2DZOB

Crystal structure analysis of yeast nas6p complexed with the proteasome subunit, rpt3
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
MSLAPEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure analysis of yeast Nas6p complexed with the proteasome subunit, rpt3
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Probable 26S proteasome regulatory subunit p28
total genus 15
structure length 57
sequence length 57
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dzoB00
2RKOA 4FCWA 1IN4A 5DYGA 1W5TA 3VLFB 1SXJA 2ZAMA 2C98A 3GLIB 1HT1E 5FTKA 4FW9A 2CHVA 3GLHB 3CF0A 4KLNA 5EP4A 5FTJA 4FWHA 3PXGA 2Z4RA 2XSZA 3U60B 3AJIB 3H4MA 4KODA 1KYIA 1IXSB 1IN6A 1J7KA 1IXRC 4LZZA 5EXTA 5JI3E 4FWGA 4ZPXA 3KDSE 4I81A 1NY5A 1IY0A 1IY2A 3BOSA 3HU1A 1E32A 2HCBA 5JI2E 4L16A 3B9PA 1IM2A 4FD2A 1NJGA 3DZDA 2CE7A 2CHGA 3SC3A 5EXXA 1JR3A 3GLGB 1L8QA 4FCVA 2QENA 1G3IA 3MHVC 2C99A 2CHQA 4I4LA 4JN6A 4LJ4A 3WHKA 4D81A 2DHRA 2V1UA 2BJWA 4LGMA 5C1BA 5EXPA 4LJ6A 4QHTA 1NVMA 5EQTA 1SXJE 3VFDA 3U61B 2R62A 4EIWA 4QNRA 1XXHA 2V6ZM 3D8BA 4LJAA 5FTLA 3GLIA 2QBYA 3EIHA 4LJ8A 3K1JA 3GLFB 1JR3D 2QP9X 4L4UA 4D82A 1E94E 1OFHA 4LJ7A 5EP3A 5EXSA 1HQCA 1QVRA 3PVSA 1JQJC 3HU3A 4WW0A 2DZOB 1XWIA 1S3SA 2QZ4A 1DO0A 3UK6A 4LJ9A 2BJVA 3R8FA 1QZMA 1C1KA 5EP2A 4LY6A 2DVWB 1DO2A 1R7RA 4Z8XA 1IQPA 1IN8A 1D2NA 4L15A 3M0EA 4GITA 4LCBA 1G41A 1SXJC 1IN7A 1NY6A 2CEAA 2C9CA 3SYKA 3CF2A 4KO8A 1SXJB 3EIEA 5EP1A 1OFIA 2KRKA 1HQYE 1SXJD 4QHSA 5DYIA 5FTNA 3WHLA 1IN5A 3PFIA 4QNMA 2C96A 2DZNB 4FCTA 2DWZB 3SYLA 2QBYB 4LRSA 1IY1A 2C9OA 3GLGA 2QPAA 2VIIA 3U5ZB 3KW6A 1W5SA 1G4AE 1UM8A 3HU2A 2XSZD 3M6AA 4LJ5A 1NJFA 5C18A 4FWDA 5FTMA 2X8AA 1XXHB 2Z4SA 1NSFA 1LV7A 2R65A 1OJLA 3GLHA 3HWSA 1IXZA 1HT2E 4QOSA 3GLFA 2ZANA 2FNAA 4LRTA 1R6BX 4A3VB 1X37A 3ZH9B 4D80A 2ZAOA 1FNNA 1KSFX
