2DZOB

Crystal structure analysis of yeast nas6p complexed with the proteasome subunit, rpt3
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
MSLAPEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure analysis of yeast Nas6p complexed with the proteasome subunit, rpt3
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Probable 26S proteasome regulatory subunit p28
total genus 15
structure length 57
sequence length 57
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dzoB00
4FWDA 4LRTA 2DZOB 2XSZA 3EIHA 1C1KA 1IN8A 2QP9X 4A3VB 1NSFA 4QOSA 5EP4A 1HQCA 1JR3A 5C18A 1QZMA 3CF0A 3GLIA 3WHKA 3HU2A 1DO2A 1XXHA 4WW0A 2QBYA 1NY6A 5EQTA 1R6BX 4FWHA 2KRKA 1IN6A 4LY6A 5EXPA 1IQPA 1S3SA 2BJVA 5EP2A 1OFIA 3SYKA 5C1BA 1IM2A 1G41A 1HQYE 1LV7A 2BJWA 1D2NA 2CE7A 1FNNA 4LJ6A 5JI2E 3U5ZB 1IXZA 1IY0A 4KLNA 2CEAA 4L15A 1W5SA 1QVRA 1UM8A 1HT1E 4FCTA 1KYIA 1IN5A 4KO8A 4D82A 4LJ4A 2R65A 2X8AA 2CHQA 5JI3E 1SXJC 2XSZD 2V6ZM 2V1UA 2C9CA 2DWZB 2QZ4A 3HU1A 4I81A 2VIIA 3GLGB 3H4MA 4LRSA 3ZH9B 2ZAMA 1IN7A 2CHVA 3BOSA 3DZDA 5EXSA 5EP1A 3U61B 3KDSE 2QENA 4QNMA 4QHSA 1HT2E 5EXXA 3AJIB 4LJ5A 4GITA 4JN6A 4LJ7A 4Z8XA 1E32A 1E94E 2C9OA 2C96A 3SC3A 3B9PA 5EXTA 4FWGA 3D8BA 4KODA 5FTLA 1L8QA 3PVSA 3M0EA 1NY5A 3MHVC 1R7RA 3SYLA 1OFHA 1SXJA 1JR3D 2ZAOA 4QHTA 3PFIA 1SXJE 4LZZA 1J7KA 4LGMA 5FTMA 4EIWA 1OJLA 1DO0A 3KW6A 4FD2A 4QNRA 1NJGA 1IY1A 4FCWA 3GLFA 2C98A 1W5TA 4LJAA 4D80A 1IXSB 3VLFB 5DYIA 1IN4A 1NVMA 2DVWB 2R62A 3R8FA 5DYGA 3GLGA 3M6AA 3GLIB 4I4LA 2QBYB 1KSFX 4L4UA 2HCBA 4LJ9A 3VFDA 5EP3A 5FTKA 3GLFB 1JQJC 5FTJA 3U60B 5FTNA 3UK6A 4FCVA 1G3IA 4LJ8A 1G4AE 2DHRA 1XWIA 2Z4RA 4L16A 3GLHA 4ZPXA 1IXRC 1NJFA 3HU3A 2ZANA 1SXJB 4FW9A 1X37A 3PXGA 1IY2A 2C99A 4LCBA 3K1JA 2Z4SA 3CF2A 3HWSA 4D81A 2RKOA 2CHGA 3EIEA 3WHLA 2QPAA 3GLHB 1XXHB 2DZNB 2FNAA 1SXJD
chains in the Genus database with same CATH superfamily
1DGHB 2L7HA 1Z5BA 1WXQA 3I01M 4LZJA 2DI0A 2XF3A 2XSZA 1D0MA 4IBCA 3A45A 1C1KA 4B7FA 4G4OA 2YQZA 3BXWA 1Y8GA 3GPPA 1FJGM 2QNJA 4B3SM 1NV8A 5EP4A 1QUSA 4PDIA 1JR3A 2LVPC 1QZMA 4M9SA 1GO5A 3T6PA 1JR3E 1NY6A 3OTOM 1R6BX 2DWLA 1N36M 3I51A 1IQPA 1S3SA 3T1YM 4DR2M 5C1BA 2YR0A 3MK6A 4RNAA 2R44A 4X65M 2CE7A 2M5ZA 2LVAA 3A42A 4DV6M 2X49A 4LJ6A 1NNJA 1N78A 3GQ3A 4XK8F 1L2DA 4AQYM 2L7IA 1N77A 1W5SA 4QOZC 1QVRA 3GP1A 1UM8A 1KYIA 1AUAA 3LMMA 1P3QQ 3HY5A 2CUZA 1OAIA 2R18A 5IREB 4ITQA 2WSEF 1DV0A 2CHQA 3UZUA 1KFVA 3TWLA 4JI8M 2V6ZM 1GL6A 3FYDA 4HL4A 1Q3CA 2DWZB 2KA6B 2MJ5B 4I81A 1XC8A 4REZA 3AV0A 4L8RC 5ITUA 5DNYA 3RE8A 3DZDA 1TDZA 3IG5A 3FUUA 2QENA 3LVWA 4F2LA 2HL7A 1TTEA 3GQ4A 4DR3M 2Y0QA 4GITA 5KO3A 1I94M 4MGYE 4Z8XA 2EKFA 3B7QA 2C9OA 3QWLA 3HZJA 2YFQA 3L26A 2LWXA 5EXTA 1J5EM 1Z59A 5FTLA 1L8QA 3PVSA 3M0EA 5IWAM 4MGKE 4LF9M 3CGWA 4F1IA 2OQ4A 2ZAOA 4JI1M 3RFWA 2LXEA 2FH0A 2DAEA 4EIWA 1J7KA 4NRWA 3B74A 3DFZA 1TR8A 1DO0A 4BB9A 1N32M 5IT9S 4FD2A 2LNHC 2DNAA 4QNRA 2UXBM 4GHAA 3H4JA 3SATA 1QAOA 1IY1A 2G5GX 1E9RA 1D0KA 5E26A 5KPRA 4FCWA 3SBJA 3VKGA 1E9SA 3U6DA 3GPUA 2VDBB 4D80A 4B3RM 1IXSB 4IBEA 4S12A 1IN4A 1NVMA 2DHYA 2R62A 4K0KM 3FRHA 3GLGA 3GLIB 4B7GA 1QAMA 1F4IA 1QAQA 2O01F 3MMPA 4L4UA 3TPZA 2OPFA 2F5QA 5FTKA 2DWNA 2DAGA 2H5XA 4GH9A 2EO2A 3U6MA 3VK7A 2DZLA 3FE3A 5ITRA 1GJSA 1Z6TA 4DR7M 2LTUA 1T43A 4L16A 1CUKA 2K47A 4R71A 3FUWA 1XB2B 1IXRC 1NJFA 1V34A 1QUTA 2ZANA 3HU3A 4G4NA 3C3EA 2CRUA 1TDHA 3PXGA 2F5PA 3KOZE 2L2DA 3K1JA 2F4VM 1WJ7A 1YSYA 3M7GA 3J7BA 4D81A 1L2BA 2HHHM 3GRRA 3B7ZA 4RF1A 3E21A 3WHLA 4AKGA 1EE8A 2QPAA 3LQRA 3KFUG 4JI4M 1SXJD 1ZQ9A 1WGNA 4LRTA 4NC6A 4PT5A 3U61A 4GRIA 4X62M 2CWBA 1XNQM 2JY5A 3EIHA 2LVNC 4AZFA 2UXDM 1QDTA 2KNZA 3HHXA 4ANRA 2QP9X 1PJSA 2B3TA 4G3OA 4CISA 3FUXA 4JXJA 5C18A 2DENA 1K3WA 4KT0F 5EJCA 3WHKA 4MM3B 2QBYA 1GKIA 1XXHA 5ITXE 3JR5A 4FWHA 5LMUM 1J09A 5KQ8A 2BJVA 4AI6A 1VQ1A 3IHPA 5EP2A 1OFIA 3SYKA 2JY6B 1G71A 1G41A 2RGHA 1TH4A 2FFJA 4M9XA 3UGJA 4DV5M 1FNNA 3R9XB 3U5ZB 1IXZA 1MU5A 2F5OA 3SMSA 3VDPA 3K8ZA 4DUZM 1HT1E 1IN5A 3HGIA 