2DZ9A

Crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with biotinyl-5'-amp, mutation d104a
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNAVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 70
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dz9A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dz9A01
1U1SA 3SWNB 4M7AC 2Q5IA 4C8QA 3JB9H 3V8LA 1G51A 3I7FA 3M4QA 1H4VB 3FJPA 3VQXA 1Y96B 5GANg 1KOGA 4M78A 3VQWA 4X9DA 3V7SA 4EMKB 4XEMA 4C92E 2ZNJA 1D3BA 4H2XA 3WQZA 1NJ5A 1W66A 3JCMJ 4YCWA 2I4NA 3L4GA 2IY5A 1ADJA 5GAOq 5GAMh 2RHQA 1TH7A 4M7AD 4TVYA 2XGTA 2G4CA 4A54A 4XTXA 3NELA 1B34B 4YRSA 1YFRA 4QVCA 3A32A 4M77A 4HWRA 1I81A 3VBBA 3CMQA 4M7AF 2DTIA 1NJ8A 1JJCA 4M7DG 4PJOA 5E3IA 4YRNA 1H641 3BY7A 2I4OA 3M4PA 4HWPA 5LJ3j 3L2ZA 2DVEA 4C92B 2C8MA 2DXUA 4H2VA 3QO3A 1BBWA 1USYC 2DEQA 4YRRA 1PYSA 3QUIA 3V7CA 3A74A 4CH6A 1ASZA 4YYEA 2P5IA 2QHTA 1E1OA 3E9IA 2DZCA 3LSSA 4YRIA 4QVDA 1X55A 4TQDA 1H4SA 4MMKA 5LJ3d 5LJ5j 4L87A 3V8JA 4M7DD 4K87A 4MMLA 4J6XA 4C92G 4H2SA 2DZ9A 4M7AE 4RDXA 3W3SA 1QF6A 1EVKA 4P73C 3HXVA 1WU7A 1N9SA 3HFVA 3AHUA 4TWAA 4C8QC 3HXYA 5GAN2 2ZT7A 5LJ5d 5GAMd 2ARUA 3P8TA 3RKXA 1X56A 3JCMg 11ASA 3FIFA 4HWOA 1N9WA 5GAOl 1HC7A 4F7UF 2CGHA 2ZR2A 4P74A 3QTCA 5GAMe 1KQ2A 3QO5A 4EMHA 5LJ3f 4M7AB 3ERRA 1IL2A 3RUXA 3VQVA 4UP8A 4PHCA 4J6YA 1YFTA 3BFMA 4M77C 2ODRC 3RIRA 3RKYA 2ZT6A 3HFZA 5GMKl 1E1TA 1VQZA 4C8QF 4H2WA 4YRCA 5CAIA 4PJOC 3V8KA 2CJ9A 4XU3A 3M4GA 4WI1A 1B7YB 4XTVA 3TUPA 1BBUA 4TVWA 4YROA 4NOYA 5LJ5f 1ASYA 2QHSA 2EWNA 2ARTA 4HT8A 4M7AG 1YFSA 4XTWA 3PCOB 3HXUA 5C53B 2VC8A 3RL6A 4F7UE 5GAMg 5LJ3h 1WLEA 3QNEA 3BW1A 2FB7A 1EQRA 4HWSA 4M77F 4XEOA 1B76A 1NYRA 3IALA 2DU5A 3GIBA 3QHSA 1WNLA 1B34A 4PJOF 4YRTA 3REXA 1SRYA 4M7DB 4LNSA 1M8VA 2ZINA 1M5Q1 1KMMA 3QO7A 1LOJA 1L0WA 4CH3A 3L1AA 4UPAA 4C8QE 4JUVA 5LJ5h 4OP0A 4UP9A 4JRIA 4M75C 4C92A 1ATIA 4J15A 1JRIA 2ALYB 3QSUA 2CIMA 4A53A 2ZNIA 2ZT8A 3RACA 4PG3A 4YRGA 1I4K1 2EJ9A 2RB6A 2E1HA 3V7RA 4RQFA 3MF2A 4YDQA 1WQWA 4P74C 3ICAA 4M77E 3JB9I 4PNOA 1NJ1A 4DQ2A 1FYFA 3HTZA 4PJOE 4RMFA 2DTOA 4CS4A 3EFRA 3SB2A 4V2SA 1J5WA 4N0AA 5GAOp 4ZTZB 1X01A 4M75F 1I8FA 3P8VA 4YCVA 4J5YA 2K57A 4F7UG 3HRIA 4XU1A 4EMGA 3SWNC 3RKWA 2PMEA 5K1PA 1EFWA 1KQ1A 2I4LA 4KR3A 1H4QA 5GAOr 4HA8A 2I4MA 2Q7HA 2DXTA 3NETA 4Q15A 4EMKC 1LYLA 1C0AA 3A7RA 2AKWB 4C8QG 3UGTA 1E24A 2ZGWA 3JCMX 4HWTA 5LJ3e 4BWAA 2YHTA 4ZTUB 4CS3A 4ZIBA 12ASA 4M7AA 1EIYB 4G85A 4TVAB 2J3LA 2VXEA 4YPFA 4YRLA 4M78C 4M75E 1NJ2A 1B7YA 5LJ5e 4M77G 5GANj 4RCBA 4C8QD 2ZR3A 3UGQA 4CH5A 2EJFA 2RHSB 4PJOG 1QE0A 4YCUA 5GMKj 5GAN4 4AH6A 5GAN7 4M78D 1H4TA 2ZCEA 4XU2A 2QHVA 2FYKA 5GMKi 3PCOA 3EFSA 2ARSA 5LJ3g 2RM4A 1ADYA 1BIBA 1HXDA 3TEHB 4YRKA 5GANd 1KMNA 4M78F 3REUA 4XTUA 2XTIA 3HFNA 5GAN5 4M75B 3FB9A 1I5LA 4M7DA 2E65A 3JB9D 2ODRD 4M77D 3HXWA 2YLCA 2EAYA 5GAOm 4N0AC 3HFOA 1RIQA 4PJOD 5LJ5g 4G84A 1GGMA 1WQ7A 3BJUA 3JB9F 3RERA 3A31A 1NJ6A 2ALYA 4XTZA 1B8AA 3PGGA 3OD1A 4KQEA 5GMKm 1WYDA 1B70B 3HY1A 1NYQA 4WJ4A 4M75G 1X2GA 2RA2A 2E5AA 1WPYA 2DJZA 2JN0A 4YRFA 3NEMA 1YB3A 4P73A 1Z7MA 4P72A 4BW9A 5GANf 3NENA 4M78E 2CJBA 4RQEA 4TTVA 4YRJA 1MGQA 4F7UB 1Z7NA 1BIAA 4HVCA 2DDZA 5GAN8 2Q5HA 4JRKA 4Y91A 4H2TA 2ZXFA 3JCMQ 2EL9A 4CS2A 5C51B 2QTXA 5KNNA 4M75D 1YGBA 2ZTGA 4C8QB 2E41A 3JCMb 1X54A 3E9HA 4RCCA 5ELNA 4EX5A 5DY9A 3KFUA 4KR2A 2AKWA 4M78B 3BDUA 2I2LA 3TEGA 5GANh 3JB9J 1D3BB 4H2UA 4H2XB 2ZZGA 5GAOn 4J6WA 4P3NA 4DPGA 4P71A 3L4GB 5HGQA 3JCMd 2IY5B 2ZZEA 3UH0A 2E3CA 5GMKh 1U1TA 3A5YA 2RHQB 4TQFA 3RGLA 1EIYA 4YRMA 4YRPA 3VU3C 2AMCA 4YRQA 4TVAA 3A5ZA 3HXXA 2DKGA 4M7DC 4E51A 4YP0A 1G5IA 1HK9A 2E10A 1SETA 3DSQA 4M77B 4P3PA 4P75A 3JCMe 1JJCB 1YCYA 4PJOB 3HY0A 3LC0A 4YREA 3R07A 4NCXA 4M78G 3JCMV 1G5HA 3HSBA 2AMCB 3QO8A 4O2DA 2RHSA 2DQ0A 5GAMj 2EJGA 2P0LA 5C52B 5I21A 4NL2A 3RESA 1NNHA 1PYSB 2J3MA 4H02A 4Q6GA 4WJ3M 4UP7A 2ZIMA 4H2YA 2Q7EA 2HNIA 5F5WA 4M7DF 3JB9G 3PZCA 4P72C 3TEHA 3JCMf 4C92C 4M75A 4K88A 4X9CA 1X2HA 4NL3A 2DQ3A 3MEYA 2VXFA 2QHUA 4JLIA 4XU0A 4XQ3A 2C7IA 4XTYA 3P8YA 3JCMW 5GAN6 3INZA 2Q7GA 4C92D 1EVLA 2CJAA 3JCMc 1E22A 1EOVA 3HXZA 3IKMB 4HT9A 1USYA 3A7AA 2RD1A 1B70A 4X5OA 4WF2A 2Y90A 4C92F 1JBMA 3JCMh 3UFGA 2DTHA 5GANe 5K1XA 1HTTA 4P71C 4OLFA 4M7DE 4K86A 2E64A 3HRKA 3JCMP 4P3OA 3RF1A 5GMKe 3SWNA 1LNXA 3IG2A 3MF1A 3A7UA 3G1ZA 4EO4A 4F7UA 2ZIOA 5GAMf 3VQYA 5ELOA 2ZT5A 1Y96A 3HFZB 2PMFA 2ZZFA 5GAN3 1SESA 4EMKA 2YLBA 2DU7A 3IKLA 4P75C 1LJOA 3LSQA 1N9RA 1SERA 4CH4A
chains in the Genus database with same CATH superfamily
3HPWA 1YN8A 2Q5IA 3CCRT 3ME9A 5KYYA 2E70A 3V8LA 3HL8A 4PLIA 3BE3A 1DJ7B 1H4VB 3D7SB 1JO8A 2L8DA 2EBPA 3E9FA 1WXBA 1YJWA 3PT9A 1RAGB 3OS2A 1KOGA 1OPKA 4VUBA 4QQDA 1JQQA 1VQ8Q 1M8MA 3I56T 5GAMh 4RTWA 1Q7YR 4M7AD 4TVYA 1M4ZA 1NM7A 4A54A 2X9HA 3CCRA 4XTXA 3CC2Q 4ZNXA 1B34B 1AWOA 5FU6B 2EW3A 2R57A 1I81A 4YTLA 4LDUA 1M2VA 1KSWA 4GY5A 4KT0E 1D0XA 4M7DG 2L2PA 4YRNA 4HCBA 4O5VA 1WHMA 3VS3A 3OYNA 1GXIE 4FM4B 2F69A 3H8ZA 4C92B 2DVEA 2DXUA 4JJCA 1X27A 1BBWA 2P4RA 4OGEA 4YRRA 3HRSA 2G3RA 2HCKA 2WSCE 3A74A 2ROLA 3MP6A 2K3YA 4OB1B 3T9NA 4E7SA 3LSSA 1D1CA 2KBTA 2HL5C 2R58A 5D6XA 1H4SA 2JTFA 1T3SA 2AKKA 2MAMA 5LJ3d 3F70A 5CR2A 3CCUA 2HQEA 3G71Q 3OYMA 1Q81C 2ZZDA 2DZ9A 2LC4A 5KYWA 1MMAA 2GQVA 2H3EB 2LT1A 4GBQA 4JJDA 1X2QA 2YWWA 2LTOA 5KE2A 2F1LA 4K11A 3TSWA 4C8QC 2DL3A 4RTZA 3RKXA 2D6FA 2JM8A 2V8JA 5GAOl 1HC7A 4N4HA 2J6KA 2X3WD 2GFAA 2ZR2A 4CC3A 3MPUB 3CC7T 4ANJA 1RACB 4Z8AA 3QO5A 5IH2A 2RK2A 5LJ3f 4LN2A 3ERRA 2CP5A 4KGVB 1NJIU 1M90R 2LJ3A 3E2UA 3VQVA 2KT8A 3EG9A 2ODRC 2JM9A 4M77C 3CC4T 3RKYA 4JS5A 2D0QB 2HQXA 2BTTA 3CXCP 1VQZA 4C8QF 1RUWA 3V8KA 2OI3A 2VGMA 1K73U 1B7YB 3ASKA 2XDDA 3CC7A 3CMET 1FMWA 2EYZA 2HL3A 3MJXA 3QIIA 1SSFA 1VQNA 3ZEHA 2EPDA 4M7AG 3CC4A 4XTWA 1VQ6T 3HXUA 2YUNA 2OTJT 1PD1A 2AZVA 2VVKA 1N5ZA 3QNEA 3FLGA 1WGSA 2ZPBB 4M77F 3CCLQ 4XEOA 2DU5A 3GIBA 2ZCFB 3SHWA 4ZTFA 1WNLA 2QQBA 1B34A 4YRTA 1X43A 2ZINA 1KHIA 2P0KA 2M16A 2R5MA 1Q82R 1KMMA 1L0WA 2PQWA 2X51A 1VQ6A 3OW2P 2F5KA 3QWXX 5CKHA 3VS4A 2O4XB 2K4YA 2DL5A 2V8KA 4C0ZA 4M75C 4C92A 2AT1B 1M3BA 1QQJA 2A08A 3QSUA 1VA7A 2CIMA 2C06A 2LJ0A 1G3TA 5CIUA 4YRGA 2EJ9A 3V7RA 3MF2A 1TS9A 3VS6A 1TWBA 1QCFA 3OYFA 1YHQQ 1W2BA 1NJ1A 1NPRA 1YIJQ 2HBWA 3FRNA 4WCIA 4CS4A 3G1JA 1K9MU 2K9GA 1CKBA 1WXUA 1MV0B 2VGNA 4RUGA 3OW2A 4ZTZB 4V2SA 4N0AA 4M75F 3P8VA 3GF5A 4JDSA 1K8AU 1ZSZC 4J5YA 2BZYA 4F7UG 4PJMA 3QWYA 4XU1A 1VQMT 3HRTA 2RPNA 3OB9A 4EMGA 5J39A 3X20B 3EH2A 4HA8A 2L3QA 2Y4YA 3THKA 2QQSA 4J83A 2Q7HA 5J3BA 1LYLA 3A7RA 2AKWB 2P84A 2QGGA 4OB2B 3LWHA 3TSZA 2A8EA 2ZGWA 4RTYA 1GCQC 4HWTA 5LJ3e 1VQ4T 2YHTA 2CZ0B 4ZTUB 1AEYA 4HVVA 4CS3A 1EIYB 12ASA 4RKUE 1Y0MA 4Y28E 3G7ZA 2FL7A 4BUGA 1VIFA 2DIGA 2J6OA 3QPHA 1B7YA 1W2BS 4KGXB 4OVAA 3WVEB 1VQ4A 1S72T 4RCBA 3OS1A 5EC7A 4KUDK 2EYQA 2IG0A 1LVKA 2DERA 3OW2S 4YCUA 2GTOA 4ZGJB 5GAN7 2DBMA 2FO0A 4XU2A 2D9TA 5GMKi 2XICA 1QVFA 2QHVA 3S3NA 1IGQA 5LJ3g 1OZ3A 2CUBA 3DLMA 2V1QA 2E4HA 2CP7A 2RHYA 4YRKA 1O9SA 1VQ7Q 3REUA 4PJJA 4R56A 1S72A 2EQUA 2EFIA 2YXYA 4B9XA 2K5LA 1BB9A 1I5LA 4C0GA 1Q7YC 3HXWA 2YLCA 1X6BA 5EG2A 4A4HA 1KHCA 4PJOD 4G84A 2QA4T 1WQ7A 3BJUA 2O4XA 4LDYA 2RI2A 1WA7A 1AOJA 3UA7A 1MNEA 1NZ9A 4XTZA 2CKKA 5GMKm 1WYDA 3CMAT 3HY1A 1M1KR 1W4SA 4LNPA 1X2GA 2E5AA 1WPYA 1JU5C 1GFDA 4BB7A 1B07A 2PUOB 1QKWA 2KVQG 4BW9A 2H3JA 1UHCA 4M78E 3NENA 4RQEA 4CC4B 4OB3B 1N8RU 2PVDB 4DBFA 4HVCA 1QVFS 1VQOQ 1YHQA 5CKBA 4OMNA 2ZXFA 2JS2A 4CS2A 1M3CA 1G83A 2PNIA 1G3WA 4C8QB 1SEMA 2E41A 1VYVA 2DETA 3E9HA 3PVQA 3META 5DY9A 4EX5A 2AKWA 2QQAA 3BDUA 2DL8A 5GANh 3JB9J 2BIVA 2LCLA 2ZZGA 5GAOn 4P71A 3L4GB 3JCMd 1N27A 2ZZEA 1V1CA 4TQFA 2RHQB 1EIYA 2CYZB 4YRPA 1SKUB 4C0FA 3A5ZA 2D0NA 3M4YA 4Z88A 1SRLA 4J9FA 2V26A 1SETA 4M77B 1N6AA 2DA9A 1M90C 3O8VA 4YREA 3R07A 3URGA 4NCXA 4J7IA 3JCMV 1PKSA 2VYTA 3X24B 2GCXA 2EJGA 1D09B 3UATA 3H0IA 2DPPB 1ZA2B 3LGFA 1M30A 2COZA 2KRMA 3BDLA 2HNIA 4JJNK 1VQ5T 3CCMQ 2J6FA 1WYXA 3PZCA 1KC8R 3JCMf 1Q81U 4C92C 1K1ZA 4CI0C 1ZSGA 2ZPFB 1YI2A 4DEXA 3M55A 4NL3A 1YJNQ 1BKBA 4JLIA 4E2FB 2QQRA 4XQ3A 4PFOA 5IHIA 2C7IA 3P8YA 3JCMW 1IRXA 1VQ5A 5HCKA 5GAN6 3NTKA 4MDXA 2KROA 3QZ9B 3PNWC 2DE0X 5KE3A 1TUGB 1WHHA 3A7AA 3UA6A 2G6FX 3PE0A 4WF2A 2CSQA 4C92F 5K1XA 2LQ8A 3I55T 3CD6T 1HTTA 3HRKA 2RJFA 2JMAA 5GMKe 3PIOA 1LNXA 2QEXT 3UDCA 3OMCA 3H0HA 4HT4A 3VQYA 3VUZA 3HFZB 2PMFA 5GAN3 5GJVB 1SESA 1B3QA 1ZSZB 3QDFA 1Y7XA 3I55A 1YJ9T 2EYXA 2RQRA 4C8QA 2RMOA 2I0NA 2OJ2A 3JB9H 3CEYA 4Y92A 1G51A 1UJYA 3VRYA 3I7FA 1FYNA 3VQXA 1Y96B 2ECZA 4KULA 2ZNJA 3M56A 2XI9A 2LJ1A 3JCMJ 1H8KA 2I4NA 3L4GA 4E7HA 4DOWA 1LCKA 4OMFB 2W0ZA 5A2QE 2RHQA 1TH7A 4A4EA 4DBHA 2O88A 1PCXA 2YSQA 1X6OA 4AFUC 1O75A 1YFRA 4M77A 1BCMA 4QVZA 3VBBA 1FMKA 2DTIA 1NJ8A 1XJWB 2KY9A 4PJNA 3G6EQ 4KH1B 2DRMA 4XK8E 2I4OA 2LCCA 5LJ3j 4HWPA 3L2ZA 1QCOA 4PFPA 4OF1A 4JZ3A 2YT6A 3KXTA 4J9GA 1M27C 2KEAA 1YWOA 1ASZA 3MQZA 1ZUYA 1OPLA 4YYEA 4HCZA 2QHTA 