chains in the Genus database with same CATH superfamily
2DWMA 2YFQA 3DFZA 1DV0A 2R4EA 2JNHA 3E9SA 3J2PB 2CV2A 4JV5M 1QANA 3LVWA 2C98A 4PDGA 4GC5A 4PCZA 1Q39A 3FTEA 3VKGA 3GLHB 4IBKA 1DGHA 1V34A 1H6UA 5EP4A 2L4FA 2DZLA 4DUZM 1PJJA 3PXGA 1IBKM 3UZUA 2WSEF 1T6OA 2QSFX 1F4IA 2KRUA 4P17A 4LZZA 5EXTA 2YQZA 3I4VA 3KOYE 1I4WA 4FWGA 4YY3M 3GP1A 4ZPXA 2LVOC 3C3EA 1YSYA 1QAQA 3HJ8A 1IY0A 3I51A 2Y0TA 3Q8GA 4B3SM 4LF7M 3UMMA 2CP8A 3QYEA 1IM2A 3VDPA 4NL4H 4R7GA 4WURA 3FKEA 2D7HA 3IG8A 4M0DA 5EXXA 4DR7M 1NV9A 2X49A 5IREB 1WR1B 2C99A 4JN6A 3J7BA 4DR6M 2BJWA 3KOWE 4L78A 5C1BA 5EXPA 2KZUA 3JR4A 3BXWA 2XZUA 2YNMD 2DAMA 5DNYA 3U61B 3CGWA 4CHTB 3IHPA 1TDZA 1WIVA 3K92A 2VF7A 2JY5A 3D8BA 2EA0A 1PJSA 3QYBA 2FFJA 1QYRA 2JWSA 4Q7JA 3K1JA 1DGGA 1GVNA 3U6DA 2XF3A 2BWBA 5ITTA 1R5LA 4GMQA 4IBFA 4AKGA 1PRBA 1LTMA 1E94E 1XMOM 1QVRA 3HU3A 4S12A 2DZOB 1GJTA 2G5GX 3LCUA 4WW0A 2DWNA 4LG2A 1XB2B 3UK6A 4LGYA 3R8FA 1EFUB 3GPPA 1HNXM 1E9SA 2XEPA 5EP2A 3FTCA 3KSXA 3LMMA 3SARA 1R7RA 2RRUA 3C58A 3SATA 1R2ZA 3M0EA 4IBEA 2O01F 2VF8A 4AG6A 2C9CA 4L6V6 4IJFA 4NC6A 2LTUA 1OFIA 3BBZA 1HQYE 3KP0E 4IBGA 2APLA 5FTNA 1XC8A 1XNQM 3CTWB 1UFZA 3GQ5A 2D7EA 2CV0A 4QNMA 3FYCA 4G6ZA 2Z3XA 3AKZA 2Z7JA 1PJQA 4AG5A 3SAWA 3T1HM 4DV4M 1XMQM 2C9OA 3LVVA 3AV0A 3A98B 3GLGA 4TUWA 2LVPC 4ITQA 3DOAA 4LF8M 1W5SA 1QUTA 4JI3M 1NJFA 4JI7M 3SHGB 5L8RF 1TF0B 5ITUA 2L7HA 1NSFA 1LV7A 1MU5A 2I7PA 3I04M 2R65A 5ITRA 3U61A 2F5SA 1Z5BA 3J7AS 5FLXS 5GKNA 4B7FA 3GLFA 1ZMUA 3D8LA 2J7OA 5KPTA 1R6BX 3E46A 4X66M 5FTLA 1FNNA 1KSFX 2YR0A 3WHLA 2DAGA 4AI6A 3L27A 1SXJA 4X64M 5E26A 1QZEA 2ZAMA 4JI8M 2EO2A 1N75A 3SHFA 2CHVA 3K9PA 1IXSA 2UUBM 4LFCM 2O25A 3M7GA 2UUCM 