2DZOB

Crystal structure analysis of yeast nas6p complexed with the proteasome subunit, rpt3
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
b'MSLAPEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable 26S proteasome regulatory subunit p28
publication title Crystal structure analysis of yeast Nas6p complexed with the proteasome subunit, rpt3
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 15
structure length 57
sequence length 57
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dzoB00
5DYIA 5EP3A 3GLGA 1XXHB 4L16A 1OFIA 3PVSA 3AJIB 1W5TA 1NVMA 4LJ7A 3D8BA 3PFIA 5EXPA 1E32A 1G4AE 4LJ8A 2XSZA 4LRSA 5EP1A 2CHQA 1D2NA 2CEAA 4ZPXA 2QZ4A 1IQPA 4QOSA 4L15A 2V6ZM 4FWGA 2CHVA 1IN7A 1SXJD 3CF2A 4FW9A 1QZMA 3SYKA 3B9PA 3VLFB 5FTLA 2QBYB 2ZANA 1R7RA 2C96A 1IXZA 2KRKA 4FD2A 3MHVC 4KO8A 3GLHA 5C18A 3KDSE 1IY2A 5EXSA 1JR3D 4FWHA 5FTKA 2QPAA 3UK6A 5C1BA 4WW0A 5DYGA 5EXTA 2RKOA 4QHSA 1W5SA 1XXHA 1IN4A 3GLFB 4LY6A 1KYIA 1QVRA 4D82A 5JI2E 5JI3E 2Z4RA 4LCBA 5FTNA 1HT2E 3U5ZB 4JN6A 3GLGB 4A3VB 3U60B 2DWZB 3HWSA 4LJ5A 4L4UA 3GLIA 1IN6A 1DO0A 2HCBA 1IN5A 3EIEA 4EIWA 2BJVA 1LV7A 2QENA 2BJWA 1SXJA 1OJLA 1DO2A 2DHRA 1IY1A 4LJ9A 4D81A 1HQCA 1SXJC 4I81A 3H4MA 1G41A 2XSZD 2V1UA 3K1JA 3M0EA 1E94E 3ZH9B 2CE7A 5EP4A 1NJFA 4QNMA 2ZAMA 2C99A 3M6AA 5EQTA 5FTJA 1IN8A 1HQYE 1JR3A 3EIHA 1IXRC 4LJ4A 4D80A 2Z4SA 1NJGA 4FCTA 3GLHB 1IXSB 4QHTA 5EXXA 2DVWB 4LGMA 1NY6A 3U61B 4QNRA 1UM8A 3HU1A 3GLFA 4KLNA 1JQJC 1IY0A 1KSFX 1R6BX 2R62A 1IM2A 1NSFA 4Z8XA 5EP2A 3BOSA 2FNAA 2QP9X 3SYLA 3CF0A 2C9OA 2VIIA 4KODA 1J7KA 3DZDA 4FWDA 2QBYA 3PXGA 1FNNA 3SC3A 1G3IA 3GLIB 1L8QA 1X37A 2DZNB 1HT1E 1XWIA 2X8AA 3R8FA 4LRTA 1OFHA 4GITA 1NY5A 2ZAOA 3WHKA 1C1KA 3HU2A 1SXJB 4FCWA 4LZZA 2DZOB 4LJ6A 1S3SA 2CHGA 1SXJE 2C9CA 3KW6A 3VFDA 2C98A 4I4LA 3HU3A 4FCVA 2R65A 5FTMA 3WHLA 4LJAA
chains in the Genus database with same CATH superfamily
3L29A 4W5WA 5DYIA 3MK6A 4LZJA 4L16A 4DR2M 3FYDA 4B3SM 1OFIA 3U6OA 1JR3E 2VQEM 4LFAM 3K92A 4LJ7A 5L8RF 1GJTA 1N77A 4KT0F 2EO2A 3I4VA 5EXPA 4MGKE 3TQSA 2KRUA 4LF8M 1TF0B 1QQWA 4Y28F 1WR1B 4MGIE 2F5PA 4IBCA 1HR0M 5BR8M 2DAKA 4G4NA 3NBIA 2G8LA 2KNZA 2V6ZM 2M5ZA 2LVQD 5JI3E 3GLGE 3AV0A 3B9PA 3NBXX 1EIJA 3AFHA 1J5EM 2UXBM 3GRRA 4AKGA 3JAMS 2UUBM 2JA2A 2C96A 4F2LA 1K82A 4WURA 3U6MA 4KO8A 3T1YM 5EXSA 3HHXA 4DR3M 4OU7A 2LTUA 2D7EA 3AOEA 3U61A 5FTKA 2L7HA 4IBJA 2F5QA 1G71A 3UK6A 1DGHA 2O5RA 1VDDA 5C1BA 5EXTA 3SAVA 4REZA 1XXHA 1D0MA 4DV6M 1K3WA 1LTMA 4G4RA 2D7HA 3SARA 2ZBKB 3HZJA 3B7ZA 1Q02A 1XHBA 2R44A 4LCBA 2XFSA 3GLGB 4II7A 4A3VB 5KPRA 4DV2M 3ZC7B 2X49A 1IN6A 4M0WA 1N78A 1R2ZA 5KQ8A 2CV1A 2OOBA 3E4RA 3EIEA 1IN5A 2LHGA 1LV7A 2FS1A 1DV0A 1DO2A 1IY1A 2QCUA 4IBEA 1SXJC 3H4MA 2XSZD 4RF0A 2FFJA 1WGLA 3QAUA 3U6DA 3TE6A 3SAUA 2WZJA 3KOZE 3SHGB 4PDIA 4LF5M 2C99A 2F5SA 1IN8A 1HQYE 3LVVA 1VDLA 4NSRA 4R3DA 4S12A 3DOAA 2RRUA 4PDGA 1IBLM 2XGNA 2GNOA 4GIPA 2Z4SA 2LVNC 4FCTA 2R45A 4QHTA 4L6V6 4FVMA 4LGMA 4JI2M 4DV1M 1UM8A 3GLHE 1G59A 3GLFA 1JB0F 3FUVA 3RFWA 3AL0C 3KP1E 2EUCA 4YY3M 2KNVA 2KW0A 2FNAA 3FE3A 3AKZA 1D0LA 3GQ5A 4NSOB 4KODA 1J7KA 3SATA 5DNYA 1NV8A 8CATA 4IBBA 3LW5F 3UMMA 2ERCA 1VEGA 2WSFF 2DZNB 3F92A 2WSEF 1HT1E 1OAIA 2EKKA 1NHGC 1T3TA 4LRTA 3ZCBB 3R8FA 2LVAA 4JV5M 1MU5A 2QHOB 1PGYA 1XMOM 4LZZA 4LF4M 4B3MM 1SXJE 3I4YA 4PT5A 2ZTDA 2UU9M 4MM3B 2C98A 4I4LA 3HU3A 4LFBM 4CIZA 4JXJA 2KZUA 4R71A 3W0LB 3V76A 4RNAA 3FTDA 4K0KM 4B7GA 2Y0TA 5ITRA 2KA6B 2OQ4A 1L2CA 1W5TA 2DXIA 2VQFM 1GVNA 1PJTA 3D8BA 3TWMA 3U6CA 3IECA 3HHZA 1L1ZA 1HNZM 4LJ8A 4NXNM 3KSJA 5EP1A 1V33A 4IJFA 1QANA 3TWLA 4NXMM 4BLCA 1F4IA 1D2NA 1J09A 3IHPA 4QOSA 3VK7A 4FWGA 3VLFB 1EE8A 3SYKA 5FTLA 5ITXA 2QBYB 3T15A 2M60A 3C58A 1Z5AA 1R4GA 2B3TA 3C9PA 3L28A 2ZANA 2Y21A 4JI0M 3MHVC 1UFZA 4OW0A 2X4AA 3LCVB 3FD9A 4LG2A 1QZEA 1JR3D 1XMQM 2CUZA 2JNHA 1Z59A 4FWHA 2Y0QA 2QPAA 4DV4M 2JY8A 4F1IA 4QHSA 5KO3A 1W5SA 2EJSA 1T6OA 2ZM6M 1TH2A 3I51A 2MR9A 2JUJA 3B89A 1KYIA 4GH9A 2Z4RA 1RU3A 2KEBA 1QAMA 