4KO8A 2XGNA 3AOEC 2K6BA 4DR1M 2NQ8C 4GC9A 1PGYA 1ZMUA 4I8OA 4LF7M 2XSZD 4JI0M 3Q8XA 2MR9A 2XZUA 2FS1A 2C9CA 1WR1B 2JZ1A 2QZ4A 1D0LA 3KS4A 2VIIA 3U5ZA 1VEGA 2E5LM 5KPZA 1QZEA 3HJSA 4DV3M 2UUCM 4IBJA 1IN7A 2CHVA 2R0IA 1V33A 2UXCM 4G6ZA 3D8LA 3FKEA 3KP0E 4IIWA 5EP1A 2DXIA 2OO9A 3SASA 3E4RA 3KDSE 1HR0M 2O5RA 1HNZM 5EXXA 1ZMVA 3TE6A 3GLFE 4OVZB 2KDLA 1I4WA 4P17A 3KVWA 3SC3A 3B9PA 2MGWA 4BBAA 4KODA 3HJ8A 4HLQA 1K82A 3ZC7B 1TGUA 3HKPA 3HJQA 4GEWA 1VDDA 3Q8GA 3PFIA 3SFZA 1SXJE 4LZZA 2LBCA 2D7EA 4YY3M 3KW6A 1QYRA 5ITQA 4B7HA 4JYAM 1OQYA 3K9PA 1MN3A 1OAOC 1OTRA 3GLHE 5KPTA 4MGIE 2HAKA 2BWBA 1PM5A 4LG2A 1W5TA 2KW0A 3HHWA 5DYIA 5BR8M 1GVNA 2DVWB 1NNUC 2EJSA 3C3DA 4I4LA 1PRBA 4Q7JA 2QBYB 3I4YA 1V92A 2K9DA 2D7HA 4G4RA 1R4GA 2WZJA 3AOEA 4PCZA 1GL7A 3QYEA 2EUCA 2WSCF 3NBIA 3L27A 3U60B 2FE8A 5FTNA 4IBGA 4FVMA 4Z6YA 4TUWA 3UK6A 4FCVA 1XNRM 2HKJA 4LJ8A 3SAUA 2DHRA 3JR4A 2Z8YM 4B08A 4M9ZA 1DGGA 3U6QA 4HEOA 3PNYA 3W0LB 2KXEA 1DGHA 2UUAM 2LVQD 1OIZA 2K0BX 2M60A 1DGFA 2J7OA 3BBZA 3LW5F 2C99A 3GRVA 3FD9A 4LCBA 3C58A 4LFBM 3CF2A 5ITYA 1NHWC 3EIEA 4B3MM 1PJQA 1QDRA 3F92A 3A46A 2R4JA 3C9PA 4FWDA 2DZOB 1Q3BA 3LQQA 4L78A 4DV4M 3L2AA 3AKZA 2DAKA 8CATA 1Z5CA 1LTMA 4CJ6A 3GO8A 2CP8A 3GLIE 5F3WA 2Q2EB 1HQCA 3QAUA 4KHPM 4W5WA 3GLIA 3ILKA 1DO2A 1YLAA 3KSXA 4WW0A 4AG5A 3B89A 1PJIA 1N34M 4LY6A 1G8PA 1ZAEA 1IN6A 3UJNA 1XXHE 4R3DA 5ITXA 3L25A 4IJFA 1L2CA 1HNXM 1IM2A 4II7A 4CGYB 3GRUA 3L29A 1LV7A 2BJWA 1D2NA 1A5TA 2V1CA 1TH3A 2LH0A 2KHHA 2R6FA 2O25A 2CEAA 2KEBA 4L15A 3SHFA 4OU7A 1NHGC 2P5TA 2L4EA 3U6SA 1G59A 5IZ7D 3AL0C 2L6OA 3J81S 2YNMD 4WP2A 2R65A 1WHCA 2BNKA 4WURA 1SXJC 4OX9M 4AKIA 3FRIA 2V1UA 5KQDA 2ZBKB 4NXNM 2R4EA 1IBKM 4LRSA 1YE9A 2R46A 2ZAMA 2RGOA 3BOSA 1RU3A 1VEKA 2GNOA 3FTEA 4IBKA 3U61B 2MROB 4LF5M 4M0DA 1WIVA 4MGZE 4JI2M 1VEJA 3J2PB 3LCUA 2KRUA 4RF0A 3ZQJA 4DV2M 3J7AS 4I5SA 2DAIA 2VF7A 4LJ7A 3GRYA 3HHYA 1E32A 1E94E 2CFOA 2QCUA 2C96A 2QSFX 3W0FA 3D8BA 4GMQA 2JP7A 1NY5A 3KSJA 3SYLA 4UN2B 4X64M 4GKKM 3ZCBB 4QHTA 4RKUF 4LF8M 4LGMA 5FTMA 4DUYM 2G8LA 1OJLA 1GABA 2MH8A 1Q02A 4NL4H 4NOOB 1BVSA 1T6OA 3LCVB 4XGIA 2C98A 4LJAA 3RGPA 3NWLA 3T38A 3VLFB 1VDLA 3AFHA 4OW0A 5DYGA 1WGLA 3M6AA 3FUTA 2JY8A 4LF6M 1MX0A 2DWMA 1KSFX 5DFLA 4YHHM 2L09A 2HCBA 4IBIA 3B7NA 2W82A 4MH0E 1PJTA 2LVOC 1TH2A 2CV1A 5EP3A 4JI3M 3VDUA 3KP1E 1K3XA 2VQEM 2VQFM 1R2YA 1IXSA 5GKNA 5ITTA 3JAMS 4CIZA 4NXMM 2Z4RA 1XWIA 5H37D 3TWKA 3E9SA 3GLHA 4NSRA 3GQ5A 3W68A 2QHOB 4DV0M 2KZSA 2WSFF 1HJPA 4Y28F 3W67A 1ORYB 4X66M 4BLCA 1SXJB 4FW9A 3V76A 2KNVA 3FTDA 4LF4M 3DA1A 3E46A 2Z4SA 2JZ0A 3FTCA 3HWSA 3FTFA 2ZM6M 2RKOA 2CHGA 3MJ5A 2ZTCA 3J80S 1QANA 2XH9A 1N75A 3VKHA 4PDGA 3GLHB 1XXHB 4PD2A 2DZNB 2Z3XA 2HWJA 4B3TM 1GLNA 1TF0B 2JWSA 1OIPA 3VK8A 4P16A 2CV2A 3DOAA 2CV0A 4NRVA 2A5YB 5LMNM 3KS8A 1IN8A 4A3VB 3GPXA 1NSFA 4QOSA 3CF0A 4CHTB 1Z5AA 3IG8A 3HU2A 3L28A 2I7NA 5E6JA 5EQTA 2JA2A 4MGHA 2KRKA 5EXPA 4DBGB 3GPYA 5A2QS 3J27B 3U60A 1HQYE 2ZTDA 2RRUA 3PNVA 1T3TA 1R2ZA 4IBDA 1XHBA 2KZUA 5JI2E 3T15A 1IY0A 2FOIC 4KLNA 3TWMA 2KNAA 4FCTA 1H6UA 1OKSA 4DV1M 1IBMM 2J5YA 4LGYA 2F5NA 4AKHA 4D82A 2XZFA 2R45A 5FSWA 4LJ4A 2AHMA 2X8AA 2Y20A 3HHZA 5JI3E 2G3QA 2D7GA 3GLFB 4LFCM 3KXEC 3U6EA 3HU1A 2JY7A 3U6PA 2XFTA 5BPVA 3GLGB 3H4MA 3ZH9B 1L1ZA 3SMPA 2UU9M 1QQWA 5EXSA 7CATA 2EA0A 4GC5A 3U6LA 2Y21A 4IBFA 1ZMWA 4QNMA 1IFYA 2C5RA 3LVVA 4QHSA 1HT2E 3AJIB 4LJ5A 4R7GA 3I4VA 4JN6A 2J7NA 2F5SA 4DR6M 3CF6E 2XLJA 4JI6M 1XMQM 3GLGE 5FLXS 4JI5M 4FWGA 2H1RA 3KOWE 2GQFA 1Q39A 3MHVC 4DR5M 2X4AA 1R7RA 1OFHA 2XEPA 1SXJA 4AW4A 1JR3D 3AOGA 3HX3A 1L1TA 1DGBA 4OVZA 1EFUB 1MJGM 3K9OA 3K92A 4GHLA 2Y0TA 3SAWA 1NJGA 3FYCA 1PJJA 4G4QA 3THGA 3U6OA 3TQSA 3TL4X 3GLFA 3UMMA 3IECA 4GKJM 4XBOA 1NV9A 1ZV1A 2UUBM 1NO1A 4AG6A 5L8RF 3R8FA 1SG9A 3NBXX 2VF8A 2BWEA 2DKLA 3A98B 3U6CA 3K2LA 2I7PA 1IBLM 3KOXE 4LJ9A 3VFDA 1C7YA 2EKKA 2XFSA 1AIPC 3KOYE 1JQJC 1VG5A 4GIPA 1R5LA 4NSOB 2LHCA 1UFZA 2QQ8A 2DAMA 5FTJA 1N33M 2OOBA 1XMOM 1G3IA 3CTWB 1G4AE 4JI7M 1EIJA 2N35A 2JNHA 3RGSA 4DV7M 3T1HM 3FUVA 4M0WA 4ZPXA 2APLA 4L6V6 3SAVA 1JB0F 1YUBA 2OOAA 4IJEA 4LFAM 4MB7A 3SARA 3QYBA 4DR4M 3I04M 2JXNA 1X37A 4JV5M 1IY2A 4IBBA 2L4FA 1GJTA 2ERCA 2Z7JA 2LHGA 3SHGB 2JUJA 2FNAA 1HNWM