4KT0F 4X65M 2G3QA 4F1IA 3FYDA 2FH0A 2D7GA 2LHGA 1YLAA 1XHBA 4JI4M 2XSZA 3LCVB 4LF5M 1TDHA 1J7KA 1QDRA 3W0LB 5FSWA 3VK7A 4M9ZA 2LBCA 3GLGE 1G8PA 1GL7A 1K3WA 4BLCA 1Z5AA 4LZJA 8CATA 3HHYA 2UXCM 4L16A 4FD2A 5BR8M 1NJGA 4REZA 3IG5A 3TWMA 2EKKA 1TR8A 2JUJA 2XGNA 1L8QA 2LHCA 2K47A 4FCVA 3ILKA 4G4OA 3SAVA 3MHVC 4GC9A 4D81A 3NBIA 3WHKA 2LVQD 2V1UA 3HY5A 1MX0A 1Q3BA 3SBJA 4LJ6A 1IBLM 4Y28F 3FUWA 2R18A 1L2CA 2R4JA 1VEGA 2R62A 3U6CA 1HR0M 2EUCA 4GH9A 3AL0C 4QNRA 3T15A 4G4NA 1XXHA 2V6ZM 3QAUA 4HLQA 3L29A 4RF1A 2P5TA 1PGYA 3TE6A 4JI6M 3J81S 1N78A 4WP2A 3LQRA 2I7NA 3U6QA 3GQ4A 3GLFB 4OX9M 1JR3D 4AQYM 2KZSA 4GKKM 3VKHA 2XH9A 3U6MA 3RE8A 4PT5A 4JI0M 2OQ4A 3U6PA 2Q2EB 4ANRA 1OFHA 4LJ7A 3ZCBB 3KVWA 3W67A 4X62M 1N77A 1JQJC 4W5WA 4DV3M 4JI2M 1VG5A 1D0LA 1TH4A 2LVNC 4IBDA 4G4RA 1R2YA 4BBAA 2KEBA 3FUVA 3C3DA 1QZMA 1C1KA 4LY6A 1L2DA 4G3OA 1DO2A 1I94M 4K0KM 1AUAA 2KNAA 4GITA 1C7YA 3T6PA 3MJ5A 2KA6B 1IN7A 1NY6A 2V1CA 1D0MA 2NQ8C 3SYKA 4KO8A 3DA1A 1SXJB 3L25A 3EIEA 3K2LA 3U60B 5EP1A 2DXIA 2KRKA 2F5OA 3W68A 2MJ5B 2FOIC 5IT9S 2CUZA 1PJTA 3V76A 4OU7A 2DAIA 2DNAA 3RGPA 3B74A 1N32M 4DR1M 3R9XB 4R3DA 2QBYB 2CRUA 4GHAA 1WXQA 2BNKA 3HHXA 4DR3M 5KPRA 3GRVA 3TPZA 2UU9M 4IBIA 4DR5M 3VK8A 4IJEA 4RKUF 2VIIA 4PDIA 3U5ZB 2QHOB 2ZTCA 1G4AE 1ZV1A 3VDUA 1UM8A 2UXBM 1D0KA 2XSZD 3B7NA 4LJ5A 4KHPM 2LXEA 4LF6M 3AOEA 1GABA 4B7GA 3JR5A 3W0FA 3RFWA 1A5TA 4OVZB 2J7NA 4RNAA 4DBGB 3HWSA 4XK8F 1GO5A 3SAUA 3HJSA 2ZBKB 3T38A 2FNAA 5H37D 1X37A 4LRTA 3A45A 5DYGA 4F2LA 2HL7A 4FCWA 4FVMA 4Z6YA 1QDTA 3GLIE 3U60A 4NRWA 2LWXA 1W5TA 2FS1A 3AFHA 4NSOB 3UGJA 2BWEA 3ZC7B 4HL4A 1TGUA 1HT1E 5FTKA 5KQDA 1JB0F 1MJGM 4DV1M 2L4EA 4CJ6A 4LFBM 4YHHM 3CF0A 4IIWA 1QAOA 4I5SA 4KLNA 1E9RA 4FWHA 2QQ8A 2E5LM 3H4JA 4B3TM 3AOGA 