2GF7A 3MHXA 3E9IA 2DZCA 2CT4A 1PWTA 2MI6A 4YRIA 2ATCB 1NLPC 4TQDA 3V8JA 4M7DD 4K87A 2F5TX 1NYFA 1AWWA 3OA6A 4MZTA 1MV3A 4LUDA 2HKNA 4RMOA 1WU7A 2EYWA 1T0HA 3HFVA 1UG1A 2ZT7A 5LJ5d 4CC7A 4JRPA 2OTLT 3VYHB 1X56A 3JCMg 3OSVA 1WFWA 3FIFA 2LQWA 1J3TA 4AFZC 1N9WA 4QW2A 3LWIA 2PVOB 1M1KC 1JEGA 5HK3A 2KK4A 4L6V5 1KQ2A 1OEBA 1BI2A 1QCNA 2CH4A 4M7AB 1UGSB 2EQMA 1IL2A 3RUXA 4J9CA 3FC3A 2K7AA 3FJ5A 4UP8A 4AT1B 3HFZA 3BFMA 2OTLA 1JXMA 4E7ZA 2JUFA 1PM3A 5GMKl 1QWEA 2CREA 1WXTA 4YRCA 1VUBA 1ZSZA 2HZYA 2FZCB 5CAIA 4XAXB 4PJOC 2CJ9A 4WI1A 2FVUA 4FW1A 4XTVA 4BDYA 1AHJB 3TUPA 1BBUA 1BI1A 2DIQA 3I35A 5FLXE 5LJ5f 5CQYA 1YJWT 2QHSA 3QDRB 6AT1B 2EWNA 3P8HA 4MZPA 2ARTA 4HT8A 1YFSA 1T3LA 1K4US 2QXFA 2O31A 2VC8A 3RL6A 3CCVT 3QYHB 1WLEA 1Q7YU 1B76A 3IALA 3OY9A 4LDWA 4RTTA 2K2MA 4II1A 4PJOF 1VQLQ 3REXA 1SRYA 4LNSA 4PLLA 3VS1A 1MHNA 2YRCA 4KUIA 4UPAA 1YCSB 4O6JA 4C8QE 1E6GA 5CKFA 4ELZC 2RQVA 3LGLA 3CCVA 2NUPB 1UGQB 4UP9A 5C6SA 1SG5A 1MMDA 4J15A 2ALYB 3C4SA 4A53A 2BZ8A 2ZT8A 2RI5A 4PL6A 3OYHA 1I4K1 4R0KA 2FPEA 4RQFA 2RQTA 4GLMA 1WQWA 2FEIA 1G3YA 4M77E 3CCUT 2LZ6B 4DEYA 1KC8C 3MP1A 3UPUA 2OTJQ 3HTZA 4RMFA 2DTOA 4IURA 4FT2A 2KGTA 5GAOp 1X01A 1KK7A 1NYGA 3HRIA 3G4SQ 3EG2A 2EIFA 2K3BA 3RKWA 5DLOA 2L5QA 1VQPQ 1VQKT 2PU9B 1GRIA 1D0YA 3SFMA 1H3ZA 4Q15A 2DXTA 1C0AA 3QBYA 3GBQA 3UGTA 5KYXB 3E1SA 3LX7A 4PKCC 3N5BB 3P8BB 4M7AA 2V8IA 1M90U 1C0MA 4LVKA 3GOXA 4G85A 4KBMB 1VQKA 1VQ9Q 1VOMA 3CCQT 4M75E 2D8JA 2EQIA 1NJ2A 5LJ5e 2X4JA 3LW5E 2ZR3A 5D7UA 2K5FA 1VQNT 4CH5A 2RHSB 3MEAA 4HCKA 5D6YA 1BCOA 1AWJA 5GMKj 5GAN4 4AH6A 2YRDA 3CCST 1VQMQ 2CZ7B 4M78D 2CSIA 1D0ZA 2FYKA 1SHFA 2P0PA 2ARSA 5D6WA 4CC2A 3CCQA 2MWPA 3ZL7C 3CCEQ 1NPPA 4XTUA 2M51A 3FDRA 2COYA 3HFNA 1BBZA 3FB9A 4BACA 1IXDA 3CCSA 2EAYA 1OYXA 3HFOA 1QVGP 5IXBA 2DL4A 5LJ5g 1UGRB 1GGMA 3JB9F 2NUPA 1FX7A 3RERA 2F2WA 1VQLA 4QKUA 3KBGA 1V76A 3A31A 3SEMA 2QASA 3TQ7P 3CXCA 3ZFJA 2ALYA 1B8AA 4KQEA 2HAXA 1VQ8A 3CBPA 5A0DA 3LYIA 3M0UA 2RA2A 3LH5A 2JN0A 4YRFA 4LD6A 4P73A 3OYAA 3CC2A 2VKNA 2C0TA 5A0LA 4TTVA 1TUCA 4FT4A 3MKDA 1GL5A 1AT1B 3FEOA 4Y91A 1MUZA 4H2TA 5AT1B 2X3XD 3GNGA 1ABOA 1U06A 2NUTB 2QDYB 3G71T 2EL9A 2BUDA 2QTXA 3UWNA 5KNNA 2YRVA 4OMPA 4FCYA 2ZTGA 3JCMb 2QA4Q 3GP8A 2LDMA 2LVMA 4KR2A 5IAYA 5CKEA 3OYIA 3E19A 1ZBJA 2K2VA 3AT1B 3R6NA 3TCJA 1D3BB 5KCOA 4DPGA 5AYFA 2KRSA 4D6WA 2RF0A 3PIPA 3ULRB 5KYXA 3CXCS 3G71A 3CMAQ 2E3CA 1R77A 2AMCA 1SHGA 3QJ6A 3DB4A 3HXXA 4M7DC 3I5SA 1RABB 1G5IA 1HK9A 2E10A 2ZPIB 3DSQA 2JS0A 4P3PA 4JZ4A 3H41A 1K76A 2NUZA 3M0QA 1JJCB 2CZ1B 2ENMA 1WHJA 4PJOB 5M9OA 1ABQA 4M78G 1RLQC 1G5HA 2VV5A 3HSBA 2RHSA 4X34A 3A5ZB 3HP9A 5C52B 2M0OA 4IIOA 1UFFA 4J7FA 5A0GA 2JZ2A 3CBMA 3MO8A 2J3MA 4Q6GA 4WJ3M 3WVDB 2ZIMA 1SSHA 4M7DF 3NFCA 1GCPA 4ESRA 5L8RE 1OX8A 4Z89A 5CO7A 3KUFA 3L2RA 1G3SA 4K88A 2HDAA 4X9CA 2FZKB 1I5OB 3MEYA 3EGDB 1HSQA 3RBBB 2VXFA 2QHUA 2ABLA 3CQTA 2KYMA 4EPCA 3OYLA 4LE9A 1MNDA 1ARKA 3OYCA 2ESWA 1E22A 3IKMB 4B6MA 4HT9A 1TOVA 7AT1B 1M1KU 3J7AF 3EHRA 3HHTB 2Y90A 2XHCA 3CCLA 2KXCA 3UFGA 2DTHA 3RDVA 2RO0A 1RLPC 4OLFA 9ATCB 4IUPA 5FRNA 1E7OA 1OULA 3SWNA 3IG2A 1XOVA 3MF1A 4DBRA 2J06A 4JLGA 2GFUA 5GAMf 4J8OA 1Q86R 2ED1A 3H6ZA 1YHQT 3RMSA 2ZZFA 2F2XA 4EMKA 2YLBA 2DU7A 4P75C 1GBQA 3CCJQ 2DRKA 3LSQA 2NUTA 2MMPA 1X69A 2BZXA 1G2BA 1YWPA 4M7AC 4EDUA 2KR3A 1QW1A 3M59A 4BE2A 4P5NA 2LRQA 4KH0B 5KYUB 3OSSC 3VQWA 2EKOA 4X9DA 4XEMA 4C92E 2KI7A 1D3BA 3WQZA 1YIJA 3KFVA 1ADJA 5GAOq 3L2WA 2Z0WA 1BI0A 1GBRA 2XGTA 2G4CA 2MK5A 1M9SA 1W6XA 2DBKA 3CD6Q 1HYOA 1AVZC 4QVCA 4HWRA 2DVJA 5IHNA 4FYYB 4M7AF 3CMQA 2C0OA 1JJCA 4PJOA 3MEUA 2DD5A 4MZMA 3L42A 1QVPA 1H641 2DYBA 3M4PA 2VB6A 2IVWA 3A8OB 1R0BG 2VUBA 2C8MA 4H2VA 3QO3A 4QT7A 1USYC 2CH4W 4KRTA 1QLYA 5HKCA 4E7LA 3QUIA 3V7CA 2OAUA 2FPFA 2P5IA 4AG2C 4C0DB 1KC8U 1E1OA 3HTRA 4C5HA 1KD1R 3RR6A 3EGXA 5LJ5j 2FZGB 3JSCA 4L87A 1YI2T 4MMLA 2MCNA 2A28A 1FXXA 2BKDN 2Y4XA 4H2SA 3EGDA 4RDXA 3W3SA 4A63B 2LP5A 4A4GA 4P73C 1N9SA 5CVIA 5KH6A 3AHUA 1OZ2A 2LT4A 1NBEB 3S3OA 4AFQC 5I22A 1M1GA 1OU8A 3HXYA 3Q1JA 1QWFA 5GAN2 4FU6A 1YITQ 3P8TA 1XQHA 1KIKA 1G5VA 2HSEB 1VQ7A 4F7UF 1UDLA 2HBPA 1SRMA 2AHJB 1Q82C 3QTCA 2ZPHB 5CKDA 5GAMe 2QDLA 1PRMC 1H3HA 3OYEA 3UT1A 3WXMB 2HSPA 4E7IA 4PHCA 1YFTA 3JAME 2A3LA 2RJEA 4H2WA 2J05A 1ZX6A 4LDVA 2IIMA 3NTIA 2LCSA 2COWA 5FROA 4TVWA 4NOYA 1YFNA 5KYUA 4BE0A 2NWMA 3VUBA 3PCOB 5C53B 4ZTJA 5GAMg 4BY6C 5LJ3h 1WJQA 2RHUA 4ZGEB 3PVLA 1EQRA 4FSXA 1NYRA 2H8HA 2CUDA 1S1NA 4B9WA 2RK1A 1VQOA 4DBQA 2YUQA 4M7DB 1M8VA 1H92A 1VYTA 3MP8A 5ECAA 2M9UA 1YBYA 4CH3A 1W1FA 3OYKA 1ZA1B 2KDSA 4JUVA 3DB3A 2GQIA 2E3HA 4OP0A 3O5ZA 4JRIA 4J9IA 1JRIA 2ZNIA 2KE9A 2GNCA 3RACA 1OI1A 3I5RA 4LD9K 2RB6A 2M02A 2ZPGB 4YDQA 3CPFA 3P8DA 4P74C 2PZ1A 3JB9I 4PNOA 4C5EA 1EX4A 5I2SA 4DQ2A 3M58A 4PJOE 2K5IA 3OQ5A 3SB2A 3OBYA 1J5WA 3CCRQ 2KMTA 1I8FA 2EGAA 4EIKA 1SPKA 3LH0A 5HY6A 1WHLA 3SWNC 2PMEA 2KAFA 3HRUA 5K1PA 5IHKA 1NG2A 2I4LA 3DLLA 5GAOr 1RAHB 3CBOA 3CCMA 3I56Q 2I4MA 3NETA 3M54A 4EMKC 3M5AA 4C8QG 1U8RA 2CP3A 5IXFA 1B7TA 4E7JA 4L59A 1YJNA 2EGCA 4HVWA 2O2OA 4YRLA 3LLRA 2EQKA 3VS5A 4OGCA 8ATCB 3PTAA 3CCUQ 2EQJA 2XMFA 1Q86C 4M77G 2MF2A 1WHGA 3MEVA 4HVUA 4CRIA 1WJRA 3UGQA 2EJFA 2HD0A 2VWFA 3VS7A 2KRNA 2GGRA 5IT9E 3A8LB 1H4TA 3TU4K 2LX7A 2XIDA 2ZCEA 4F04B 3PCOA 2X4WA 1ADYA 1FMVA 4A4FA 1BIBA 3GPLA 1HXDA 3TEHB 5GANd 2KT1A 1KMNA 3OYJA 2HQHA 1PC0A 2EYYA 4M7DA 2E65A 4FYWB 2BE9B 2XKOC 4BI4A 1TU0B 2ROTA 2DYIA 1V29B 1NE8A 1WIEA 1E6HA 2XDPA 3U23A 3EFOB 2PVGB 1WDXA 4MDWA 4HKEA 1NJ6A 4IUVA 4D8KA 5FW9A 3G6ET 3PGGA 1B70B 3CC7Q 3OBWA 1NYQA 3J81E 1VIEA 4M75G 4ZN3A 3VKIA 1SF9A 1JB0E 5FWBA 3EHQA 4E6RA 3NEMA 1Z7MA 2FG0A 3C0CA 5GANf 1KJWA 3CC4Q 4IUQA 2O9SA 1MGQA 4F7UB 4FIBA 1KD1C 3G6EA 5GAN8 2FRWA 4JRKA 3CMEQ 4A4KA 2L0AA 1IHWA 2PTKA 3TREA 1IREB 4OMQA 4RTVA 1RI9A 1VQ6Q 1ACMB 2L3PA 3ZBDA 4N4IA 4LVIA 5ELNA 1BYMA 3KFUA 4BE1A 2A0FB 4M78B 2I2LA 1X6GA 3R6OA 1YNZA 5FRMA 2NS6A 3TEGA 4H2XB 2ZAEA 4J6WA 2JMCA 3M0RA 1FWZA 1U5SA 4Z02A 2IY5B 3UH0A 1G8XA 3RMQA 3A5YA 5GMKh 3EH1A 3RGLA 3I56A 1WX6A 3NGPA 4OMLA 3VU3C 4YRQA 4YP0A 2RH2A 1TSFA 2OAWA 3L2QA 4RG8A 4P75A 4RTUA 3VS2A 2AMCB 3QO8A 4O2DA 2DQ0A 5GAMj 1OQKA 2KYBA 4M4ZA 3VV0A 4C5IA 3RESA 1NNHA 2HEQA 1PYSB 4H02A 2DNUA 4H2YA 4BY6B 4P72C 3TEHA 2XDBA 3X26B 2CZ6B 2A37A 3A8MB 4F16A 3X28B 1Z9ZA 2X4XA 1X2HA 3J80E 1PD0A 1C1AA 4C0DC 4OMOA 3EFOA 1X75C 4XU0A 1VQLT 2E5QA 4DOVA 3INZA 2E6NA 2Q7GA 4C92D 1EVLA 2LX9A 3VJPA 3JCMc 1EOVA 1CKAA 4FL6A 3A98A 2JTEA 1USYA 1VQ8T 1KFZA 4ZN1A 1Q82U 1UUEA 1VQ4Q 2RD1A 1B70A 4X5OA 5L23A 2LMJA 3JCMh 2F2VA 3C12A 5GANe 4BDZA 3CC2T 1K0SA 2D1XA 4FSSA 3EG3A 3M0PA 4M7DE 3RF1A 1ZHIA 3TEEA 3OS5A 3VYGA 3A7UA 3G1ZA 4F7UA 2ZIOA 1F1BB 2FPDA 1IGUA 1UJ0A 2ZT5A 1NJIR 1IB8A 1S72Q 2B86A 3IKLA 1LJOA 2A36A 3PFSA 1SERA 4L5GA 4CH4A 1U1SA 1EZZB 1K73R 3SWNB 1QVGA 2K3XA 4IUTA 3G4ST 3CMEA 3M4QA 3FJPA 4DA4A 3UF4A 1W2BP 5GANg 4M78A 3V7SA 4EMKB 2DJQA 1VQPT 4H2XA 5FWCA 1NJ5A 1W66A 3EG0A 4YCWA 2IY5A 2RJCA 3MCAB 2OTJA 1KG1A 4LVJA 4LVLA 3C94A 3NELA 1JJ2P 4YRSA 4J9BA 4IUUA 2RHZA 3G4SA 2JJ9A 1M2OA 1NEBA 1HD3A 2DLPA 3A32A 3H0FA 2CS7A 3VRZA 3SD4A 4PJLA 1VQPA 2B8AA 5E3IA 1WLPB 5J26A 1RL2A 1VQ9T 5KYNA 2SEMA 3BY7A 1PKTA 2RHXA 1RAFB 2JVVA 3I9QA 2DEQA 2L3RA 2DL7A 1PYSA 4CH6A 3RNJA 1AWXA 5CK9A 3OYGA 3E9GA 2NLUA 4PFZA 1Y71A 3H9NA 1CSKA 1JJ2A 1QVGS 4QVDA 1I0CA 4ATOA 1VQ9A 1X55A 4MMKA 1OX9A 2KSSA 3QYGB 4NS5A 1K9AA 3CCET 4J6XA 4C92G 1PHTA 1K9MR 1T0JA 4M7AE 1QF6A 1TUDA 2WACA 1EVKA 2JOYA 3HXVA 5IN1A 2O9VA 1K8AR 1BK2A 3TVTA 1IHVA 3QZ5B 1QVFP 2SRCA 1VQMA 1QP2A 4TWAA 2K79A 2MOXA 2DAQA 2QTVA 2QAZA 2EKHA 3EGXB 4QQGA 2X35A 3MEWA 5GAMd 4QQ6A 2ARUA 3CCLT 2M0YA 4J9HA 11ASA 5DM7R 4HWOA 3CCEA 3OMGA 1NEGA 1RI0A 2CP6A 2CGHA 2GTJA 3S3MA 4P74A 2ED0A 3S6WA 1W70A 4EMHA 1Q86U 2EVRA 3M57A 4J6YA 2ZT6A 3M0TA 3RIRA 1UE9A 2YDLA 1E1TA 2DF6A 2P4TA 5GJWB 2NYSA 1JJ2S 4XU3A 2CP2A 3M4GA 2YUPA 4E47A 1YI2Q 1AZGB 4Q5WA 2AZSA 1GFCA 4LUEA 2DMOA 4ORZA 4YROA 3EG1A 4IKFA 2DX1A 1VQ5Q 3M0SA 4JJBA 1I07A 1ASYA 2YUOA 3EGUA 4ZGDB 1AD5A 2AK5A 3CPWP 3A8HB 4IIMA 1YIJT 1BU1A 1PSEA 4RG2A 4AMCA 4F7UE 1Q95G 4F14A 2PUKB 2FRYA 2FB7A 3BW1A 4HWSA 1D1AA 5DLQE 1JXOA 2OX7A 3QHSA 1PNJA 5FU7C 2CDTA 3NTHA 1UGVA 1M5Q1 3QO7A 1LOJA 2DM1A 1A0NB 3L1AA 3QXEB 1UTIA 4FYXB 4LXCA 4LDXA 3C95A 4WTOB 2O01E 3L2UA 5LJ5h 2QA4A 4BD3A 4HCCA 2QI2A 2DXBA 1ATIA 2RQUA 3CPWA 1QP3A 3EAEA 3I55Q 2QK0A 2P0QA 1BI3A 2GBQA 1KQSP 4PG3A 2E1HA 2QEXQ 3CMAA 4J9DA 1WI7A 2M1HA 1KD1U 2FHDA 3ICAA 2RI3A 1EIFA 4F17A 1FYFA 3NMZC 4JS4A 1N8RR 1ZUKA 1YJ9Q 2J7IA 3HKSA 3EFRA 4YCVA 2ZPEB 2K57A 2QYZA 4BI3A 2JXBA 3M9QA 2DEUA 2VASA 1EFWA 1KQSA 1KQ1A 4KR3A 1H4QA 2RN8A 2DK3A 1VQ7T 1MMGA 1U3OA 3GNFB 3NPFA 4R55A 1E24A 3JCMX 1R8OB 4BWAA 4KGZB 4E7KA 3CPWS 2MYSA 4ZIBA 4TVAB 2J3LA 2VXEA 4YPFA 1PRLC 5FU6C 4M78C 3PMIA 1OOTA 2LNVA 3QG1A 2R5AA 1ZLMA 5CCAA 3ER0A 4C5GA 1NJIC 5GANj 4AFSC 4C8QD 1VYUA 1PG5B 3CCJT 3X25B 4PJOG 1QE0A 1LPLA 4FW2A 2BE7D 1K73C 1WJSA 