1V34A 2HKJA 2KZSA 4JN6A 4Q7JA 4LF9M 2D7GA 3FUXA 2DWZB 4LJ5A 1WGNA 2C5RA 3FYCA 4L8RC 5KPZA 3NWLA 4P16A 2KNAA 1DO0A 1E9RA 4PCZA 3FUTA 2F5NA 2LVPC 4OX9M 1CUKA 1E9SA 2BJWA 3J81S 2K47A 2XZUA 4D81A 4R7GA 1HQCA 4GHLA 4DR4M 4I81A 1G41A 2V1UA 4YHHM 1Q3CA 4L78A 3ZH9B 1OKSA 1NJFA 2ZAMA 1IBMM 4JI4M 3J2PB 1H6UA 3T6PA 5FSWA 3ILKA 2HWJA 5DFLA 1JR3A 1MJGM 2H5XA 3SASA 1I94M 1TDZA 2HHHM 4P17A 2K9DA 3J7BA 3LQQA 1HNXM 3OTOM 5EXXA 1Z6TA 2ZTCA 1NY6A 4Z6YA 3U61B 1DGBA 4DUZM 3FUWA 5KQDA 1DGHB 5H37D 2UXDM 1IM2A 3VKHA 1GL7A 4Z8XA 3GPXA 1N33M 1TGUA 5EJCA 3L2AA 3SYLA 2C9OA 2VF8A 4AKIA 2DKLA 4CGYB 1L1TA 2L2DA 3KOWE 2JZ1A 3PXGA 1FNNA 3VDUA 2CFOA 1G3IA 4I5SA 1DGFA 1XWIA 2K0BX 1OFHA 2R46A 1GL6A 2ZAOA 4M9ZA 3PNVA 2F5OA 1PRBA 2L09A 2R4EA 4CHTB 3GPPA 1SG9A 1MN3A 2OO9A 3E46A 2J5YA 3FTFA 2QSFX 2CHGA 3M7GA 1YSYA 2EKFA 4JI5M 3A98B 4B08A 3VFDA 3GO8A 2LH0A 3PNYA 5FTMA 4LGYA 2P5TA 1P3QQ 3WHLA 4ITQA 4X64M 3THGA 3UGJA 3U5ZA 3DFZA 1Y8GA 2VF7A 3U60A 4UN2B 1N32M 3FTEA 1VG5A 3AOGA 1NVMA 1WIVA 3H4JA 2CP8A 2W82A 4NOOB 2JY6B 2MJ5B 1N75A 2JWSA 2LHCA 3PFIA 4HLQA 3VKGA 1E32A 2YNMD 3C3EA 3W67A 3R9XB 2XSZA 1HJPA 4LRSA 1EFUB 2XLJA 2CHQA 4DR6M 2CEAA 2Y20A 2DENA 3HKPA 4JYAM 4XGIA 2R4JA 4ZPXA 2QZ4A 3GRYA 4MGZE 3W0FA 3ZQJA 4JI8M 1SXJD 4NC6A 1VQ1A 2DWNA 3T38A 2DWMA 3KS8A 1NV9A 3K2LA 5E6JA 1R7RA 3FUUA 1TTEA 1N34M 1QDRA 5IWAM 1IXZA 2KRKA 4M9SA 4AW4A 3GLHA 1G8PA 1IXSA 1IY2A 3UZUA 1MX0A 1ZMVA 2LBCA 4OVZA 3Q8XA 1YUBA 3HY5A 3AOEC 4WW0A 1QAOA 3SAWA 1TH4A 2O25A 3GRVA 3QYEA 1GJSA 2YR0A 3HJSA 3KSXA 3LQRA 5ITXE 3JR5A 4LY6A 1QVRA 4D82A 4IBKA 3KFUG 2Z8YM 1HT2E 2Q2EB 5ITYA 2FOIC 3K8ZA 3HWSA 4G4QA 4L4UA 3GLIA 3T1HM 3VK8A 4MH0E 1ZQ9A 3A46A 2QNJA 3L25A 2J7NA 3B7NA 3RE8A 4IBDA 2HCBA 4G6ZA 4JI7M 3MJ5A 2BJVA 4EIWA 4LFCM 2YFQA 1SXJA 3E21A 2DHRA 4B3TM 2UUCM 3K1JA 2JZ0A 3FRHA 3M0EA 4WP2A 2YQZA 2CE7A 2JY7A 3HJ8A 2XEPA 5FTJA 2LVOC 5IZ7D 1IXRC 2LNHC 1OIPA 4D80A 3U6SA 5FLXS 4GKJM 2VDBB 1C7YA 2DZLA 1NJGA 2HL7A 3HGIA 3I04M 3TPZA 5ITQA 4PD2A 3SFZA 3UJNA 3J80S 4QNRA 5LMNM 2F4VM 3HU1A 2E5LM 4RF1A 1JQJC 1IY0A 1KSFX 1R6BX 2R62A 2BWBA 5EP2A 3BOSA 2QP9X 2UUAM 2R0IA 3CF0A 5E26A 3QWLA 2VIIA 1NNUC 2KXEA 2OPFA 3SMPA 2L4EA 2XF3A 4NRVA 1XXHE 1PJIA 4FWDA 1KFVA 4GHAA 1BVSA 4IBIA 2EA0A 4AQYM 2CV0A 3KP0E 1GKIA 1X37A 4AG5A 4X62M 4NRWA 2R18A 4GITA 4ANRA 3IG5A 2XH9A 4RKUF 3GQ3A 4DV5M 1C1KA 1AUAA 4IIWA 2K6BA 3HU2A 4FCWA 3RGSA 2J7OA 3L26A 2LWXA 3IG8A 1XC8A 1S3SA 3J27B 4B3RM 2JP7A 3GPYA 4KHPM 3SHFA 2Z3XA 2DWLA 3KW6A 1R5LA 4GKKM 1R2YA 1I4WA 2MROB 4LJAA 3GLGA 5EP3A 1XXHB 3KS4A 2I7PA 3PVSA 3AJIB 1L2BA 3U6QA 3U6PA 3U6LA 2UXCM 1OIZA 3TWKA 1OAOC 2O01F 2QQ8A 2AHMA 1G4AE 3BBZA 2HAKA 2DI0A 2N35A 2I7NA 3K9OA 5GKNA 1VEJA 3GLFE 1YLAA 3HHWA 1IQPA 3FKEA 3SBJA 4L15A 2BWEA 1QYRA 4M9XA 2CHVA 1IN7A 3CF2A 3K9PA 2V1CA 1QZMA 3KXEC 4FW9A 5IREB 3GQ4A 1PJJA 5BPVA 5IT9S 3FTCA 4BB9A 4DV3M 2A5YB 4FD2A 1NHWC 2DHYA 3KDSE 1TDHA 5C18A 3DA1A 3LVWA 4QOZC 4LF6M 3BXWA 3KVWA 2JY5A 2MH8A 5KPTA 4IBGA 4MGYE 2XZFA 5F3WA 1K3XA 4GEWA 4NL4H 4BBAA 1GLNA 5DYGA 2L7IA 2RKOA 4X65M 4DV0M 2FE8A 1IN4A 1V92A 2R6FA 5A2QS 2MGWA 1NO1A 3W68A 3GLFB 2FH0A 5JI2E 5FTNA 1ORYB 1ZV1A 2G5GX 3U5ZB 4GMQA 3U60B 4G3OA 1A5TA 4MB7A 2XFTA 4GRIA 3GPUA 2NQ8C 3CF6E 1OTRA 3B74A 3KOYE 1L2DA 1TR8A 4HL4A 2DAEA 2QENA 1OJLA 2KHHA 2OOAA 1WJ7A 2WSCF 3C3DA 4IJEA 4LJ9A 4AKHA 3MMPA 3U6EA 2LXEA 1TH3A 4MGHA 1N36M 4LF7M 1E94E 5EP4A 1XB2B 2BNKA 4DR7M 3RGPA 4QNMA 3FRIA 4IBFA 3M6AA 5EQTA 3HHYA 1QAQA 3VDPA 1YE9A 1GABA 1VEKA 3EIHA 4XK8F 3GLIE 1ZAEA 4I8OA 1T43A 4LJ4A 1HNWM 1Q3BA 4XBOA 2H1RA 3TL4X 2L4FA 2DAIA 2GQFA 3GLHB 3J7AS 1IXSB 1GO5A 4CJ6A 7CATA 1IBKM 2DVWB 2G3QA 3HX3A 4OVZB 4AI6A 4JI6M 4DV7M 3A42A 4M0DA 3SMSA 4GC9A 4KLNA 2KDLA 3CTWB 4DR5M 1DGGA 1QUTA 1NSFA 3A45A 3CGWA 4CISA 1QUSA 1XNQM 4GC5A 3QYBA 1WHCA 3GP1A 3DZDA 3LMMA 2Z7JA 4B7HA 2QBYA 2RGOA 1XNRM 1IFYA 3B7QA 1Q39A 4JI1M 3GRUA 3SC3A 4DR1M 3GLIB 2JXNA 4DUYM 2CWBA 1L8QA 4AG6A 2X8AA 4TUWA 4G4OA 3KOXE 1NY5A 1Z5CA 2DAGA 4HEOA 2L6OA 2DNAA 3WHKA 4AZFA 4B7FA 3LCUA 3HJQA 1FJGM 1SXJB 4DBGB 1NNJA 2CRUA 2DZOB 2CV2A 2RGHA 4LJ6A 5LMUM 1AIPC 3E9SA 1WXQA 1ZMUA 2APLA 2DAMA 5ITUA 1PJQA 3I01M 4JI3M 1Z5BA 1OQYA 2C9CA 3Q8GA 1PM5A 1ZMWA 1PJSA 1QDTA 3JR4A 4FCVA 2R65A 3D8LA 3L27A 5ITTA 4X66M 1D0KA
