2DZOB

Crystal structure analysis of yeast nas6p complexed with the proteasome subunit, rpt3
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
MSLAPEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable 26S proteasome regulatory subunit p28
publication title Crystal structure analysis of yeast Nas6p complexed with the proteasome subunit, rpt3
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 15
structure length 57
sequence length 57
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dzoB00
1OFHA 2VIIA 5EP2A 2C96A 1XXHA 4KODA 5EQTA 4QHTA 3GLGA 1C1KA 1D2NA 1DO0A 4D80A 5EXTA 4EIWA 5C18A 4D81A 1J7KA 3M0EA 2R65A 4L15A 2QZ4A 1G4AE 1G3IA 4LJ4A 3WHKA 1IXSB 4I4LA 4A3VB 2QBYB 1E32A 3SYKA 4GITA 2XSZD 2CE7A 3HU1A 2CHQA 2XSZA 5FTKA 3ZH9B 2QBYA 3BOSA 3M6AA 3B9PA 1NY5A 5FTNA 1UM8A 1IM2A 1E94E 3H4MA 3K1JA 4WW0A 1IY1A 1OFIA 4LJ8A 2DHRA 1QZMA 4KO8A 4FD2A 4I81A 4Z8XA 5DYIA 2DZOB 1W5TA 5FTMA 4FWGA 5EXPA 1W5SA 3GLIB 4FCWA 2C98A 1S3SA 5EXSA 4FWHA 4JN6A 2BJWA 2QP9X 3GLHB 4KLNA 1G41A 1NJGA 1IQPA 3MHVC 3GLIA 1NSFA 4FCVA 2V1UA 3GLHA 2KRKA 1KSFX 2RKOA 4QNRA 2ZAMA 4FW9A 3SYLA 3AJIB 4FWDA 4L16A 3WHLA 3GLFB 1DO2A 2BJVA 4LGMA 3U60B 4ZPXA 1NJFA 2ZAOA 3PXGA 3GLFA 1SXJB 3U61B 3PFIA 1HQCA 4QOSA 3VFDA 4FCTA 1HT1E 1IN7A 4LRSA 2Z4RA 3DZDA 2CHGA 3VLFB 3R8FA 1SXJA 1SXJC 1LV7A 4LRTA 3EIHA 1QVRA 1IXRC 2DVWB 3KDSE 1IN8A 1JQJC 1OJLA 2QENA 2DWZB 2FNAA 2C99A 2DZNB 2ZANA 4LJ6A 4QNMA 4LJ7A 3HU3A 4LJAA 3GLGB 5FTJA 1R7RA 2QPAA 5EP4A 1HQYE 5FTLA 3U5ZB 3UK6A 2CHVA 1SXJE 5JI3E 3D8BA 2R62A 1IN5A 5EP1A 1IN4A 2CEAA 1L8QA 4QHSA 1X37A 5C1BA 2C9OA 1NY6A 1FNNA 1JR3D 1SXJD 1XWIA 5EXXA 2HCBA 4LJ5A 5JI2E 1JR3A 5EP3A 1IY2A 2X8AA 3CF0A 2C9CA 4D82A 2V6ZM 1HT2E 3KW6A 4LJ9A 3EIEA 3SC3A 4LZZA 1R6BX 3CF2A 5DYGA 3HWSA 4LCBA 1XXHB 4L4UA 1IN6A 1IY0A 3HU2A 4LY6A 3PVSA 1KYIA 1NVMA 2Z4SA 1IXZA
chains in the Genus database with same CATH superfamily
3HZJA 4DR6M 2K9DA 2G8LA 3DFZA 5EQTA 5IWAM 1TF0B 1C1KA 2MR9A 1D2NA 1DO0A 1AIPC 1DGFA 4IBFA 5EXTA 4DV1M 1N34M 1J7KA 1VDDA 3M0EA 4LF9M 4CHTB 3AOGA 3TE6A 1G3IA 2Y20A 1YUBA 5ITUA 3T1YM 4DUYM 3T38A 1IXSB 5KQDA 2XH9A 4A3VB 2DAMA 2QBYB 2BWBA 3SYKA 2XEPA 3KP1E 4LF7M 2Y0TA 1VEGA 1XXHE 3HGIA 4IBEA 3M6AA 4LFAM 3GLGE 3D8LA 5KPTA 5L8RF 2D7HA 2JY6B 1UM8A 2P5TA 1IM2A 2K0BX 3IG8A 2L4FA 1WGLA 1MX0A 3FUTA 4LF6M 1N75A 3KXEC 2L09A 1GJTA 4LY6A 4I81A 2EO2A 2R4EA 5ITXE 5EXPA 3KS4A 3GLIB 5ITYA 2JZ0A 3FUWA 1S3SA 1ORYB 4HLQA 1QQWA 3UJNA 3JAMS 4GKKM 2BJWA 2YQZA 3Q8GA 2EA0A 4LFCM 4NRWA 1G41A 4X66M 3MHVC 5IZ7D 1NSFA 2AHMA 3FE3A 3HKPA 3HJQA 4I5SA 2V1UA 4MGKE 3LMMA 3SAVA 4QNRA 2KHHA 4GIPA 1NHGC 2RRUA 2A5YB 4L16A 3TL4X 2K6BA 3WHLA 2I7PA 2Y0QA 4L8RC 1QYRA 3T6PA 2OPFA 3IHPA 4LGMA 3SAUA 3I4VA 3R9XB 1NJFA 2ZAOA 4B08A 3FRIA 2UU9M 3GLFA 3Q8XA 3UGJA 2J7NA 3JR4A 4RKUF 1XHBA 3GLIE 2Z4RA 3MK6A 4MH0E 2XFTA 3VLFB 1SXJA 1V33A 2JWSA 4X62M 1QVRA 4OW0A 1IXRC 5ITRA 1OJLA 3I01M 4GH9A 2FNAA 2C99A 4DV3M 1ZAEA 4OX9M 3GLGB 3QAUA 4R3DA 2YFQA 3HY5A 5F3WA 4JI4M 3U6QA 4UN2B 1R2ZA 1R7RA 5DNYA 1WIVA 4M0DA 5EP4A 3GQ3A 3U5ZB 4LFBM 2CHVA 8CATA 2XZFA 1NNJA 4OVZB 5JI3E 4RNAA 3SASA 1JB0F 2EUCA 2O5RA 4RF1A 3I51A 3U6LA 1L1TA 3NWLA 1P3QQ 4PD2A 4GKJM 3VKHA 2CV1A 1XNQM 3PNVA 3HHXA 1NY6A 4LF8M 1FNNA 5IT9S 2LVAA 5EXXA 2XF3A 4Q7JA 4LJ5A 1DGBA 1PJQA 3T15A 2FFJA 2WSEF 4G4QA 2QHOB 1OQYA 2GQFA 1DGHA 3SC3A 4GC5A 3VKGA 2DWMA 1R6BX 2ZBKB 4XK8F 2KXEA 4AI6A 3CF2A 2GNOA 3VDPA 3FKEA 4IBDA 2JY5A 1QDTA 2VIIA 2C96A 1XXHA 1JR3E 4KODA 4NXMM 3QWLA 3FTEA 3GLGA 1EFUB 4D80A 3J80S 4GEWA 4L78A 3FTDA 5C18A 1E9RA 4JV5M 2R44A 3C3DA 4B3MM 2DAGA 1GVNA 1TH2A 2WZJA 4GHAA 2EKFA 3SMPA 4K0KM 3HHYA 4G4NA 4BLCA 4I4LA 2UUCM 2CUZA 3NBXX 1E32A 4DV6M 1QAOA 4GRIA 4IBGA 1GL6A 3KOYE 1Q3CA 4F1IA 4AW4A 1IXSA 2OOAA 5IREB 5KPZA 2XSZA 3K9OA 3ZH9B 1NV8A 4NOOB 2QBYA 4B3TM 3U6SA 2XZUA 3TWLA 3L2AA 3NBIA 5FTNA 1MJGM 3M7GA 1N36M 1TGUA 1D0MA 3KVWA 3TWKA 1TH3A 2F5SA 4B3SM 2R46A 3B89A 3J7BA 3K1JA 4PDIA 4CISA 3LVVA 1IY1A 1AUAA 1ZMVA 5A2QS 2DHRA 3U6OA 