chains in the Genus database with same CATH topology
1DGHB 2L7HA 1Z5BA 1WXQA 4LZJA 2XF3A 2XSZA 4IBCA 3A45A 1C1KA 4B7FA 4G4OA 2YQZA 3GPPA 1FJGM 4B3SM 5EP4A 4PDIA 1JR3A 4M9SA 1QZMA 1NY6A 3OTOM 1R6BX 2DWLA 1N36M 3I51A 1IQPA 1S3SA 3T1YM 4DR2M 5C1BA 2YR0A 3MK6A 4RNAA 4X65M 2CE7A 2M5ZA 3A42A 4DV6M 2X49A 4LJ6A 1NNJA 1N78A 3GQ3A 1L2DA 4AQYM 2L7IA 1N77A 1W5SA 4QOZC 1QVRA 3GP1A 1UM8A 1KYIA 3LMMA 2CUZA 2R18A 5IREB 4ITQA 2CHQA 3UZUA 1KFVA 3TWLA 4JI8M 2V6ZM 1GL6A 3FYDA 4HL4A 1Q3CA 2DWZB 2KA6B 4I81A 1XC8A 4REZA 3AV0A 4L8RC 5ITUA 5DNYA 3RE8A 3DZDA 1TDZA 3IG5A 3FUUA 2QENA 3LVWA 2HL7A 3GQ4A 4DR3M 2Y0QA 4GITA 5KO3A 1I94M 4MGYE 4Z8XA 3QWLA 1J5EM 2C9OA 2YFQA 3L26A 2LWXA 5EXTA 1Z59A 5FTLA 1L8QA 3PVSA 3M0EA 5IWAM 4MGKE 4LF9M 2OQ4A 2ZAOA 4JI1M 3RFWA 2LXEA 4EIWA 1J7KA 4NRWA 3DFZA 1DO0A 4BB9A 1N32M 5IT9S 4FD2A 2LNHC 4QNRA 2UXBM 4GHAA 3SATA 1QAOA 1IY1A 2G5GX 1E9RA 3VKGA 5E26A 5KPRA 4FCWA 3SBJA 1E9SA 3U6DA 4D80A 4B3RM 1IXSB 4IBEA 4S12A 1IN4A 1NVMA 2R62A 4K0KM 3GLGA 3GLIB 4B7GA 1QAMA 1QAQA 4L4UA 3TPZA 2OPFA 2F5QA 5FTKA 2DWNA 4GH9A 2EO2A 3U6MA 3VK7A 5ITRA 1Z6TA 4DR7M 4L16A 2K47A 3FUWA 1IXRC 1NJFA 3HU3A 2ZANA 4G4NA 1TDHA 3PXGA 2F5PA 3KOZE 2F4VM 3K1JA 1YSYA 3M7GA 3J7BA 4D81A 1L2BA 2HHHM 3GRRA 4RF1A 3WHLA 4AKGA 1EE8A 2QPAA 3LQRA 3KFUG 4JI4M 1SXJD 1ZQ9A 4LRTA 4PT5A 3U61A 4GRIA 4X62M 1XNQM 3EIHA 4AZFA 2UXDM 3HHXA 2QP9X 4CISA 3FUXA 4JXJA 5C18A 1K3WA 5EJCA 3WHKA 4MM3B 2QBYA 1GKIA 1XXHA 5ITXE 3JR5A 4FWHA 5LMUM 1J09A 5KQ8A 2BJVA 4AI6A 5EP2A 1OFIA 3SYKA 2RGHA 1G41A 1TH4A 2FFJA 4M9XA 3UGJA 4DV5M 1FNNA 3R9XB 3U5ZB 1IXZA 1MU5A 2F5OA 3SMSA 3VDPA 3K8ZA 4DUZM 1HT1E 1IN5A 3HGIA 4KO8A 2XGNA 3AOEC 4DR1M 2NQ8C 4GC9A 4I8OA 4LF7M 2XSZD 4JI0M 3Q8XA 2XZUA 2C9CA 2QZ4A 3KS4A 2VIIA 3U5ZA 2E5LM 5KPZA 3HJSA 4DV3M 2UUCM 4IBJA 1IN7A 2CHVA 2UXCM 4G6ZA 3D8LA 3FKEA 3KP0E 4IIWA 5EP1A 2DXIA 3SASA 3E4RA 3KDSE 1HR0M 2O5RA 1HNZM 5EXXA 3TE6A 4OVZB 1I4WA 3KVWA 3SC3A 3B9PA 4BBAA 4KODA 3HJ8A 4HLQA 1K82A 3ZC7B 1TGUA 3HKPA 3HJQA 1VDDA 3PFIA 3SFZA 1SXJE 4LZZA 2D7EA 4YY3M 3KW6A 1QYRA 5ITQA 4B7HA 4JYAM 5KPTA 4MGIE 1PM5A 4LG2A 1W5TA 2KW0A 3HHWA 5DYIA 5BR8M 1GVNA 2DVWB 1NNUC 4I4LA 2QBYB 3I4YA 2D7HA 4G4RA 3AOEA 4PCZA 1GL7A 2EUCA 3NBIA 3L27A 3U60B 2FE8A 5FTNA 4IBGA 4FVMA 4Z6YA 4TUWA 3UK6A 4FCVA 1XNRM 2HKJA 4LJ8A 3SAUA 2DHRA 3JR4A 4B08A 4M9ZA 1DGGA 3U6QA 3PNYA 3W0LB 2KXEA 1DGHA 2UUAM 2M60A 1DGFA 2J7OA 3C58A 2C99A 3GRVA 3FD9A 4LCBA 4LFBM 3CF2A 5ITYA 1NHWC 3EIEA 4B3MM 3A46A 2R4JA 4FWDA 2DZOB 1Q3BA 3LQQA 4L78A 4DV4M 3L2AA 3AKZA 8CATA 1Z5CA 3GO8A 5F3WA 2Q2EB 1HQCA 3QAUA 4KHPM 4W5WA 3GLIA 3ILKA 1DO2A 3KSXA 4WW0A 4AG5A 1PJIA 1N34M 4LY6A 1G8PA 1ZAEA 1IN6A 3UJNA 4R3DA 5ITXA 3L25A 4IJFA 1L2CA 1HNXM 1IM2A 4II7A 4CGYB 3GRUA 3L29A 1LV7A 2BJWA 1D2NA 2V1CA 1TH3A 2LH0A 2CEAA 2KEBA 4L15A 3SHFA 4OU7A 1NHGC 2P5TA 3U6SA 1G59A 5IZ7D 3AL0C 2L6OA 3J81S 2YNMD 2R65A 2BNKA 4WURA 1SXJC 4OX9M 4AKIA 2V1UA 5KQDA 2ZBKB 4NXNM 2R4EA 1IBKM 4LRSA 1YE9A 2R46A 2ZAMA 2RGOA 3BOSA 3FTEA 4IBKA 3U61B 4LF5M 4M0DA 4JI2M 4MGZE 3J2PB 4RF0A 2KRUA 4DV2M 3J7AS 4I5SA 4LJ7A 3GRYA 3HHYA 1E32A 1E94E 2CFOA 2QCUA 2C96A 3W0FA 3D8BA 4GMQA 1NY5A 3KSJA 3SYLA 4X64M 4GKKM 3ZCBB 4QHTA 4LF8M 4LGMA 5FTMA 4DUYM 2G8LA 1OJLA 4NL4H 4NOOB 4XGIA 2C98A 4LJAA 3RGPA 3NWLA 3T38A 3VLFB 3AFHA 4OW0A 5DYGA 3M6AA 4LF6M 3FUTA 1MX0A 2DWMA 1KSFX 4YHHM 2L09A 2HCBA 4IBIA 2W82A 4MH0E 1TH2A 2CV1A 5EP3A 4JI3M 3VDUA 3KP1E 1K3XA 2VQEM 2VQFM 1R2YA 5GKNA 5ITTA 3JAMS 4NXMM 2Z4RA 1XWIA 5H37D 3TWKA 3E9SA 3GLHA 4NSRA 3GQ5A 4DV0M 2KZSA 1ORYB 4X66M 4BLCA 1SXJB 4FW9A 3FTDA 4LF4M 3DA1A 2Z4SA 3FTCA 3HWSA 3FTFA 2ZM6M 2RKOA 2CHGA 3MJ5A 3J80S 1QANA 2XH9A 1N75A 3VKHA 4PDGA 3GLHB 1XXHB 4PD2A 2DZNB 2Z3XA 4B3TM 1GLNA 3VK8A 4P16A 2CV2A 3DOAA 2CV0A 4NRVA 2A5YB 5LMNM 3KS8A 1IN8A 