2LQKA 2RNAA 3A1PA 1M1FA 3EFSA 2RM4A 4JPBW 2EGEA 3GLXA 1HJDA 1KQSS 2DILA 4M78F 1VQOT 2XTIA 1M3AA 1XNIA 1Q81R 3DKMA 2X4YA 5GAN5 4M75B 1UB4A 5CQXA 3OYDA 3CCJA 3JB9D 2ODRD 4M77D 2E12A 3PMTA 5GAOm 4N0AC 1RIQA 3QKJA 2OTLQ 5I2MA 1NLOC 1ZBXA 1MMNA 2LQNA 1AZEA 3OD1A 3JRZA 4N4GA 2CT3A 1QMCA 1TTHB 4WJ4A 1TG0A 2XG8D 1RAIB 2WSEE 2DJZA 3L2VA 2JTMA 1YB3A 2RQWA 3JV3A 5LL6S 4P72A 2DFUA 3CD6A 2QGFB 2CJBA 4LVMA 4YRJA 2KNBB 2QEXA 1EFNA 1BIAA 1Z7NA 1Y57A 2DDZA 2A7YA 4ME7A 4PK4A 4GLKA 2LNHB 2Q5HA 2KQWA 1R0CB 2JT4A 2QQ9A 1YJWQ 3JCMQ 1K9MC 5C51B 1WHKA 1PSFA 4M75D 1RADB 1YJ9A 1YGBA 1D1BA 5KCHA 3OYBA 1RAEB 1K8AC 3CCMT 2E3IA 1RAAB 5KYYB 3CCVQ 4RCCA 1X54A 1ZUUA 3OYYA 2RHIA 2RJDA 5C0MA 2AIRB 2K6DA 4FYVB 2IPOB 4H2UA 1C6VX 4P3NA 5HGQA 1YITT 3REAB 1YJNT 1U1TA 4JRQA 4YRMA 5HK0A 1UHFA 1UEBA 2AKLA 4AG1C 4TVAA 2JNGA 2DKGA 2HMAA 3REBB 4E51A 3SDZA 2L89A 3VS0A 3JCMe 1M2VB 1Y07A 1YCYA 2MWOA 5I11A 2DO3A 2L3SA 3HY0A 3LC0A 2C0IA 4BI8B 1UGPB 3A8GB 1YITA 2P0LA 5I21A 3OS0A 4NL2A 1TXQA 4J9EA 1X2KA 4UP7A 2DXCA 2Q7EA 1IZ6A 5F5WA 2KXDA 3JB9G 1YP5A 4OMMA 2CP0A 2HKQB 4M75A 5FU7B 3M53A 2QG9B 2MPXC 2XD0A 1XTDA 2W10A 2DQ3A 1OV3A 2V1RA 1WZOA 5KYWB 1VQKQ 2DD4A 4XTYA 2CJAA 1P92A 8AT1B 3QJYA 3HXZA 2MIOA 4D8DA 3NHNA 1UECA 1K0XA 4TVRA 2JW4A 1Z9QA 1JBMA 4HXJA 2D8HA 4P71C 4K86A 2E64A 4P3OA 3JCMP 2XU8A 2E6ZA 4RTXA 3CCQQ 2E5KA 4OB0B 4UC4A 4EO4A 1IO6A 5ELOA 2XK0A 1Y96A 3EG9B 4ELYC 1QKXA 1I1JA 2WSFE 4X1VA 1N8RC 1VQNQ 1ZQ1A 3IQLA 1N9RA 1GCQA 3CCSQ 1OU9A
chains in the Genus database with same CATH topology
3HPWA 2Q5IA 3CCRT 3ME9A 2E70A 3V8LA 3HL8A 4PLIA 1H4VB 1DJ7B 2L8DA 3E9FA 1KOGA 1YJWA 3PT9A 3OS2A 4VUBA 4QQDA 3I56T 5GAMh 4M7AD 4TVYA 1M4ZA 4A54A 3CCRA 4XTXA 1B34B 5FU6B 2R57A 1I81A 4YTLA 4LDUA 4GY5A 4KT0E 4M7DG 4YRNA 4HCBA 4O5VA 3OYNA 1GXIE 4FM4B 2F69A 3H8ZA 4C92B 2DVEA 2DXUA 1BBWA 4OGEA 4YRRA 3HRSA 2G3RA 2WSCE 3A74A 3MP6A 2K3YA 4OB1B 3T9NA 3LSSA 2R58A 5D6XA 1H4SA 2JTFA 2MAMA 5LJ3d 3F70A 5CR2A 3CCUA 2HQEA 3OYMA 1Q81C 2ZZDA 2DZ9A 2LC4A 2GQVA 2LT1A 2LTOA 5KE2A 4C8QC 3RKXA 2D6FA 2V8JA 5GAOl 1HC7A 4N4HA 2GFAA 2ZR2A 3CC7T 3QO5A 2RK2A 5LJ3f 3ERRA 1NJIU 3VQVA 2ODRC 3CC4T 4M77C 4JS5A 3RKYA 2D0QB 2HQXA 1VQZA 4C8QF 3V8KA 2VGMA 1K73U 1B7YB 3ASKA 2XDDA 3CC7A 3CMET 3QIIA 1SSFA 1VQNA 3ZEHA 4M7AG 3CC4A 4XTWA 1VQ6T 3HXUA 2OTJT 3QNEA 3FLGA 1WGSA 2ZPBB 4M77F 4XEOA 2DU5A 3GIBA 2ZCFB 4ZTFA 1WNLA 2QQBA 1B34A 4YRTA 2ZINA 1KHIA 2P0KA 2M16A 2R5MA 1KMMA 1L0WA 2PQWA 1VQ6A 2F5KA 5CKHA 2O4XB 2K4YA 2V8KA 4C0ZA 4M75C 4C92A 3QSUA 2CIMA 2C06A 1G3TA 5CIUA 4YRGA 2EJ9A 3V7RA 3MF2A 3OYFA 1W2BA 1NJ1A 1NPRA 3FRNA 4CS4A 1K9MU 3OW2A 2VGNA 4ZTZB 4V2SA 4N0AA 4M75F 3P8VA 3GF5A 4JDSA 1K8AU 4J5YA 4F7UG 1VQMT 4XU1A 3HRTA 3OB9A 4EMGA 5J39A 3X20B 4HA8A 2Y4YA 2QQSA 4J83A 2Q7HA 5J3BA 1LYLA 3A7RA 2AKWB 4OB2B 3LWHA 2A8EA 2ZGWA 4HWTA 5LJ3e 1VQ4T 2YHTA 2CZ0B 4ZTUB 4CS3A 1EIYB 12ASA 4RKUE 4Y28E 3G7ZA 2FL7A 4BUGA 1VIFA 2DIGA 3QPHA 1B7YA 1W2BS 3WVEB 4OVAA 1VQ4A 1S72T 4RCBA 3OS1A 4KUDK 2EYQA 2IG0A 3OW2S 4YCUA 4ZGJB 5GAN7 4XU2A 2QHVA 2D9TA 5GMKi 2XICA 1QVFA 3S3NA 5LJ3g 1OZ3A 3DLMA 2RHYA 4YRKA 1O9SA 3REUA 4R56A 1S72A 2EQUA 2EFIA 4B9XA 2K5LA 1I5LA 4C0GA 1Q7YC 3HXWA 2YLCA 5EG2A 4A4HA 1KHCA 4PJOD 4G84A 2QA4T 1WQ7A 3BJUA 2O4XA 4LDYA 2RI2A 1NZ9A 4XTZA 2CKKA 5GMKm 1WYDA 3CMAT 3HY1A 1W4SA 1X2GA 2E5AA 1WPYA 4BB7A 2PUOB 2KVQG 4BW9A 2H3JA 3NENA 4M78E 4RQEA 4OB3B 1N8RU 2PVDB 4HVCA 1QVFS 1YHQA 5CKBA 2ZXFA 4CS2A 1G3WA 4C8QB 2E41A 3E9HA 3META 5DY9A 4EX5A 2AKWA 2QQAA 3BDUA 5GANh 3JB9J 2BIVA 2LCLA 2ZZGA 5GAOn 4P71A 3L4GB 3JCMd 1N27A 2ZZEA 4TQFA 2RHQB 1EIYA 2CYZB 4YRPA 4C0FA 3A5ZA 3M4YA 1SETA 4M77B 1N6AA 1M90C 3O8VA 4YREA 3R07A 3URGA 4NCXA 4J7IA 3JCMV 2VYTA 3X24B 2GCXA 2EJGA 2DPPB 3LGFA 3BDLA 2HNIA 4JJNK 1VQ5T 3PZCA 3JCMf 1Q81U 4C92C 4CI0C 2ZPFB 1YI2A 3M55A 4NL3A 1BKBA 4JLIA 2C7IA 2QQRA 4XQ3A 3P8YA 3JCMW 1VQ5A 5GAN6 3NTKA 4MDXA 3QZ9B 3PNWC 5KE3A 3A7AA 4WF2A 4C92F 5K1XA 2LQ8A 3I55T 3CD6T 1HTTA 3HRKA 2RJFA 5GMKe 3PIOA 1LNXA 2QEXT 3UDCA 3OMCA 4HT4A 3VQYA 3VUZA 3HFZB 2PMFA 5GAN3 1SESA 1Y7XA 3I55A 1YJ9T 4C8QA 3JB9H 3CEYA 1G51A 3I7FA 3VQXA 1Y96B 4KULA 2ZNJA 3M56A 2XI9A 3JCMJ 2I4NA 3L4GA 4E7HA 4DOWA 4OMFB 5A2QE 2RHQA 1TH7A 4A4EA 1X6OA 1O75A 1YFRA 4M77A 4QVZA 3VBBA 2DTIA 1NJ8A 2KY9A 4XK8E 2I4OA 2LCCA 5LJ3j 4HWPA 3L2ZA 4OF1A 3KXTA 1ASZA 3MQZA 4YYEA 4HCZA 2QHTA 2GF7A 3MHXA 3E9IA 2DZCA 2MI6A 4YRIA 4TQDA 3V8JA 4M7DD 4K87A 2F5TX 3OA6A 4MZTA 4RMOA 1WU7A 3HFVA 2ZT7A 5LJ5d 4JRPA 2OTLT 3VYHB 1X56A 3JCMg 3OSVA 3FIFA 1N9WA 4QW2A 3LWIA 2PVOB 1M1KC 5HK3A 2KK4A 4L6V5 1KQ2A 1BI2A 4M7AB 1UGSB 2EQMA 1IL2A 3RUXA 3FC3A 4UP8A 3HFZA 3BFMA 2OTLA 2JUFA 5GMKl 4YRCA 1VUBA 5CAIA 4XAXB 4PJOC 2CJ9A 4WI1A 2FVUA 4XTVA 4BDYA 1AHJB 3TUPA 1BBUA 1BI1A 2DIQA 5FLXE 5LJ5f 5CQYA 1YJWT 2QHSA 3QDRB 2EWNA 3P8HA 4MZPA 2ARTA 4HT8A 1YFSA 2QXFA 2VC8A 3RL6A 3CCVT 3QYHB 1WLEA 1Q7YU 1B76A 3IALA 3OY9A 4LDWA 4II1A 4PJOF 3REXA 1SRYA 4LNSA 4PLLA 1MHNA 4KUIA 4UPAA 4O6JA 4C8QE 5CKFA 4ELZC 3LGLA 3CCVA 1UGQB 4UP9A 5C6SA 4J15A 2ALYB 3C4SA 4A53A 2ZT8A 2RI5A 4PL6A 3OYHA 1I4K1 4RQFA 1WQWA 1G3YA 4M77E 3CCUT 1KC8C 3MP1A 3UPUA 3HTZA 4RMFA 2DTOA 4IURA 4FT2A 5GAOp 1X01A 3HRIA 2EIFA 3RKWA 5DLOA 2L5QA 1VQKT 2PU9B 3SFMA 1H3ZA 4Q15A 2DXTA 1C0AA 3QBYA 3UGTA 3E1SA 3LX7A 4PKCC 3N5BB 3P8BB 4M7AA 2V8IA 1M90U 4LVKA 3GOXA 4G85A 4KBMB 1VQKA 3CCQT 4M75E 1NJ2A 5LJ5e 2X4JA 3LW5E 2ZR3A 2K5FA 1VQNT 4CH5A 2RHSB 3MEAA 5D6YA 5GMKj 5GAN4 4AH6A 3CCST 2CZ7B 4M78D 2FYKA 2P0PA 2ARSA 5D6WA 3CCQA 2MWPA 1NPPA 4XTUA 3FDRA 3HFNA 3FB9A 4BACA 3CCSA 2EAYA 1OYXA 3HFOA 5LJ5g 1UGRB 1GGMA 3JB9F 1FX7A 3RERA 1VQLA 3KBGA 3A31A 3CXCA 3ZFJA 2ALYA 1B8AA 4KQEA 2HAXA 1VQ8A 3CBPA 5A0DA 3LYIA 2RA2A 2JN0A 4YRFA 4LD6A 4P73A 3OYAA 3CC2A 5A0LA 4TTVA 4FT4A 3FEOA 4Y91A 4H2TA 3GNGA 2QDYB 3G71T 2EL9A 2BUDA 2QTXA 3UWNA 5KNNA 2YRVA 2ZTGA 3JCMb 3GP8A 2LDMA 2LVMA 4KR2A 5IAYA 5CKEA 3OYIA 3E19A 2K2VA 3TCJA 1D3BB 5KCOA 4DPGA 5AYFA 4D6WA 3PIPA 3CXCS 3G71A 2E3CA 2AMCA 3QJ6A 3DB4A 3HXXA 4M7DC 1G5IA 1HK9A 2E10A 2ZPIB 3DSQA 4P3PA 1JJCB 2CZ1B 4PJOB 5M9OA 4M78G 1G5HA 2VV5A 3HSBA 2RHSA 4X34A 3A5ZB 3HP9A 5C52B 2M0OA 4J7FA 5A0GA 2JZ2A 3CBMA 3MO8A 2J3MA 4Q6GA 4WJ3M 3WVDB 2ZIMA 4M7DF 3NFCA 5L8RE 5CO7A 3KUFA 3L2RA 1G3SA 4K88A 4X9CA 3MEYA 2VXFA 2QHUA 4EPCA 3OYLA 3OYCA 1E22A 3IKMB 4HT9A 1M1KU 3J7AF 3HHTB 2Y90A 2XHCA 3CCLA 3UFGA 2DTHA 2RO0A 4OLFA 4IUPA 5FRNA 3SWNA 3IG2A 1XOVA 3MF1A 4JLGA 2GFUA 5GAMf 4J8OA 3H6ZA 1YHQT 3RMSA 2ZZFA 4EMKA 2YLBA 2DU7A 4P75C 3LSQA 2MMPA 4M7AC 4EDUA 1QW1A 3M59A 4BE2A 4P5NA 2LRQA 3OSSC 3VQWA 2EKOA 4X9DA 4XEMA 4C92E 1D3BA 3WQZA 1YIJA 1ADJA 5GAOq 3L2WA 1BI0A 2XGTA 2G4CA 1M9SA 4QVCA 4HWRA 3CMQA 4M7AF 1JJCA 4PJOA 3MEUA 2DD5A 4MZMA 3L42A 1QVPA 1H641 3M4PA 3A8OB 2IVWA 2VUBA 2C8MA 4H2VA 3QO3A 1USYC 5HKCA 4E7LA 3QUIA 3V7CA 2OAUA 2P5IA 4C0DB 1KC8U 1E1OA 4C5HA 5LJ5j 3JSCA 4L87A 1YI2T 4MMLA 1FXXA 2BKDN 2Y4XA 4H2SA 4RDXA 3W3SA 4A4GA 4P73C 1N9SA 5CVIA 5KH6A 3AHUA 1OZ2A 2LT4A 3S3OA 1M1GA 3HXYA 3Q1JA 5GAN2 4FU6A 3P8TA 1XQHA 1G5VA 1VQ7A 4F7UF 2HBPA 2AHJB 1Q82C 3QTCA 2ZPHB 5CKDA 5GAMe 3OYEA 3UT1A 3WXMB 4E7IA 4PHCA 1YFTA 3JAME 2A3LA 2RJEA 4H2WA 4LDVA 3NTIA 5FROA 4TVWA 4NOYA 4BE0A 3VUBA 3PCOB 5C53B 4ZTJA 5GAMg 4BY6C 5LJ3h 1WJQA 2RHUA 1EQRA 4ZGEB 4FSXA 1NYRA 4B9WA 2RK1A 1VQOA 4M7DB 1M8VA 3MP8A 2M9UA 1YBYA 4CH3A 3OYKA 2KDSA 4JUVA 3DB3A 4OP0A 4JRIA 1JRIA 2ZNIA 3RACA 1OI1A 4LD9K 2RB6A 2ZPGB 4YDQA 3CPFA 3P8DA 4P74C 3JB9I 4PNOA 4C5EA 5I2SA 4DQ2A 3M58A 4PJOE 2K5IA 3OQ5A 3SB2A 3OBYA 1J5WA 2KMTA 1I8FA 5HY6A 3LH0A 3SWNC 2PMEA 2KAFA 3HRUA 5K1PA 2I4LA 3DLLA 5GAOr 3CBOA 3CCMA 2I4MA 3NETA 3M54A 4EMKC 3M5AA 4C8QG 1U8RA 4E7JA 4L59A 1YJNA 4YRLA 3LLRA 2EQKA 4OGCA 3PTAA 2EQJA 1Q86C 4M77G 2MF2A 3MEVA 4CRIA 1WJRA 3UGQA 2EJFA 2HD0A 5IT9E 3A8LB 1H4TA 2ZCEA 3TU4K 2XIDA 3PCOA 2X4WA 1ADYA 4A4FA 1BIBA 3GPLA 1HXDA 3TEHB 5GANd 1KMNA 3OYJA 4M7DA 2E65A 2XKOC 4BI4A 1V29B 1NE8A 2XDPA 2PVGB 4MDWA 4HKEA 1NJ6A 4IUVA 3G6ET 3PGGA 1B70B 3OBWA 1NYQA 3J81E 1VIEA 4M75G 4ZN3A 3VKIA 1JB0E 3NEMA 1Z7MA 5GANf 4IUQA 1MGQA 4F7UB 4FIBA 1KD1C 3G6EA 5GAN8 4JRKA 4A4KA 3TREA 1IREB 3ZBDA 4N4IA 4LVIA 5ELNA 1BYMA 3KFUA 4BE1A 4M78B 2I2LA 3R6OA 5FRMA 2NS6A 3TEGA 4H2XB 4J6WA 1FWZA 4Z02A 2IY5B 3UH0A 3RMQA 3A5YA 5GMKh 3RGLA 3I56A 3VU3C 4YRQA 4YP0A 2RH2A 3L2QA 4RG8A 4P75A 2AMCB 3QO8A 4O2DA 2DQ0A 5GAMj 3VV0A 4C5IA 3RESA 1NNHA 1PYSB 4H02A 4H2YA 4BY6B 4P72C 3TEHA 2XDBA 3X26B 2CZ6B 3A8MB 3X28B 2X4XA 1X2HA 3J80E 4C0DC 1VQLT 1X75C 4XU0A 2E5QA 4DOVA 3INZA 2E6NA 2Q7GA 4C92D 1EVLA 2LX9A 3VJPA 3JCMc 1EOVA 4FL6A 1USYA 1VQ8T 4ZN1A 1Q82U 2RD1A 1B70A 4X5OA 3JCMh 3C12A 5GANe 4BDZA 3CC2T 4M7DE 3RF1A 1ZHIA 3TEEA 3OS5A 3VYGA 3A7UA 3G1ZA 4F7UA 2ZIOA 2ZT5A 3IKLA 1LJOA 3PFSA 1SERA 4L5GA 4CH4A 1U1SA 3SWNB 1QVGA 2K3XA 4IUTA 3G4ST 3CMEA 3M4QA 3FJPA 4DA4A 5GANg 4M78A 3V7SA 4EMKB 1VQPT 4H2XA 1NJ5A 1W66A 4YCWA 2IY5A 2RJCA 3MCAB 2OTJA 1KG1A 4LVJA 4LVLA 3C94A 3NELA 4YRSA 4IUUA 2RHZA 3G4SA 3A32A 2CS7A 