chains in the Genus database with same CATH topology
3L29A 4W5WA 5DYIA 3MK6A 4LZJA 4L16A 4DR2M 3FYDA 4B3SM 1OFIA 3U6OA 2VQEM 4LFAM 3K92A 4LJ7A 1N77A 2EO2A 3I4VA 5EXPA 4MGKE 3TQSA 2KRUA 4LF8M 1QQWA 4MGIE 2F5PA 4IBCA 1HR0M 5BR8M 4G4NA 3NBIA 2G8LA 2V6ZM 2M5ZA 5JI3E 3AV0A 3B9PA 3AFHA 1J5EM 2UXBM 3GRRA 4AKGA 3JAMS 2UUBM 2JA2A 2C96A 1K82A 4WURA 3U6MA 4KO8A 3T1YM 5EXSA 3HHXA 4DR3M 4OU7A 2D7EA 3AOEA 3U61A 5FTKA 2L7HA 4IBJA 2F5QA 3UK6A 1DGHA 2O5RA 1VDDA 5C1BA 5EXTA 3SAVA 4REZA 1XXHA 4DV6M 1K3WA 4G4RA 2D7HA 3SARA 2ZBKB 4LCBA 1XHBA 2XFSA 3GLGB 4II7A 4A3VB 5KPRA 4DV2M 3ZC7B 2X49A 1IN6A 4M0WA 1N78A 1R2ZA 5KQ8A 2CV1A 3E4RA 3EIEA 1IN5A 1LV7A 1DO2A 1IY1A 2QCUA 4IBEA 1SXJC 3H4MA 2XSZD 4RF0A 2FFJA 3QAUA 3U6DA 3TE6A 3SAUA 3KOZE 3SHGB 4PDIA 4LF5M 2C99A 2F5SA 1IN8A 1HQYE 3LVVA 4NSRA 4R3DA 4S12A 3DOAA 4PDGA 1IBLM 2XGNA 4GIPA 2Z4SA 4FCTA 2R45A 4QHTA 4FVMA 4LGMA 4JI2M 4DV1M 1UM8A 1G59A 3GLFA 3FUVA 3RFWA 3AL0C 3KP1E 2EUCA 4YY3M 2KW0A 2FNAA 3AKZA 3GQ5A 3SATA 4NSOB 4KODA 1J7KA 5DNYA 8CATA 4IBBA 3UMMA 2ERCA 2DZNB 3ZCBB 1HT1E 3R8FA 1NHGC 1T3TA 4LRTA 4JV5M 1MU5A 1XMOM 4LZZA 4LF4M 4B3MM 1SXJE 3I4YA 4PT5A 2UU9M 4MM3B 2C98A 4I4LA 3HU3A 4LFBM 4JXJA 2KZUA 3W0LB 4RNAA 3FTDA 4K0KM 4B7GA 2Y0TA 5ITRA 2KA6B 2OQ4A 1L2CA 1W5TA 2DXIA 2VQFM 1GVNA 3D8BA 3TWMA 3U6CA 3HHZA 1L1ZA 1HNZM 4LJ8A 4NXNM 3KSJA 5EP1A 4IJFA 4NXMM 1QANA 3TWLA 4BLCA 1D2NA 1J09A 4QOSA 3VK7A 4FWGA 3VLFB 1EE8A 3SYKA 5FTLA 5ITXA 2QBYB 3T15A 2M60A 3C58A 1Z5AA 3L28A 2ZANA 2Y21A 4JI0M 3MHVC 4OW0A 2X4AA 3FD9A 4LG2A 1JR3D 1XMQM 2CUZA 4FWHA 1Z59A 2Y0QA 2QPAA 4DV4M 4QHSA 5KO3A 1W5SA 2ZM6M 1TH2A 3I51A 1KYIA 4GH9A 2Z4RA 2KEBA 1QAMA 2HKJA 2KZSA 4JN6A 4LF9M 2D7GA 3FUXA 2DWZB 4LJ5A 2C5RA 3FYCA 4L8RC 5KPZA 3NWLA 4P16A 1DO0A 1E9RA 4PCZA 3FUTA 2F5NA 4OX9M 1E9SA 2BJWA 3J81S 2K47A 2XZUA 4D81A 4R7GA 1HQCA 4GHLA 4DR4M 4I81A 1G41A 2V1UA 4YHHM 1Q3CA 4L78A 3ZH9B 1NJFA 2ZAMA 1IBMM 4JI4M 3J2PB 1H6UA 5FSWA 3SASA 3ILKA 1JR3A 1I94M 1TDZA 2HHHM 3J7BA 3LQQA 1HNXM 3OTOM 5EXXA 1Z6TA 1NY6A 4Z6YA 3U61B 1DGBA 4DUZM 3FUWA 5KQDA 1DGHB 5H37D 2UXDM 1IM2A 3VKHA 1GL7A 4Z8XA 3GPXA 1N33M 1TGUA 5EJCA 3L2AA 3SYLA 2C9OA 4AKIA 4CGYB 1L1TA 3KOWE 3PXGA 1FNNA 3VDUA 2CFOA 1G3IA 4I5SA 1DGFA 1XWIA 1OFHA 2R46A 1GL6A 2ZAOA 4M9ZA 3PNVA 2F5OA 2L09A 2R4EA 4CHTB 3GPPA 3FTFA 2CHGA 3M7GA 1YSYA 4JI5M 3A98B 4B08A 3VFDA 3GO8A 2LH0A 3PNYA 5FTMA 4LGYA 2P5TA 3WHLA 4ITQA 4X64M 3THGA 3UGJA 3U5ZA 3DFZA 3U60A 1N32M 3FTEA 3AOGA 1NVMA 2W82A 4NOOB 1N75A 3PFIA 3VKGA 4HLQA 1E32A 2YNMD 3R9XB 2XSZA 4LRSA 2XLJA 2CHQA 4DR6M 2CEAA 2Y20A 3HKPA 4JYAM 4XGIA 2R4JA 4ZPXA 2QZ4A 3GRYA 4MGZE 3W0FA 4JI8M 1SXJD 2DWNA 3T38A 2DWMA 3KS8A 3K2LA 5E6JA 1R7RA 3FUUA 1N34M 5IWAM 1IXZA 2KRKA 4M9SA 4AW4A 3GLHA 1G8PA 1IY2A 3UZUA 1MX0A 4OVZA 3Q8XA 1YUBA 3AOEC 4WW0A 1QAOA 3SAWA 1TH4A 3GRVA 2YR0A 3HJSA 3KSXA 3LQRA 5ITXE 3JR5A 4LY6A 1QVRA 4D82A 4IBKA 3KFUG 1HT2E 2Q2EB 5ITYA 2FOIC 3K8ZA 3HWSA 4G4QA 4L4UA 3GLIA 3T1HM 3VK8A 4MH0E 1ZQ9A 3A46A 3L25A 2J7NA 3RE8A 4IBDA 2HCBA 4G6ZA 4JI7M 3MJ5A 2BJVA 4EIWA 4LFCM 2YFQA 1SXJA 2DHRA 4B3TM 2UUCM 3K1JA 3M0EA 2YQZA 2CE7A 3HJ8A 2XEPA 5FTJA 5IZ7D 1IXRC 2LNHC 4D80A 3U6SA 5FLXS 4GKJM 1NJGA 2HL7A 3HGIA 3TPZA 5ITQA 4PD2A 3SFZA 3UJNA 3J80S 4QNRA 5LMNM 2F4VM 3HU1A 2E5LM 4RF1A 1JQJC 1IY0A 1KSFX 1R6BX 2R62A 5EP2A 3BOSA 2QP9X 2UUAM 3CF0A 5E26A 3QWLA 2VIIA 1NNUC 2KXEA 2OPFA 3SMPA 2XF3A 4NRVA 1PJIA 4FWDA 1KFVA 4GHAA 4IBIA 2EA0A 4AQYM 3KP0E 1GKIA 1X37A 4AG5A 4X62M 4NRWA 2R18A 4GITA 3GQ3A 3IG5A 2XH9A 4DV5M 1C1KA 4IIWA 3HU2A 4FCWA 3RGSA 2J7OA 3L26A 2LWXA 3IG8A 1XC8A 1S3SA 3J27B 4B3RM 3GPYA 4KHPM 3SHFA 2Z3XA 2DWLA 3KW6A 4GKKM 1R2YA 1I4WA 4LJAA 3GLGA 5EP3A 1XXHB 3KS4A 2I7PA 3PVSA 3AJIB 1L2BA 3U6QA 3U6PA 3U6LA 2UXCM 3TWKA 2AHMA 1G4AE 2I7NA 5GKNA 