1QZMA 1K3WA 3AFHA 4FD2A 4Z8XA 1YSYA 2DZOB 4PT5A 1VDLA 1YLAA 1VEJA 3F92A 4NSOB 5E6JA 4JI8M 1HNXM 3L25A 3GPYA 3B7NA 2WSFF 1CUKA 3W0FA 1PJJA 4DR2M 4KLNA 4NL4H 2RGHA 3GLIA 4NXNM 4FCVA 5KO3A 7CATA 2KRKA 2ZTDA 2LVQD 2VQEM 2KNZA 4REZA 1R4GA 4MGHA 4R71A 3FTFA 1I4WA 2ZAMA 2L2DA 2OOBA 3SAWA 2O25A 4FW9A 4BB9A 4FWDA 3MJ5A 3RFWA 1IBMM 4CIZA 1ZMWA 2FOIC 3U60B 2FH0A 3GRUA 4LZJA 3VK8A 3VFDA 3GPXA 1NNUC 2CWBA 1XB2B 2NQ8C 3DZDA 5GKNA 1GLNA 4LGYA 4HL4A 2XLJA 2MH8A 1SXJC 1LV7A 2EKKA 5ITTA 3EIHA 2LHGA 1T43A 3K2LA 2DVWB 3KDSE 2HHHM 3DA1A 4JI2M 2QENA 2DWZB 3C9PA 5FLXS 3ILKA 4CGYB 4LJAA 1LTMA 3A42A 4I8OA 4IJFA 2W82A 2F5QA 1EE8A 2MGWA 4DR3M 1GKIA 1PJTA 4L6V6 5BR8M 1NO1A 2E5LM 1Q39A 2UXDM 1N78A 3RE8A 4DV4M 4X64M 3U5ZA 2V1CA 2R4JA 1L8QA 5BPVA 1X37A 4OVZA 3L27A 3ZCBB 1NV9A 3DOAA 3GRYA 1ZMUA 1NHWC 1V34A 3J81S 3A46A 1JR3A 2CRUA 2DZLA 4OU7A 3U61A 2H1RA 4NC6A 2X8AA 2LHCA 1TDZA 2C9CA 3GPPA 1R5LA 1HT2E 4GHLA 2DKLA 4LJ9A 3EIEA 1K3XA 1IBLM 3B74A 4LZZA 2LH0A 4AG5A 1TR8A 3L26A 1HR0M 3FTCA 3HWSA 4M0WA 3KOWE 2VF7A 4II7A 3HU2A 1KYIA 3J2PB 2Z4SA 3FYCA 5EP2A 1MN3A 2Z3XA 1IFYA 3BBZA 2FE8A 4B7GA 2M5ZA 3GQ5A 4EIWA 3AL0C 3V76A 2KRUA 4D81A 2ZM6M 2R65A 2R45A 1D0LA 3KP0E 2QZ4A 3LW5F 2JY8A 3U6DA 2LVPC 3FD9A 2DWLA 4LJ4A 2ZTCA 3BXWA 2JP7A 3WHKA 3K8ZA 4LF5M 3U6MA 2LXEA 3LCVB 5DFLA 3UMMA 1VG5A 4GITA 4Z6YA 4M9SA 1XC8A 3RGSA 1HJPA 1OTRA 2CE7A 2CHQA 2RGOA 5FTKA 3SHFA 1UFZA 2BNKA 2KDLA 2O01F 1PGYA 1OIPA 2B3TA 3W67A 4JI7M 1QANA 3SARA 2KZSA 5LMNM 3H4MA 4MGYE 4DV7M 4WW0A 2OO9A 4LJ8A 4KO8A 5DYIA 4AKIA 1Q3BA 3FUXA 5FTMA 4FWGA 3KFUG 2Q2EB 2C98A 3HX3A 5H37D 4FVMA 4HEOA 4MB7A 2QP9X 3GLHB 3TWMA 1IQPA 2KW0A 3C3EA 2JNHA 1YE9A 5ITXA 2RKOA 4B7HA 1QDRA 1G8PA 1PRBA 4LG2A 1HNZM 4PCZA 4W5WA 4AG6A 2DAEA 1WJ7A 2XGNA 3J27B 1J09A 1L1ZA 1DO2A 2QSFX 2Z8YM 2BJVA 4DV5M 1L2DA 4DR4M 1MU5A 4ZPXA 4DR7M 3KOZE 4DR5M 4MGZE 3LQQA 1TTEA 2OQ4A 4DV0M 1QAMA 3HJSA 3U60A 2VDBB 1HT1E 1IN7A 2Z7JA 4LRSA 5FSWA 2DAKA 3T1HM 1Z5BA 3TQSA 3GLHE 1T3TA 2ERCA 3SHGB 5ITQA 4LRTA 2L7HA 1QUTA 3H4JA 2CFOA 3TPZA 2UXBM 3SATA 1N32M 1Z5AA 1C7YA 3HHZA 1IN8A 1JQJC 1G71A 5E26A 1J5EM 1HNWM 3AV0A 3HU3A 1WGNA 4NRVA 4RF0A 3GO8A 5FTJA 2CP8A 1T6OA 3L29A 1D0KA 3B7QA 5FTLA 3UK6A 3PNYA 3AOEA 3CTWB 4IJEA 1N33M 2UUBM 4S12A 3D8BA 4YY3M 1IN5A 3W0LB 3J7AS 1IN4A 2BWEA 4DBGB 2DENA 1A5TA 3VK7A 4QHSA 3C58A 1ZV1A 3K92A 3FYDA 3LCUA 5C1BA 4B3RM 1I94M 2C9OA 2HL7A 1DGGA 2F5PA 1XWIA 5JI2E 3U6PA 1G59A 5EP3A 2KNVA 3GP1A 4D82A 1WHCA 1V92A 1L2BA 1Z59A 4JYAM 4BBAA 3KW6A 4KT0F 2C5RA 1XNRM 4DUZM 4X65M 1RU3A 2DHYA 3E4RA 4JI3M 2JA2A 3A45A 3FUVA 4R7GA 4WURA 4TUWA 2DI0A 3QYEA 4IBBA 1IN6A 1IY0A 1QZEA 1GL7A 2MJ5B 2MROB 4DV2M 1NVMA 4G4OA 1OFHA 4P16A 4IBIA 2FS1A 2YNMD 1SG9A 1ZQ9A 2HWJA 2JZ1A 3KOXE 1Z6TA 2LNHC 3HJ8A 4GC9A 4QHTA 2VQFM 2UUAM 3OTOM 3KS8A 2DXIA 4L15A 4MM3B 1FJGM 3K9PA 1QAQA 3SMSA 1G4AE 5EJCA 2KA6B 2JUJA 3E21A 4JI6M 2UXCM 3KSJA 1OKSA 2XSZD 4NSRA 4XGIA 4B7FA 1OIZA 2KNAA 3HU1A 4IIWA 2DAIA 3AKZA 2QCUA 4AQYM 3BOSA 1QUSA 3B9PA 1NY5A 1BVSA 3E9SA 2D7GA 4AKGA 2KEBA 2LWXA 2JXNA 3KSXA 1E94E 2K47A 1OFIA 1VEKA 4JI1M 1PJSA 1EIJA 1W5TA 1Q02A 1W5SA 2G3QA 2H5XA 2QQ8A 1PM5A 2G5GX 1OAOC 2D7EA 4FCWA 4MGIE 5EXSA 3GRRA 4FWHA 4CJ6A 4JN6A 1GABA 1GO5A 4ITQA 5KPRA 3ZQJA 1NJGA 4ANRA 3GQ4A 2L7IA 2X4AA 1H6UA 2LBCA 3GLHA 3IG5A 1KSFX 2VF8A 3LQRA 2APLA 4PDGA 2J5YA 3SYLA 3AJIB 3CGWA 4QOZC 1KFVA 3GLFB 4IBKA 4G4RA 1VQ1A 2CV2A 2J7OA 3FUUA 1WR1B 3PXGA 3U6EA 1XMQM 2CV0A 4IBCA 4KHPM 1SXJB 3U61B 3PFIA 1HQCA 4QOSA 4AZFA 4FCTA 3E46A 2YR0A 2CHGA 2R6FA 4GMQA 1PJIA 2DWNA 3R8FA 1GJSA 2F5NA 4IBJA 3I4YA 4P17A 5KQ8A 3QYBA 1TDHA 2HKJA 2JY7A 2LVOC 3SFZA 1N77A 1IBKM 1K82A 4LF4M 4JI0M 3W68A 4LJ6A 2DZNB 2ZANA 1XMOM 4QNMA 1DV0A 4LJ7A 3U6CA 4G6ZA 4M9ZA 3L28A 4AKHA 1L2CA 2QPAA 3GLFE 3RGPA 1HQYE 2L6OA 3THGA 2EJSA 3I04M 4DR1M 2DNAA 2N35A 3VDUA 2R0IA 2Y21A 3GPUA 3AOEC 1SXJE 1E9SA 3IECA 1Z5CA 2LTUA 2R62A 2X49A 3A98B 5EP1A 1OAIA 2CEAA 2F4VM 4Y28F 2F5OA 2I7NA 2KZUA 4WP2A 1TH4A 2LVNC 1JR3D 1Y8GA 1SXJD 3CF6E 4JXJA 2HCBA 4YHHM 5LMUM 3LVWA 3B7ZA 3HHWA 1DGHB 2R18A 4M9XA 1IY2A 3CF0A 4JI5M 3ZC7B 3FRHA 4F2LA 2WSCF 2V6ZM 2QNJA 1F4IA 3MMPA 4XBOA 3SBJA 1R2YA 1WXQA 2HAKA 4G3OA 3UZUA 5DYGA 3JR5A 4LCBA 2M60A 1XXHB 4L4UA 2XFSA 3GRVA 2L4EA 3PVSA 1IXZA