3SD4A 1VQPA 2B8AA 5E3IA 5J26A 1RL2A 1VQ9T 3BY7A 2RHXA 2JVVA 2DEQA 2L3RA 1PYSA 4CH6A 5CK9A 3OYGA 3E9GA 2NLUA 1Y71A 1JJ2A 1QVGS 4QVDA 4ATOA 1VQ9A 1X55A 4MMKA 2KSSA 3QYGB 4NS5A 3CCET 4J6XA 4C92G 4M7AE 1QF6A 2WACA 1EVKA 2JOYA 3HXVA 5IN1A 3QZ5B 1VQMA 1QP2A 4TWAA 2X35A 4QQGA 2DAQA 3MEWA 5GAMd 4QQ6A 2ARUA 3CCLT 11ASA 5DM7R 4HWOA 3CCEA 3OMGA 1RI0A 2CGHA 3S3MA 4P74A 3S6WA 4EMHA 1Q86U 3M57A 4J6YA 2ZT6A 3RIRA 1E1TA 2P4TA 1JJ2S 4XU3A 3M4GA 4E47A 4Q5WA 4YROA 4IKFA 1ASYA 4ZGDB 3A8HB 1YIJT 1PSEA 4RG2A 4F7UE 2PUKB 3BW1A 2FB7A 4HWSA 5DLQE 3QHSA 5FU7C 3NTHA 1M5Q1 3QO7A 1LOJA 3L1AA 3QXEB 4LDXA 3C95A 2O01E 3L2UA 5LJ5h 2QA4A 4BD3A 4HCCA 2QI2A 2DXBA 1ATIA 3CPWA 1QP3A 3EAEA 2P0QA 1BI3A 4PG3A 2E1HA 3CMAA 2M1HA 1KD1U 2FHDA 3ICAA 2RI3A 1EIFA 1FYFA 4JS4A 3HKSA 3EFRA 4YCVA 2ZPEB 2K57A 4BI3A 3M9QA 1EFWA 1KQSA 1KQ1A 4KR3A 1H4QA 2DK3A 1VQ7T 3GNFB 4R55A 1E24A 3JCMX 1R8OB 4BWAA 4E7KA 3CPWS 4ZIBA 4TVAB 2J3LA 2VXEA 4YPFA 5FU6C 4M78C 3PMIA 2LNVA 3QG1A 2R5AA 5CCAA 3ER0A 4C5GA 1NJIC 5GANj 4C8QD 3CCJT 3X25B 4PJOG 1QE0A 1K73C 1WJSA 2LQKA 1M1FA 3EFSA 2RM4A 3GLXA 1KQSS 4M78F 1VQOT 2XTIA 1XNIA 3DKMA 2X4YA 5GAN5 4M75B 1UB4A 5CQXA 3OYDA 3CCJA 3JB9D 2ODRD 4M77D 2E12A 3PMTA 5GAOm 4N0AC 1RIQA 3QKJA 5I2MA 1ZBXA 3OD1A 3JRZA 4N4GA 4WJ4A 2XG8D 2WSEE 2DJZA 3L2VA 2JTMA 1YB3A 5LL6S 4P72A 3CD6A 2CJBA 4LVMA 4YRJA 2QEXA 1Z7NA 1BIAA 2DDZA 2A7YA 4ME7A 4GLKA 2Q5HA 2KQWA 2QQ9A 3JCMQ 1K9MC 5C51B 1PSFA 4M75D 1YJ9A 1YGBA 5KCHA 3OYBA 1K8AC 3CCMT 1X54A 4RCCA 3OYYA 2RHIA 2RJDA 5C0MA 4H2UA 4P3NA 5HGQA 1YITT 1YJNT 1U1TA 4JRQA 4YRMA 5HK0A 1UEBA 4TVAA 2JNGA 2DKGA 4E51A 3SDZA 2L89A 3JCMe 1Y07A 1YCYA 2MWOA 2DO3A 3HY0A 3LC0A 4BI8B 1UGPB 3A8GB 1YITA 2P0LA 5I21A 3OS0A 4NL2A 4UP7A 2DXCA 2Q7EA 1IZ6A 5F5WA 3JB9G 4M75A 5FU7B 3M53A 2XD0A 1XTDA 2DQ3A 2DD4A 4XTYA 2CJAA 1P92A 3QJYA 3HXZA 4TVRA 1JBMA 4P71C 4K86A 2E64A 4P3OA 3JCMP 2XU8A 2E6ZA 4OB0B 4UC4A 4EO4A 5ELOA 2XK0A 1Y96A 4ELYC 2WSFE 1N8RC 1ZQ1A 1N9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U1S A;  3SWN B;  4M7A C;  2Q5I A;  4C8Q A;  3JB9 H;  3V8L A;  1G51 A;  3I7F A;  3M4Q A;  1H4V B;  3FJP A;  3VQX A;  1Y96 B;  5GAN g;  1KOG A;  4M78 A;  3VQW A;  4X9D A;  3V7S A;  4EMK B;  4XEM A;  4C92 E;  2ZNJ A;  1D3B A;  4H2X A;  3WQZ A;  1NJ5 A;  1W66 A;  3JCM J;  4YCW A;  2I4N A;  3L4G A;  2IY5 A;  1ADJ A;  5GAO q;  5GAM h;  2RHQ A;  1TH7 A;  4M7A D;  4TVY A;  2XGT A;  2G4C A;  4A54 A;  4XTX A;  3NEL A;  1B34 B;  4YRS A;  1YFR A;  4QVC A;  3A32 A;  4M77 A;  4HWR A;  1I81 A;  3VBB A;  3CMQ A;  4M7A F;  2DTI A;  1NJ8 A;  1JJC A;  4M7D G;  4PJO A;  5E3I A;  4YRN A;  1H64 1;  3BY7 A;  2I4O A;  3M4P A;  4HWP A;  5LJ3 j;  3L2Z A;  2DVE A;  4C92 B;  2C8M A;  2DXU A;  4H2V A;  3QO3 A;  1BBW A;  1USY C;  2DEQ A;  4YRR A;  1PYS A;  3QUI A;  3V7C A;  3A74 A;  4CH6 A;  1ASZ A;  4YYE A;  2P5I A;  2QHT A;  1E1O A;  3E9I A;  2DZC A;  3LSS A;  4YRI A;  4QVD A;  1X55 A;  4TQD A;  1H4S A;  4MMK A;  5LJ3 d;  5LJ5 j;  4L87 A;  3V8J A;  4M7D D;  4K87 A;  4MML A;  4J6X A;  4C92 G;  4H2S A;  2DZ9 A;  4M7A E;  4RDX A;  3W3S A;  1QF6 A;  1EVK A;  4P73 C;  3HXV A;  1WU7 A;  1N9S A;  3HFV A;  3AHU A;  4TWA A;  4C8Q C;  3HXY A;  5GAN 2;  2ZT7 A;  5LJ5 d;  5GAM d;  2ARU A;  3P8T A;  3RKX A;  1X56 A;  3JCM g;  11AS A;  3FIF A;  4HWO A;  1N9W A;  5GAO l;  1HC7 A;  4F7U F;  2CGH A;  2ZR2 A;  4P74 A;  3QTC A;  5GAM e;  1KQ2 A;  3QO5 A;  4EMH A;  5LJ3 f;  4M7A B;  3ERR A;  1IL2 A;  3RUX A;  3VQV A;  4UP8 A;  4PHC A;  4J6Y A;  1YFT A;  3BFM A;  4M77 C;  2ODR C;  3RIR A;  3RKY A;  2ZT6 A;  3HFZ A;  5GMK l;  1E1T A;  1VQZ A;  4C8Q F;  4H2W A;  4YRC A;  5CAI A;  4PJO C;  3V8K A;  2CJ9 A;  4XU3 A;  3M4G A;  4WI1 A;  1B7Y B;  4XTV A;  3TUP A;  1BBU A;  4TVW A;  4YRO A;  4NOY A;  5LJ5 f;  1ASY A;  2QHS A;  2EWN A;  2ART A;  4HT8 A;  4M7A G;  1YFS A;  4XTW A;  3PCO B;  3HXU A;  5C53 B;  2VC8 A;  3RL6 A;  4F7U E;  5GAM g;  5LJ3 h;  1WLE A;  3QNE A;  3BW1 A;  2FB7 A;  1EQR A;  4HWS A;  4M77 F;  4XEO A;  1B76 A;  1NYR A;  3IAL A;  2DU5 A;  3GIB A;  3QHS A;  1WNL A;  1B34 A;  4PJO F;  4YRT A;  3REX A;  1SRY A;  4M7D B;  4LNS A;  1M8V A;  2ZIN A;  1M5Q 1;  1KMM A;  3QO7 A;  1LOJ A;  1L0W A;  4CH3 A;  3L1A A;  4UPA A;  4C8Q E;  4JUV A;  5LJ5 h;  4OP0 A;  4UP9 A;  4JRI A;  4M75 C;  4C92 A;  1ATI A;  4J15 A;  1JRI A;  2ALY B;  3QSU A;  2CIM A;  4A53 A;  2ZNI A;  2ZT8 A;  3RAC A;  4PG3 A;  4YRG A;  1I4K 1;  2EJ9 A;  2RB6 A;  2E1H A;  3V7R A;  4RQF A;  3MF2 A;  4YDQ A;  1WQW A;  4P74 C;  3ICA A;  4M77 E;  3JB9 I;  4PNO A;  1NJ1 A;  4DQ2 A;  1FYF A;  3HTZ A;  4PJO E;  4RMF A;  2DTO A;  4CS4 A;  3EFR A;  3SB2 A;  4V2S A;  1J5W A;  4N0A A;  5GAO p;  4ZTZ B;  1X01 A;  4M75 F;  1I8F A;  3P8V A;  4YCV A;  4J5Y A;  2K57 A;  4F7U G;  3HRI A;  4XU1 A;  4EMG A;  3SWN C;  3RKW A;  2PME A;  5K1P A;  1EFW A;  1KQ1 A;  2I4L A;  4KR3 A;  1H4Q A;  5GAO r;  4HA8 A;  2I4M A;  2Q7H A;  2DXT A;  3NET A;  4Q15 A;  4EMK C;  1LYL A;  1C0A A;  3A7R A;  2AKW B;  4C8Q G;  3UGT A;  1E24 A;  2ZGW A;  3JCM X;  4HWT A;  5LJ3 e;  4BWA A;  2YHT A;  4ZTU B;  4CS3 A;  4ZIB A;  12AS A;  4M7A A;  1EIY B;  4G85 A;  4TVA B;  2J3L A;  2VXE A;  4YPF A;  4YRL A;  4M78 C;  4M75 E;  1NJ2 A;  1B7Y A;  5LJ5 e;  4M77 G;  5GAN j;  4RCB A;  4C8Q D;  2ZR3 A;  3UGQ A;  4CH5 A;  2EJF A;  2RHS B;  4PJO G;  1QE0 A;  4YCU A;  5GMK j;  5GAN 4;  4AH6 A;  5GAN 7;  4M78 D;  1H4T A;  2ZCE A;  4XU2 A;  2QHV A;  2FYK A;  5GMK i;  3PCO A;  3EFS A;  2ARS A;  5LJ3 g;  2RM4 A;  1ADY A;  1BIB A;  1HXD A;  3TEH B;  4YRK A;  5GAN d;  1KMN A;  4M78 F;  3REU A;  4XTU A;  2XTI A;  3HFN A;  5GAN 5;  4M75 B;  3FB9 A;  1I5L A;  4M7D A;  2E65 A;  3JB9 D;  2ODR D;  4M77 D;  3HXW A;  2YLC A;  2EAY A;  5GAO m;  4N0A C;  3HFO A;  1RIQ A;  4PJO D;  5LJ5 g;  4G84 A;  1GGM A;  1WQ7 A;  3BJU A;  3JB9 F;  3RER A;  3A31 A;  1NJ6 A;  2ALY A;  4XTZ A;  1B8A A;  3PGG A;  3OD1 A;  4KQE A;  5GMK m;  1WYD A;  1B70 B;  3HY1 A;  1NYQ A;  4WJ4 A;  4M75 G;  1X2G A;  2RA2 A;  2E5A A;  1WPY A;  2DJZ A;  2JN0 A;  4YRF A;  3NEM A;  1YB3 A;  4P73 A;  1Z7M A;  4P72 A;  4BW9 A;  5GAN f;  3NEN A;  4M78 E;  2CJB A;  4RQE A;  4TTV A;  4YRJ A;  1MGQ A;  4F7U B;  1Z7N A;  1BIA A;  4HVC A;  2DDZ A;  5GAN 8;  2Q5H A;  4JRK A;  4Y91 A;  4H2T A;  2ZXF A;  3JCM Q;  2EL9 A;  4CS2 A;  5C51 B;  2QTX A;  5KNN A;  4M75 D;  1YGB A;  2ZTG A;  4C8Q B;  2E41 A;  3JCM b;  1X54 A;  3E9H A;  4RCC A;  5ELN A;  4EX5 A;  5DY9 A;  3KFU A;  4KR2 A;  2AKW A;  4M78 B;  3BDU A;  2I2L A;  3TEG A;  5GAN h;  3JB9 J;  1D3B B;  4H2U A;  4H2X B;  2ZZG A;  5GAO n;  4J6W A;  4P3N A;  4DPG A;  4P71 A;  3L4G B;  5HGQ A;  3JCM d;  2IY5 B;  2ZZE A;  3UH0 A;  2E3C A;  5GMK h;  1U1T A;  3A5Y A;  2RHQ B;  4TQF A;  3RGL A;  1EIY A;  4YRM A;  4YRP A;  3VU3 C;  2AMC A;  4YRQ A;  4TVA A;  3A5Z A;  3HXX A;  2DKG A;  4M7D C;  4E51 A;  4YP0 A;  1G5I A;  1HK9 A;  2E10 A;  1SET A;  3DSQ A;  4M77 B;  4P3P A;  4P75 A;  3JCM e;  1JJC B;  1YCY A;  4PJO B;  3HY0 A;  3LC0 A;  4YRE A;  3R07 A;  4NCX A;  4M78 G;  3JCM V;  1G5H A;  3HSB A;  2AMC B;  3QO8 A;  4O2D A;  2RHS A;  2DQ0 A;  5GAM j;  2EJG A;  2P0L A;  5C52 B;  5I21 A;  4NL2 A;  3RES A;  1NNH A;  1PYS B;  2J3M A;  4H02 A;  4Q6G A;  4WJ3 M;  4UP7 A;  2ZIM A;  4H2Y A;  2Q7E A;  2HNI A;  5F5W A;  4M7D F;  3JB9 G;  3PZC A;  4P72 C;  3TEH A;  3JCM f;  4C92 C;  4M75 A;  4K88 A;  4X9C A;  1X2H A;  4NL3 A;  2DQ3 A;  3MEY A;  2VXF A;  2QHU A;  4JLI A;  4XU0 A;  4XQ3 A;  2C7I A;  4XTY A;  3P8Y A;  3JCM W;  5GAN 6;  3INZ A;  2Q7G A;  4C92 D;  1EVL A;  2CJA A;  3JCM c;  1E22 A;  1EOV A;  3HXZ A;  3IKM B;  4HT9 A;  1USY A;  3A7A A;  2RD1 A;  1B70 A;  4X5O A;  4WF2 A;  2Y90 A;  4C92 F;  1JBM A;  3JCM h;  3UFG A;  2DTH A;  5GAN e;  5K1X A;  1HTT A;  4P71 C;  4OLF A;  4M7D E;  4K86 A;  2E64 A;  3HRK A;  3JCM P;  4P3O A;  3RF1 A;  5GMK e;  3SWN A;  1LNX A;  3IG2 A;  3MF1 A;  3A7U A;  3G1Z A;  4EO4 A;  4F7U A;  2ZIO A;  5GAM f;  3VQY A;  5ELO A;  2ZT5 A;  1Y96 A;  3HFZ B;  2PMF A;  2ZZF A;  5GAN 3;  1SES A;  4EMK A;  2YLB A;  2DU7 A;  3IKL A;  4P75 C;  1LJO A;  3LSQ A;  1N9R A;  1SER A;  4CH4 A; 
#chains in the Genus database with same CATH topology