3MK6A 1FJGM 3H4MA 2Z8YM 5JI3E 1IN6A 3A46A 3E21A 1OIPA 1OKSA 2KXEA 3KXEC 3RGSA 1IBMM 2UUAM 1IY2A 2ERCA 3AOEC 3BOSA 3HU1A 4B3RM 5JI2E 5EJCA 3DZDA 1GL6A 1CUKA 2CE7A 2GQFA 3I01M 4JI5M 2W82A 1JR3A 2F5QA 3GLGB 2JA2A 2QENA 3KS4A 4I4LA 4I8OA 4LF9M 4JYAM 4XGIA 2DHRA 2R6FA 3NWLA 4M0WA 3L28A 3SMSA 3I4YA 1GKIA 2CV1A 4IBJA 4QHTA 1NVMA 2AHMA 3VFDA 2OPFA 1N34M 1QUSA 3GLHE 2J5YA 2B3TA 1K3XA 2RGHA 4EIWA 2WSCF 4PD2A 7CATA 1NNJA 3HGIA 1TTEA 1VDDA 1ORYB 4LJAA 3EIHA 3K8ZA 4LJ8A 4B7HA 1K82A 4NXMM 2XFSA 3NBXX 3MMPA 2CWBA 2C5RA 2WSFF 5ITYA 3TL4X 2JY7A 5EXSA 3HZJA 3PVSA 1Q02A 5KO3A 4UN2B 4CISA 3HX3A 2EJSA 1DO0A 2KNVA 3TWKA 3FE3A 4LJ9A 1RU3A 1IFYA 3QWLA 1NHWC 4G4QA 1ZAEA 3J80S 4MH0E 3T1YM 3U6SA 3SASA 3HHZA 4Z8XA 1IQPA 1IN8A 1D2NA 1V92A 1L2BA 1L1ZA 2XFTA 3IECA 1QQWA 1G41A 2L7IA 2HHHM 3CF2A 3PNVA 2XLJA 1QAMA 4MB7A 2LH0A 2GNOA 1SXJD 4QHSA 3GO8A 1IN5A 3PFIA 2OOBA 3KS8A 1Y8GA 4NOOB 2C96A 1NNUC 2DZNB 2DWZB 1DGHB 4FCTA 4B3MM 4LRSA 1IY1A 2RGOA 1OQYA 4MGHA 5E6JA 4R71A 4MM3B 1WGLA 2Y21A 1ZMVA 4MGIE 3FTFA 1Z5CA 3KW6A 4GEWA 2DWLA 4LFAM 3HU2A 3M6AA 4JI1M 1NO1A 4HEOA 4FWDA 5FTMA 2DI0A 1XXHB 3KP1E 2F4VM 3KSJA 3GPUA 1OAIA 1T43A 3GLHA 3FTDA 1IXZA 1HT2E 4QOSA 3U6LA 3FRHA 5A2QS 2A5YB 3FRIA 4GRIA 4D80A 3GQ3A 5IZ7D 4CIZA 2L6OA 2RKOA 4DR4M 2QCUA 1IN4A 3VLFB 3FUTA 1PJIA 1GJSA 5DFLA 4FW9A 1XXHE 3GPXA 1WHCA 3U6OA 2X4AA 3SFZA 3F92A 5ITQA 1N33M 1VDLA 5FTJA 1YUBA 2EKFA 2Z4RA 2QNJA 1P3QQ 2JZ0A 3AJIB 3B7QA 2L09A 2K6BA 2HWJA 1KYIA 1IXSB 1IXRC 1V33A 3GRUA 4GIPA 4IBCA 4KODA 1T3TA 3KOZE 4NXNM 1Z6TA 1VQ1A 3OTOM 1Z59A 2JXNA 3KDSE 4I81A 1NY5A 4LF4M 4DUYM 3L2AA 1E32A 2HCBA 3J27B 4OVZA 4XBOA 3B9PA 3PNYA 4II7A 2ZTDA 3FD9A 1XNRM 3CF6E 2M5ZA 5LMNM 2CHGA 3SC3A 3GPYA 1NV8A 3ZQJA 3TQSA 2N35A 3KFUG 2JP7A 3LQQA 