chains in the Genus database with same CATH topology
4DR6M 2G8LA 3DFZA 5EQTA 5IWAM 1C1KA 1D2NA 1DO0A 1DGFA 4IBFA 5EXTA 4DV1M 1N34M 1J7KA 1VDDA 3M0EA 4LF9M 4CHTB 3AOGA 3TE6A 1G3IA 2Y20A 1YUBA 5ITUA 3T1YM 4DUYM 3T38A 1IXSB 5KQDA 2XH9A 4A3VB 2QBYB 3SYKA 2XEPA 3KP1E 4LF7M 2Y0TA 3HGIA 4IBEA 3M6AA 4LFAM 3D8LA 5KPTA 2D7HA 1UM8A 2P5TA 1IM2A 3IG8A 1MX0A 3FUTA 4LF6M 1N75A 3KXEC 2L09A 4I81A 2EO2A 2R4EA 5ITXE 5EXPA 3KS4A 3GLIB 5ITYA 3FUWA 1S3SA 1ORYB 4HLQA 1QQWA 3UJNA 3JAMS 4GKKM 2BJWA 2YQZA 2EA0A 4LFCM 4NRWA 1G41A 4X66M 3MHVC 5IZ7D 1NSFA 2AHMA 3HKPA 3HJQA 4I5SA 2V1UA 4MGKE 3LMMA 3SAVA 4QNRA 4GIPA 1NHGC 2A5YB 4L16A 3TL4X 3WHLA 2I7PA 2Y0QA 4L8RC 1QYRA 2OPFA 4LGMA 3SAUA 3R9XB 3I4VA 1NJFA 2ZAOA 4B08A 2UU9M 3GLFA 3Q8XA 3UGJA 2J7NA 3JR4A 1XHBA 2Z4RA 3MK6A 4MH0E 2XFTA 3VLFB 1SXJA 4X62M 1QVRA 4OW0A 1IXRC 5ITRA 1OJLA 4GH9A 2FNAA 2C99A 4DV3M 1ZAEA 4OX9M 3GLGB 3QAUA 4R3DA 2YFQA 5F3WA 4JI4M 3U6QA 1R2ZA 1R7RA 5DNYA 3GQ3A 4M0DA 5EP4A 3U5ZB 4LFBM 2CHVA 8CATA 2XZFA 1NNJA 4OVZB 5JI3E 4RNAA 3SASA 2EUCA 2O5RA 4RF1A 3I51A 3U6LA 1L1TA 3NWLA 3VKHA 4PD2A 4GKJM 2CV1A 1XNQM 3PNVA 3HHXA 1NY6A 4LF8M 1FNNA 5IT9S 5EXXA 2XF3A 4LJ5A 1DGBA 3T15A 2FFJA 4G4QA 1DGHA 3SC3A 4GC5A 3VKGA 2DWMA 1R6BX 2ZBKB 2KXEA 4AI6A 3CF2A 3VDPA 3FKEA 4IBDA 2VIIA 2C96A 1XXHA 4KODA 4NXMM 3FTEA 3QWLA 3GLGA 4D80A 3J80S 4L78A 3FTDA 5C18A 1E9RA 4JV5M 4B3MM 1GVNA 1TH2A 4GHAA 3SMPA 4K0KM 3HHYA 4G4NA 4BLCA 4I4LA 2UUCM 2CUZA 1E32A 4DV6M 1QAOA 4GRIA 4IBGA 1GL6A 3KOYE 1Q3CA 4AW4A 5IREB 5KPZA 2XSZA 3ZH9B 2QBYA 4NOOB 4B3TM 3U6SA 2XZUA 3TWLA 3L2AA 3NBIA 5FTNA 3M7GA 1N36M 1TGUA 3TWKA 3KVWA 2F5SA 1TH3A 4B3SM 2R46A 3J7BA 3K1JA 4PDIA 4CISA 3LVVA 1IY1A 5A2QS 3U6OA 2DHRA 1K3WA 1QZMA 3AFHA 4FD2A 4Z8XA 1YSYA 2DZOB 4PT5A 4NSOB 5E6JA 4JI8M 1HNXM 3L25A 3GPYA 3W0FA 1PJJA 4DR2M 4KLNA 4NL4H 2RGHA 3GLIA 4NXNM 4FCVA 5KO3A 7CATA 2KRKA 2VQEM 4REZA 4MGHA 3FTFA 1I4WA 2ZAMA 3SAWA 4FW9A 4BB9A 4FWDA 3MJ5A 3RFWA 1IBMM 3U60B 2FOIC 3GRUA 4LZJA 3VK8A 3VFDA 3GPXA 1NNUC 2NQ8C 5GKNA 3DZDA 1GLNA 4LGYA 4HL4A 2XLJA 1SXJC 1LV7A 5ITTA 3EIHA 3K2LA 2DVWB 3KDSE 2HHHM 3DA1A 4JI2M 2QENA 2DWZB 5FLXS 3ILKA 4CGYB 4LJAA 3A42A 4I8OA 4IJFA 2W82A 2F5QA 1EE8A 4DR3M 1GKIA 5BR8M 2E5LM 2UXDM 1Q39A 1N78A 3RE8A 4DV4M 4X64M 3U5ZA 2V1CA 2R4JA 1L8QA 5BPVA 1X37A 4OVZA 3L27A 3ZCBB 3DOAA 3GRYA 1NHWC 3J81S 3A46A 1JR3A 1TDZA 3U61A 4OU7A 4KHPM 2H1RA 2X8AA 2C9CA 3GPPA 1HT2E 4GHLA 4LJ9A 3EIEA 1K3XA 1IBLM 4LZZA 2LH0A 4AG5A 3L26A 1HR0M 3FTCA 3HWSA 4M0WA 3KOWE 4II7A 3HU2A 3J2PB 1KYIA 2Z4SA 3FYCA 5EP2A 2Z3XA 2FE8A 4B7GA 2M5ZA 3GQ5A 4EIWA 3AL0C 2KRUA 4D81A 2ZM6M 2R65A 2R45A 3KP0E 3U6DA 2QZ4A 2DWLA 3FD9A 4LJ4A 3WHKA 3K8ZA 4LF5M 3U6MA 2LXEA 3UMMA 4GITA 4Z6YA 4M9SA 1XC8A 3RGSA 2CE7A 2CHQA 2RGOA 5FTKA 3SHFA 2BNKA 4JI7M 1QANA 3SARA 2KZSA 5LMNM 3H4MA 4MGYE 4DV7M 4WW0A 4LJ8A 4KO8A 5DYIA 4AKIA 1Q3BA 3FUXA 5FTMA 4FWGA 3KFUG 2Q2EB 2C98A 5H37D 4FVMA 4MB7A 2QP9X 3GLHB 3TWMA 1IQPA 2KW0A 1YE9A 5ITXA 2RKOA 4B7HA 1G8PA 4LG2A 1HNZM 4PCZA 4W5WA 4AG6A 2XGNA 3J27B 1J09A 1L1ZA 1DO2A 4DR4M 2BJVA 4DV5M 1L2DA 1MU5A 4ZPXA 4DR7M 3KOZE 4DR5M 4MGZE 3LQQA 2OQ4A 4DV0M 1QAMA 3HJSA 3U60A 3T1HM 1HT1E 1IN7A 2Z7JA 4LRSA 5FSWA 1Z5BA 3TQSA 1T3TA 2ERCA 3SHGB 5ITQA 4LRTA 2L7HA 2UXBM 2CFOA 3TPZA 3SATA 1N32M 1Z5AA 3HHZA 1IN8A 1JQJC 5E26A 1J5EM 1HNWM 3AV0A 3HU3A 4NRVA 4RF0A 3GO8A 5FTJA 3L29A 5FTLA 3UK6A 3PNYA 3AOEA 3CTWB 4IJEA 1N33M 2UUBM 4S12A 3D8BA 4YY3M 1IN5A 3W0LB 3J7AS 1IN4A 3VK7A 4QHSA 3C58A 4B3RM 3K92A 3FYDA 5C1BA 1I94M 2C9OA 1DGGA 2HL7A 2F5PA 1XWIA 5JI2E 3U6PA 1G59A 5EP3A 3GP1A 4D82A 1L2BA 4JYAM 1Z59A 4BBAA 3KW6A 2C5RA 1XNRM 4DUZM 4X65M 3E4RA 4JI3M 2JA2A 3A45A 3FUVA 4R7GA 4WURA 4TUWA 4IBBA 1IN6A 1IY0A 4DV2M 1GL7A 4G4OA 1NVMA 1OFHA 4P16A 4IBIA 2YNMD 1ZQ9A 3KOXE 