4A3VB 3GPXA 1NSFA 4QOSA 3CF0A 4CHTB 1Z5AA 3IG8A 3HU2A 3L28A 2I7NA 5E6JA 5EQTA 2JA2A 4MGHA 2KRKA 5EXPA 3GPYA 5A2QS 3J27B 3U60A 1HQYE 3PNVA 1T3TA 1R2ZA 4IBDA 1XHBA 2KZUA 5JI2E 3T15A 1IY0A 2FOIC 4KLNA 3TWMA 4FCTA 1H6UA 4DV1M 1IBMM 4LGYA 2F5NA 4AKHA 4D82A 2XZFA 2R45A 5FSWA 4LJ4A 2AHMA 2X8AA 2Y20A 3HHZA 5JI3E 2D7GA 4LFCM 3KXEC 3U6EA 3HU1A 3U6PA 2XFTA 5BPVA 3GLGB 3H4MA 3ZH9B 1L1ZA 3SMPA 2UU9M 1QQWA 5EXSA 7CATA 2EA0A 4GC5A 3U6LA 2Y21A 4IBFA 4QNMA 2C5RA 3LVVA 4QHSA 1HT2E 3AJIB 4LJ5A 4R7GA 3I4VA 4JN6A 2J7NA 2F5SA 4DR6M 3CF6E 2XLJA 4JI6M 1XMQM 5FLXS 4JI5M 4FWGA 2H1RA 3KOWE 1Q39A 3MHVC 4DR5M 2X4AA 1R7RA 1OFHA 2XEPA 1SXJA 4AW4A 1JR3D 3AOGA 1L1TA 1DGBA 4OVZA 3K92A 4GHLA 2Y0TA 3SAWA 1NJGA 3FYCA 1PJJA 4G4QA 3THGA 3U6OA 3TQSA 3TL4X 3GLFA 3UMMA 4GKJM 4XBOA 2UUBM 4AG6A 3R8FA 3A98B 3U6CA 3K2LA 2I7PA 1IBLM 3KOXE 4LJ9A 3VFDA 2XFSA 3GPUA 3KOYE 1JQJC 4GIPA 5FTJA 3GLFB 4NSOB 1N33M 1XMOM 1G3IA 3CTWB 1G4AE 4JI7M 3RGSA 4DV7M 3T1HM 3FUVA 4M0WA 4ZPXA 3SAVA 1YUBA 4LFAM 4IJEA 4MB7A 3SARA 4DR4M 1X37A 4JV5M 1IY2A 4IBBA 2ERCA 2Z7JA 3SHGB 2FNAA 1HNWM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FWD A;  4LRT A;  2DZO B;  2XSZ A;  3EIH A;  1C1K A;  1IN8 A;  2QP9 X;  4A3V B;  1NSF A;  4QOS A;  5EP4 A;  1HQC A;  1JR3 A;  5C18 A;  1QZM A;  3CF0 A;  3GLI A;  3WHK A;  3HU2 A;  1DO2 A;  1XXH A;  4WW0 A;  2QBY A;  1NY6 A;  5EQT A;  1R6B X;  4FWH A;  2KRK A;  1IN6 A;  4LY6 A;  5EXP A;  1IQP A;  1S3S A;  2BJV A;  5EP2 A;  1OFI A;  3SYK A;  5C1B A;  1IM2 A;  1G41 A;  1HQY E;  1LV7 A;  2BJW A;  1D2N A;  2CE7 A;  1FNN A;  4LJ6 A;  5JI2 E;  3U5Z B;  1IXZ A;  1IY0 A;  4KLN A;  2CEA A;  4L15 A;  1W5S A;  1QVR A;  1UM8 A;  1HT1 E;  4FCT A;  1KYI A;  1IN5 A;  4KO8 A;  4D82 A;  4LJ4 A;  2R65 A;  2X8A A;  2CHQ A;  5JI3 E;  1SXJ C;  2XSZ D;  2V6Z M;  2V1U A;  2C9C A;  2DWZ B;  2QZ4 A;  3HU1 A;  4I81 A;  2VII A;  3GLG B;  3H4M A;  4LRS A;  3ZH9 B;  2ZAM A;  1IN7 A;  2CHV A;  3BOS A;  3DZD A;  5EXS A;  5EP1 A;  3U61 B;  3KDS E;  2QEN A;  4QNM A;  4QHS A;  1HT2 E;  5EXX A;  3AJI B;  4LJ5 A;  4GIT A;  4JN6 A;  4LJ7 A;  4Z8X A;  1E32 A;  1E94 E;  2C9O A;  2C96 A;  3SC3 A;  3B9P A;  5EXT A;  4FWG A;  3D8B A;  4KOD A;  5FTL A;  1L8Q A;  3PVS A;  3M0E A;  1NY5 A;  3MHV C;  1R7R A;  3SYL A;  1OFH A;  1SXJ A;  1JR3 D;  2ZAO A;  4QHT A;  3PFI A;  1SXJ E;  4LZZ A;  1J7K A;  4LGM A;  5FTM A;  4EIW A;  1OJL A;  1DO0 A;  3KW6 A;  4FD2 A;  4QNR A;  1NJG A;  1IY1 A;  4FCW A;  3GLF A;  2C98 A;  1W5T A;  4LJA A;  4D80 A;  1IXS B;  3VLF B;  5DYI A;  1IN4 A;  1NVM A;  2DVW B;  2R62 A;  3R8F A;  5DYG A;  3GLG A;  3M6A A;  3GLI B;  4I4L A;  2QBY B;  1KSF X;  4L4U A;  2HCB A;  4LJ9 A;  3VFD A;  5EP3 A;  5FTK A;  3GLF B;  1JQJ C;  5FTJ A;  3U60 B;  5FTN A;  3UK6 A;  4FCV A;  1G3I A;  4LJ8 A;  1G4A E;  2DHR A;  1XWI A;  2Z4R A;  4L16 A;  3GLH A;  4ZPX A;  1IXR C;  1NJF A;  3HU3 A;  2ZAN A;  1SXJ B;  4FW9 A;  1X37 A;  3PXG A;  1IY2 A;  2C99 A;  4LCB A;  3K1J A;  2Z4S A;  3CF2 A;  3HWS A;  4D81 A;  2RKO A;  2CHG A;  3EIE A;  3WHL A;  2QPA A;  3GLH B;  1XXH B;  2DZN B;  2FNA A;  1SXJ D; 
#chains in the Genus database with same CATH topology
 1DGH B;  2L7H A;  1Z5B A;  1WXQ A;  3I01 M;  4LZJ A;  2DI0 A;  2XF3 A;  2XSZ A;  1D0M A;  4IBC A;  3A45 A;  1C1K A;  4B7F A;  4G4O A;  2YQZ A;  3BXW A;  1Y8G A;  3GPP A;  1FJG M;  2QNJ A;  4B3S M;  1NV8 A;  5EP4 A;  1QUS A;  4PDI A;  1JR3 A;  2LVP C;  1QZM A;  4M9S A;  1GO5 A;  3T6P A;  1JR3 E;  1NY6 A;  3OTO M;  1R6B X;  2DWL A;  1N36 M;  3I51 A;  1IQP A;  1S3S A;  3T1Y M;  4DR2 M;  5C1B A;  2YR0 A;  3MK6 A;  4RNA A;  2R44 A;  4X65 M;  2CE7 A;  2M5Z A;  2LVA A;  3A42 A;  4DV6 M;  2X49 A;  4LJ6 A;  1NNJ A;  1N78 A;  3GQ3 A;  4XK8 F;  1L2D A;  4AQY M;  2L7I A;  1N77 A;  1W5S A;  4QOZ C;  1QVR A;  3GP1 A;  1UM8 A;  1KYI A;  1AUA A;  3LMM A;  1P3Q Q;  3HY5 A;  2CUZ A;  1OAI A;  2R18 A;  5IRE B;  4ITQ A;  2WSE F;  1DV0 A;  2CHQ A;  3UZU A;  1KFV A;  