2OO9A 1PM5A 1HNWM 2JZ1A 4BB9A 1G3IA 2R0IA 1AIPC 1NHGC 2KW0A 5KPZA 2CHQA 4LJ4A 5BPVA 5IWAM 1BVSA 3C9PA 4DR2M 4LGMA 3K9OA 4M9SA 1KFVA 1YE9A 2WZJA 2MH8A 5EQTA 4QOZC 4IBBA 1SXJE 1EE8A 2F5PA 4GHLA 1GLNA 3U6EA 2H1RA 2MR9A 5ITXE 1TH3A 2KNZA 2R45A 2O5RA 4AKHA 2JY6B 2ZAOA 3GLIA 2FE8A 3E4RA 2CFOA 2K9DA 2QBYA 2Y0QA 3LW5F 1SG9A 3HHWA 4P16A 3GLFE 2QP9X 4NRVA 2HAKA 2LNHC 4L4UA 3SMPA 1ZQ9A 4D82A 4DV0M 3Q8XA 2M60A 4AW4A 4AKIA 3UJNA 2LVAA 5EP3A 1HQCA 1WJ7A 2KDLA 1MN3A 3JAMS 2UXDM 1DGFA 1DGBA 4AZFA 2OOAA 1XWIA 1G71A 1S3SA 2QZ4A 4CGYB 1VEKA 5KQ8A 3FUXA 2BJVA 2DAEA 2DVWB 4DV5M 3A42A 2K0BX 2G8LA 2DKLA 3TWLA 1G59A 4L15A 4MGKE 4LCBA 1SXJC 2CEAA 2L2DA 1Q3CA 4M9XA 2ZM6M 2F5NA 4DV6M 1R4GA 1JR3E 2KHHA 1WGNA 4B08A 5DYIA 2R44A 4MGYE 2JY8A 3B7ZA 4OW0A 4RF0A 1J5EM 1N36M 3GRYA 1HJPA 1OAOC 3SYLA 3HKPA 2DHYA 4JXJA 4GKJM 2DENA 2QPAA 2MGWA 3FUUA 3GRRA 3HJQA 2DAKA 5LMUM 1TH2A 4NSRA 4DV7M 4L8RC 3L26A 2HKJA 3B89A 4DV2M 3KOXE 3THGA 5C18A 1L1TA 2X8AA 2VQFM 2H5XA 1HNZM 2Z4SA 2VQEM 2MROB 2Y20A 4MGZE 3U5ZA 1OJLA 1OTRA 1VEJA 1ZMWA 5F3WA 2ZANA 2R46A 5ITXA 1J09A 4A3VB 2XZFA 3ZH9B 3GLIB 2VDBB 1OIZA 1EIJA
chains in the Genus database with same CATH topology
2DWMA 2YFQA 3DFZA 2R4EA 3J2PB 3E9SA 2CV2A 4JV5M 1QANA 3LVWA 2C98A 4PDGA 4GC5A 4PCZA 1Q39A 3FTEA 3VKGA 3GLHB 4IBKA 1DGHA 1H6UA 5EP4A 4DUZM 1PJJA 3PXGA 1IBKM 3UZUA 2KRUA 5EXTA 4LZZA 2YQZA 3I4VA 3KOYE 1I4WA 4FWGA 4YY3M 3GP1A 4ZPXA 1YSYA 1QAQA 3HJ8A 1IY0A 3I51A 2Y0TA 4B3SM 4LF7M 3UMMA 1IM2A 3VDPA 4NL4H 4R7GA 4WURA 3FKEA 2D7HA 3IG8A 4M0DA 5EXXA 4DR7M 2X49A 5IREB 2C99A 4JN6A 3J7BA 4DR6M 2BJWA 3KOWE 4L78A 5C1BA 5EXPA 2KZUA 3JR4A 2XZUA 2YNMD 5DNYA 3U61B 4CHTB 1TDZA 3K92A 3D8BA 2EA0A 2FFJA 1QYRA 3K1JA 1DGGA 1GVNA 3U6DA 2XF3A 5ITTA 4GMQA 4IBFA 4AKGA 