 3HPW A;  1YN8 A;  2Q5I A;  3CCR T;  3ME9 A;  5KYY A;  2E70 A;  3V8L A;  3HL8 A;  4PLI A;  3BE3 A;  1DJ7 B;  1H4V B;  3D7S B;  1JO8 A;  2L8D A;  2EBP A;  3E9F A;  1WXB A;  1YJW A;  3PT9 A;  1RAG B;  3OS2 A;  1KOG A;  1OPK A;  4VUB A;  4QQD A;  1JQQ A;  1VQ8 Q;  1M8M A;  3I56 T;  5GAM h;  4RTW A;  1Q7Y R;  4M7A D;  4TVY A;  1M4Z A;  1NM7 A;  4A54 A;  2X9H A;  3CCR A;  4XTX A;  3CC2 Q;  4ZNX A;  1B34 B;  1AWO A;  5FU6 B;  2EW3 A;  2R57 A;  1I81 A;  4YTL A;  4LDU A;  1M2V A;  1KSW A;  4GY5 A;  4KT0 E;  1D0X A;  4M7D G;  2L2P A;  4YRN A;  4HCB A;  4O5V A;  1WHM A;  3VS3 A;  3OYN A;  1GXI E;  4FM4 B;  2F69 A;  3H8Z A;  4C92 B;  2DVE A;  2DXU A;  4JJC A;  1X27 A;  1BBW A;  2P4R A;  4OGE A;  4YRR A;  3HRS A;  2G3R A;  2HCK A;  2WSC E;  3A74 A;  2ROL A;  3MP6 A;  2K3Y A;  4OB1 B;  3T9N A;  4E7S A;  3LSS A;  1D1C A;  2KBT A;  2HL5 C;  2R58 A;  5D6X A;  1H4S A;  2JTF A;  1T3S A;  2AKK A;  2MAM A;  5LJ3 d;  3F70 A;  5CR2 A;  3CCU A;  2HQE A;  3G71 Q;  3OYM A;  1Q81 C;  2ZZD A;  2DZ9 A;  2LC4 A;  5KYW A;  1MMA A;  2GQV A;  2H3E B;  2LT1 A;  4GBQ A;  4JJD A;  1X2Q A;  2YWW A;  2LTO A;  5KE2 A;  2F1L A;  4K11 A;  3TSW A;  4C8Q C;  2DL3 A;  4RTZ A;  3RKX A;  2D6F A;  2JM8 A;  2V8J A;  5GAO l;  1HC7 A;  4N4H A;  2J6K A;  2X3W D;  2GFA A;  2ZR2 A;  4CC3 A;  3MPU B;  3CC7 T;  4ANJ A;  1RAC B;  4Z8A A;  3QO5 A;  5IH2 A;  2RK2 A;  5LJ3 f;  4LN2 A;  3ERR A;  2CP5 A;  4KGV B;  1NJI U;  1M90 R;  2LJ3 A;  3E2U A;  3VQV A;  2KT8 A;  3EG9 A;  2ODR C;  2JM9 A;  4M77 C;  3CC4 T;  3RKY A;  4JS5 A;  2D0Q B;  2HQX A;  2BTT A;  3CXC P;  1VQZ A;  4C8Q F;  1RUW A;  3V8K A;  2OI3 A;  2VGM A;  1K73 U;  1B7Y B;  3ASK A;  2XDD A;  3CC7 A;  3CME T;  1FMW A;  2EYZ A;  2HL3 A;  3MJX A;  3QII A;  1SSF A;  1VQN A;  3ZEH A;  2EPD A;  4M7A G;  3CC4 A;  4XTW A;  1VQ6 T;  3HXU A;  2YUN A;  2OTJ T;  1PD1 A;  2AZV A;  2VVK A;  1N5Z A;  3QNE A;  3FLG A;  1WGS A;  2ZPB B;  4M77 F;  3CCL Q;  4XEO A;  2DU5 A;  3GIB A;  2ZCF B;  3SHW A;  4ZTF A;  1WNL A;  2QQB A;  1B34 A;  4YRT A;  1X43 A;  2ZIN A;  1KHI A;  2P0K A;  2M16 A;  2R5M A;  1Q82 R;  1KMM A;  1L0W A;  2PQW A;  2X51 A;  1VQ6 A;  3OW2 P;  2F5K A;  3QWX X;  5CKH A;  3VS4 A;  2O4X B;  2K4Y A;  2DL5 A;  2V8K A;  4C0Z A;  4M75 C;  4C92 A;  2AT1 B;  1M3B A;  1QQJ A;  2A08 A;  3QSU A;  1VA7 A;  2CIM A;  2C06 A;  2LJ0 A;  1G3T A;  5CIU A;  4YRG A;  2EJ9 A;  3V7R A;  3MF2 A;  1TS9 A;  3VS6 A;  1TWB A;  1QCF A;  3OYF A;  1YHQ Q;  1W2B A;  1NJ1 A;  1NPR A;  1YIJ Q;  2HBW A;  3FRN A;  4WCI A;  4CS4 A;  3G1J A;  1K9M U;  2K9G A;  1CKB A;  1WXU A;  1MV0 B;  2VGN A;  4RUG A;  3OW2 A;  4ZTZ B;  4V2S A;  4N0A A;  4M75 F;  3P8V A;  3GF5 A;  4JDS A;  1K8A U;  1ZSZ C;  4J5Y A;  2BZY A;  4F7U G;  4PJM A;  3QWY A;  4XU1 A;  1VQM T;  3HRT A;  2RPN A;  3OB9 A;  4EMG A;  5J39 A;  3X20 B;  3EH2 A;  4HA8 A;  2L3Q A;  2Y4Y A;  3THK A;  2QQS A;  4J83 A;  2Q7H A;  5J3B A;  1LYL A;  3A7R A;  2AKW B;  2P84 A;  2QGG A;  4OB2 B;  3LWH A;  3TSZ A;  2A8E A;  2ZGW A;  4RTY A;  1GCQ C;  4HWT A;  5LJ3 e;  1VQ4 T;  2YHT A;  2CZ0 B;  4ZTU B;  1AEY A;  4HVV A;  4CS3 A;  1EIY B;  12AS A;  4RKU E;  1Y0M A;  4Y28 E;  3G7Z A;  2FL7 A;  4BUG A;  1VIF A;  2DIG A;  2J6O A;  3QPH A;  1B7Y A;  1W2B S;  4KGX B;  4OVA A;  3WVE B;  1VQ4 A;  1S72 T;  4RCB A;  3OS1 A;  5EC7 A;  4KUD K;  2EYQ A;  2IG0 A;  1LVK A;  2DER A;  3OW2 S;  4YCU A;  2GTO A;  4ZGJ B;  5GAN 7;  2DBM A;  2FO0 A;  4XU2 A;  2D9T A;  5GMK i;  2XIC A;  1QVF A;  2QHV A;  3S3N A;  1IGQ A;  5LJ3 g;  1OZ3 A;  2CUB A;  3DLM A;  2V1Q A;  2E4H A;  2CP7 A;  2RHY A;  4YRK A;  1O9S A;  1VQ7 Q;  3REU A;  4PJJ A;  4R56 A;  1S72 A;  2EQU A;  2EFI A;  2YXY A;  4B9X A;  2K5L A;  1BB9 A;  1I5L A;  4C0G A;  1Q7Y C;  3HXW A;  2YLC A;  1X6B A;  5EG2 A;  4A4H A;  1KHC A;  4PJO D;  4G84 A;  2QA4 T;  1WQ7 A;  3BJU A;  2O4X A;  4LDY A;  2RI2 A;  1WA7 A;  1AOJ A;  3UA7 A;  1MNE A;  1NZ9 A;  4XTZ A;  2CKK A;  5GMK m;  1WYD A;  3CMA T;  3HY1 A;  1M1K R;  1W4S A;  4LNP A;  1X2G A;  2E5A A;  1WPY A;  1JU5 C;  1GFD A;  4BB7 A;  1B07 A;  2PUO B;  1QKW A;  2KVQ G;  4BW9 A;  2H3J A;  1UHC A;  4M78 E;  3NEN A;  4RQE A;  4CC4 B;  4OB3 B;  1N8R U;  2PVD B;  4DBF A;  4HVC A;  1QVF S;  1VQO Q;  1YHQ A;  5CKB A;  4OMN A;  2ZXF A;  2JS2 A;  4CS2 A;  1M3C A;  1G83 A;  2PNI A;  1G3W A;  4C8Q B;  1SEM A;  2E41 A;  1VYV A;  2DET A;  3E9H A;  3PVQ A;  3MET A;  5DY9 A;  4EX5 A;  2AKW A;  2QQA A;  3BDU A;  2DL8 A;  5GAN h;  3JB9 J;  2BIV A;  2LCL A;  2ZZG A;  5GAO n;  4P71 A;  3L4G B;  3JCM d;  1N27 A;  2ZZE A;  1V1C A;  4TQF A;  2RHQ B;  1EIY A;  2CYZ B;  4YRP A;  1SKU B;  4C0F A;  3A5Z A;  2D0N A;  3M4Y A;  4Z88 A;  1SRL A;  4J9F A;  2V26 A;  1SET A;  4M77 B;  1N6A A;  2DA9 A;  1M90 C;  3O8V A;  4YRE A;  3R07 A;  3URG A;  4NCX A;  4J7I A;  3JCM V;  1PKS A;  2VYT A;  3X24 B;  2GCX A;  2EJG A;  1D09 B;  3UAT A;  3H0I A;  2DPP B;  1ZA2 B;  3LGF A;  1M30 A;  2COZ A;  2KRM A;  3BDL A;  2HNI A;  4JJN K;  1VQ5 T;  3CCM Q;  2J6F A;  1WYX A;  3PZC A;  1KC8 R;  3JCM f;  1Q81 U;  4C92 C;  1K1Z A;  4CI0 C;  1ZSG A;  2ZPF B;  1YI2 A;  4DEX A;  3M55 A;  4NL3 A;  1YJN Q;  1BKB A;  4JLI A;  4E2F B;  2QQR A;  4XQ3 A;  4PFO A;  5IHI A;  2C7I A;  3P8Y A;  3JCM W;  1IRX A;  1VQ5 A;  5HCK A;  5GAN 6;  3NTK A;  4MDX A;  2KRO A;  3QZ9 B;  3PNW C;  2DE0 X;  5KE3 A;  1TUG B;  1WHH A;  3A7A A;  3UA6 A;  2G6F X;  3PE0 A;  4WF2 A;  2CSQ A;  4C92 F;  5K1X A;  2LQ8 A;  3I55 T;  3CD6 T;  1HTT A;  3HRK A;  2RJF A;  2JMA A;  5GMK e;  3PIO A;  1LNX A;  2QEX T;  3UDC A;  3OMC A;  3H0H A;  4HT4 A;  3VQY A;  3VUZ A;  3HFZ B;  2PMF A;  5GAN 3;  5GJV B;  1SES A;  1B3Q A;  1ZSZ B;  3QDF A;  1Y7X A;  3I55 A;  1YJ9 T;  2EYX A;  2RQR A;  4C8Q A;  2RMO A;  2I0N A;  2OJ2 A;  3JB9 H;  3CEY A;  4Y92 A;  1G51 A;  1UJY A;  3VRY A;  3I7F A;  1FYN A;  3VQX A;  1Y96 B;  2ECZ A;  4KUL A;  2ZNJ A;  3M56 A;  2XI9 A;  2LJ1 A;  3JCM J;  1H8K A;  2I4N A;  3L4G A;  4E7H A;  4DOW A;  1LCK A;  4OMF B;  2W0Z A;  5A2Q E;  2RHQ A;  1TH7 A;  4A4E A;  4DBH A;  2O88 A;  1PCX A;  2YSQ A;  1X6O A;  4AFU C;  1O75 A;  1YFR A;  4M77 A;  1BCM A;  4QVZ A;  3VBB A;  1FMK A;  2DTI A;  1NJ8 A;  1XJW B;  2KY9 A;  4PJN A;  3G6E Q;  4KH1 B;  2DRM A;  4XK8 E;  2I4O A;  2LCC A;  5LJ3 j;  4HWP A;  3L2Z A;  1QCO A;  4PFP A;  4OF1 A;  4JZ3 A;  2YT6 A;  3KXT A;  4J9G A;  1M27 C;  2KEA A;  1YWO A;  1ASZ A;  3MQZ A;  1ZUY A;  1OPL A;  4YYE A;  4HCZ A;  2QHT A;  2GF7 A;  3MHX A;  3E9I A;  2DZC A;  2CT4 A;  1PWT A;  2MI6 A;  4YRI A;  2ATC B;  1NLP C;  4TQD A;  3V8J A;  4M7D D;  4K87 A;  2F5T X;  1NYF A;  1AWW A;  3OA6 A;  4MZT A;  1MV3 A;  4LUD A;  2HKN A;  4RMO A;  1WU7 A;  2EYW A;  1T0H A;  3HFV A;  1UG1 A;  2ZT7 A;  5LJ5 d;  4CC7 A;  4JRP A;  2OTL T;  3VYH B;  1X56 A;  3JCM g;  3OSV A;  1WFW A;  3FIF A;  2LQW A;  1J3T A;  4AFZ C;  1N9W A;  4QW2 A;  3LWI A;  2PVO B;  1M1K C;  1JEG A;  5HK3 A;  2KK4 A;  4L6V 5;  1KQ2 A;  1OEB A;  1BI2 A;  1QCN A;  2CH4 A;  4M7A B;  1UGS B;  2EQM A;  1IL2 A;  3RUX A;  4J9C A;  3FC3 A;  2K7A A;  3FJ5 A;  4UP8 A;  4AT1 B;  3HFZ A;  3BFM A;  2OTL A;  1JXM A;  4E7Z A;  2JUF A;  1PM3 A;  5GMK l;  1QWE A;  2CRE A;  1WXT A;  4YRC A;  1VUB A;  1ZSZ A;  2HZY A;  2FZC B;  5CAI A;  4XAX B;  4PJO C;  2CJ9 A;  4WI1 A;  2FVU A;  4FW1 A;  4XTV A;  4BDY A;  1AHJ B;  3TUP A;  1BBU A;  1BI1 A;  2DIQ A;  3I35 A;  5FLX E;  5LJ5 f;  5CQY A;  1YJW T;  2QHS A;  3QDR B;  6AT1 B;  2EWN A;  3P8H A;  4MZP A;  2ART A;  4HT8 A;  1YFS A;  1T3L A;  1K4U S;  2QXF A;  2O31 A;  2VC8 A;  3RL6 A;  3CCV T;  3QYH B;  1WLE A;  1Q7Y U;  1B76 A;  3IAL A;  3OY9 A;  4LDW A;  4RTT A;  2K2M A;  4II1 A;  4PJO F;  1VQL Q;  3REX A;  1SRY A;  4LNS A;  4PLL A;  3VS1 A;  1MHN A;  2YRC A;  4KUI A;  4UPA A;  1YCS B;  4O6J A;  4C8Q E;  1E6G A;  5CKF A;  4ELZ C;  2RQV A;  3LGL A;  3CCV A;  2NUP B;  1UGQ B;  4UP9 A;  5C6S A;  1SG5 A;  1MMD A;  4J15 A;  2ALY B;  3C4S A;  4A53 A;  2BZ8 A;  2ZT8 A;  2RI5 A;  4PL6 A;  3OYH A;  1I4K 1;  4R0K A;  2FPE A;  4RQF A;  2RQT A;  4GLM A;  1WQW A;  2FEI A;  1G3Y A;  4M77 E;  3CCU T;  2LZ6 B;  4DEY A;  1KC8 C;  3MP1 A;  3UPU A;  2OTJ Q;  3HTZ A;  4RMF A;  2DTO A;  4IUR A;  4FT2 A;  2KGT A;  5GAO p;  1X01 A;  1KK7 A;  1NYG A;  3HRI A;  3G4S Q;  3EG2 A;  2EIF A;  2K3B A;  3RKW A;  5DLO A;  2L5Q A;  1VQP Q;  1VQK T;  2PU9 B;  1GRI A;  1D0Y A;  3SFM A;  1H3Z A;  4Q15 A;  2DXT A;  1C0A A;  3QBY A;  3GBQ A;  3UGT A;  5KYX B;  3E1S A;  3LX7 A;  4PKC C;  3N5B B;  3P8B B;  4M7A A;  2V8I A;  1M90 U;  1C0M A;  4LVK A;  3GOX A;  4G85 A;  4KBM B;  1VQK A;  1VQ9 Q;  1VOM A;  3CCQ T;  4M75 E;  2D8J A;  2EQI A;  1NJ2 A;  5LJ5 e;  2X4J A;  3LW5 E;  2ZR3 A;  5D7U A;  2K5F A;  1VQN T;  4CH5 A;  2RHS B;  3MEA A;  4HCK A;  5D6Y A;  1BCO A;  1AWJ A;  5GMK j;  5GAN 4;  4AH6 A;  2YRD A;  3CCS T;  1VQM Q;  2CZ7 B;  4M78 D;  2CSI A;  1D0Z A;  2FYK A;  1SHF A;  2P0P A;  2ARS A;  5D6W A;  4CC2 A;  3CCQ A;  2MWP A;  3ZL7 C;  3CCE Q;  1NPP A;  4XTU A;  2M51 A;  3FDR A;  2COY A;  3HFN A;  1BBZ A;  3FB9 A;  4BAC A;  1IXD A;  3CCS A;  2EAY A;  1OYX A;  3HFO A;  1QVG P;  5IXB A;  2DL4 A;  5LJ5 g;  1UGR B;  1GGM A;  3JB9 F;  2NUP A;  1FX7 A;  3RER A;  2F2W A;  1VQL A;  4QKU A;  3KBG A;  1V76 A;  3A31 A;  3SEM A;  2QAS A;  3TQ7 P;  3CXC A;  3ZFJ A;  2ALY A;  1B8A A;  4KQE A;  2HAX A;  1VQ8 A;  3CBP A;  5A0D A;  3LYI A;  3M0U A;  2RA2 A;  3LH5 A;  2JN0 A;  4YRF A;  4LD6 A;  4P73 A;  3OYA A;  3CC2 A;  2VKN A;  2C0T A;  5A0L A;  4TTV A;  1TUC A;  4FT4 A;  3MKD A;  1GL5 A;  1AT1 B;  3FEO A;  4Y91 A;  1MUZ A;  4H2T A;  5AT1 B;  2X3X D;  3GNG A;  1ABO A;  1U06 A;  2NUT B;  2QDY B;  3G71 T;  2EL9 A;  2BUD A;  2QTX A;  3UWN A;  5KNN A;  2YRV A;  4OMP A;  4FCY A;  2ZTG A;  3JCM b;  2QA4 Q;  3GP8 A;  2LDM A;  2LVM A;  4KR2 A;  5IAY A;  5CKE A;  3OYI A;  3E19 A;  1ZBJ A;  2K2V A;  3AT1 B;  3R6N A;  3TCJ A;  1D3B B;  5KCO A;  4DPG A;  5AYF A;  2KRS A;  4D6W A;  2RF0 A;  3PIP A;  3ULR B;  5KYX A;  3CXC S;  3G71 A;  3CMA Q;  2E3C A;  1R77 A;  2AMC A;  1SHG A;  3QJ6 A;  3DB4 A;  3HXX A;  4M7D C;  3I5S A;  1RAB B;  1G5I A;  1HK9 A;  2E10 A;  2ZPI B;  3DSQ A;  2JS0 A;  4P3P A;  4JZ4 A;  3H41 A;  1K76 A;  2NUZ A;  3M0Q A;  1JJC B;  2CZ1 B;  2ENM A;  1WHJ A;  4PJO B;  5M9O A;  1ABQ A;  4M78 G;  1RLQ C;  1G5H A;  2VV5 A;  3HSB A;  2RHS A;  4X34 A;  3A5Z B;  3HP9 A;  5C52 B;  2M0O A;  4IIO A;  1UFF A;  4J7F A;  5A0G A;  2JZ2 A;  3CBM A;  3MO8 A;  2J3M A;  4Q6G A;  4WJ3 M;  3WVD B;  2ZIM A;  1SSH A;  4M7D F;  3NFC A;  1GCP A;  4ESR A;  5L8R E;  1OX8 A;  4Z89 A;  5CO7 A;  3KUF A;  3L2R A;  1G3S A;  4K88 A;  2HDA A;  4X9C A;  2FZK B;  1I5O B;  3MEY A;  3EGD B;  1HSQ A;  3RBB B;  2VXF A;  2QHU A;  2ABL A;  3CQT A;  2KYM A;  4EPC A;  3OYL A;  4LE9 A;  1MND A;  1ARK A;  3OYC A;  2ESW A;  1E22 A;  3IKM B;  4B6M A;  4HT9 A;  1TOV A;  7AT1 B;  1M1K U;  3J7A F;  3EHR A;  3HHT B;  2Y90 A;  2XHC A;  3CCL A;  2KXC A;  3UFG A;  2DTH A;  3RDV A;  2RO0 A;  1RLP C;  4OLF A;  9ATC B;  4IUP A;  5FRN A;  1E7O A;  1OUL A;  3SWN A;  3IG2 A;  1XOV A;  3MF1 A;  4DBR A;  2J06 A;  4JLG A;  2GFU A;  5GAM f;  4J8O A;  1Q86 R;  2ED1 A;  3H6Z A;  1YHQ T;  3RMS A;  2ZZF A;  2F2X A;  4EMK A;  2YLB A;  2DU7 A;  4P75 C;  1GBQ A;  3CCJ Q;  2DRK A;  3LSQ A;  2NUT A;  2MMP A;  1X69 A;  2BZX A;  1G2B A;  1YWP A;  4M7A C;  4EDU A;  2KR3 A;  1QW1 A;  3M59 A;  4BE2 A;  4P5N A;  2LRQ A;  4KH0 B;  5KYU B;  3OSS C;  3VQW A;  2EKO A;  4X9D A;  4XEM A;  4C92 E;  2KI7 A;  1D3B A;  3WQZ A;  1YIJ A;  3KFV A;  1ADJ A;  5GAO q;  3L2W A;  2Z0W A;  1BI0 A;  1GBR A;  2XGT A;  2G4C A;  2MK5 A;  1M9S A;  1W6X A;  2DBK A;  3CD6 Q;  1HYO A;  1AVZ C;  4QVC A;  4HWR A;  2DVJ A;  5IHN A;  4FYY B;  4M7A F;  3CMQ A;  2C0O A;  1JJC A;  4PJO A;  3MEU A;  2DD5 A;  4MZM A;  3L42 A;  1QVP A;  1H64 1;  2DYB A;  3M4P A;  2VB6 A;  2IVW A;  3A8O B;  1R0B G;  2VUB A;  2C8M A;  4H2V A;  3QO3 A;  4QT7 A;  1USY C;  2CH4 W;  4KRT A;  1QLY A;  5HKC A;  4E7L A;  3QUI A;  3V7C A;  2OAU A;  2FPF A;  2P5I A;  4AG2 C;  4C0D B;  1KC8 U;  1E1O A;  3HTR A;  4C5H A;  1KD1 R;  3RR6 A;  3EGX A;  5LJ5 j;  2FZG B;  3JSC A;  4L87 A;  1YI2 T;  4MML A;  2MCN A;  2A28 A;  1FXX A;  2BKD N;  2Y4X A;  4H2S A;  3EGD A;  4RDX A;  3W3S A;  4A63 B;  2LP5 A;  4A4G A;  4P73 C;  1N9S A;  5CVI A;  5KH6 A;  3AHU A;  1OZ2 A;  2LT4 A;  1NBE B;  3S3O A;  4AFQ C;  5I22 A;  1M1G A;  1OU8 A;  3HXY A;  3Q1J A;  1QWF A;  5GAN 2;  4FU6 A;  1YIT Q;  3P8T A;  1XQH A;  1KIK A;  1G5V A;  2HSE B;  1VQ7 A;  4F7U F;  1UDL A;  2HBP A;  1SRM A;  2AHJ B;  1Q82 C;  3QTC A;  2ZPH B;  5CKD A;  5GAM e;  2QDL A;  1PRM C;  1H3H A;  3OYE A;  3UT1 A;  3WXM B;  2HSP A;  4E7I A;  4PHC A;  1YFT A;  3JAM E;  2A3L A;  2RJE A;  4H2W A;  2J05 A;  1ZX6 A;  4LDV A;  2IIM A;  3NTI A;  2LCS A;  2COW A;  5FRO A;  4TVW A;  4NOY A;  1YFN A;  5KYU A;  4BE0 A;  2NWM A;  3VUB A;  3PCO B;  5C53 B;  4ZTJ A;  5GAM g;  4BY6 C;  5LJ3 h;  1WJQ A;  2RHU A;  4ZGE B;  3PVL A;  1EQR A;  4FSX A;  1NYR A;  2H8H A;  2CUD A;  1S1N A;  4B9W A;  2RK1 A;  1VQO A;  4DBQ A;  2YUQ A;  4M7D B;  1M8V A;  1H92 A;  1VYT A;  3MP8 A;  5ECA A;  2M9U A;  1YBY A;  4CH3 A;  1W1F A;  3OYK A;  1ZA1 B;  2KDS A;  4JUV A;  3DB3 A;  2GQI A;  2E3H A;  4OP0 A;  3O5Z A;  4JRI A;  4J9I A;  1JRI A;  2ZNI A;  2KE9 A;  2GNC A;  3RAC A;  1OI1 A;  3I5R A;  4LD9 K;  2RB6 A;  2M02 A;  2ZPG B;  4YDQ A;  3CPF A;  3P8D A;  4P74 C;  2PZ1 A;  3JB9 I;  4PNO A;  4C5E A;  1EX4 A;  5I2S A;  4DQ2 A;  3M58 A;  4PJO E;  2K5I A;  3OQ5 A;  3SB2 A;  3OBY A;  1J5W A;  3CCR Q;  2KMT A;  1I8F A;  2EGA A;  4EIK A;  1SPK A;  3LH0 A;  5HY6 A;  1WHL A;  3SWN C;  2PME A;  2KAF A;  3HRU A;  5K1P A;  5IHK A;  1NG2 A;  2I4L A;  3DLL A;  5GAO r;  1RAH B;  3CBO A;  3CCM A;  3I56 Q;  2I4M A;  3NET A;  3M54 A;  4EMK C;  3M5A A;  4C8Q G;  1U8R A;  2CP3 A;  5IXF A;  1B7T A;  4E7J A;  4L59 A;  1YJN A;  2EGC A;  4HVW A;  2O2O A;  4YRL A;  3LLR A;  2EQK A;  3VS5 A;  4OGC A;  8ATC B;  3PTA A;  3CCU Q;  2EQJ A;  2XMF A;  1Q86 C;  4M77 G;  2MF2 A;  1WHG A;  3MEV A;  4HVU A;  4CRI A;  1WJR A;  3UGQ A;  2EJF A;  2HD0 A;  2VWF A;  3VS7 A;  2KRN A;  2GGR A;  5IT9 E;  3A8L B;  1H4T A;  3TU4 K;  2LX7 A;  2XID A;  2ZCE A;  4F04 B;  3PCO A;  2X4W A;  1ADY A;  1FMV A;  4A4F A;  1BIB A;  3GPL A;  1HXD A;  3TEH B;  5GAN d;  2KT1 A;  1KMN A;  3OYJ A;  2HQH A;  1PC0 A;  2EYY A;  4M7D A;  2E65 A;  4FYW B;  2BE9 B;  2XKO C;  4BI4 A;  1TU0 B;  2ROT A;  2DYI A;  1V29 B;  1NE8 A;  1WIE A;  1E6H A;  2XDP A;  3U23 A;  3EFO B;  2PVG B;  1WDX A;  4MDW A;  4HKE A;  1NJ6 A;  4IUV A;  4D8K A;  5FW9 A;  3G6E T;  3PGG A;  1B70 B;  3CC7 Q;  3OBW A;  1NYQ A;  3J81 E;  1VIE A;  4M75 G;  4ZN3 A;  3VKI A;  1SF9 A;  1JB0 E;  5FWB A;  3EHQ A;  4E6R A;  3NEM A;  1Z7M A;  2FG0 A;  3C0C A;  5GAN f;  1KJW A;  3CC4 Q;  4IUQ A;  2O9S A;  1MGQ A;  4F7U B;  4FIB A;  1KD1 C;  3G6E A;  5GAN 8;  2FRW A;  4JRK A;  3CME Q;  4A4K A;  2L0A A;  1IHW A;  2PTK A;  3TRE A;  1IRE B;  4OMQ A;  4RTV A;  1RI9 A;  1VQ6 Q;  1ACM B;  2L3P A;  3ZBD A;  4N4I A;  4LVI A;  5ELN A;  1BYM A;  3KFU A;  4BE1 A;  2A0F B;  4M78 B;  2I2L A;  1X6G A;  3R6O A;  1YNZ A;  5FRM A;  2NS6 A;  3TEG A;  4H2X B;  2ZAE A;  4J6W A;  2JMC A;  3M0R A;  1FWZ A;  1U5S A;  4Z02 A;  2IY5 B;  3UH0 A;  1G8X A;  3RMQ A;  3A5Y A;  5GMK h;  3EH1 A;  3RGL A;  3I56 A;  1WX6 A;  3NGP A;  4OML A;  3VU3 C;  4YRQ A;  4YP0 A;  2RH2 A;  1TSF A;  2OAW A;  3L2Q A;  4RG8 A;  4P75 A;  4RTU A;  3VS2 A;  2AMC B;  3QO8 A;  4O2D A;  2DQ0 A;  5GAM j;  1OQK A;  2KYB A;  4M4Z A;  3VV0 A;  4C5I A;  3RES A;  1NNH A;  2HEQ A;  1PYS B;  4H02 A;  2DNU A;  4H2Y A;  4BY6 B;  4P72 C;  3TEH A;  2XDB A;  3X26 B;  2CZ6 B;  2A37 A;  3A8M B;  4F16 A;  3X28 B;  1Z9Z A;  2X4X A;  1X2H A;  3J80 E;  1PD0 A;  1C1A A;  4C0D C;  4OMO A;  3EFO A;  1X75 C;  4XU0 A;  1VQL T;  2E5Q A;  4DOV A;  3INZ A;  2E6N A;  2Q7G A;  4C92 D;  1EVL A;  2LX9 A;  3VJP A;  3JCM c;  1EOV A;  1CKA A;  4FL6 A;  3A98 A;  2JTE A;  1USY A;  1VQ8 T;  1KFZ A;  4ZN1 A;  1Q82 U;  1UUE A;  1VQ4 Q;  2RD1 A;  1B70 A;  4X5O A;  5L23 A;  2LMJ A;  3JCM h;  2F2V A;  3C12 A;  5GAN e;  4BDZ A;  3CC2 T;  1K0S A;  2D1X A;  4FSS A;  3EG3 A;  3M0P A;  4M7D E;  3RF1 A;  1ZHI A;  3TEE A;  3OS5 A;  3VYG A;  3A7U A;  3G1Z A;  4F7U A;  2ZIO A;  1F1B B;  2FPD A;  1IGU A;  1UJ0 A;  2ZT5 A;  1NJI R;  1IB8 A;  1S72 Q;  2B86 A;  3IKL A;  1LJO A;  2A36 A;  3PFS A;  1SER A;  4L5G A;  4CH4 A;  1U1S A;  1EZZ B;  1K73 R;  3SWN B;  1QVG A;  2K3X A;  4IUT A;  3G4S T;  3CME A;  3M4Q A;  3FJP A;  4DA4 A;  3UF4 A;  1W2B P;  5GAN g;  4M78 A;  3V7S A;  4EMK B;  2DJQ A;  1VQP T;  4H2X A;  5FWC A;  1NJ5 A;  1W66 A;  3EG0 A;  4YCW A;  2IY5 A;  2RJC A;  3MCA B;  2OTJ A;  1KG1 A;  4LVJ A;  4LVL A;  3C94 A;  3NEL A;  1JJ2 P;  4YRS A;  4J9B A;  4IUU A;  2RHZ A;  3G4S A;  2JJ9 A;  1M2O A;  1NEB A;  1HD3 A;  2DLP A;  3A32 A;  3H0F A;  2CS7 A;  3VRZ A;  3SD4 A;  4PJL A;  1VQP A;  2B8A A;  5E3I A;  1WLP B;  5J26 A;  1RL2 A;  1VQ9 T;  5KYN A;  2SEM A;  3BY7 A;  1PKT A;  2RHX A;  1RAF B;  2JVV A;  3I9Q A;  2DEQ A;  2L3R A;  2DL7 A;  1PYS A;  4CH6 A;  3RNJ A;  1AWX A;  5CK9 A;  3OYG A;  3E9G A;  2NLU A;  4PFZ A;  1Y71 A;  3H9N A;  1CSK A;  1JJ2 A;  1QVG S;  4QVD A;  1I0C A;  4ATO A;  1VQ9 A;  1X55 A;  4MMK A;  1OX9 A;  2KSS A;  3QYG B;  4NS5 A;  1K9A A;  3CCE T;  4J6X A;  4C92 G;  1PHT A;  1K9M R;  1T0J A;  4M7A E;  1QF6 A;  1TUD A;  2WAC A;  1EVK A;  2JOY A;  3HXV A;  5IN1 A;  2O9V A;  1K8A R;  1BK2 A;  3TVT A;  1IHV A;  3QZ5 B;  1QVF P;  2SRC A;  1VQM A;  1QP2 A;  4TWA A;  2K79 A;  2MOX A;  2DAQ A;  2QTV A;  2QAZ A;  2EKH A;  3EGX B;  4QQG A;  2X35 A;  3MEW A;  5GAM d;  4QQ6 A;  2ARU A;  3CCL T;  2M0Y A;  4J9H A;  11AS A;  5DM7 R;  4HWO A;  3CCE A;  3OMG A;  1NEG A;  1RI0 A;  2CP6 A;  2CGH A;  2GTJ A;  3S3M A;  4P74 A;  2ED0 A;  3S6W A;  1W70 A;  4EMH A;  1Q86 U;  2EVR A;  3M57 A;  4J6Y A;  2ZT6 A;  3M0T A;  3RIR A;  1UE9 A;  2YDL A;  1E1T A;  2DF6 A;  2P4T A;  5GJW B;  2NYS A;  1JJ2 S;  4XU3 A;  2CP2 A;  3M4G A;  2YUP A;  4E47 A;  1YI2 Q;  1AZG B;  4Q5W A;  2AZS A;  1GFC A;  4LUE A;  2DMO A;  4ORZ A;  4YRO A;  3EG1 A;  