3TWL A;  4JI8 M;  2V6Z M;  1GL6 A;  3FYD A;  4HL4 A;  1Q3C A;  2DWZ B;  2KA6 B;  2MJ5 B;  4I81 A;  1XC8 A;  4REZ A;  3AV0 A;  4L8R C;  5ITU A;  5DNY A;  3RE8 A;  3DZD A;  1TDZ A;  3IG5 A;  3FUU A;  2QEN A;  3LVW A;  4F2L A;  2HL7 A;  1TTE A;  3GQ4 A;  4DR3 M;  2Y0Q A;  4GIT A;  5KO3 A;  1I94 M;  4MGY E;  4Z8X A;  2EKF A;  3B7Q A;  2C9O A;  3QWL A;  3HZJ A;  2YFQ A;  3L26 A;  2LWX A;  5EXT A;  1J5E M;  1Z59 A;  5FTL A;  1L8Q A;  3PVS A;  3M0E A;  5IWA M;  4MGK E;  4LF9 M;  3CGW A;  4F1I A;  2OQ4 A;  2ZAO A;  4JI1 M;  3RFW A;  2LXE A;  2FH0 A;  2DAE A;  4EIW A;  1J7K A;  4NRW A;  3B74 A;  3DFZ A;  1TR8 A;  1DO0 A;  4BB9 A;  1N32 M;  5IT9 S;  4FD2 A;  2LNH C;  2DNA A;  4QNR A;  2UXB M;  4GHA A;  3H4J A;  3SAT A;  1QAO A;  1IY1 A;  2G5G X;  1E9R A;  1D0K A;  5E26 A;  5KPR A;  4FCW A;  3SBJ A;  3VKG A;  1E9S A;  3U6D A;  3GPU A;  2VDB B;  4D80 A;  4B3R M;  1IXS B;  4IBE A;  4S12 A;  1IN4 A;  1NVM A;  2DHY A;  2R62 A;  4K0K M;  3FRH A;  3GLG A;  3GLI B;  4B7G A;  1QAM A;  1F4I A;  1QAQ A;  2O01 F;  3MMP A;  4L4U A;  3TPZ A;  2OPF A;  2F5Q A;  5FTK A;  2DWN A;  2DAG A;  2H5X A;  4GH9 A;  2EO2 A;  3U6M A;  3VK7 A;  2DZL A;  3FE3 A;  5ITR A;  1GJS A;  1Z6T A;  4DR7 M;  2LTU A;  1T43 A;  4L16 A;  1CUK A;  2K47 A;  4R71 A;  3FUW A;  1XB2 B;  1IXR C;  1NJF A;  1V34 A;  1QUT A;  2ZAN A;  3HU3 A;  4G4N A;  3C3E A;  2CRU A;  1TDH A;  3PXG A;  2F5P A;  3KOZ E;  2L2D A;  3K1J A;  2F4V M;  1WJ7 A;  1YSY A;  3M7G A;  3J7B A;  4D81 A;  1L2B A;  2HHH M;  3GRR A;  3B7Z A;  4RF1 A;  3E21 A;  3WHL A;  4AKG A;  1EE8 A;  2QPA A;  3LQR A;  3KFU G;  4JI4 M;  1SXJ D;  1ZQ9 A;  1WGN A;  4LRT A;  4NC6 A;  4PT5 A;  3U61 A;  4GRI A;  4X62 M;  2CWB A;  1XNQ M;  2JY5 A;  3EIH A;  2LVN C;  4AZF A;  2UXD M;  1QDT A;  2KNZ A;  3HHX A;  4ANR A;  2QP9 X;  1PJS A;  2B3T A;  4G3O A;  4CIS A;  3FUX A;  4JXJ A;  5C18 A;  2DEN A;  1K3W A;  4KT0 F;  5EJC A;  3WHK A;  4MM3 B;  2QBY A;  1GKI A;  1XXH A;  5ITX E;  3JR5 A;  4FWH A;  5LMU M;  1J09 A;  5KQ8 A;  2BJV A;  4AI6 A;  1VQ1 A;  3IHP A;  5EP2 A;  1OFI A;  3SYK A;  2JY6 B;  1G71 A;  1G41 A;  2RGH A;  1TH4 A;  2FFJ A;  4M9X A;  3UGJ A;  4DV5 M;  1FNN A;  3R9X B;  3U5Z B;  1IXZ A;  1MU5 A;  2F5O A;  3SMS A;  3VDP A;  3K8Z A;  4DUZ M;  1HT1 E;  1IN5 A;  3HGI A;  4KO8 A;  2XGN A;  3AOE C;  2K6B A;  4DR1 M;  2NQ8 C;  4GC9 A;  1PGY A;  1ZMU A;  4I8O A;  4LF7 M;  2XSZ D;  4JI0 M;  3Q8X A;  2MR9 A;  2XZU A;  2FS1 A;  2C9C A;  1WR1 B;  2JZ1 A;  2QZ4 A;  1D0L A;  3KS4 A;  2VII A;  3U5Z A;  1VEG A;  2E5L M;  5KPZ A;  1QZE A;  3HJS A;  4DV3 M;  2UUC M;  4IBJ A;  1IN7 A;  2CHV A;  2R0I A;  1V33 A;  2UXC M;  4G6Z A;  3D8L A;  3FKE A;  3KP0 E;  4IIW A;  5EP1 A;  2DXI A;  2OO9 A;  3SAS A;  3E4R A;  3KDS E;  1HR0 M;  2O5R A;  1HNZ M;  5EXX A;  1ZMV A;  3TE6 A;  3GLF E;  4OVZ B;  2KDL A;  1I4W A;  4P17 A;  3KVW A;  3SC3 A;  3B9P A;  2MGW A;  4BBA A;  4KOD A;  3HJ8 A;  4HLQ A;  1K82 A;  3ZC7 B;  1TGU A;  3HKP A;  3HJQ A;  4GEW A;  1VDD A;  3Q8G A;  3PFI A;  3SFZ A;  1SXJ E;  4LZZ A;  2LBC A;  2D7E A;  4YY3 M;  3KW6 A;  1QYR A;  5ITQ A;  4B7H A;  4JYA M;  1OQY A;  3K9P A;  1MN3 A;  1OAO C;  1OTR A;  3GLH E;  5KPT A;  4MGI E;  2HAK A;  2BWB A;  1PM5 A;  4LG2 A;  1W5T A;  2KW0 A;  3HHW A;  5DYI A;  5BR8 M;  1GVN A;  2DVW B;  1NNU C;  2EJS A;  3C3D A;  4I4L A;  1PRB A;  4Q7J A;  2QBY B;  3I4Y A;  1V92 A;  2K9D A;  2D7H A;  4G4R A;  1R4G A;  2WZJ A;  3AOE A;  4PCZ A;  1GL7 A;  3QYE A;  2EUC A;  2WSC F;  3NBI A;  3L27 A;  3U60 B;  2FE8 A;  5FTN A;  4IBG A;  4FVM A;  4Z6Y A;  4TUW A;  3UK6 A;  4FCV A;  1XNR M;  2HKJ A;  4LJ8 A;  3SAU A;  2DHR A;  3JR4 A;  2Z8Y M;  4B08 A;  4M9Z A;  1DGG A;  3U6Q A;  4HEO A;  3PNY A;  3W0L B;  2KXE A;  1DGH A;  2UUA M;  2LVQ D;  1OIZ A;  2K0B X;  2M60 A;  1DGF A;  2J7O A;  3BBZ A;  3LW5 F;  2C99 A;  3GRV A;  3FD9 A;  4LCB A;  3C58 A;  4LFB M;  3CF2 A;  5ITY A;  1NHW C;  3EIE A;  4B3M M;  1PJQ A;  1QDR A;  3F92 A;  3A46 A;  2R4J A;  3C9P A;  4FWD A;  2DZO B;  1Q3B A;  3LQQ A;  4L78 A;  4DV4 M;  3L2A A;  3AKZ A;  2DAK A;  8CAT A;  1Z5C A;  1LTM A;  4CJ6 A;  3GO8 A;  2CP8 A;  3GLI E;  5F3W A;  2Q2E B;  1HQC A;  3QAU A;  4KHP M;  4W5W A;  3GLI A;  3ILK A;  1DO2 A;  1YLA A;  3KSX A;  4WW0 A;  4AG5 A;  3B89 A;  1PJI A;  1N34 M;  4LY6 A;  1G8P A;  1ZAE A;  1IN6 A;  3UJN A;  1XXH E;  4R3D A;  5ITX A;  3L25 A;  4IJF A;  1L2C A;  1HNX M;  1IM2 A;  4II7 A;  4CGY B;  3GRU A;  3L29 A;  1LV7 A;  2BJW A;  1D2N A;  1A5T A;  2V1C A;  1TH3 A;  2LH0 A;  2KHH A;  2R6F A;  2O25 A;  2CEA A;  2KEB A;  4L15 A;  3SHF A;  4OU7 A;  1NHG C;  2P5T A;  2L4E A;  3U6S A;  1G59 A;  5IZ7 D;  3AL0 C;  2L6O A;  3J81 S;  2YNM D;  4WP2 A;  2R65 A;  1WHC A;  2BNK A;  4WUR A;  1SXJ C;  4OX9 M;  4AKI A;  3FRI A;  2V1U A;  5KQD A;  2ZBK B;  4NXN M;  2R4E A;  1IBK M;  4LRS A;  1YE9 A;  2R46 A;  2ZAM A;  2RGO A;  3BOS A;  1RU3 A;  1VEK A;  2GNO A;  3FTE A;  4IBK A;  3U61 B;  2MRO B;  4LF5 M;  4M0D A;  1WIV A;  4MGZ E;  4JI2 M;  1VEJ A;  3J2P B;  3LCU A;  2KRU A;  4RF0 A;  3ZQJ A;  4DV2 M;  3J7A S;  4I5S A;  2DAI A;  2VF7 A;  4LJ7 A;  3GRY A;  3HHY A;  1E32 A;  1E94 E;  2CFO A;  2QCU A;  2C96 A;  2QSF X;  3W0F A;  3D8B A;  4GMQ A;  2JP7 A;  1NY5 A;  3KSJ A;  3SYL A;  4UN2 B;  4X64 M;  4GKK M;  3ZCB B;  4QHT A;  4RKU F;  4LF8 M;  4LGM A;  5FTM A;  4DUY M;  2G8L A;  1OJL A;  1GAB A;  2MH8 A;  1Q02 A;  4NL4 H;  4NOO B;  1BVS A;  1T6O A;  3LCV B;  4XGI A;  2C98 A;  4LJA A;  3RGP A;  3NWL A;  3T38 A;  3VLF B;  1VDL A;  3AFH A;  4OW0 A;  5DYG A;  1WGL A;  3M6A A;  3FUT A;  2JY8 A;  4LF6 M;  1MX0 A;  2DWM A;  1KSF X;  5DFL A;  4YHH M;  2L09 A;  2HCB A;  4IBI A;  3B7N A;  2W82 A;  4MH0 E;  1PJT A;  2LVO C;  1TH2 A;  2CV1 A;  5EP3 A;  4JI3 M;  3VDU A;  3KP1 E;  1K3X A;  2VQE M;  2VQF M;  1R2Y A;  1IXS A;  5GKN A;  5ITT A;  3JAM S;  4CIZ A;  4NXM M;  2Z4R A;  1XWI A;  5H37 D;  3TWK A;  3E9S A;  3GLH A;  4NSR A;  3GQ5 A;  3W68 A;  2QHO B;  4DV0 M;  2KZS A;  2WSF F;  1HJP A;  4Y28 F;  3W67 A;  1ORY B;  4X66 M;  4BLC A;  1SXJ B;  4FW9 A;  3V76 A;  2KNV A;  3FTD A;  4LF4 M;  3DA1 A;  3E46 A;  2Z4S A;  2JZ0 A;  3FTC A;  3HWS A;  3FTF A;  2ZM6 M;  2RKO A;  2CHG A;  3MJ5 A;  2ZTC A;  3J80 S;  1QAN A;  2XH9 A;  1N75 A;  3VKH A;  4PDG A;  3GLH B;  1XXH B;  4PD2 A;  2DZN B;  2Z3X A;  2HWJ A;  4B3T M;  1GLN A;  1TF0 B;  2JWS A;  1OIP A;  3VK8 A;  4P16 A;  2CV2 A;  3DOA A;  2CV0 A;  4NRV A;  2A5Y B;  5LMN M;  3KS8 A;  1IN8 A;  4A3V B;  3GPX A;  1NSF A;  4QOS A;  3CF0 A;  4CHT B;  1Z5A A;  3IG8 A;  3HU2 A;  3L28 A;  2I7N A;  5E6J A;  5EQT A;  2JA2 A;  4MGH A;  2KRK A;  5EXP A;  4DBG B;  3GPY A;  5A2Q S;  3J27 B;  3U60 A;  1HQY E;  2ZTD A;  2RRU A;  3PNV A;  1T3T A;  1R2Z A;  4IBD A;  1XHB A;  2KZU A;  5JI2 E;  3T15 A;  1IY0 A;  2FOI C;  4KLN A;  3TWM A;  2KNA A;  4FCT A;  1H6U A;  1OKS A;  4DV1 M;  1IBM M;  2J5Y A;  4LGY A;  2F5N A;  4AKH A;  4D82 A;  2XZF A;  2R45 A;  5FSW A;  4LJ4 A;  2AHM A;  2X8A A;  2Y20 A;  3HHZ A;  5JI3 E;  2G3Q A;  2D7G A;  3GLF B;  4LFC M;  3KXE C;  3U6E A;  3HU1 A;  2JY7 A;  3U6P A;  2XFT A;  5BPV A;  3GLG B;  3H4M A;  3ZH9 B;  1L1Z A;  3SMP A;  2UU9 M;  1QQW A;  5EXS A;  7CAT A;  2EA0 A;  4GC5 A;  3U6L A;  2Y21 A;  4IBF A;  1ZMW A;  4QNM A;  1IFY A;  2C5R A;  3LVV A;  4QHS A;  1HT2 E;  3AJI B;  4LJ5 A;  4R7G A;  3I4V A;  4JN6 A;  2J7N A;  2F5S A;  4DR6 M;  3CF6 E;  2XLJ A;  4JI6 M;  1XMQ M;  3GLG E;  5FLX S;  4JI5 M;  4FWG A;  2H1R A;  3KOW E;  2GQF A;  1Q39 A;  3MHV C;  4DR5 M;  2X4A A;  1R7R A;  1OFH A;  2XEP A;  1SXJ A;  4AW4 A;  1JR3 D;  3AOG A;  3HX3 A;  1L1T A;  1DGB A;  4OVZ A;  1EFU B;  1MJG M;  3K9O A;  3K92 A;  4GHL A;  2Y0T A;  3SAW A;  1NJG A;  3FYC A;  1PJJ A;  4G4Q A;  3THG A;  3U6O A;  3TQS A;  3TL4 X;  3GLF A;  3UMM A;  3IEC A;  4GKJ M;  4XBO A;  1NV9 A;  1ZV1 A;  2UUB M;  1NO1 A;  4AG6 A;  5L8R F;  3R8F A;  1SG9 