1E94E 1XMOM 1QVRA 3HU3A 4S12A 2DZOB 2G5GX 4WW0A 2DWNA 4LG2A 3UK6A 4LGYA 3R8FA 1HNXM 3GPPA 1E9SA 2XEPA 5EP2A 3FTCA 3KSXA 3LMMA 3SARA 1R7RA 3C58A 3SATA 1R2ZA 3M0EA 4IBEA 4AG6A 2C9CA 4IJFA 1XNQM 1OFIA 3KP0E 1HQYE 4IBGA 5FTNA 1XC8A 3CTWB 2D7EA 2CV0A 4QNMA 3FYCA 4G6ZA 2Z3XA 3AKZA 2Z7JA 3T1HM 4AG5A 3SAWA 4DV4M 1XMQM 2C9OA 3LVVA 3AV0A 3A98B 3GLGA 4TUWA 4ITQA 3DOAA 4LF8M 1W5SA 4JI3M 1NJFA 4JI7M 3SHGB 5ITUA 2L7HA 1NSFA 1LV7A 1MU5A 2I7PA 3U61A 2R65A 5ITRA 2F5SA 3J7AS 1Z5BA 5FLXS 5GKNA 4B7FA 3GLFA 3D8LA 2J7OA 5KPTA 1R6BX 4X66M 5FTLA 1FNNA 2YR0A 1KSFX 3WHLA 4AI6A 3L27A 1SXJA 4X64M 5E26A 2ZAMA 4JI8M 2EO2A 1N75A 3SHFA 2CHVA 2UUBM 4LFCM 3M7GA 2UUCM 4X65M 3FYDA 2D7GA 1XHBA 4JI4M 2XSZA 4LF5M 1TDHA 1J7KA 3W0LB 5FSWA 3VK7A 4M9ZA 1G8PA 1GL7A 1K3WA 4BLCA 1Z5AA 4LZJA 8CATA 3HHYA 2UXCM 4L16A 4FD2A 5BR8M 1NJGA 4REZA 3IG5A 3TWMA 2XGNA 1L8QA 2K47A 4FCVA 3ILKA 4G4OA 3SAVA 3MHVC 4GC9A 4D81A 3NBIA 3WHKA 2V1UA 1MX0A 1Q3BA 3SBJA 4LJ6A 1IBLM 3FUWA 2R18A 1L2CA 2R4JA 2R62A 3U6CA 1HR0M 2EUCA 4GH9A 3AL0C 4QNRA 3T15A 4G4NA 1XXHA 2V6ZM 3QAUA 4HLQA 3L29A 4RF1A 2P5TA 3TE6A 4JI6M 3J81S 1N78A 3LQRA 2I7NA 3U6QA 3GQ4A 3GLFB 4OX9M 1JR3D 4AQYM 2KZSA 4GKKM 3VKHA 2XH9A 3U6MA 3RE8A 4PT5A 4JI0M 2OQ4A 3U6PA 2Q2EB 1OFHA 4LJ7A 3ZCBB 3KVWA 4X62M 1N77A 1JQJC 4W5WA 4DV3M 4JI2M 1TH4A 4IBDA 4G4RA 1R2YA 4BBAA 2KEBA 3FUVA 1QZMA 1C1KA 4LY6A 1L2DA 1DO2A 1I94M 4K0KM 4GITA 3MJ5A 2KA6B 1IN7A 1NY6A 2V1CA 2NQ8C 3SYKA 3L25A 4KO8A 3DA1A 1SXJB 3EIEA 3K2LA 2DXIA 5EP1A 2KRKA 2F5OA 5IT9S 2FOIC 2CUZA 4OU7A 3RGPA 1N32M 4DR1M 3R9XB 4R3DA 2QBYB 4GHAA 1WXQA 2BNKA 3HHXA 4DR3M 5KPRA 3GRVA 3TPZA 2UU9M 4IBIA 4DR5M 3VK8A 4IJEA 4PDIA 2VIIA 3U5ZB 1G4AE 3VDUA 2UXBM 1UM8A 2XSZD 4KHPM 4LJ5A 2LXEA 4LF6M 3AOEA 4B7GA 3JR5A 3W0FA 3RFWA 