4IKF A;  2DX1 A;  1VQ5 Q;  3M0S A;  4JJB A;  1I07 A;  1ASY A;  2YUO A;  3EGU A;  4ZGD B;  1AD5 A;  2AK5 A;  3CPW P;  3A8H B;  4IIM A;  1YIJ T;  1BU1 A;  1PSE A;  4RG2 A;  4AMC A;  4F7U E;  1Q95 G;  4F14 A;  2PUK B;  2FRY A;  2FB7 A;  3BW1 A;  4HWS A;  1D1A A;  5DLQ E;  1JXO A;  2OX7 A;  3QHS A;  1PNJ A;  5FU7 C;  2CDT A;  3NTH A;  1UGV A;  1M5Q 1;  3QO7 A;  1LOJ A;  2DM1 A;  1A0N B;  3L1A A;  3QXE B;  1UTI A;  4FYX B;  4LXC A;  4LDX A;  3C95 A;  4WTO B;  2O01 E;  3L2U A;  5LJ5 h;  2QA4 A;  4BD3 A;  4HCC A;  2QI2 A;  2DXB A;  1ATI A;  2RQU A;  3CPW A;  1QP3 A;  3EAE A;  3I55 Q;  2QK0 A;  2P0Q A;  1BI3 A;  2GBQ A;  1KQS P;  4PG3 A;  2E1H A;  2QEX Q;  3CMA A;  4J9D A;  1WI7 A;  2M1H A;  1KD1 U;  2FHD A;  3ICA A;  2RI3 A;  1EIF A;  4F17 A;  1FYF A;  3NMZ C;  4JS4 A;  1N8R R;  1ZUK A;  1YJ9 Q;  2J7I A;  3HKS A;  3EFR A;  4YCV A;  2ZPE B;  2K57 A;  2QYZ A;  4BI3 A;  2JXB A;  3M9Q A;  2DEU A;  2VAS A;  1EFW A;  1KQS A;  1KQ1 A;  4KR3 A;  1H4Q A;  2RN8 A;  2DK3 A;  1VQ7 T;  1MMG A;  1U3O A;  3GNF B;  3NPF A;  4R55 A;  1E24 A;  3JCM X;  1R8O B;  4BWA A;  4KGZ B;  4E7K A;  3CPW S;  2MYS A;  4ZIB A;  4TVA B;  2J3L A;  2VXE A;  4YPF A;  1PRL C;  5FU6 C;  4M78 C;  3PMI A;  1OOT A;  2LNV A;  3QG1 A;  2R5A A;  1ZLM A;  5CCA A;  3ER0 A;  4C5G A;  1NJI C;  5GAN j;  4AFS C;  4C8Q D;  1VYU A;  1PG5 B;  3CCJ T;  3X25 B;  4PJO G;  1QE0 A;  1LPL A;  4FW2 A;  2BE7 D;  1K73 C;  1WJS A;  2LQK A;  2RNA A;  3A1P A;  1M1F A;  3EFS A;  2RM4 A;  4JPB W;  2EGE A;  3GLX A;  1HJD A;  1KQS S;  2DIL A;  4M78 F;  1VQO T;  2XTI A;  1M3A A;  1XNI A;  1Q81 R;  3DKM A;  2X4Y A;  5GAN 5;  4M75 B;  1UB4 A;  5CQX A;  3OYD A;  3CCJ A;  3JB9 D;  2ODR D;  4M77 D;  2E12 A;  3PMT A;  5GAO m;  4N0A C;  1RIQ A;  3QKJ A;  2OTL Q;  5I2M A;  1NLO C;  1ZBX A;  1MMN A;  2LQN A;  1AZE A;  3OD1 A;  3JRZ A;  4N4G A;  2CT3 A;  1QMC A;  1TTH B;  4WJ4 A;  1TG0 A;  2XG8 D;  1RAI B;  2WSE E;  2DJZ A;  3L2V A;  2JTM A;  1YB3 A;  2RQW A;  3JV3 A;  5LL6 S;  4P72 A;  2DFU A;  3CD6 A;  2QGF B;  2CJB A;  4LVM A;  4YRJ A;  2KNB B;  2QEX A;  1EFN A;  1BIA A;  1Z7N A;  1Y57 A;  2DDZ A;  2A7Y A;  4ME7 A;  4PK4 A;  4GLK A;  2LNH B;  2Q5H A;  2KQW A;  1R0C B;  2JT4 A;  2QQ9 A;  1YJW Q;  3JCM Q;  1K9M C;  5C51 B;  1WHK A;  1PSF A;  4M75 D;  1RAD B;  1YJ9 A;  1YGB A;  1D1B A;  5KCH A;  3OYB A;  1RAE B;  1K8A C;  3CCM T;  2E3I A;  1RAA B;  5KYY B;  3CCV Q;  4RCC A;  1X54 A;  1ZUU A;  3OYY A;  2RHI A;  2RJD A;  5C0M A;  2AIR B;  2K6D A;  4FYV B;  2IPO B;  4H2U A;  1C6V X;  4P3N A;  5HGQ A;  1YIT T;  3REA B;  1YJN T;  1U1T A;  4JRQ A;  4YRM A;  5HK0 A;  1UHF A;  1UEB A;  2AKL A;  4AG1 C;  4TVA A;  2JNG A;  2DKG A;  2HMA A;  3REB B;  4E51 A;  3SDZ A;  2L89 A;  3VS0 A;  3JCM e;  1M2V B;  1Y07 A;  1YCY A;  2MWO A;  5I11 A;  2DO3 A;  2L3S A;  3HY0 A;  3LC0 A;  2C0I A;  4BI8 B;  1UGP B;  3A8G B;  1YIT A;  2P0L A;  5I21 A;  3OS0 A;  4NL2 A;  1TXQ A;  4J9E A;  1X2K A;  4UP7 A;  2DXC A;  2Q7E A;  1IZ6 A;  5F5W A;  2KXD A;  3JB9 G;  1YP5 A;  4OMM A;  2CP0 A;  2HKQ B;  4M75 A;  5FU7 B;  3M53 A;  2QG9 B;  2MPX C;  2XD0 A;  1XTD A;  2W10 A;  2DQ3 A;  1OV3 A;  2V1R A;  1WZO A;  5KYW B;  1VQK Q;  2DD4 A;  4XTY A;  2CJA A;  1P92 A;  8AT1 B;  3QJY A;  3HXZ A;  2MIO A;  4D8D A;  3NHN A;  1UEC A;  1K0X A;  4TVR A;  2JW4 A;  1Z9Q A;  1JBM A;  4HXJ A;  2D8H A;  4P71 C;  4K86 A;  2E64 A;  4P3O A;  3JCM P;  2XU8 A;  2E6Z A;  4RTX A;  3CCQ Q;  2E5K A;  4OB0 B;  4UC4 A;  4EO4 A;  1IO6 A;  5ELO A;  2XK0 A;  1Y96 A;  3EG9 B;  4ELY C;  1QKX A;  1I1J A;  2WSF E;  4X1V A;  1N8R C;  1VQN Q;  1ZQ1 A;  3IQL A;  1N9R A;  1GCQ A;  3CCS Q;  1OU9 A; 
#chains in the Genus database with same CATH homology
 3HPW A;  2Q5I A;  3CCR T;  3ME9 A;  2E70 A;  3V8L A;  3HL8 A;  4PLI A;  1H4V B;  1DJ7 B;  2L8D A;  3E9F A;  1KOG A;  1YJW A;  3PT9 A;  3OS2 A;  4VUB A;  4QQD A;  3I56 T;  5GAM h;  4M7A D;  4TVY A;  1M4Z A;  4A54 A;  3CCR A;  4XTX A;  1B34 B;  5FU6 B;  2R57 A;  1I81 A;  4YTL A;  4LDU A;  4GY5 A;  4KT0 E;  4M7D G;  4YRN A;  4HCB A;  4O5V A;  3OYN A;  1GXI E;  4FM4 B;  2F69 A;  3H8Z A;  4C92 B;  2DVE A;  2DXU A;  1BBW A;  4OGE A;  4YRR A;  3HRS A;  2G3R A;  2WSC E;  3A74 A;  3MP6 A;  2K3Y A;  4OB1 B;  3T9N A;  3LSS A;  2R58 A;  5D6X A;  1H4S A;  2JTF A;  2MAM A;  5LJ3 d;  3F70 A;  5CR2 A;  3CCU A;  2HQE A;  3OYM A;  1Q81 C;  2ZZD A;  2DZ9 A;  2LC4 A;  2GQV A;  2LT1 A;  2LTO A;  5KE2 A;  4C8Q C;  3RKX A;  2D6F A;  2V8J A;  5GAO l;  1HC7 A;  4N4H A;  2GFA A;  2ZR2 A;  3CC7 T;  3QO5 A;  2RK2 A;  5LJ3 f;  3ERR A;  1NJI U;  3VQV A;  2ODR C;  3CC4 T;  4M77 C;  4JS5 A;  3RKY A;  2D0Q B;  2HQX A;  1VQZ A;  4C8Q F;  3V8K A;  2VGM A;  1K73 U;  1B7Y B;  3ASK A;  2XDD A;  3CC7 A;  3CME T;  3QII A;  1SSF A;  1VQN A;  3ZEH A;  4M7A G;  3CC4 A;  4XTW A;  1VQ6 T;  3HXU A;  2OTJ T;  3QNE A;  3FLG A;  1WGS A;  2ZPB B;  4M77 F;  4XEO A;  2DU5 A;  3GIB A;  2ZCF B;  4ZTF A;  1WNL A;  2QQB A;  1B34 A;  4YRT A;  2ZIN A;  1KHI A;  2P0K A;  2M16 A;  2R5M A;  1KMM A;  1L0W A;  2PQW A;  1VQ6 A;  2F5K A;  5CKH A;  2O4X B;  2K4Y A;  2V8K A;  4C0Z A;  4M75 C;  4C92 A;  3QSU A;  2CIM A;  2C06 A;  1G3T A;  5CIU A;  4YRG A;  2EJ9 A;  3V7R A;  3MF2 A;  3OYF A;  1W2B A;  1NJ1 A;  1NPR A;  3FRN A;  4CS4 A;  1K9M U;  3OW2 A;  2VGN A;  4ZTZ B;  4V2S A;  4N0A A;  4M75 F;  3P8V A;  3GF5 A;  4JDS A;  1K8A U;  4J5Y A;  4F7U G;  1VQM T;  4XU1 A;  3HRT A;  3OB9 A;  4EMG A;  5J39 A;  3X20 B;  4HA8 A;  2Y4Y A;  2QQS A;  4J83 A;  2Q7H A;  5J3B A;  1LYL A;  3A7R A;  2AKW B;  4OB2 B;  3LWH A;  2A8E A;  2ZGW A;  4HWT A;  5LJ3 e;  1VQ4 T;  2YHT A;  2CZ0 B;  4ZTU B;  4CS3 A;  1EIY B;  12AS A;  4RKU E;  4Y28 E;  3G7Z A;  2FL7 A;  4BUG A;  1VIF A;  2DIG A;  3QPH A;  1B7Y A;  1W2B S;  3WVE B;  4OVA A;  1VQ4 A;  1S72 T;  4RCB A;  3OS1 A;  4KUD K;  2EYQ A;  2IG0 A;  3OW2 S;  4YCU A;  4ZGJ B;  5GAN 7;  4XU2 A;  2QHV A;  2D9T A;  5GMK i;  2XIC A;  1QVF A;  3S3N A;  5LJ3 g;  1OZ3 A;  3DLM A;  2RHY A;  4YRK A;  1O9S A;  3REU A;  4R56 A;  1S72 A;  2EQU A;  2EFI A;  4B9X A;  2K5L A;  1I5L A;  4C0G A;  1Q7Y C;  3HXW A;  2YLC A;  5EG2 A;  4A4H A;  1KHC A;  4PJO D;  4G84 A;  2QA4 T;  1WQ7 A;  3BJU A;  2O4X A;  4LDY A;  2RI2 A;  1NZ9 A;  4XTZ A;  2CKK A;  5GMK m;  1WYD A;  3CMA T;  3HY1 A;  1W4S A;  1X2G A;  2E5A A;  1WPY A;  4BB7 A;  2PUO B;  2KVQ G;  4BW9 A;  2H3J A;  3NEN A;  4M78 E;  4RQE A;  4OB3 B;  1N8R U;  2PVD B;  4HVC A;  1QVF S;  1YHQ A;  5CKB A;  2ZXF A;  4CS2 A;  1G3W A;  4C8Q B;  2E41 A;  3E9H A;  3MET A;  5DY9 A;  4EX5 A;  2AKW A;  2QQA A;  3BDU A;  5GAN h;  3JB9 J;  2BIV A;  2LCL A;  2ZZG A;  5GAO n;  4P71 A;  3L4G B;  3JCM d;  1N27 A;  2ZZE A;  4TQF A;  2RHQ B;  1EIY A;  2CYZ B;  4YRP A;  4C0F A;  3A5Z A;  3M4Y A;  1SET A;  4M77 B;  1N6A A;  1M90 C;  3O8V A;  4YRE A;  3R07 A;  3URG A;  4NCX A;  4J7I A;  3JCM V;  2VYT A;  3X24 B;  2GCX A;  2EJG A;  2DPP B;  3LGF A;  3BDL A;  2HNI A;  4JJN K;  1VQ5 T;  3PZC A;  3JCM f;  1Q81 U;  4C92 C;  4CI0 C;  2ZPF B;  1YI2 A;  3M55 A;  4NL3 A;  1BKB A;  4JLI A;  2C7I A;  2QQR A;  4XQ3 A;  3P8Y A;  3JCM W;  1VQ5 A;  5GAN 6;  3NTK A;  4MDX A;  3QZ9 B;  3PNW C;  5KE3 A;  3A7A A;  4WF2 A;  4C92 F;  5K1X A;  2LQ8 A;  3I55 T;  3CD6 T;  1HTT A;  3HRK A;  2RJF A;  5GMK e;  3PIO A;  1LNX A;  2QEX T;  3UDC A;  3OMC A;  4HT4 A;  3VQY A;  3VUZ A;  3HFZ B;  2PMF A;  5GAN 3;  1SES A;  1Y7X A;  3I55 A;  1YJ9 T;  4C8Q A;  3JB9 H;  3CEY A;  1G51 A;  3I7F A;  3VQX A;  1Y96 B;  4KUL A;  2ZNJ A;  3M56 A;  2XI9 A;  3JCM J;  2I4N A;  3L4G A;  4E7H A;  4DOW A;  4OMF B;  5A2Q E;  2RHQ A;  1TH7 A;  4A4E A;  1X6O A;  1O75 A;  1YFR A;  4M77 A;  4QVZ A;  3VBB A;  2DTI A;  1NJ8 A;  2KY9 A;  4XK8 E;  2I4O A;  2LCC A;  5LJ3 j;  4HWP A;  3L2Z A;  4OF1 A;  3KXT A;  1ASZ A;  3MQZ A;  4YYE A;  4HCZ A;  2QHT A;  2GF7 A;  3MHX A;  3E9I A;  2DZC A;  2MI6 A;  4YRI A;  4TQD A;  3V8J A;  4M7D D;  4K87 A;  2F5T X;  3OA6 A;  4MZT A;  4RMO A;  1WU7 A;  3HFV A;  2ZT7 A;  5LJ5 d;  4JRP A;  2OTL T;  3VYH B;  1X56 A;  3JCM g;  3OSV A;  3FIF A;  1N9W A;  4QW2 A;  3LWI A;  2PVO B;  1M1K C;  5HK3 A;  2KK4 A;  4L6V 5;  1KQ2 A;  1BI2 A;  4M7A B;  1UGS B;  2EQM A;  1IL2 A;  3RUX A;  3FC3 A;  4UP8 A;  3HFZ A;  3BFM A;  2OTL A;  2JUF A;  5GMK l;  4YRC A;  1VUB A;  5CAI A;  4XAX B;  4PJO C;  2CJ9 A;  4WI1 A;  2FVU A;  4XTV A;  4BDY A;  1AHJ B;  3TUP A;  1BBU A;  1BI1 A;  2DIQ A;  5FLX E;  5LJ5 f;  5CQY A;  1YJW T;  2QHS A;  3QDR B;  2EWN A;  3P8H A;  4MZP A;  2ART A;  4HT8 A;  1YFS A;  2QXF A;  2VC8 A;  3RL6 A;  3CCV T;  3QYH B;  1WLE A;  1Q7Y U;  1B76 A;  3IAL A;  3OY9 A;  4LDW A;  4II1 A;  4PJO F;  3REX A;  1SRY A;  4LNS A;  4PLL A;  1MHN A;  4KUI A;  4UPA A;  4O6J A;  4C8Q E;  5CKF A;  4ELZ C;  3LGL A;  3CCV