3HHWA 1IQPA 3FKEA 3SBJA 4L15A 1QYRA 4M9XA 2CHVA 1IN7A 3CF2A 3KXEC 2V1CA 1QZMA 4FW9A 5IREB 3GQ4A 1PJJA 5BPVA 5IT9S 3FTCA 4BB9A 4DV3M 2A5YB 4FD2A 1NHWC 5C18A 3KDSE 1TDHA 4QOZC 3DA1A 3LVWA 4LF6M 3KVWA 5KPTA 5F3WA 4IBGA 4MGYE 2XZFA 1K3XA 4NL4H 4BBAA 1GLNA 5DYGA 2L7IA 2RKOA 4X65M 4DV0M 2FE8A 1IN4A 5A2QS 3GLFB 5JI2E 5FTNA 1ORYB 2G5GX 3U5ZB 4GMQA 3U60B 4MB7A 2XFTA 4GRIA 3GPUA 2NQ8C 3CF6E 3KOYE 1L2DA 4HL4A 2QENA 1OJLA 4IJEA 4LJ9A 4AKHA 3U6EA 2LXEA 1TH3A 4MGHA 1N36M 4LF7M 1E94E 5EP4A 4DR7M 2BNKA 3RGPA 4QNMA 4IBFA 3M6AA 5EQTA 3HHYA 1QAQA 3VDPA 1YE9A 3EIHA 1ZAEA 4I8OA 4LJ4A 1HNWM 1Q3BA 4XBOA 2H1RA 3TL4X 3GLHB 3J7AS 1IXSB 7CATA 1IBKM 2DVWB 4OVZB 4AI6A 4JI6M 4DV7M 3A42A 4M0DA 3SMSA 4GC9A 4KLNA 3CTWB 4DR5M 1DGGA 1NSFA 3A45A 4CISA 1XNQM 4GC5A 3GP1A 3DZDA 3LMMA 2Z7JA 4B7HA 2QBYA 2RGOA 1XNRM 4JI1M 1Q39A 3GRUA 3SC3A 4DR1M 3GLIB 4DUYM 4AG6A 1L8QA 2X8AA 4TUWA 4G4OA 3KOXE 1NY5A 1Z5CA 2L6OA 3WHKA 4AZFA 4B7FA 3HJQA 1FJGM 1SXJB 1NNJA 2CV2A 2DZOB 2RGHA 4LJ6A 5LMUM 3E9SA 1WXQA 5ITUA 2CV0A 4JI3M 1Z5BA 2C9CA 1PM5A 3JR4A 4FCVA 2R65A 3D8LA 3L27A 5ITTA 4X66M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DYI A;  5EP3 A;  3GLG A;  1XXH B;  4L16 A;  1OFI A;  3PVS A;  3AJI B;  1W5T A;  1NVM A;  4LJ7 A;  3D8B A;  3PFI A;  5EXP A;  1E32 A;  1G4A E;  4LJ8 A;  2XSZ A;  4LRS A;  5EP1 A;  2CHQ A;  1D2N A;  2CEA A;  4ZPX A;  2QZ4 A;  1IQP A;  4QOS A;  4L15 A;  2V6Z M;  4FWG A;  2CHV A;  1IN7 A;  1SXJ D;  3CF2 A;  4FW9 A;  1QZM A;  3SYK A;  3B9P A;  3VLF B;  5FTL A;  2QBY B;  2ZAN A;  1R7R A;  2C96 A;  1IXZ A;  2KRK A;  4FD2 A;  3MHV C;  4KO8 A;  3GLH A;  5C18 A;  3KDS E;  1IY2 A;  5EXS A;  1JR3 D;  4FWH A;  5FTK A;  2QPA A;  3UK6 A;  5C1B A;  4WW0 A;  5DYG A;  5EXT A;  2RKO A;  4QHS A;  1W5S A;  1XXH A;  1IN4 A;  3GLF B;  4LY6 A;  1KYI A;  1QVR A;  4D82 A;  5JI2 E;  5JI3 E;  2Z4R A;  4LCB A;  5FTN A;  1HT2 E;  3U5Z B;  4JN6 A;  3GLG B;  4A3V B;  3U60 B;  2DWZ B;  3HWS A;  4LJ5 A;  4L4U A;  3GLI A;  1IN6 A;  1DO0 A;  2HCB A;  1IN5 A;  3EIE A;  4EIW A;  2BJV A;  1LV7 A;  2QEN A;  2BJW A;  1SXJ A;  1OJL A;  1DO2 A;  2DHR A;  1IY1 A;  4LJ9 A;  4D81 A;  1HQC A;  1SXJ C;  4I81 A;  3H4M A;  1G41 A;  2XSZ D;  2V1U A;  3K1J A;  3M0E A;  1E94 E;  3ZH9 B;  2CE7 A;  5EP4 A;  1NJF A;  4QNM A;  2ZAM A;  2C99 A;  3M6A A;  5EQT A;  5FTJ A;  1IN8 A;  1HQY E;  1JR3 A;  3EIH A;  1IXR C;  4LJ4 A;  4D80 A;  2Z4S A;  1NJG A;  4FCT A;  3GLH B;  1IXS B;  4QHT A;  5EXX A;  2DVW B;  4LGM A;  1NY6 A;  3U61 B;  4QNR A;  1UM8 A;  3HU1 A;  3GLF A;  4KLN A;  1JQJ C;  1IY0 A;  1KSF X;  1R6B X;  2R62 A;  1IM2 A;  1NSF A;  4Z8X A;  5EP2 A;  3BOS A;  2FNA A;  2QP9 X;  3SYL A;  3CF0 A;  2C9O A;  2VII A;  4KOD A;  1J7K A;  3DZD A;  4FWD A;  2QBY A;  3PXG A;  1FNN A;  3SC3 A;  1G3I A;  3GLI B;  1L8Q A;  1X37 A;  2DZN B;  1HT1 E;  1XWI A;  2X8A A;  3R8F A;  4LRT A;  1OFH A;  4GIT A;  1NY5 A;  2ZAO A;  3WHK A;  1C1K A;  3HU2 A;  1SXJ B;  4FCW A;  4LZZ A;  2DZO B;  4LJ6 A;  1S3S A;  2CHG A;  1SXJ E;  2C9C A;  3KW6 A;  3VFD A;  2C98 A;  4I4L A;  3HU3 A;  4FCV A;  2R65 A;  5FTM A;  3WHL A;  4LJA A; 
#chains in the Genus database with same CATH topology
 3L29 A;  4W5W A;  5DYI A;  3MK6 A;  4LZJ A;  4L16 A;  4DR2 M;  3FYD A;  4B3S M;  1OFI A;  3U6O A;  1JR3 E;  2VQE M;  4LFA M;  3K92 A;  4LJ7 A;  5L8R F;  1GJT A;  1N77 A;  4KT0 F;  2EO2 A;  3I4V A;  5EXP A;  4MGK E;  3TQS A;  2KRU A;  4LF8 M;  1TF0 B;  1QQW A;  4Y28 F;  1WR1 B;  4MGI E;  2F5P A;  4IBC A;  1HR0 M;  5BR8 M;  2DAK A;  4G4N A;  3NBI A;  2G8L A;  2KNZ A;  2V6Z M;  2M5Z A;  2LVQ D;  5JI3 E;  3GLG E;  3AV0 A;  3B9P A;  3NBX X;  1EIJ A;  3AFH A;  1J5E M;  2UXB M;  3GRR A;  4AKG A;  3JAM S;  2UUB M;  2JA2 A;  2C96 A;  4F2L A;  1K82 A;  4WUR A;  3U6M A;  4KO8 A;  3T1Y M;  5EXS A;  3HHX A;  4DR3 M;  4OU7 A;  2LTU A;  2D7E A;  3AOE A;  3U61 A;  5FTK A;  2L7H A;  4IBJ A;  2F5Q A;  1G71 A;  3UK6 A;  1DGH A;  2O5R A;  1VDD A;  5C1B A;  