4OVZB 2J7NA 4RNAA 3HWSA 3SAUA 3HJSA 2ZBKB 3T38A 2FNAA 5H37D 1X37A 4LRTA 3A45A 5DYGA 2HL7A 4FCWA 4FVMA 4Z6YA 3U60A 4NRWA 2LWXA 1W5TA 3AFHA 4NSOB 3UGJA 3ZC7B 4HL4A 1TGUA 1HT1E 5FTKA 5KQDA 4DV1M 4LFBM 4YHHM 3CF0A 4IIWA 1QAOA 4I5SA 4KLNA 1E9RA 4FWHA 2E5LM 4B3TM 3AOGA 3MK6A 1FJGM 3H4MA 5JI3E 1IN6A 3A46A 2KXEA 3KXEC 3RGSA 1IBMM 2UUAM 1IY2A 2ERCA 3AOEC 3BOSA 3HU1A 4B3RM 5JI2E 5EJCA 3DZDA 1GL6A 2CE7A 4JI5M 2W82A 1JR3A 2F5QA 3GLGB 2JA2A 2QENA 3KS4A 4I4LA 4I8OA 4LF9M 4JYAM 4XGIA 2DHRA 4M0WA 3NWLA 3L28A 3SMSA 3I4YA 1GKIA 2CV1A 4IBJA 4QHTA 1NVMA 2AHMA 3VFDA 2OPFA 1N34M 1K3XA 2RGHA 4EIWA 4PD2A 7CATA 1NNJA 3HGIA 1VDDA 1ORYB 4LJAA 3EIHA 3K8ZA 4LJ8A 4B7HA 1K82A 4NXMM 2XFSA 2C5RA 5ITYA 3TL4X 5EXSA 4CISA 3PVSA 5KO3A 1DO0A 3TWKA 4LJ9A 3QWLA 1NHWC 4G4QA 1ZAEA 3J80S 4MH0E 3T1YM 3U6SA 3SASA 3HHZA 4Z8XA 1IQPA 1IN8A 1D2NA 1L2BA 1L1ZA 2XFTA 1QQWA 1G41A 2L7IA 2HHHM 3CF2A 3PNVA 2XLJA 1QAMA 4MB7A 2LH0A 1SXJD 4QHSA 3GO8A 1IN5A 3PFIA 3KS8A 4NOOB 2C96A 1NNUC 2DZNB 2DWZB 1DGHB 4FCTA 4B3MM 4LRSA 1IY1A 2RGOA 5E6JA 4MGHA 4MM3B 2Y21A 4MGIE 3FTFA 1Z5CA 3KW6A 2DWLA 4LFAM 3HU2A 3M6AA 4JI1M 4FWDA 5FTMA 1XXHB 3KP1E 2F4VM 3KSJA 3GPUA 3GLHA 3FTDA 1IXZA 1HT2E 4QOSA 3U6LA 5A2QS 2A5YB 4GRIA 4D80A 3GQ3A 5IZ7D 2L6OA 2RKOA 4DR4M 2QCUA 1IN4A 3VLFB 3FUTA 1PJIA 4FW9A 3GPXA 3U6OA 2X4AA 3SFZA 5ITQA 1N33M 5FTJA 1YUBA 2Z4RA 3U60B 3AJIB 3GQ5A 2L09A 4GIPA 1KYIA 1IXSB 1IXRC 3GRUA 4IBCA 4KODA 3OTOM 4GHLA 1T3TA 3KOZE 4NXNM 1Z6TA 1Z59A 3KDSE 4I81A 1NY5A 4LF4M 4DUYM 3L2AA 1E32A 2HCBA 3J27B 4OVZA 4XBOA 3B9PA 3PNYA 4II7A 3FD9A 1XNRM 3CF6E 2M5ZA 5LMNM 2CHGA 3SC3A 3GPYA 3TQSA 3KFUG 1PM5A 3LQQA 1HNWM 4BB9A 1G3IA 5KPZA 2KW0A 1NHGC 2CHQA 4LJ4A 5BPVA 5IWAM 4DR2M 4LGMA 4M9SA 1KFVA 1YE9A 5EQTA 4QOZC 4IBBA 1SXJE 1EE8A 