4GC9A 1Z6TA 2LNHC 3HJ8A 4QHTA 2VQFM 2UUAM 3OTOM 3KS8A 2DXIA 4L15A 4MM3B 1FJGM 1QAQA 3SMSA 1G4AE 5EJCA 2KA6B 4JI6M 2UXCM 3KSJA 4B7FA 2XSZD 4NSRA 4XGIA 3HU1A 3AKZA 4IIWA 4AQYM 2QCUA 3BOSA 3B9PA 1NY5A 3E9SA 2D7GA 4AKGA 2KEBA 2LWXA 3KSXA 1E94E 2K47A 1OFIA 4JI1M 1W5TA 1W5SA 1PM5A 2G5GX 4FCWA 2D7EA 4MGIE 5EXSA 3GRRA 4FWHA 4JN6A 4ITQA 5KPRA 1NJGA 3GQ4A 2L7IA 2X4AA 1H6UA 3GLHA 3IG5A 1KSFX 3LQRA 4PDGA 3SYLA 3AJIB 4QOZC 1KFVA 3GLFB 4IBKA 4G4RA 2CV2A 2J7OA 3FUUA 3PXGA 3U6EA 1XMQM 2CV0A 4IBCA 1SXJB 3U61B 3PFIA 1HQCA 4QOSA 4AZFA 4FCTA 2YR0A 2CHGA 4GMQA 1PJIA 2DWNA 3R8FA 2F5NA 4IBJA 3I4YA 5KQ8A 1TDHA 2HKJA 3SFZA 1N77A 1IBKM 1K82A 4LF4M 4JI0M 4LJ6A 2DZNB 2ZANA 1XMOM 4QNMA 4LJ7A 3U6CA 4G6ZA 4M9ZA 3L28A 4AKHA 1L2CA 2QPAA 3RGPA 1HQYE 2L6OA 3THGA 4DR1M 3VDUA 2Y21A 3GPUA 3AOEC 1SXJE 1E9SA 1Z5CA 2R62A 2X49A 3A98B 5EP1A 2CEAA 2F4VM 2F5OA 2I7NA 2KZUA 1TH4A 1JR3D 4YHHM 1SXJD 3CF6E 4JXJA 2HCBA 5LMUM 3LVWA 3HHWA 1DGHB 2R18A 4M9XA 1IY2A 3CF0A 4JI5M 3ZC7B 2V6ZM 4XBOA 3SBJA 1R2YA 1WXQA 3UZUA 5DYGA 3JR5A 4LCBA 2M60A 1XXHB 4L4UA 2XFSA 3GRVA 4LY6A 3PVSA 1IXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OFH A;  2VII A;  5EP2 A;  2C96 A;  1XXH A;  4KOD A;  5EQT A;  4QHT A;  3GLG A;  1C1K A;  1D2N A;  1DO0 A;  4D80 A;  5EXT A;  4EIW A;  5C18 A;  4D81 A;  1J7K A;  3M0E A;  2R65 A;  4L15 A;  2QZ4 A;  1G4A E;  1G3I A;  4LJ4 A;  3WHK A;  1IXS B;  4I4L A;  4A3V B;  2QBY B;  1E32 A;  3SYK A;  4GIT A;  2XSZ D;  2CE7 A;  3HU1 A;  2CHQ A;  2XSZ A;  5FTK A;  3ZH9 B;  2QBY A;  3BOS A;  3M6A A;  3B9P A;  1NY5 A;  5FTN A;  1UM8 A;  1IM2 A;  1E94 E;  3H4M A;  3K1J A;  4WW0 A;  1IY1 A;  1OFI A;  4LJ8 A;  2DHR A;  1QZM A;  4KO8 A;  4FD2 A;  4I81 A;  4Z8X A;  5DYI A;  2DZO B;  1W5T A;  5FTM A;  4FWG A;  5EXP A;  1W5S A;  3GLI B;  4FCW A;  2C98 A;  1S3S A;  5EXS A;  4FWH A;  4JN6 A;  2BJW A;  2QP9 X;  3GLH B;  4KLN A;  1G41 A;  1NJG A;  1IQP A;  3MHV C;  3GLI A;  1NSF A;  4FCV A;  2V1U A;  3GLH A;  2KRK A;  1KSF X;  2RKO A;  4QNR A;  2ZAM A;  4FW9 A;  3SYL A;  3AJI B;  4FWD A;  4L16 A;  3WHL A;  3GLF B;  1DO2 A;  2BJV A;  4LGM A;  3U60 B;  4ZPX A;  1NJF A;  2ZAO A;  3PXG A;  3GLF A;  1SXJ B;  3U61 B;  3PFI A;  1HQC A;  4QOS A;  3VFD A;  4FCT A;  1HT1 E;  1IN7 A;  4LRS A;  2Z4R A;  3DZD A;  2CHG A;  3VLF B;  3R8F A;  1SXJ A;  1SXJ C;  1LV7 A;  4LRT A;  3EIH A;  1QVR A;  1IXR C;  2DVW B;  3KDS E;  1IN8 A;  1JQJ C;  1OJL A;  2QEN A;  2DWZ B;  2FNA A;  2C99 A;  2DZN B;  2ZAN A;  4LJ6 A;  4QNM A;  4LJ7 A;  3HU3 A;  4LJA A;  3GLG B;  5FTJ A;  1R7R A;  2QPA A;  5EP4 A;  1HQY E;  5FTL A;  3U5Z B;  3UK6 A;  2CHV A;  1SXJ E;  5JI3 E;  3D8B A;  2R62 A;  1IN5 A;  5EP1 A;  1IN4 A;  2CEA A;  1L8Q A;  4QHS A;  1X37 A;  5C1B A;  2C9O A;  1NY6 A;  1FNN A;  1JR3 D;  1SXJ D;  1XWI A;  5EXX A;  2HCB A;  4LJ5 A;  5JI2 E;  1JR3 A;  5EP3 A;  1IY2 A;  2X8A A;  3CF0 A;  2C9C A;  4D82 A;  2V6Z M;  1HT2 E;  3KW6 A;  4LJ9 A;  3EIE A;  3SC3 A;  4LZZ A;  1R6B X;  3CF2 A;  5DYG A;  3HWS A;  4LCB A;  1XXH B;  4L4U A;  1IN6 A;  1IY0 A;  3HU2 A;  4LY6 A;  3PVS A;  1KYI A;  1NVM A;  2Z4S A;  1IXZ A; 
#chains in the Genus database with same CATH topology
 3HZJ A;  4DR6 M;  2K9D A;  2G8L A;  3DFZ A;  5EQT A;  5IWA M;  1TF0 B;  1C1K A;  2MR9 A;  1D2N A;  1DO0 A;  1AIP C;  1DGF A;  4IBF A;  5EXT A;  4DV1 M;  1N34 M;  1J7K A;  1VDD A;  3M0E A;  4LF9 M;  4CHT B;  3AOG A;  3TE6 A;  1G3I A;  2Y20 A;  1YUB A;  5ITU A;  3T1Y M;  4DUY M;  3T38 A;  1IXS B;  5KQD A;  2XH9 A;  4A3V B;  2DAM A;  2QBY B;  2BWB A;  3SYK A;  2XEP A;  3KP1 E;  4LF7 M;  2Y0T A;  1VEG A;  1XXH E;  3HGI A;  4IBE A;  3M6A A;  4LFA M;  3GLG E;  3D8L A;  5KPT A;  5L8R F;  2D7H A;  2JY6 B;  1UM8 A;  2P5T A;  1IM2 A;  2K0B X;  3IG8 A;  2L4F A;  1WGL A;  1MX0 A;  3FUT A;  4LF6 M;  1N75 A;  3KXE C;  2L09 A;  1GJT A;  4LY6 A;  4I81 A;  2EO2 A;  2R4E A;  5ITX E;  5EXP A;  3KS4 A;  3GLI B;  5ITY A;  2JZ0 A;  3FUW A;  1S3S A;  1ORY B;  