5EXT A;  3SAV A;  4REZ A;  1XXH A;  1D0M A;  4DV6 M;  1K3W A;  1LTM A;  4G4R A;  2D7H A;  3SAR A;  2ZBK B;  3HZJ A;  3B7Z A;  1Q02 A;  1XHB A;  2R44 A;  4LCB A;  2XFS A;  3GLG B;  4II7 A;  4A3V B;  5KPR A;  4DV2 M;  3ZC7 B;  2X49 A;  1IN6 A;  4M0W A;  1N78 A;  1R2Z A;  5KQ8 A;  2CV1 A;  2OOB A;  3E4R A;  3EIE A;  1IN5 A;  2LHG A;  1LV7 A;  2FS1 A;  1DV0 A;  1DO2 A;  1IY1 A;  2QCU A;  4IBE A;  1SXJ C;  3H4M A;  2XSZ D;  4RF0 A;  2FFJ A;  1WGL A;  3QAU A;  3U6D A;  3TE6 A;  3SAU A;  2WZJ A;  3KOZ E;  3SHG B;  4PDI A;  4LF5 M;  2C99 A;  2F5S A;  1IN8 A;  1HQY E;  3LVV A;  1VDL A;  4NSR A;  4R3D A;  4S12 A;  3DOA A;  2RRU A;  4PDG A;  1IBL M;  2XGN A;  2GNO A;  4GIP A;  2Z4S A;  2LVN C;  4FCT A;  2R45 A;  4QHT A;  4L6V 6;  4FVM A;  4LGM A;  4JI2 M;  4DV1 M;  1UM8 A;  3GLH E;  1G59 A;  3GLF A;  1JB0 F;  3FUV A;  3RFW A;  3AL0 C;  3KP1 E;  2EUC A;  4YY3 M;  2KNV A;  2KW0 A;  2FNA A;  3FE3 A;  3AKZ A;  1D0L A;  3GQ5 A;  4NSO B;  4KOD A;  1J7K A;  3SAT A;  5DNY A;  1NV8 A;  8CAT A;  4IBB A;  3LW5 F;  3UMM A;  2ERC A;  1VEG A;  2WSF F;  2DZN B;  3F92 A;  2WSE F;  1HT1 E;  1OAI A;  2EKK A;  1NHG C;  1T3T A;  4LRT A;  3ZCB B;  3R8F A;  2LVA A;  4JV5 M;  1MU5 A;  2QHO B;  1PGY A;  1XMO M;  4LZZ A;  4LF4 M;  4B3M M;  1SXJ E;  3I4Y A;  4PT5 A;  2ZTD A;  2UU9 M;  4MM3 B;  2C98 A;  4I4L A;  3HU3 A;  4LFB M;  4CIZ A;  4JXJ A;  2KZU A;  4R71 A;  3W0L B;  3V76 A;  4RNA A;  3FTD A;  4K0K M;  4B7G A;  2Y0T A;  5ITR A;  2KA6 B;  2OQ4 A;  1L2C A;  1W5T A;  2DXI A;  2VQF M;  1GVN A;  1PJT A;  3D8B A;  3TWM A;  3U6C A;  3IEC A;  3HHZ A;  1L1Z A;  1HNZ M;  4LJ8 A;  4NXN M;  3KSJ A;  5EP1 A;  1V33 A;  4IJF A;  1QAN A;  3TWL A;  4NXM M;  4BLC A;  1F4I A;  1D2N A;  1J09 A;  3IHP A;  4QOS A;  3VK7 A;  4FWG A;  3VLF B;  1EE8 A;  3SYK A;  5FTL A;  5ITX A;  2QBY B;  3T15 A;  2M60 A;  3C58 A;  1Z5A A;  1R4G A;  2B3T A;  3C9P A;  3L28 A;  2ZAN A;  2Y21 A;  4JI0 M;  3MHV C;  1UFZ A;  4OW0 A;  2X4A A;  3LCV B;  3FD9 A;  4LG2 A;  1QZE A;  1JR3 D;  1XMQ M;  2CUZ A;  2JNH A;  1Z59 A;  4FWH A;  2Y0Q A;  2QPA A;  4DV4 M;  2JY8 A;  4F1I A;  4QHS A;  5KO3 A;  1W5S A;  2EJS A;  1T6O A;  2ZM6 M;  1TH2 A;  3I51 A;  2MR9 A;  2JUJ A;  3B89 A;  1KYI A;  4GH9 A;  2Z4R A;  1RU3 A;  2KEB A;  1QAM A;  1V34 A;  2HKJ A;  2KZS A;  4JN6 A;  4Q7J A;  4LF9 M;  2D7G A;  3FUX A;  2DWZ B;  4LJ5 A;  1WGN A;  2C5R A;  3FYC A;  4L8R C;  5KPZ A;  3NWL A;  4P16 A;  2KNA A;  1DO0 A;  1E9R A;  4PCZ A;  3FUT A;  2F5N A;  2LVP C;  4OX9 M;  1CUK A;  1E9S A;  2BJW A;  3J81 S;  2K47 A;  2XZU A;  4D81 A;  4R7G A;  1HQC A;  4GHL A;  4DR4 M;  4I81 A;  1G41 A;  2V1U A;  4YHH M;  1Q3C A;  4L78 A;  3ZH9 B;  1OKS A;  1NJF A;  2ZAM A;  1IBM M;  4JI4 M;  3J2P B;  1H6U A;  3T6P A;  5FSW A;  3ILK A;  2HWJ A;  5DFL A;  1JR3 A;  1MJG M;  2H5X A;  3SAS A;  1I94 M;  1TDZ A;  2HHH M;  4P17 A;  2K9D A;  3J7B A;  3LQQ A;  1HNX M;  3OTO M;  5EXX A;  1Z6T A;  2ZTC A;  1NY6 A;  4Z6Y A;  3U61 B;  1DGB A;  4DUZ M;  3FUW A;  5KQD A;  1DGH B;  5H37 D;  2UXD M;  1IM2 A;  3VKH A;  1GL7 A;  4Z8X A;  3GPX A;  1N33 M;  1TGU A;  5EJC A;  3L2A A;  3SYL A;  2C9O A;  2VF8 A;  4AKI A;  2DKL A;  4CGY B;  1L1T A;  2L2D A;  3KOW E;  2JZ1 A;  3PXG A;  1FNN A;  3VDU A;  2CFO A;  1G3I A;  4I5S A;  1DGF A;  1XWI A;  2K0B X;  1OFH A;  2R46 A;  1GL6 A;  2ZAO A;  4M9Z A;  3PNV A;  2F5O A;  1PRB A;  2L09 A;  2R4E A;  4CHT B;  3GPP A;  1SG9 A;  1MN3 A;  2OO9 A;  3E46 A;  2J5Y A;  3FTF A;  2QSF X;  2CHG A;  3M7G A;  1YSY A;  2EKF A;  4JI5 M;  3A98 B;  4B08 A;  3VFD A;  3GO8 A;  2LH0 A;  3PNY A;  5FTM A;  4LGY A;  2P5T A;  1P3Q Q;  3WHL A;  4ITQ A;  4X64 M;  3THG A;  3UGJ A;  3U5Z A;  3DFZ A;  1Y8G A;  2VF7 A;  3U60 A;  4UN2 B;  1N32 M;  3FTE A;  1VG5 A;  3AOG A;  1NVM A;  1WIV A;  3H4J A;  2CP8 A;  2W82 A;  4NOO B;  2JY6 B;  2MJ5 B;  1N75 A;  2JWS A;  2LHC A;  3PFI A;  4HLQ A;  3VKG A;  1E32 A;  2YNM D;  3C3E A;  3W67 A;  3R9X