A;  3NBX X;  2VF8 A;  2BWE A;  2DKL A;  3A98 B;  3U6C A;  3K2L A;  2I7P A;  1IBL M;  3KOX E;  4LJ9 A;  3VFD A;  1C7Y A;  2EKK A;  2XFS A;  1AIP C;  3KOY E;  1JQJ C;  1VG5 A;  4GIP A;  1R5L A;  4NSO B;  2LHC A;  1UFZ A;  2QQ8 A;  2DAM A;  5FTJ A;  1N33 M;  2OOB A;  1XMO M;  1G3I A;  3CTW B;  1G4A E;  4JI7 M;  1EIJ A;  2N35 A;  2JNH A;  3RGS A;  4DV7 M;  3T1H M;  3FUV A;  4M0W A;  4ZPX A;  2APL A;  4L6V 6;  3SAV A;  1JB0 F;  1YUB A;  2OOA A;  4IJE A;  4LFA M;  4MB7 A;  3SAR A;  3QYB A;  4DR4 M;  3I04 M;  2JXN A;  1X37 A;  4JV5 M;  1IY2 A;  4IBB A;  2L4F A;  1GJT A;  2ERC A;  2Z7J A;  2LHG A;  3SHG B;  2JUJ A;  2FNA A;  1HNW M; 
#chains in the Genus database with same CATH homology
 1DGH B;  2L7H A;  1Z5B A;  1WXQ A;  4LZJ A;  2XF3 A;  2XSZ A;  4IBC A;  3A45 A;  1C1K A;  4B7F A;  4G4O A;  2YQZ A;  3GPP A;  1FJG M;  4B3S M;  5EP4 A;  4PDI A;  1JR3 A;  4M9S A;  1QZM A;  1NY6 A;  3OTO M;  1R6B X;  2DWL A;  1N36 M;  3I51 A;  1IQP A;  1S3S A;  3T1Y M;  4DR2 M;  5C1B A;  2YR0 A;  3MK6 A;  4RNA A;  4X65 M;  2CE7 A;  2M5Z A;  3A42 A;  4DV6 M;  2X49 A;  4LJ6 A;  1NNJ A;  1N78 A;  3GQ3 A;  1L2D A;  4AQY M;  2L7I A;  1N77 A;  1W5S A;  4QOZ C;  1QVR A;  3GP1 A;  1UM8 A;  1KYI A;  3LMM A;  2CUZ A;  2R18 A;  5IRE B;  4ITQ A;  2CHQ A;  3UZU A;  1KFV A;  3TWL A;  4JI8 M;  2V6Z M;  1GL6 A;  3FYD A;  4HL4 A;  1Q3C A;  2DWZ B;  2KA6 B;  4I81 A;  1XC8 A;  4REZ A;  3AV0 A;  4L8R C;  5ITU A;  5DNY A;  3RE8 A;  3DZD A;  1TDZ A;  3IG5 A;  3FUU A;  2QEN A;  3LVW A;  2HL7 A;  3GQ4 A;  4DR3 M;  2Y0Q A;  4GIT A;  5KO3 A;  1I94 M;  4MGY E;  4Z8X A;  3QWL A;  1J5E M;  2C9O A;  2YFQ A;  3L26 A;  2LWX A;  5EXT A;  1Z59 A;  5FTL A;  1L8Q A;  3PVS A;  3M0E A;  5IWA M;  4MGK E;  4LF9 M;  2OQ4 A;  2ZAO A;  4JI1 M;  3RFW A;  2LXE A;  4EIW A;  1J7K A;  4NRW A;  3DFZ A;  1DO0 A;  4BB9 A;  1N32 M;  5IT9 S;  4FD2 A;  2LNH C;  4QNR A;  2UXB M;  4GHA A;  3SAT A;  1QAO A;  1IY1 A;  2G5G X;  1E9R A;  3VKG A;  5E26 A;  5KPR A;  4FCW A;  3SBJ A;  1E9S A;  3U6D A;  4D80 A;  4B3R M;  1IXS B;  4IBE A;  4S12 A;  1IN4 A;  1NVM A;  2R62 A;  4K0K M;  3GLG A;  3GLI B;  4B7G A;  1QAM A;  1QAQ A;  4L4U A;  3TPZ A;  2OPF A;  2F5Q A;  5FTK A;  2DWN A;  4GH9 A;  2EO2 A;  3U6M A;  3VK7 A;  5ITR A;  1Z6T A;  4DR7 M;  4L16 A;  2K47 A;  3FUW A;  1IXR C;  1NJF A;  3HU3 A;  2ZAN A;  4G4N A;  1TDH A;  3PXG A;  2F5P A;  3KOZ E;  2F4V M;  3K1J A;  1YSY A;  3M7G A;  3J7B A;  4D81 A;  1L2B A;  2HHH M;  3GRR A;  4RF1 A;  3WHL A;  4AKG A;  1EE8 A;  2QPA A;  3LQR A;  3KFU G;  4JI4 M;  1SXJ D;  1ZQ9 A;  4LRT A;  4PT5 A;  3U61 A;  4GRI A;  4X62 M;  1XNQ M;  3EIH A;  4AZF A;  2UXD M;  3HHX A;  2QP9 X;  4CIS A;  3FUX A;  4JXJ A;  5C18 A;  1K3W A;  5EJC A;  3WHK A;  4MM3 B;  2QBY A;  1GKI A;  1XXH A;  5ITX E;  3JR5 A;  4FWH A;  5LMU M;  1J09 A;  5KQ8 A;  2BJV A;  4AI6 A;  5EP2 A;  1OFI A;  3SYK A;  2RGH A;  1G41 A;  1TH4 A;  2FFJ A;  4M9X A;  3UGJ A;  4DV5 M;  1FNN A;  3R9X B;  3U5Z B;  1IXZ A;  1MU5 A;  2F5O A;  3SMS A;  3VDP A;  3K8Z A;  4DUZ M;  1HT1 E;  1IN5 A;  3HGI A;  4KO8 A;  2XGN A;  3AOE C;  4DR1 M;  2NQ8 C;  4GC9 A;  4I8O A;  4LF7 M;  2XSZ D;  4JI0 M;  3Q8X A;  2XZU A;  2C9C A;  2QZ4 A;  3KS4 A;  2VII A;  3U5Z A;  2E5L M;  5KPZ A;  3HJS A;  4DV3 M;  2UUC M;  4IBJ A;  1IN7 A;  2CHV A;  2UXC M;  4G6Z A;  3D8L A;  3FKE A;  3KP0 E;  4IIW A;  5EP1 A;  2DXI A;  3SAS A;  3E4R A;  3KDS E;  1HR0 M;  2O5R A;  1HNZ M;  5EXX A;  3TE6 A;  4OVZ B;  1I4W A;  3KVW A;  3SC3 A;  3B9P A;  4BBA A;  4KOD A;  3HJ8 A;  4HLQ A;  1K82 A;  3ZC7 B;  1TGU A;  3HKP A;  3HJQ A;  1VDD A;  3PFI A;  3SFZ A;  1SXJ E;  4LZZ A;  2D7E A;  4YY3 M;  3KW6 A;  1QYR A;  5ITQ A;  4B7H A;  4JYA M;  5KPT A;  4MGI E;  1PM5 A;  4LG2 A;  1W5T A;  2KW0 A;  3HHW A;  5DYI A;  5BR8 M;  1GVN A;  2DVW B;  1NNU C;  4I4L A;  2QBY B;  3I4Y A;  2D7H A;  4G4R A;  3AOE A;  4PCZ A;  1GL7 A;  2EUC A;  3NBI A;  3L27 A;  3U60 B;  2FE8 