A;  1UGQ B;  4UP9 A;  5C6S A;  4J15 A;  2ALY B;  3C4S A;  4A53 A;  2ZT8 A;  2RI5 A;  4PL6 A;  3OYH A;  1I4K 1;  4RQF A;  1WQW A;  1G3Y A;  4M77 E;  3CCU T;  1KC8 C;  3MP1 A;  3UPU A;  3HTZ A;  4RMF A;  2DTO A;  4IUR A;  4FT2 A;  5GAO p;  1X01 A;  3HRI A;  2EIF A;  3RKW A;  5DLO A;  2L5Q A;  1VQK T;  2PU9 B;  3SFM A;  1H3Z A;  4Q15 A;  2DXT A;  1C0A A;  3QBY A;  3UGT A;  3E1S A;  3LX7 A;  4PKC C;  3N5B B;  3P8B B;  4M7A A;  2V8I A;  1M90 U;  4LVK A;  3GOX A;  4G85 A;  4KBM B;  1VQK A;  3CCQ T;  4M75 E;  1NJ2 A;  5LJ5 e;  2X4J A;  3LW5 E;  2ZR3 A;  2K5F A;  1VQN T;  4CH5 A;  2RHS B;  3MEA A;  5D6Y A;  5GMK j;  5GAN 4;  4AH6 A;  3CCS T;  2CZ7 B;  4M78 D;  2FYK A;  2P0P A;  2ARS A;  5D6W A;  3CCQ A;  2MWP A;  1NPP A;  4XTU A;  3FDR A;  3HFN A;  3FB9 A;  4BAC A;  3CCS A;  2EAY A;  1OYX A;  3HFO A;  5LJ5 g;  1UGR B;  1GGM A;  3JB9 F;  1FX7 A;  3RER A;  1VQL A;  3KBG A;  3A31 A;  3CXC A;  3ZFJ A;  2ALY A;  1B8A A;  4KQE A;  2HAX A;  1VQ8 A;  3CBP A;  5A0D A;  3LYI A;  2RA2 A;  2JN0 A;  4YRF A;  4LD6 A;  4P73 A;  3OYA A;  3CC2 A;  5A0L A;  4TTV A;  4FT4 A;  3FEO A;  4Y91 A;  4H2T A;  3GNG A;  2QDY B;  3G71 T;  2EL9 A;  2BUD A;  2QTX A;  3UWN A;  5KNN A;  2YRV A;  2ZTG A;  3JCM b;  3GP8 A;  2LDM A;  2LVM A;  4KR2 A;  5IAY A;  5CKE A;  3OYI A;  3E19 A;  2K2V A;  3TCJ A;  1D3B B;  5KCO A;  4DPG A;  5AYF A;  4D6W A;  3PIP A;  3CXC S;  3G71 A;  2E3C A;  2AMC A;  3QJ6 A;  3DB4 A;  3HXX A;  4M7D C;  1G5I A;  1HK9 A;  2E10 A;  2ZPI B;  3DSQ A;  4P3P A;  1JJC B;  2CZ1 B;  4PJO B;  5M9O A;  4M78 G;  1G5H A;  2VV5 A;  3HSB A;  2RHS A;  4X34 A;  3A5Z B;  3HP9 A;  5C52 B;  2M0O A;  4J7F A;  5A0G A;  2JZ2 A;  3CBM A;  3MO8 A;  2J3M A;  4Q6G A;  4WJ3 M;  3WVD B;  2ZIM A;  4M7D F;  3NFC A;  5L8R E;  5CO7 A;  3KUF A;  3L2R A;  1G3S A;  4K88 A;  4X9C A;  3MEY A;  2VXF A;  2QHU A;  4EPC A;  3OYL A;  3OYC A;  1E22 A;  3IKM B;  4HT9 A;  1M1K U;  3J7A F;  3HHT B;  2Y90 A;  2XHC A;  3CCL A;  3UFG A;  2DTH A;  2RO0 A;  4OLF A;  4IUP A;  5FRN A;  3SWN A;  3IG2 A;  1XOV A;  3MF1 A;  4JLG A;  2GFU A;  5GAM f;  4J8O A;  3H6Z A;  1YHQ T;  3RMS A;  2ZZF A;  4EMK A;  2YLB A;  2DU7 A;  4P75 C;  3LSQ A;  2MMP A;  4M7A C;  4EDU A;  1QW1 A;  3M59 A;  4BE2 A;  4P5N A;  2LRQ A;  3OSS C;  3VQW A;  2EKO A;  4X9D A;  4XEM A;  4C92 E;  1D3B A;  3WQZ A;  1YIJ A;  1ADJ A;  5GAO q;  3L2W A;  1BI0 A;  2XGT A;  2G4C A;  1M9S A;  4QVC A;  4HWR A;  3CMQ A;  4M7A F;  1JJC A;  4PJO A;  3MEU A;  2DD5 A;  4MZM A;  3L42 A;  1QVP A;  1H64 1;  3M4P A;  3A8O B;  2IVW A;  2VUB A;  2C8M A;  4H2V A;  3QO3 A;  1USY C;  5HKC A;  4E7L A;  3QUI A;  3V7C A;  2OAU A;  2P5I A;  4C0D B;  1KC8 U;  1E1O A;  4C5H A;  5LJ5 j;  3JSC A;  4L87 A;  1YI2 T;  4MML A;  1FXX A;  2BKD N;  2Y4X A;  4H2S A;  4RDX A;  3W3S A;  4A4G A;  4P73 C;  1N9S A;  5CVI A;  5KH6 A;  3AHU A;  1OZ2 A;  2LT4 A;  3S3O A;  1M1G A;  3HXY A;  3Q1J A;  5GAN 2;  4FU6 A;  3P8T A;  1XQH A;  1G5V A;  1VQ7 A;  4F7U F;  2HBP A;  2AHJ B;  1Q82 C;  3QTC A;  2ZPH B;  5CKD A;  5GAM e;  3OYE A;  3UT1 A;  3WXM B;  4E7I A;  4PHC A;  1YFT A;  3JAM E;  2A3L A;  2RJE A;  4H2W A;  4LDV A;  3NTI A;  5FRO A;  4TVW A;  4NOY A;  4BE0 A;  3VUB A;  3PCO B;  5C53 B;  4ZTJ A;  5GAM g;  4BY6 C;  5LJ3 h;  1WJQ A;  2RHU A;  1EQR A;  4ZGE B;  4FSX A;  1NYR A;  4B9W A;  2RK1 A;  1VQO A;  4M7D B;  1M8V A;  3MP8 A;  2M9U A;  1YBY A;  4CH3 A;  3OYK A;  2KDS A;  4JUV A;  3DB3 A;  4OP0 A;  4JRI A;  1JRI A;  2ZNI A;  3RAC A;  1OI1 A;  4LD9 K;  2RB6 A;  2ZPG B;  4YDQ A;  3CPF A;  3P8D A;  4P74 C;  3JB9 I;  4PNO A;  4C5E A;  5I2S A;  4DQ2 A;  3M58 A;  4PJO E;  2K5I A;  3OQ5 A;  3SB2 A;  3OBY A;  1J5W A;  2KMT A;  1I8F A;  5HY6 A;  3LH0 A;  3SWN C;  2PME A;  2KAF A;  3HRU A;  5K1P A;  2I4L A;  3DLL A;  5GAO r;  3CBO A;  3CCM A;  2I4M A;  3NET A;  3M54 A;  4EMK C;  3M5A A;  4C8Q G;  1U8R A;  4E7J A;  4L59 A;  1YJN A;  4YRL A;  3LLR A;  2EQK A;  4OGC A;  3PTA A;  2EQJ A;  1Q86 C;  4M77 G;  2MF2 A;  3MEV A;  4CRI A;  1WJR A;  3UGQ A;  2EJF A;  2HD0 A;  5IT9 E;  3A8L B;  1H4T A;  2ZCE A;  3TU4 K;  2XID A;  3PCO A;  2X4W A;  1ADY A;  4A4F A;  1BIB A;  3GPL A;  1HXD A;  3TEH B;  5GAN d;  1KMN A;  3OYJ A;  4M7D A;  2E65 A;  2XKO C;  4BI4 A;  1V29 B;  1NE8 A;  2XDP A;  2PVG B;  4MDW A;  4HKE A;  1NJ6 A;  4IUV A;  3G6E T;  3PGG A;  1B70 B;  3OBW A;  1NYQ A;  3J81 E;  1VIE A;  4M75 G;  4ZN3 A;  3VKI A;  1JB0 E;  3NEM A;  1Z7M A;  5GAN f;  4IUQ A;  1MGQ A;  4F7U B;  4FIB A;  1KD1 C;  3G6E A;  5GAN 8;  4JRK A;  4A4K A;  3TRE A;  1IRE B;  3ZBD A;  4N4I A;  4LVI A;  5ELN A;  1BYM A;  3KFU A;  4BE1 A;  4M78 B;  2I2L A;  3R6O A;  5FRM A;  2NS6 A;  3TEG A;  4H2X B;  4J6W A;  1FWZ A;  4Z02 A;  2IY5 B;  3UH0 A;  3RMQ A;  3A5Y A;  5GMK h;  3RGL A;  3I56 A;  3VU3 C;  4YRQ A;  4YP0 A;  2RH2 A;  3L2Q A;  4RG8 A;  4P75 A;  2AMC B;  3QO8 A;  4O2D A;  2DQ0 A;  5GAM j;  3VV0 A;  4C5I A;  3RES A;  1NNH A;  1PYS B;  4H02 A;  4H2Y A;  4BY6 B;  4P72 C;  3TEH A;  2XDB A;  3X26 B;  2CZ6 B;  3A8M B;  3X28 B;  2X4X A;  1X2H A;  3J80 E;  4C0D C;  1VQL T;  1X75 C;  4XU0 A;  2E5Q A;  4DOV A;  3INZ A;  2E6N A;  2Q7G A;  4C92 D;  1EVL A;  2LX9 A;  3VJP A;  3JCM c;  1EOV A;  4FL6 A;  1USY A;  1VQ8 T;  4ZN1 A;  1Q82 U;  2RD1 A;  1B70 A;  4X5O A;  3JCM h;  3C12 A;  5GAN e;  4BDZ A;  3CC2 T;  4M7D E;  3RF1 A;  1ZHI A;  3TEE A;  3OS5 A;  3VYG A;  3A7U A;  3G1Z A;  4F7U A;  2ZIO A;  2ZT5 A;  3IKL A;  1LJO A;  3PFS A;  1SER A;  4L5G A;  4CH4 A;  1U1S A;  3SWN B;  1QVG A;  2K3X A;  4IUT A;  3G4S T;  3CME A;  3M4Q A;  3FJP A;  4DA4 A;  5GAN g;  4M78 A;  3V7S A;  4EMK B;  1VQP T;  4H2X A;  1NJ5 A;  1W66 A;  4YCW A;  2IY5 A;  2RJC A;  3MCA B;  2OTJ A;  1KG1 A;  4LVJ A;  4LVL A;  3C94 A;  3NEL A;  4YRS A;  4IUU A;  2RHZ A;  3G4S A;  3A32 A;  2CS7 A;  3SD4 A;  1VQP A;  2B8A A;  5E3I A;  5J26 A;  1RL2 A;  1VQ9 T;  3BY7 A;  2RHX A;  2JVV A;  2DEQ A;  2L3R A;  1PYS A;  4CH6 A;  5CK9 A;  3OYG A;  3E9G A;  2NLU A;  1Y71 A;  1JJ2 A;  1QVG S;  4QVD A;  4ATO A;  1VQ9 A;  1X55 A;  4MMK A;  2KSS A;  3QYG B;  4NS5 A;  3CCE T;  4J6X A;  4C92 G;  4M7A E;  1QF6 A;  2WAC A;  1EVK A;  2JOY A;  3HXV A;  5IN1 A;  3QZ5 B;  1VQM A;  1QP2 A;  4TWA A;  2X35 A;  4QQG A;  2DAQ A;  3MEW A;  5GAM d;  4QQ6 A;  2ARU A;  3CCL T;  11AS A;  5DM7 R;  4HWO A;  3CCE A;  3OMG A;  1RI0 A;  2CGH A;  3S3M A;  4P74 A;  3S6W A;  4EMH A;  1Q86 U;  3M57 A;  4J6Y A;  2ZT6 A;  3RIR A;  1E1T A;  2P4T A;  1JJ2 S;  4XU3 A;  3M4G A;  4E47 A;  4Q5W A;  4YRO A;  4IKF A;  1ASY A;  4ZGD B;  3A8H B;  1YIJ T;  1PSE A;  4RG2 A;  4F7U E;  2PUK B;  3BW1 A;  2FB7 A;  4HWS A;  5DLQ E;  3QHS A;  5FU7 C;  3NTH A;  1M5Q 1;  3QO7 A;  1LOJ A;  3L1A A;  3QXE B;  4LDX A;  3C95 A;  2O01 E;  3L2U A;  5LJ5 h;  2QA4 A;  4BD3 A;  4HCC A;  2QI2 A;  2DXB A;  1ATI A;  3CPW A;  1QP3 A;  3EAE A;  2P0Q A;  1BI3 A;  4PG3 A;  2E1H A;  3CMA A;  2M1H A;  1KD1 U;  2FHD A;  3ICA A;  2RI3 A;  1EIF A;  1FYF A;  4JS4 A;  3HKS A;  3EFR A;  4YCV A;  2ZPE B;  2K57 A;  4BI3 A;  3M9Q A;  1EFW A;  1KQS A;  1KQ1 A;  4KR3 A;  1H4Q A;  2DK3 A;  1VQ7 T;  3GNF B;  4R55 A;  1E24 A;  3JCM X;  1R8O B;  4BWA A;  4E7K A;  3CPW S;  4ZIB A;  4TVA B;  2J3L A;  2VXE A;  4YPF A;  5FU6 C;  4M78 C;  3PMI A;  2LNV A;  3QG1 A;  2R5A A;  5CCA A;  3ER0 A;  4C5G A;  1NJI C;  5GAN j;  4C8Q D;  3CCJ T;  3X25 B;  4PJO G;  1QE0 A;  1K73 C;  1WJS A;  2LQK A;  1M1F A;  3EFS A;  2RM4 A;  3GLX A;  1KQS S;  4M78 F;  1VQO T;  2XTI A;  1XNI A;  3DKM A;  2X4Y A;  5GAN 5;  4M75 B;  1UB4 A;  5CQX A;  3OYD A;  3CCJ A;  3JB9 D;  2ODR D;  4M77 D;  2E12 A;  3PMT A;  5GAO m;  4N0A C;  1RIQ A;  3QKJ A;  5I2M A;  1ZBX A;  3OD1 A;  3JRZ A;  4N4G A;  4WJ4 A;  2XG8 D;  2WSE E;  2DJZ A;  3L2V A;  2JTM A;  1YB3 A;  5LL6 S;  4P72 A;  3CD6 A;  2CJB A;  4LVM A;  4YRJ A;  2QEX A;  1Z7N A;  1BIA A;  2DDZ A;  2A7Y A;  4ME7 A;  4GLK A;  2Q5H A;  2KQW A;  2QQ9 A;  3JCM Q;  1K9M C;  5C51 B;  1PSF A;  4M75 D;  1YJ9 A;  1YGB A;  5KCH A;  3OYB A;  1K8A C;  3CCM T;  1X54 A;  4RCC A;  3OYY A;  2RHI A;  2RJD A;  5C0M A;  4H2U A;  4P3N A;  5HGQ A;  1YIT T;  1YJN T;  1U1T A;  4JRQ A;  4YRM A;  5HK0 A;  1UEB A;  4TVA A;  2JNG A;  2DKG A;  4E51 A;  3SDZ A;  2L89 A;  3JCM e;  1Y07 A;  1YCY A;  2MWO A;  2DO3 A;  3HY0 A;  3LC0 A;  4BI8 B;  1UGP B;  3A8G B;  1YIT A;  2P0L A;  5I21 A;  3OS0 A;  4NL2 A;  4UP7 A;  2DXC A;  2Q7E A;  1IZ6 A;  5F5W A;  3JB9 G;  4M75 A;  5FU7 B;  3M53 A;  2XD0 A;  1XTD A;  2DQ3 A;  2DD4 A;  4XTY A;  2CJA A;  1P92 A;  3QJY A;  3HXZ A;  4TVR A;  1JBM A;  4P71 C;  4K86 A;  2E64 A;  4P3O A;  3JCM P;  2XU8 A;  2E6Z A;  4OB0 B;  4UC4 A;  4EO4 A;  5ELO A;  2XK0 A;  1Y96 A;  4ELY C;  2WSF E;  1N8R C;  1ZQ1 A;  1N9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...