B;  2XSZ A;  1HJP A;  4LRS A;  1EFU B;  2XLJ A;  2CHQ A;  4DR6 M;  2CEA A;  2Y20 A;  2DEN A;  3HKP A;  4JYA M;  4XGI A;  2R4J A;  4ZPX A;  2QZ4 A;  3GRY A;  4MGZ E;  3W0F A;  3ZQJ A;  4JI8 M;  1SXJ D;  4NC6 A;  1VQ1 A;  2DWN A;  3T38 A;  2DWM A;  3KS8 A;  1NV9 A;  3K2L A;  5E6J A;  1R7R A;  3FUU A;  1TTE A;  1N34 M;  1QDR A;  5IWA M;  1IXZ A;  2KRK A;  4M9S A;  4AW4 A;  3GLH A;  1G8P A;  1IXS A;  1IY2 A;  3UZU A;  1MX0 A;  1ZMV A;  2LBC A;  4OVZ A;  3Q8X A;  1YUB A;  3HY5 A;  3AOE C;  4WW0 A;  1QAO A;  3SAW A;  1TH4 A;  2O25 A;  3GRV A;  3QYE A;  1GJS A;  2YR0 A;  3HJS A;  3KSX A;  3LQR A;  5ITX E;  3JR5 A;  4LY6 A;  1QVR A;  4D82 A;  4IBK A;  3KFU G;  2Z8Y M;  1HT2 E;  2Q2E B;  5ITY A;  2FOI C;  3K8Z A;  3HWS A;  4G4Q A;  4L4U A;  3GLI A;  3T1H M;  3VK8 A;  4MH0 E;  1ZQ9 A;  3A46 A;  2QNJ A;  3L25 A;  2J7N A;  3B7N A;  3RE8 A;  4IBD A;  2HCB A;  4G6Z A;  4JI7 M;  3MJ5 A;  2BJV A;  4EIW A;  4LFC M;  2YFQ A;  1SXJ A;  3E21 A;  2DHR A;  4B3T M;  2UUC M;  3K1J A;  2JZ0 A;  3FRH A;  3M0E A;  4WP2 A;  2YQZ A;  2CE7 A;  2JY7 A;  3HJ8 A;  2XEP A;  5FTJ A;  2LVO C;  5IZ7 D;  1IXR C;  2LNH C;  1OIP A;  4D80 A;  3U6S A;  5FLX S;  4GKJ M;  2VDB B;  1C7Y A;  2DZL A;  1NJG A;  2HL7 A;  3HGI A;  3I04 M;  3TPZ A;  5ITQ A;  4PD2 A;  3SFZ A;  3UJN A;  3J80 S;  4QNR A;  5LMN M;  2F4V M;  3HU1 A;  2E5L M;  4RF1 A;  1JQJ C;  1IY0 A;  1KSF X;  1R6B X;  2R62 A;  2BWB A;  5EP2 A;  3BOS A;  2QP9 X;  2UUA M;  2R0I A;  3CF0 A;  5E26 A;  3QWL A;  2VII A;  1NNU C;  2KXE A;  2OPF A;  3SMP A;  2L4E A;  2XF3 A;  4NRV A;  1XXH E;  1PJI A;  4FWD A;  1KFV A;  4GHA A;  1BVS A;  4IBI A;  2EA0 A;  4AQY M;  2CV0 A;  3KP0 E;  1GKI A;  1X37 A;  4AG5 A;  4X62 M;  4NRW A;  2R18 A;  4GIT A;  4ANR A;  3IG5 A;  2XH9 A;  4RKU F;  3GQ3 A;  4DV5 M;  1C1K A;  1AUA A;  4IIW A;  2K6B A;  3HU2 A;  4FCW A;  3RGS A;  2J7O A;  3L26 A;  2LWX A;  3IG8 A;  1XC8 A;  1S3S A;  3J27 B;  4B3R M;  2JP7 A;  3GPY A;  4KHP M;  3SHF A;  2Z3X A;  2DWL A;  3KW6 A;  1R5L A;  4GKK M;  1R2Y A;  1I4W A;  2MRO B;  4LJA A;  3GLG A;  5EP3 A;  1XXH B;  3KS4 A;  2I7P A;  3PVS A;  3AJI B;  1L2B A;  3U6Q A;  3U6P A;  3U6L A;  2UXC M;  1OIZ A;  3TWK A;  1OAO C;  2O01 F;  2QQ8 A;  2AHM A;  1G4A E;  3BBZ A;  2HAK A;  2DI0 A;  2N35 A;  2I7N A;  3K9O A;  5GKN A;  1VEJ A;  3GLF E;  1YLA A;  3HHW A;  1IQP A;  3FKE A;  3SBJ A;  4L15 A;  2BWE A;  1QYR A;  4M9X A;  2CHV A;  1IN7 A;  3CF2 A;  3K9P A;  2V1C A;  1QZM A;  3KXE C;  4FW9 A;  5IRE B;  3GQ4 A;  1PJJ A;  5BPV A;  5IT9 S;  3FTC A;  4BB9 A;  4DV3 M;  2A5Y B;  4FD2 A;  1NHW C;  2DHY A;  3KDS E;  1TDH A;  5C18 A;  3DA1 A;  3LVW A;  4QOZ C;  4LF6 M;  3BXW A;  3KVW A;  2JY5 A;  2MH8 A;  5KPT A;  4IBG A;  4MGY E;  2XZF A;  5F3W A;  1K3X A;  4GEW A;  4NL4 H;  4BBA A;  1GLN A;  5DYG A;  2L7I A;  2RKO A;  4X65 M;  4DV0 M;  2FE8 A;  1IN4 A;  1V92 A;  2R6F A;  5A2Q S;  2MGW A;  1NO1 A;  3W68 A;  3GLF B;  2FH0 A;  5JI2 E;  5FTN A;  1ORY B;  1ZV1 A;  2G5G X;  3U5Z B;  4GMQ A;  3U60 B;  4G3O A;  1A5T A;  4MB7 A;  2XFT A;  4GRI A;  3GPU A;  2NQ8 C;  3CF6 E;  1OTR A;  3B74 A;  3KOY E;  1L2D A;  1TR8 A;  4HL4 A;  2DAE A;  2QEN A;  1OJL A;  2KHH A;  2OOA A;  1WJ7 A;  2WSC F;  3C3D A;  4IJE A;  4LJ9 A;  4AKH A;  3MMP A;  3U6E A;  2LXE A;  1TH3 A;  4MGH A;  1N36 M;  4LF7 M;  1E94 E;  5EP4 A;  1XB2 B;  2BNK A;  4DR7 M;  3RGP A;  4QNM A;  3FRI A;  4IBF A;  3M6A A;  5EQT A;  3HHY A;  1QAQ A;  3VDP A;  1YE9 A;  1GAB A;  1VEK A;  3EIH A;  4XK8 F;  3GLI E;  1ZAE A;  4I8O A;  1T43 A;  4LJ4 A;  1HNW M;  1Q3B A;  4XBO A;  2H1R A;  3TL4 X;  2L4F A;  2DAI A;  2GQF A;  3GLH B;  3J7A S;  1IXS B;  1GO5 A;  4CJ6 A;  7CAT A;  1IBK M;  2DVW B;  2G3Q A;  3HX3 A;  4OVZ B;  4AI6 A;  4JI6 M;  4DV7 M;  3A42 A;  4M0D A;  3SMS A;  4GC9 A;  4KLN A;  2KDL A;  3CTW B;  4DR5 M;  1DGG A;  1QUT A;  1NSF A;  3A45 A;  3CGW A;  4CIS A;  1QUS A;  1XNQ M;  4GC5 A;  3QYB A;  1WHC A;  3GP1 A;  