4HLQ A;  1QQW A;  3UJN A;  3JAM S;  4GKK M;  2BJW A;  2YQZ A;  3Q8G A;  2EA0 A;  4LFC M;  4NRW A;  1G41 A;  4X66 M;  3MHV C;  5IZ7 D;  1NSF A;  2AHM A;  3FE3 A;  3HKP A;  3HJQ A;  4I5S A;  2V1U A;  4MGK E;  3LMM A;  3SAV A;  4QNR A;  2KHH A;  4GIP A;  1NHG C;  2RRU A;  2A5Y B;  4L16 A;  3TL4 X;  2K6B A;  3WHL A;  2I7P A;  2Y0Q A;  4L8R C;  1QYR A;  3T6P A;  2OPF A;  3IHP A;  4LGM A;  3SAU A;  3I4V A;  3R9X B;  1NJF A;  2ZAO A;  4B08 A;  3FRI A;  2UU9 M;  3GLF A;  3Q8X A;  3UGJ A;  2J7N A;  3JR4 A;  4RKU F;  1XHB A;  3GLI E;  2Z4R A;  3MK6 A;  4MH0 E;  2XFT A;  3VLF B;  1SXJ A;  1V33 A;  2JWS A;  4X62 M;  1QVR A;  4OW0 A;  1IXR C;  5ITR A;  1OJL A;  3I01 M;  4GH9 A;  2FNA A;  2C99 A;  4DV3 M;  1ZAE A;  4OX9 M;  3GLG B;  3QAU A;  4R3D A;  2YFQ A;  3HY5 A;  5F3W A;  4JI4 M;  3U6Q A;  4UN2 B;  1R2Z A;  1R7R A;  5DNY A;  1WIV A;  4M0D A;  5EP4 A;  3GQ3 A;  3U5Z B;  4LFB M;  2CHV A;  8CAT A;  2XZF A;  1NNJ A;  4OVZ B;  5JI3 E;  4RNA A;  3SAS A;  1JB0 F;  2EUC A;  2O5R A;  4RF1 A;  3I51 A;  3U6L A;  1L1T A;  3NWL A;  1P3Q Q;  4PD2 A;  4GKJ M;  3VKH A;  2CV1 A;  1XNQ M;  3PNV A;  3HHX A;  1NY6 A;  4LF8 M;  1FNN A;  5IT9 S;  2LVA A;  5EXX A;  2XF3 A;  4Q7J A;  4LJ5 A;  1DGB A;  1PJQ A;  3T15 A;  2FFJ A;  2WSE F;  4G4Q A;  2QHO B;  1OQY A;  2GQF A;  1DGH A;  3SC3 A;  4GC5 A;  3VKG A;  2DWM A;  1R6B X;  2ZBK B;  4XK8 F;  2KXE A;  4AI6 A;  3CF2 A;  2GNO A;  3VDP A;  3FKE A;  4IBD A;  2JY5 A;  1QDT A;  2VII A;  2C96 A;  1XXH A;  1JR3 E;  4KOD A;  4NXM M;  3QWL A;  3FTE A;  3GLG A;  1EFU B;  4D80 A;  3J80 S;  4GEW A;  4L78 A;  3FTD A;  5C18 A;  1E9R A;  4JV5 M;  2R44 A;  3C3D A;  4B3M M;  2DAG A;  1GVN A;  1TH2 A;  2WZJ A;  4GHA A;  2EKF A;  3SMP A;  4K0K M;  3HHY A;  4G4N A;  4BLC A;  4I4L A;  2UUC M;  2CUZ A;  3NBX X;  1E32 A;  4DV6 M;  1QAO A;  4GRI A;  4IBG A;  1GL6 A;  3KOY E;  1Q3C A;  4F1I A;  4AW4 A;  1IXS A;  2OOA A;  5IRE B;  5KPZ A;  2XSZ A;  3K9O A;  3ZH9 B;  1NV8 A;  4NOO B;  2QBY A;  4B3T M;  3U6S A;  2XZU A;  3TWL A;  3L2A A;  3NBI A;  5FTN A;  1MJG M;  3M7G A;  1N36 M;  1TGU A;  1D0M A;  3KVW A;  3TWK A;  1TH3 A;  2F5S A;  4B3S M;  2R46 A;  3B89 A;  3J7B A;  3K1J A;  4PDI A;  4CIS A;  3LVV A;  1IY1 A;  1AUA A;  1ZMV A;  5A2Q S;  2DHR A;  3U6O A;  1QZM A;  1K3W A;  3AFH A;  4FD2 A;  4Z8X A;  1YSY A;  2DZO B;  4PT5 A;  1VDL A;  1YLA A;  1VEJ A;  3F92 A;  4NSO B;  5E6J A;  4JI8 M;  1HNX M;  3L25 A;  3GPY A;  3B7N A;  2WSF F;  1CUK A;  3W0F A;  1PJJ A;  4DR2 M;  4KLN A;  4NL4 H;  2RGH A;  3GLI A;  4NXN M;  4FCV A;  5KO3 A;  7CAT A;  2KRK A;  2ZTD A;  2LVQ D;  2VQE M;  2KNZ A;  4REZ A;  1R4G A;  4MGH A;  4R71 A;  3FTF A;  1I4W A;  2ZAM A;  2L2D A;  2OOB A;  3SAW A;  2O25 A;  4FW9 A;  4BB9 A;  4FWD A;  3MJ5 A;  3RFW A;  1IBM M;  4CIZ A;  1ZMW A;  2FOI C;  3U60 B;  2FH0 A;  3GRU A;  4LZJ A;  3VK8 A;  3VFD A;  3GPX A;  1NNU C;  2CWB A;  1XB2 B;  2NQ8 C;  3DZD A;  5GKN A;  1GLN A;  4LGY A;  4HL4 A;  2XLJ A;  2MH8 A;  1SXJ C;  1LV7 A;  2EKK A;  5ITT A;  3EIH A;  2LHG A;  1T43 A;  3K2L A;  2DVW B;  3KDS E;  2HHH M;  3DA1 A;  4JI2 M;  2QEN A;  2DWZ B;  3C9P A;  5FLX S;  3ILK A;  4CGY B;  4LJA A;  1LTM A;  3A42 A;  4I8O A;  4IJF A;  2W82 A;  2F5Q A;  1EE8 A;  2MGW A;  4DR3 M;  1GKI A;  1PJT A;  4L6V 6;  5BR8 M;  1NO1 A;  2E5L M;  1Q39 A;  2UXD M;  1N78 A;  3RE8 A;  4DV4 M;  4X64 M;  3U5Z A;  2V1C A;  2R4J A;  1L8Q A;  5BPV A;  1X37 A;  4OVZ A;  3L27 A;  3ZCB B;  1NV9 A;  3DOA A;  3GRY A;  1ZMU A;  1NHW C;  1V34 A;  3J81 S;  3A46 A;  1JR3 A;  2CRU A;  2DZL A;  4OU7 A;  3U61 A;  2H1R A;  4NC6 A;  2X8A A;  2LHC A;  1TDZ A;  2C9C A;  3GPP A;  1R5L A;  1HT2 E;  4GHL A;  2DKL A;  4LJ9 A;  3EIE A;  1K3X A;  1IBL M;  3B74 A;  4LZZ A;  2LH0 A;  4AG5 A;  1TR8 A;  3L26 A;  1HR0 M;  3FTC A;  3HWS A;  4M0W A;  3KOW E;  2VF7 A;  4II7 A;  3HU2 A;  1KYI A;  3J2P B;  2Z4S A;  3FYC A;  5EP2 A;  1MN3 A;  2Z3X A;  1IFY A;  3BBZ A;  2FE8 