A;  5FTN A;  4IBG A;  4FVM A;  4Z6Y A;  4TUW A;  3UK6 A;  4FCV A;  1XNR M;  2HKJ A;  4LJ8 A;  3SAU A;  2DHR A;  3JR4 A;  4B08 A;  4M9Z A;  1DGG A;  3U6Q A;  3PNY A;  3W0L B;  2KXE A;  1DGH A;  2UUA M;  2M60 A;  1DGF A;  2J7O A;  3C58 A;  2C99 A;  3GRV A;  3FD9 A;  4LCB A;  4LFB M;  3CF2 A;  5ITY A;  1NHW C;  3EIE A;  4B3M M;  3A46 A;  2R4J A;  4FWD A;  2DZO B;  1Q3B A;  3LQQ A;  4L78 A;  4DV4 M;  3L2A A;  3AKZ A;  8CAT A;  1Z5C A;  3GO8 A;  5F3W A;  2Q2E B;  1HQC A;  3QAU A;  4KHP M;  4W5W A;  3GLI A;  3ILK A;  1DO2 A;  3KSX A;  4WW0 A;  4AG5 A;  1PJI A;  1N34 M;  4LY6 A;  1G8P A;  1ZAE A;  1IN6 A;  3UJN A;  4R3D A;  5ITX A;  3L25 A;  4IJF A;  1L2C A;  1HNX M;  1IM2 A;  4II7 A;  4CGY B;  3GRU A;  3L29 A;  1LV7 A;  2BJW A;  1D2N A;  2V1C A;  1TH3 A;  2LH0 A;  2CEA A;  2KEB A;  4L15 A;  3SHF A;  4OU7 A;  1NHG C;  2P5T A;  3U6S A;  1G59 A;  5IZ7 D;  3AL0 C;  2L6O A;  3J81 S;  2YNM D;  2R65 A;  2BNK A;  4WUR A;  1SXJ C;  4OX9 M;  4AKI A;  2V1U A;  5KQD A;  2ZBK B;  4NXN M;  2R4E A;  1IBK M;  4LRS A;  1YE9 A;  2R46 A;  2ZAM A;  2RGO A;  3BOS A;  3FTE A;  4IBK A;  3U61 B;  4LF5 M;  4M0D A;  4JI2 M;  4MGZ E;  3J2P B;  4RF0 A;  2KRU A;  4DV2 M;  3J7A S;  4I5S A;  4LJ7 A;  3GRY A;  3HHY A;  1E32 A;  1E94 E;  2CFO A;  2QCU A;  2C96 A;  3W0F A;  3D8B A;  4GMQ A;  1NY5 A;  3KSJ A;  3SYL A;  4X64 M;  4GKK M;  3ZCB B;  4QHT A;  4LF8 M;  4LGM A;  5FTM A;  4DUY M;  2G8L A;  1OJL A;  4NL4 H;  4NOO B;  4XGI A;  2C98 A;  4LJA A;  3RGP A;  3NWL A;  3T38 A;  3VLF B;  3AFH A;  4OW0 A;  5DYG A;  3M6A A;  4LF6 M;  3FUT A;  1MX0 A;  2DWM A;  1KSF X;  4YHH M;  2L09 A;  2HCB A;  4IBI A;  2W82 A;  4MH0 E;  1TH2 A;  2CV1 A;  5EP3 A;  4JI3 M;  3VDU A;  3KP1 E;  1K3X A;  2VQE M;  2VQF M;  1R2Y A;  5GKN A;  5ITT A;  3JAM S;  4NXM M;  2Z4R A;  1XWI A;  5H37 D;  3TWK A;  3E9S A;  3GLH A;  4NSR A;  3GQ5 A;  4DV0 M;  2KZS A;  1ORY B;  4X66 M;  4BLC A;  1SXJ B;  4FW9 A;  3FTD A;  4LF4 M;  3DA1 A;  2Z4S A;  3FTC A;  3HWS A;  3FTF A;  2ZM6 M;  2RKO A;  2CHG A;  3MJ5 A;  3J80 S;  1QAN A;  2XH9 A;  1N75 A;  3VKH A;  4PDG A;  3GLH B;  1XXH B;  4PD2 A;  2DZN B;  2Z3X A;  4B3T M;  1GLN A;  3VK8 A;  4P16 A;  2CV2 A;  3DOA A;  2CV0 A;  4NRV A;  2A5Y B;  5LMN M;  3KS8 A;  1IN8 A;  4A3V B;  3GPX A;  1NSF A;  4QOS A;  3CF0 A;  4CHT B;  1Z5A A;  3IG8 A;  3HU2 A;  3L28 A;  2I7N A;  5E6J A;  5EQT A;  2JA2 A;  4MGH A;  2KRK A;  5EXP A;  3GPY A;  5A2Q S;  3J27 B;  3U60 A;  1HQY E;  3PNV A;  1T3T A;  1R2Z A;  4IBD A;  1XHB A;  2KZU A;  5JI2 E;  3T15 A;  1IY0 A;  2FOI C;  4KLN A;  3TWM A;  4FCT A;  1H6U A;  4DV1 M;  1IBM M;  4LGY A;  2F5N A;  4AKH A;  4D82 A;  2XZF A;  2R45 A;  5FSW A;  4LJ4 A;  2AHM A;  2X8A A;  2Y20 A;  3HHZ A;  5JI3 E;  2D7G A;  4LFC M;  3KXE C;  3U6E A;  3HU1 A;  3U6P A;  2XFT A;  5BPV A;  3GLG B;  3H4M A;  3ZH9 B;  1L1Z A;  3SMP A;  2UU9 M;  1QQW A;  5EXS A;  7CAT A;  2EA0 A;  4GC5 A;  3U6L A;  2Y21 A;  4IBF A;  4QNM A;  2C5R A;  3LVV A;  4QHS A;  1HT2 E;  3AJI B;  4LJ5 A;  4R7G A;  3I4V A;  4JN6 A;  2J7N A;  2F5S A;  4DR6 M;  3CF6 E;  2XLJ A;  4JI6 M;  1XMQ M;  5FLX S;  4JI5 M;  4FWG A;  2H1R A;  3KOW E;  1Q39 A;  3MHV C;  4DR5 M;  2X4A A;  1R7R A;  1OFH A;  2XEP A;  1SXJ A;  4AW4 A;  1JR3 D;  3AOG A;  1L1T A;  1DGB A;  4OVZ A;  3K92 A;  4GHL A;  2Y0T A;  3SAW A;  1NJG A;  3FYC A;  1PJJ A;  4G4Q A;  3THG A;  3U6O A;  3TQS A;  3TL4 X;  3GLF A;  3UMM A;  4GKJ M;  4XBO A;  2UUB M;  4AG6 A;  3R8F A;  3A98 B;  3U6C A;  3K2L A;  2I7P A;  1IBL M;  3KOX E;  4LJ9 A;  3VFD A;  2XFS A;  3GPU A;  3KOY E;  1JQJ C;  4GIP A;  5FTJ A;  3GLF B;  4NSO B;  1N33 M;  1XMO M;  1G3I A;  3CTW B;  1G4A E;  4JI7 M;  3RGS A;  4DV7 M;  3T1H M;  3FUV A;  4M0W A;  4ZPX A;  3SAV A;  1YUB A;  4LFA M;  4IJE A;  4MB7 A;  3SAR A;  4DR4 M;  1X37 A;  4JV5 M;  1IY2 A;  4IBB A;  2ERC A;  2Z7J A;  3SHG B;  2FNA A;  1HNW M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...