3DZD A;  3LMM A;  2Z7J A;  4B7H A;  2QBY A;  2RGO A;  1XNR M;  1IFY A;  3B7Q A;  1Q39 A;  4JI1 M;  3GRU A;  3SC3 A;  4DR1 M;  3GLI B;  2JXN A;  4DUY M;  2CWB A;  1L8Q A;  4AG6 A;  2X8A A;  4TUW A;  4G4O A;  3KOX E;  1NY5 A;  1Z5C A;  2DAG A;  4HEO A;  2L6O A;  2DNA A;  3WHK A;  4AZF A;  4B7F A;  3LCU A;  3HJQ A;  1FJG M;  1SXJ B;  4DBG B;  1NNJ A;  2CRU A;  2DZO B;  2CV2 A;  2RGH A;  4LJ6 A;  5LMU M;  1AIP C;  3E9S A;  1WXQ A;  1ZMU A;  2APL A;  2DAM A;  5ITU A;  1PJQ A;  3I01 M;  4JI3 M;  1Z5B A;  1OQY A;  2C9C A;  3Q8G A;  1PM5 A;  1ZMW A;  1PJS A;  1QDT A;  3JR4 A;  4FCV A;  2R65 A;  3D8L A;  3L27 A;  5ITT A;  4X66 M;  1D0K A; 
#chains in the Genus database with same CATH homology
 3L29 A;  4W5W A;  5DYI A;  3MK6 A;  4LZJ A;  4L16 A;  4DR2 M;  3FYD A;  4B3S M;  1OFI A;  3U6O A;  2VQE M;  4LFA M;  3K92 A;  4LJ7 A;  1N77 A;  2EO2 A;  3I4V A;  5EXP A;  4MGK E;  3TQS A;  2KRU A;  4LF8 M;  1QQW A;  4MGI E;  2F5P A;  4IBC A;  1HR0 M;  5BR8 M;  4G4N A;  3NBI A;  2G8L A;  2V6Z M;  2M5Z A;  5JI3 E;  3AV0 A;  3B9P A;  3AFH A;  1J5E M;  2UXB M;  3GRR A;  4AKG A;  3JAM S;  2UUB M;  2JA2 A;  2C96 A;  1K82 A;  4WUR A;  3U6M A;  4KO8 A;  3T1Y M;  5EXS A;  3HHX A;  4DR3 M;  4OU7 A;  2D7E A;  3AOE A;  3U61 A;  5FTK A;  2L7H A;  4IBJ A;  2F5Q A;  3UK6 A;  1DGH A;  2O5R A;  1VDD A;  5C1B A;  5EXT A;  3SAV A;  4REZ A;  1XXH A;  4DV6 M;  1K3W A;  4G4R A;  2D7H A;  3SAR A;  2ZBK B;  4LCB A;  1XHB A;  2XFS A;  3GLG B;  4II7 A;  4A3V B;  5KPR A;  4DV2 M;  3ZC7 B;  2X49 A;  1IN6 A;  4M0W A;  1N78 A;  1R2Z A;  5KQ8 A;  2CV1 A;  3E4R A;  3EIE A;  1IN5 A;  1LV7 A;  1DO2 A;  1IY1 A;  2QCU A;  4IBE A;  1SXJ C;  3H4M A;  2XSZ D;  4RF0 A;  2FFJ A;  3QAU A;  3U6D A;  3TE6 A;  3SAU A;  3KOZ E;  3SHG B;  4PDI A;  4LF5 M;  2C99 A;  2F5S A;  1IN8 A;  1HQY E;  3LVV A;  4NSR A;  4R3D A;  4S12 A;  3DOA A;  4PDG A;  1IBL M;  2XGN A;  4GIP A;  2Z4S A;  4FCT A;  2R45 A;  4QHT A;  4FVM A;  4LGM A;  4JI2 M;  4DV1 M;  1UM8 A;  1G59 A;  3GLF A;  3FUV A;  3RFW A;  3AL0 C;  3KP1 E;  2EUC A;  4YY3 M;  2KW0 A;  2FNA A;  3AKZ A;  3GQ5 A;  3SAT A;  4NSO B;  4KOD A;  1J7K A;  5DNY A;  8CAT A;  4IBB A;  3UMM A;  2ERC A;  2DZN B;  3ZCB B;  1HT1 E;  3R8F A;  1NHG C;  1T3T A;  4LRT A;  4JV5 M;  1MU5 A;  1XMO M;  4LZZ A;  4LF4 M;  4B3M M;  1SXJ E;  3I4Y A;  4PT5 A;  2UU9 M;  4MM3 B;  2C98 A;  4I4L A;  3HU3 A;  4LFB M;  4JXJ A;  2KZU A;  3W0L B;  4RNA A;  3FTD A;  4K0K M;  4B7G A;  2Y0T A;  5ITR A;  2KA6 B;  2OQ4 A;  1L2C A;  1W5T A;  2DXI A;  2VQF M;  1GVN A;  3D8B A;  3TWM A;  3U6C A;  3HHZ A;  1L1Z A;  1HNZ M;  4LJ8 A;  4NXN M;  3KSJ A;  5EP1 A;  4IJF A;  4NXM M;  1QAN A;  3TWL A;  4BLC A;  1D2N A;  1J09 A;  4QOS A;  3VK7 A;  4FWG A;  3VLF B;  1EE8 A;  3SYK A;  5FTL A;  5ITX A;  2QBY B;  3T15 A;  2M60 A;  3C58 A;  1Z5A A;  3L28 A;  2ZAN A;  2Y21 A;  4JI0 M;  3MHV C;  4OW0 A;  2X4A A;  3FD9 A;  4LG2 A;  1JR3 D;  1XMQ M;  2CUZ A;  4FWH A;  1Z59 A;  2Y0Q A;  2QPA A;  4DV4 M;  4QHS A;  5KO3 A;  1W5S A;  2ZM6 M;  1TH2 A;  3I51 A;  1KYI A;  4GH9 A;  2Z4R A;  2KEB A;  1QAM A;  2HKJ A;  2KZS A;  4JN6 A;  4LF9 M;  2D7G A;  3FUX A;  2DWZ B;  4LJ5 A;  2C5R A;  3FYC A;  4L8R C;  5KPZ A;  3NWL A;  4P16 A;  1DO0 A;  1E9R A;  4PCZ A;  3FUT A;  2F5N A;  4OX9 M;  1E9S A;  2BJW A;  3J81 S;  2K47 A;  2XZU A;  4D81 A;  4R7G A;  1HQC A;  4GHL A;  4DR4 M;  4I81 A;  1G41 A;  2V1U A;  4YHH M;  1Q3C A;  4L78 A;  3ZH9 B;  1NJF A;  2ZAM A;  1IBM M;  4JI4 M;  3J2P B;  1H6U A;  5FSW A;  3SAS A;  3ILK A;  1JR3 A;  1I94 M;  1TDZ A;  2HHH M;  3J7B A;  3LQQ A;  1HNX M;  3OTO M;  5EXX A;  1Z6T A;  1NY6 A;  4Z6Y A;  3U61 B;  1DGB A;  4DUZ M;  3FUW A;  5KQD A;  1DGH B;  5H37 D;  2UXD M;  1IM2 A;  3VKH A;  1GL7 A;  4Z8X A;  3GPX A;  1N33 M;  1TGU A;  5EJC A;  3L2A A;  3SYL A;  2C9O A;  4AKI A;  4CGY B;  1L1T A;  3KOW E;  3PXG A;  1FNN A;  3VDU A;  2CFO A;  1G3I A;  4I5S A;  1DGF A;  1XWI A;  1OFH