A;  4B7G A;  2M5Z A;  3GQ5 A;  4EIW A;  3AL0 C;  3V76 A;  2KRU A;  4D81 A;  2ZM6 M;  2R65 A;  2R45 A;  1D0L A;  3KP0 E;  2QZ4 A;  3LW5 F;  2JY8 A;  3U6D A;  2LVP C;  3FD9 A;  2DWL A;  4LJ4 A;  2ZTC A;  3BXW A;  2JP7 A;  3WHK A;  3K8Z A;  4LF5 M;  3U6M A;  2LXE A;  3LCV B;  5DFL A;  3UMM A;  1VG5 A;  4GIT A;  4Z6Y A;  4M9S A;  1XC8 A;  3RGS A;  1HJP A;  1OTR A;  2CE7 A;  2CHQ A;  2RGO A;  5FTK A;  3SHF A;  1UFZ A;  2BNK A;  2KDL A;  2O01 F;  1PGY A;  1OIP A;  2B3T A;  3W67 A;  4JI7 M;  1QAN A;  3SAR A;  2KZS A;  5LMN M;  3H4M A;  4MGY E;  4DV7 M;  4WW0 A;  2OO9 A;  4LJ8 A;  4KO8 A;  5DYI A;  4AKI A;  1Q3B A;  3FUX A;  5FTM A;  4FWG A;  3KFU G;  2Q2E B;  2C98 A;  3HX3 A;  5H37 D;  4FVM A;  4HEO A;  4MB7 A;  2QP9 X;  3GLH B;  3TWM A;  1IQP A;  2KW0 A;  3C3E A;  2JNH A;  1YE9 A;  5ITX A;  2RKO A;  4B7H A;  1QDR A;  1G8P A;  1PRB A;  4LG2 A;  1HNZ M;  4PCZ A;  4W5W A;  4AG6 A;  2DAE A;  1WJ7 A;  2XGN A;  3J27 B;  1J09 A;  1L1Z A;  1DO2 A;  2QSF X;  2Z8Y M;  2BJV A;  4DV5 M;  1L2D A;  4DR4 M;  1MU5 A;  4ZPX A;  4DR7 M;  3KOZ E;  4DR5 M;  4MGZ E;  3LQQ A;  1TTE A;  2OQ4 A;  4DV0 M;  1QAM A;  3HJS A;  3U60 A;  2VDB B;  1HT1 E;  1IN7 A;  2Z7J A;  4LRS A;  5FSW A;  2DAK A;  3T1H M;  1Z5B A;  3TQS A;  3GLH E;  1T3T A;  2ERC A;  3SHG B;  5ITQ A;  4LRT A;  2L7H A;  1QUT A;  3H4J A;  2CFO A;  3TPZ A;  2UXB M;  3SAT A;  1N32 M;  1Z5A A;  1C7Y A;  3HHZ A;  1IN8 A;  1JQJ C;  1G71 A;  5E26 A;  1J5E M;  1HNW M;  3AV0 A;  3HU3 A;  1WGN A;  4NRV A;  4RF0 A;  3GO8 A;  5FTJ A;  2CP8 A;  1T6O A;  3L29 A;  1D0K A;  3B7Q A;  5FTL A;  3UK6 A;  3PNY A;  3AOE A;  3CTW B;  4IJE A;  1N33 M;  2UUB M;  4S12 A;  3D8B A;  4YY3 M;  1IN5 A;  3W0L B;  3J7A S;  1IN4 A;  2BWE A;  4DBG B;  2DEN A;  1A5T A;  3VK7 A;  4QHS A;  3C58 A;  1ZV1 A;  3K92 A;  3FYD A;  3LCU A;  5C1B A;  4B3R M;  1I94 M;  2C9O A;  2HL7 A;  1DGG A;  2F5P A;  1XWI A;  5JI2 E;  3U6P A;  1G59 A;  5EP3 A;  2KNV A;  3GP1 A;  4D82 A;  1WHC A;  1V92 A;  1L2B A;  1Z59 A;  4JYA M;  4BBA A;  3KW6 A;  4KT0 F;  2C5R A;  1XNR M;  4DUZ M;  4X65 M;  1RU3 A;  2DHY A;  3E4R A;  4JI3 M;  2JA2 A;  3A45 A;  3FUV A;  4R7G A;  4WUR A;  4TUW A;  2DI0 A;  3QYE A;  4IBB A;  1IN6 A;  1IY0 A;  1QZE A;  1GL7 A;  2MJ5 B;  2MRO B;  4DV2 M;  1NVM A;  4G4O A;  1OFH A;  4P16 A;  4IBI A;  2FS1 A;  2YNM D;  1SG9 A;  1ZQ9 A;  2HWJ A;  2JZ1 A;  3KOX E;  1Z6T A;  2LNH C;  3HJ8 A;  4GC9 A;  4QHT A;  2VQF M;  2UUA M;  3OTO M;  3KS8 A;  2DXI A;  4L15 A;  4MM3 B;  1FJG M;  3K9P A;  1QAQ A;  3SMS A;  1G4A E;  5EJC A;  2KA6 B;  2JUJ A;  3E21 A;  4JI6 M;  2UXC M;  3KSJ A;  1OKS A;  2XSZ D;  4NSR A;  4XGI A;  4B7F A;  1OIZ A;  2KNA A;  3HU1 A;  4IIW A;  2DAI A;  3AKZ A;  2QCU A;  4AQY M;  3BOS A;  1QUS A;  3B9P A;  1NY5 A;  1BVS A;  3E9S A;  2D7G A;  4AKG A;  2KEB A;  2LWX A;  2JXN A;  3KSX A;  1E94 E;  2K47 A;  1OFI A;  1VEK A;  4JI1 M;  1PJS A;  1EIJ A;  1W5T A;  1Q02 A;  1W5S A;  2G3Q A;  2H5X A;  2QQ8 A;  1PM5 A;  2G5G X;  1OAO C;  2D7E A;  4FCW A;  4MGI E;  5EXS A;  3GRR A;  4FWH A;  4CJ6 A;  4JN6 A;  1GAB A;  1GO5 A;  4ITQ A;  5KPR A;  3ZQJ A;  1NJG A;  4ANR A;  3GQ4 A;  2L7I A;  2X4A A;  1H6U A;  2LBC A;  3GLH A;  3IG5 A;  1KSF X;  2VF8 A;  3LQR A;  2APL A;  4PDG A;  2J5Y A;  3SYL A;  3AJI B;  3CGW A;  4QOZ C;  1KFV A;  3GLF B;  4IBK A;  4G4R A;  1VQ1 A;  2CV2 A;  2J7O A;  3FUU A;  1WR1 B;  3PXG A;  3U6E A;  1XMQ M;  2CV0 A;  4IBC A;  4KHP M;  1SXJ B;  3U61 B;  3PFI A;  1HQC A;  4QOS A;  4AZF A;  4FCT A;  3E46 A;  2YR0 A;  2CHG A;  2R6F A;  4GMQ A;  1PJI A;  2DWN A;  3R8F A;  1GJS A;  2F5N A;  4IBJ A;  3I4Y A;  4P17 A;  5KQ8 A;  3QYB A;  1TDH A;  2HKJ A;  2JY7 A;  2LVO C;  3SFZ A;  1N77 A;  1IBK M;  1K82 A;  4LF4 M;  4JI0 M;  3W68 A;  4LJ6 A;  2DZN B;  2ZAN A;  1XMO M;  4QNM A;  1DV0 A;  4LJ7 A;  3U6C A;  4G6Z A;  4M9Z A;  3L28 A;  4AKH A;  1L2C A;  2QPA A;  3GLF E;  3RGP A;  1HQY E;  2L6O A;  3THG A;  2EJS A;  