YJW T;  2I2L A;  2LNV A;  4BDZ A;  1MHN A;  4NCX A;  4BI3 A;  3RUX A;  3NTK A;  3INZ A;  2DJZ A;  3G6E A;  5CKF A;  2OTL T;  2PMF A;  2X4J A;  3VYH B;  2Q7G A;  3O8V A;  1KOG A;  3PGG A;  4F7U G;  3UDC A;  2DTO A;  3MEY A;  3OYY A;  4C92 F;  2ZNI A;  3PIO A;  4G85 A;  2QQ9 A;  4H02 A;  1KC8 U;  4Q6G A;  3OMC A;  1AHJ B;  1B70 B;  1XTD A;  1X75 C;  2EJF A;  4EMK C;  1QVG A;  3JB9 G;  3RER A;  2DKG A;  3PZC A;  5LJ3 d;  5A0D A;  2ARS A;  1KMM A;  2VXF A;  1X01 A;  2A3L A;  5LJ3 g;  5FU7 C;  4C0Z A;  1K9M U;  1Y96 B;  3NET A;  2E41 A;  3OY9 A;  4M7D B;  1X6O A;  2E5A A;  5KCH A;  3NTH A;  2ZR2 A;  2QI2 A;  5GAN j;  2RA2 A;  4UC4 A;  5C6S A;  4D6W A;  1GGM A;  2XHC A;  3A32 A;  3M9Q A;  5CAI A;  4ZTJ A;  4V2S A;  3FDR A;  4TVY A;  1VQM A;  4GY5 A;  2KDS A;  4YRS A;  5GMK h;  4K87 A;  4C5H A;  3ZBD A;  2KSS A;  2EKO A;  3PCO A;  5GAN 5;  3M53 A;  4IUU A;  1WJS A;  3OS5 A;  4Y28 E;  3H8Z A;  3OS1 A;  5GMK e;  11AS A;  3CC2 T;  1SET A;  2K2V A;  2KVQ G;  2QEX T;  1YJ9 T;  3JB9 J;  4P72 A;  4H2X A;  3KXT A;  4C0D C;  4E7I A;  3JB9 F;  3MP8 A;  1K8A U;  2RJF A;  1U8R A;  4X34 A;  3TEH A;  2ZGW A;  5FRN A;  5FU6 C;  1HXD A;  2RI5 A;  1VIE A;  3JCM c;  5IT9 E;  1YBY A;  3J7A F;  2E5Q A;  2XK0 A;  3CCV A;  1Q82 U;  4M7D C;  3QZ9 B;  5GAM f;  4TQF A;  3QYG B;  4F7U F;  2MMP A;  4PL6 A;  2CZ1 B;  4PLI A;  1WLE A;  1VQP A;  1WJQ A;  3UFG A;  3HL8 A;  4C8Q D;  1NJI U;  3OYD A;  1FYF A;  4ZTZ B;  1M1K U;  2EIF A;  1EIY A;  3L2Q A;  5I21 A;  3A7R A;  3MF2 A;  4HCC A;  4RCC A;  2EYQ A;  3OYI A;  3CCJ T;  4KUD K;  3ASK A;  3HTZ A;  2QDY B;  3X24 B;  3SB2 A;  4KUI A;  2GFA A;  1M9S A;  2DVE A;  2PVO B;  4NL2 A;  2ZZD A;  1KQ2 A;  1Y7X A;  2K5L A;  3A8H B;  2P4T A;  2BKD N;  3I7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...