A;  2R46 A;  1GL6 A;  2ZAO A;  4M9Z A;  3PNV A;  2F5O A;  2L09 A;  2R4E A;  4CHT B;  3GPP A;  3FTF A;  2CHG A;  3M7G A;  1YSY A;  4JI5 M;  3A98 B;  4B08 A;  3VFD A;  3GO8 A;  2LH0 A;  3PNY A;  5FTM A;  4LGY A;  2P5T A;  3WHL A;  4ITQ A;  4X64 M;  3THG A;  3UGJ A;  3U5Z A;  3DFZ A;  3U60 A;  1N32 M;  3FTE A;  3AOG A;  1NVM A;  2W82 A;  4NOO B;  1N75 A;  3PFI A;  3VKG A;  4HLQ A;  1E32 A;  2YNM D;  3R9X B;  2XSZ A;  4LRS A;  2XLJ A;  2CHQ A;  4DR6 M;  2CEA A;  2Y20 A;  3HKP A;  4JYA M;  4XGI A;  2R4J A;  4ZPX A;  2QZ4 A;  3GRY A;  4MGZ E;  3W0F A;  4JI8 M;  1SXJ D;  2DWN A;  3T38 A;  2DWM A;  3KS8 A;  3K2L A;  5E6J A;  1R7R A;  3FUU A;  1N34 M;  5IWA M;  1IXZ A;  2KRK A;  4M9S A;  4AW4 A;  3GLH A;  1G8P A;  1IY2 A;  3UZU A;  1MX0 A;  4OVZ A;  3Q8X A;  1YUB A;  3AOE C;  4WW0 A;  1QAO A;  3SAW A;  1TH4 A;  3GRV A;  2YR0 A;  3HJS A;  3KSX A;  3LQR A;  5ITX E;  3JR5 A;  4LY6 A;  1QVR A;  4D82 A;  4IBK A;  3KFU G;  1HT2 E;  2Q2E B;  5ITY A;  2FOI C;  3K8Z A;  3HWS A;  4G4Q A;  4L4U A;  3GLI A;  3T1H M;  3VK8 A;  4MH0 E;  1ZQ9 A;  3A46 A;  3L25 A;  2J7N A;  3RE8 A;  4IBD A;  2HCB A;  4G6Z A;  4JI7 M;  3MJ5 A;  2BJV A;  4EIW A;  4LFC M;  2YFQ A;  1SXJ A;  2DHR A;  4B3T M;  2UUC M;  3K1J A;  3M0E A;  2YQZ A;  2CE7 A;  3HJ8 A;  2XEP A;  5FTJ A;  5IZ7 D;  1IXR C;  2LNH C;  4D80 A;  3U6S A;  5FLX S;  4GKJ M;  1NJG A;  2HL7 A;  3HGI A;  3TPZ A;  5ITQ A;  4PD2 A;  3SFZ A;  3UJN A;  3J80 S;  4QNR A;  5LMN M;  2F4V M;  3HU1 A;  2E5L M;  4RF1 A;  1JQJ C;  1IY0 A;  1KSF X;  1R6B X;  2R62 A;  5EP2 A;  3BOS A;  2QP9 X;  2UUA M;  3CF0 A;  5E26 A;  3QWL A;  2VII A;  1NNU C;  2KXE A;  2OPF A;  3SMP A;  2XF3 A;  4NRV A;  1PJI A;  4FWD A;  1KFV A;  4GHA A;  4IBI A;  2EA0 A;  4AQY M;  3KP0 E;  1GKI A;  1X37 A;  4AG5 A;  4X62 M;  4NRW A;  2R18 A;  4GIT A;  3GQ3 A;  3IG5 A;  2XH9 A;  4DV5 M;  1C1K A;  4IIW A;  3HU2 A;  4FCW A;  3RGS A;  2J7O A;  3L26 A;  2LWX A;  3IG8 A;  1XC8 A;  1S3S A;  3J27 B;  4B3R M;  3GPY A;  4KHP M;  3SHF A;  2Z3X A;  2DWL A;  3KW6 A;  4GKK M;  1R2Y A;  1I4W A;  4LJA A;  3GLG A;  5EP3 A;  1XXH B;  3KS4 A;  2I7P A;  3PVS A;  3AJI B;  1L2B A;  3U6Q A;  3U6P A;  3U6L A;  2UXC M;  3TWK A;  2AHM A;  1G4A E;  2I7N A;  5GKN A;  3HHW A;  1IQP A;  3FKE A;  3SBJ A;  4L15 A;  1QYR A;  4M9X A;  2CHV A;  1IN7 A;  3CF2 A;  3KXE C;  2V1C A;  1QZM A;  4FW9 A;  5IRE B;  3GQ4 A;  1PJJ A;  5BPV A;  5IT9 S;  3FTC A;  4BB9 A;  4DV3 M;  2A5Y B;  4FD2 A;  1NHW C;  5C18 A;  3KDS E;  1TDH A;  4QOZ C;  3DA1 A;  3LVW A;  4LF6 M;  3KVW A;  5KPT A;  5F3W A;  4IBG A;  4MGY E;  2XZF A;  1K3X A;  4NL4 H;  4BBA A;  1GLN A;  5DYG A;  2L7I A;  2RKO A;  4X65 M;  4DV0 M;  2FE8 A;  1IN4 A;  5A2Q S;  3GLF B;  5JI2 E;  5FTN A;  1ORY B;  2G5G X;  3U5Z B;  4GMQ A;  3U60 B;  4MB7 A;  2XFT A;  4GRI A;  3GPU A;  2NQ8 C;  3CF6 E;  3KOY E;  1L2D A;  4HL4 A;  2QEN A;  1OJL A;  4IJE A;  4LJ9 A;  4AKH A;  3U6E A;  2LXE A;  1TH3 A;  4MGH A;  1N36 M;  4LF7 M;  1E94 E;  5EP4 A;  4DR7 M;  2BNK A;  3RGP A;  4QNM A;  4IBF A;  3M6A A;  5EQT A;  3HHY A;  1QAQ A;  3VDP A;  1YE9 A;  3EIH A;  1ZAE A;  4I8O A;  4LJ4 A;  1HNW M;  1Q3B A;  4XBO A;  2H1R A;  3TL4 X;  3GLH B;  3J7A S;  1IXS B;  7CAT A;  1IBK M;  2DVW B;  4OVZ B;  4AI6 A;  4JI6 M;  4DV7 M;  3A42 A;  4M0D A;  3SMS A;  4GC9 A;  4KLN A;  3CTW B;  4DR5 M;  1DGG A;  1NSF A;  3A45 A;  4CIS A;  1XNQ M;  4GC5 A;  3GP1 A;  3DZD A;  3LMM A;  2Z7J A;  4B7H A;  2QBY A;  2RGO A;  1XNR M;  4JI1 M;  1Q39 A;  3GRU A;  3SC3 A;  4DR1 M;  3GLI B;  4DUY M;  4AG6 A;  1L8Q A;  2X8A A;  4TUW A;  4G4O A;  3KOX E;  1NY5 A;  1Z5C A;  2L6O A;  3WHK A;  4AZF A;  4B7F A;  3HJQ A;  1FJG M;  1SXJ B;  1NNJ A;  2CV2 A;  2DZO B;  2RGH A;  4LJ6 A;  5LMU M;  3E9S A;  1WXQ A;  5ITU A;  2CV0 A;  4JI3 M;  1Z5B A;  2C9C A;  1PM5 A;  3JR4 A;  4FCV A;  2R65 A;  3D8L A;  3L27 A;  5ITT A;  4X66 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...