3I04 M;  4DR1 M;  2DNA A;  2N35 A;  3VDU A;  2R0I A;  2Y21 A;  3GPU A;  3AOE C;  1SXJ E;  1E9S A;  3IEC A;  1Z5C A;  2LTU A;  2R62 A;  2X49 A;  3A98 B;  5EP1 A;  1OAI A;  2CEA A;  2F4V M;  4Y28 F;  2F5O A;  2I7N A;  2KZU A;  4WP2 A;  1TH4 A;  2LVN C;  1JR3 D;  1Y8G A;  1SXJ D;  3CF6 E;  4JXJ A;  2HCB A;  4YHH M;  5LMU M;  3LVW A;  3B7Z A;  3HHW A;  1DGH B;  2R18 A;  4M9X A;  1IY2 A;  3CF0 A;  4JI5 M;  3ZC7 B;  3FRH A;  4F2L A;  2WSC F;  2V6Z M;  2QNJ A;  1F4I A;  3MMP A;  4XBO A;  3SBJ A;  1R2Y A;  1WXQ A;  2HAK A;  4G3O A;  3UZU A;  5DYG A;  3JR5 A;  4LCB A;  2M60 A;  1XXH B;  4L4U A;  2XFS A;  3GRV A;  2L4E A;  3PVS A;  1IXZ A; 
#chains in the Genus database with same CATH homology
 4DR6 M;  2G8L A;  3DFZ A;  5EQT A;  5IWA M;  1C1K A;  1D2N A;  1DO0 A;  1DGF A;  4IBF A;  5EXT A;  4DV1 M;  1N34 M;  1J7K A;  1VDD A;  3M0E A;  4LF9 M;  4CHT B;  3AOG A;  3TE6 A;  1G3I A;  2Y20 A;  1YUB A;  5ITU A;  3T1Y M;  4DUY M;  3T38 A;  1IXS B;  5KQD A;  2XH9 A;  4A3V B;  2QBY B;  3SYK A;  2XEP A;  3KP1 E;  4LF7 M;  2Y0T A;  3HGI A;  4IBE A;  3M6A A;  4LFA M;  3D8L A;  5KPT A;  2D7H A;  1UM8 A;  2P5T A;  1IM2 A;  3IG8 A;  1MX0 A;  3FUT A;  4LF6 M;  1N75 A;  3KXE C;  2L09 A;  4I81 A;  2EO2 A;  2R4E A;  5ITX E;  5EXP A;  3KS4 A;  3GLI B;  5ITY A;  3FUW A;  1S3S A;  1ORY B;  4HLQ A;  1QQW A;  3UJN A;  3JAM S;  4GKK M;  2BJW A;  2YQZ A;  2EA0 A;  4LFC M;  4NRW A;  1G41 A;  4X66 M;  3MHV C;  5IZ7 D;  1NSF A;  2AHM A;  3HKP A;  3HJQ A;  4I5S A;  2V1U A;  4MGK E;  3LMM A;  3SAV A;  4QNR A;  4GIP A;  1NHG C;  2A5Y B;  4L16 A;  3TL4 X;  3WHL A;  2I7P A;  2Y0Q A;  4L8R C;  1QYR A;  2OPF A;  4LGM A;  3SAU A;  3R9X B;  3I4V A;  1NJF A;  2ZAO A;  4B08 A;  2UU9 M;  3GLF A;  3Q8X A;  3UGJ A;  2J7N A;  3JR4 A;  1XHB A;  2Z4R A;  3MK6 A;  4MH0 E;  2XFT A;  3VLF B;  1SXJ A;  4X62 M;  1QVR A;  4OW0 A;  1IXR C;  5ITR A;  1OJL A;  4GH9 A;  2FNA A;  2C99 A;  4DV3 M;  1ZAE A;  4OX9 M;  3GLG B;  3QAU A;  4R3D A;  2YFQ A;  5F3W A;  4JI4 M;  3U6Q A;  1R2Z A;  1R7R A;  5DNY A;  3GQ3 A;  4M0D A;  5EP4 A;  3U5Z B;  4LFB M;  2CHV A;  8CAT A;  2XZF A;  1NNJ A;  4OVZ B;  5JI3 E;  4RNA A;  3SAS A;  2EUC A;  2O5R A;  4RF1 A;  3I51 A;  3U6L A;  1L1T A;  3NWL A;  3VKH A;  4PD2 A;  4GKJ M;  2CV1 A;  1XNQ M;  3PNV A;  3HHX A;  1NY6 A;  4LF8 M;  1FNN A;  5IT9 S;  5EXX A;  2XF3 A;  4LJ5 A;  1DGB A;  3T15 A;  2FFJ A;  4G4Q A;  1DGH A;  3SC3 A;  4GC5 A;  3VKG A;  2DWM A;  1R6B X;  2ZBK B;  2KXE A;  4AI6 A;  3CF2 A;  3VDP A;  3FKE A;  4IBD A;  2VII A;  2C96 A;  1XXH A;  4KOD A;  4NXM M;  3FTE A;  3QWL A;  3GLG A;  4D80 A;  3J80 S;  4L78 A;  3FTD A;  5C18 A;  1E9R A;  4JV5 M;  4B3M M;  1GVN A;  1TH2 A;  4GHA A;  3SMP A;  4K0K M;  3HHY A;  4G4N A;  4BLC A;  4I4L A;  2UUC M;  2CUZ A;  1E32 A;  4DV6 M;  1QAO A;  4GRI A;  4IBG A;  1GL6 A;  3KOY E;  1Q3C A;  4AW4 A;  5IRE B;  5KPZ A;  2XSZ A;  3ZH9 B;  2QBY A;  4NOO B;  4B3T M;  3U6S A;  2XZU A;  3TWL A;  3L2A A;  3NBI A;  5FTN A;  3M7G A;  1N36 M;  1TGU A;  3TWK A;  3KVW A;  2F5S A;  1TH3 A;  4B3S M;  2R46 A;  3J7B A;  3K1J A;  4PDI A;  4CIS A;  3LVV A;  1IY1 A;  5A2Q S;  3U6O A;  2DHR A;  1K3W A;  1QZM A;  3AFH A;  4FD2 A;  4Z8X A;  1YSY A;  2DZO B;  4PT5 A;  4NSO B;  5E6J A;  4JI8 M;  1HNX M;  3L25 A;  3GPY A;  3W0F A;  1PJJ A;  4DR2 M;  4KLN A;  4NL4 H;  2RGH A;  3GLI A;  4NXN M;  4FCV A;  5KO3 A;  7CAT A;  2KRK A;  2VQE M;  4REZ A;  4MGH A;  3FTF A;  1I4W A;  2ZAM A;  3SAW A;  4FW9 A;  4BB9 A;  4FWD A;  3MJ5 A;  3RFW A;  1IBM M;  3U60 B;  2FOI C;  3GRU A;  4LZJ A;  3VK8 A;  3VFD A;  3GPX A;  1NNU C;  2NQ8 C;  5GKN A;  3DZD A;  1GLN A;  4LGY A;  4HL4 A;  2XLJ A;  1SXJ C;  1LV7 A;  5ITT A;  3EIH A;  3K2L A;  2DVW B;  3KDS E;  2HHH M;  3DA1 A;  4JI2 M;  2QEN A;  2DWZ B;  5FLX S;  3ILK A;  4CGY B;  4LJA A;  3A42 A;  4I8O A;  4IJF A;  2W82 A;  2F5Q A;  1EE8 A;  4DR3 M;  1GKI A;  5BR8 M;  2E5L M;  2UXD M;  1Q39 A;  1N78 A;  3RE8 A;  4DV4 M;  4X64 M;  3U5Z A;  2V1C A;  2R4J A;  1L8Q A;  5BPV A;  1X37 A;  4OVZ A;  3L27 A;  3ZCB B;  3DOA A;  3GRY A;  1NHW C;  3J81 S;  3A46 A;  1JR3 A;  1TDZ A;  3U61 A;  4OU7 A;  4KHP M;  2H1R A;  2X8A A;  2C9C A;  3GPP A;  1HT2 E;  4GHL A;  4LJ9 A;  3EIE A;  1K3X A;  1IBL M;  4LZZ A;  2LH0 A;  4AG5 A;  3L26 A;  1HR0 M;  3FTC A;  3HWS A;  4M0W A;  3KOW E;  4II7 A;  3HU2 A;  3J2P B;  1KYI A;  2Z4S A;  3FYC A;  5EP2 A;  2Z3X A;  2FE8 A;  4B7G A;  2M5Z A;  3GQ5 A;  4EIW A;  3AL0 C;  2KRU A;  4D81 A;  2ZM6 M;  2R65 A;  2R45 A;  3KP0 E;  3U6D A;  2QZ4 A;  2DWL A;  3FD9 A;  4LJ4 A;  3WHK A;  3K8Z A;  4LF5 M;  3U6M A;  2LXE A;  3UMM A;  4GIT A;  4Z6Y A;  4M9S A;  1XC8 A;  3RGS A;  2CE7 A;  2CHQ A;  2RGO A;  5FTK A;  3SHF A;  2BNK A;  4JI7 M;  1QAN A;  3SAR A;  2KZS A;  5LMN M;  3H4M A;  4MGY E;  4DV7 M;  4WW0 A;  4LJ8 A;  4KO8 A;  5DYI A;  4AKI A;  1Q3B A;  3FUX A;  5FTM A;  4FWG A;  3KFU G;  2Q2E B;  2C98 A;  5H37 D;  4FVM A;  4MB7 A;  2QP9 X;  3GLH B;  3TWM A;  1IQP A;  2KW0 A;  1YE9 A;  5ITX A;  2RKO A;  4B7H A;  1G8P A;  4LG2 A;  1HNZ M;  4PCZ A;  4W5W A;  4AG6 A;  2XGN A;  3J27 B;  1J09 A;  1L1Z A;  1DO2 A;  4DR4 M;  2BJV A;  4DV5 M;  1L2D A;  1MU5 A;  4ZPX A;  4DR7 M;  3KOZ E;  4DR5 M;  4MGZ E;  3LQQ A;  2OQ4 A;  4DV0 M;  1QAM A;  3HJS A;  3U60 A;  3T1H M;  1HT1 E;  1IN7 A;  2Z7J A;  4LRS A;  5FSW A;  1Z5B A;  3TQS A;  1T3T A;  2ERC A;  3SHG B;  5ITQ A;  4LRT A;  2L7H A;  2UXB M;  2CFO A;  3TPZ A;  3SAT A;  1N32 M;  1Z5A A;  3HHZ A;  1IN8 A;  1JQJ C;  5E26 A;  1J5E M;  1HNW M;  3AV0 A;  3HU3 A;  4NRV A;  4RF0 A;  3GO8 A;  5FTJ A;  3L29 A;  5FTL A;  3UK6 A;  3PNY A;  3AOE A;  3CTW B;  4IJE A;  1N33 M;  2UUB M;  4S12 A;  3D8B A;  4YY3 M;  1IN5 A;  3W0L B;  3J7A S;  1IN4 A;  3VK7 A;  4QHS A;  3C58 A;  4B3R M;  3K92 A;  3FYD A;  5C1B A;  1I94 M;  2C9O A;  1DGG A;  2HL7 A;  2F5P A;  1XWI A;  5JI2 E;  3U6P A;  1G59 A;  5EP3 A;  3GP1 A;  4D82 A;  1L2B A;  4JYA M;  1Z59 A;  4BBA A;  3KW6 A;  2C5R A;  1XNR M;  4DUZ M;  4X65 M;  3E4R A;  4JI3 M;  2JA2 A;  3A45 A;  3FUV A;  4R7G A;  4WUR A;  4TUW A;  4IBB A;  1IN6 A;  1IY0 A;  4DV2 M;  1GL7 A;  4G4O A;  1NVM A;  1OFH A;  4P16 A;  4IBI A;  2YNM D;  1ZQ9 A;  3KOX E;  4GC9 A;  1Z6T A;  2LNH C;  3HJ8 A;  4QHT A;  2VQF M;  2UUA M;  3OTO M;  3KS8 A;  2DXI A;  4L15 A;  4MM3 B;  1FJG M;  1QAQ A;  3SMS A;  1G4A E;  5EJC A;  2KA6 B;  4JI6 M;  2UXC M;  3KSJ A;  4B7F A;  2XSZ D;  4NSR A;  4XGI A;  3HU1 A;  3AKZ A;  4IIW A;  4AQY M;  2QCU A;  3BOS A;  3B9P A;  1NY5 A;  3E9S A;  2D7G A;  4AKG A;  2KEB A;  2LWX A;  3KSX A;  1E94 E;  2K47 A;  1OFI A;  4JI1 M;  1W5T A;  1W5S A;  1PM5 A;  2G5G X;  4FCW A;  2D7E A;  4MGI E;  5EXS A;  3GRR A;  4FWH A;  4JN6 A;  4ITQ A;  5KPR A;  1NJG A;  3GQ4 A;  2L7I A;  2X4A A;  1H6U A;  3GLH A;  3IG5 A;  1KSF X;  3LQR A;  4PDG A;  3SYL A;  3AJI B;  4QOZ C;  1KFV A;  3GLF B;  4IBK A;  4G4R A;  2CV2 A;  2J7O A;  3FUU A;  3PXG A;  3U6E A;  1XMQ M;  2CV0 A;  4IBC A;  1SXJ B;  3U61 B;  3PFI A;  1HQC A;  4QOS A;  4AZF A;  4FCT A;  2YR0 A;  2CHG A;  4GMQ A;  1PJI A;  2DWN A;  3R8F A;  2F5N A;  4IBJ A;  3I4Y A;  5KQ8 A;  1TDH A;  2HKJ A;  3SFZ A;  1N77 A;  1IBK M;  1K82 A;  4LF4 M;  4JI0 M;  4LJ6 A;  2DZN B;  2ZAN A;  1XMO M;  4QNM A;  4LJ7 A;  3U6C A;  4G6Z A;  4M9Z A;  3L28 A;  4AKH A;  1L2C A;  2QPA A;  3RGP A;  1HQY E;  2L6O A;  3THG A;  4DR1 M;  3VDU A;  2Y21 A;  3GPU A;  3AOE C;  1SXJ E;  1E9S A;  1Z5C A;  2R62 A;  2X49 A;  3A98 B;  5EP1 A;  2CEA A;  2F4V M;  2F5O A;  2I7N A;  2KZU A;  1TH4 A;  1JR3 D;  4YHH M;  1SXJ D;  3CF6 E;  4JXJ A;  2HCB A;  5LMU M;  3LVW A;  3HHW A;  1DGH B;  2R18 A;  4M9X A;  1IY2 A;  3CF0 A;  4JI5 M;  3ZC7 B;  2V6Z M;  4XBO A;  3SBJ A;  1R2Y A;  1WXQ A;  3UZU A;  5DYG A;  3JR5 A;  4LCB A;  2M60 A;  1XXH B;  4L4U A;  2XFS A;  3GRV A;  4LY6 A;  3PVS A;  1IXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...