2F5PA 1GLNA 3U6EA 2H1RA 5ITXE 1TH3A 2R45A 2O5RA 4AKHA 3GLIA 2FE8A 3E4RA 2CFOA 2QBYA 2Y0QA 3HHWA 4P16A 2QP9X 4NRVA 4L4UA 2LNHC 3SMPA 4D82A 1ZQ9A 4DV0M 3Q8XA 2M60A 4AW4A 4AKIA 3UJNA 5EP3A 1HQCA 2UXDM 3JAMS 1DGFA 1DGBA 4AZFA 4CGYB 1XWIA 1S3SA 2QZ4A 5KQ8A 3FUXA 2BJVA 2DVWB 4DV5M 3A42A 2G8LA 3TWLA 1G59A 4L15A 4MGKE 4LCBA 1SXJC 2CEAA 2ZM6M 1Q3CA 4M9XA 2F5NA 4DV6M 4B08A 5DYIA 4MGYE 4OW0A 4RF0A 1J5EM 1N36M 3GRYA 3SYLA 3HKPA 4JXJA 4GKJM 2QPAA 3FUUA 3GRRA 3HJQA 5LMUM 1TH2A 4NSRA 4DV7M 4L8RC 3L26A 2HKJA 4DV2M 3KOXE 3THGA 5C18A 1L1TA 2X8AA 2VQFM 1HNZM 2Z4SA 2VQEM 2Y20A 4MGZE 3U5ZA 1OJLA 5F3WA 2ZANA 2R46A 5ITXA 1J09A 4A3VB 2XZFA 3ZH9B 3GLIB 2ZAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RKO A;  4FCW A;  1IN4 A;  5DYG A;  1W5T A;  3VLF B;  1SXJ A;  2ZAM A;  2C98 A;  3GLI B;  1HT1 E;  5FTK A;  4FW9 A;  2CHV A;  3GLH B;  3CF0 A;  4KLN A;  5EP4 A;  5FTJ A;  4FWH A;  3PXG A;  2Z4R A;  2XSZ A;  3U60 B;  3AJI B;  3H4M A;  4KOD A;  1KYI A;  1IXS B;  1IN6 A;  1J7K A;  1IXR C;  4LZZ A;  5EXT A;  5JI3 E;  4FWG A;  4ZPX A;  3KDS E;  4I81 A;  1NY5 A;  1IY0 A;  1IY2 A;  3BOS A;  3HU1 A;  1E32 A;  2HCB A;  5JI2 E;  4L16 A;  3B9P A;  1IM2 A;  4FD2 A;  1NJG A;  3DZD A;  2CE7 A;  2CHG A;  3SC3 A;  5EXX A;  1JR3 A;  3GLG B;  1L8Q A;  4FCV A;  2QEN A;  1G3I A;  3MHV C;  2C99 A;  2CHQ A;  4I4L A;  4JN6 A;  4LJ4 A;  3WHK A;  4D81 A;  2DHR A;  2V1U A;  2BJW A;  4LGM A;  5C1B A;  5EXP A;  4LJ6 A;  4QHT A;  1NVM A;  5EQT A;  1SXJ E;  3VFD A;  3U61 B;  2R62 A;  4EIW A;  4QNR A;  1XXH A;  2V6Z M;  3D8B A;  4LJA A;  5FTL A;  3GLI A;  2QBY A;  3EIH A;  4LJ8 A;  3K1J A;  3GLF B;  1JR3 D;  2QP9 X;  4L4U A;  4D82 A;  1E94 E;  1OFH A;  4LJ7 A;  5EP3 A;  5EXS A;  1HQC A;  1QVR A;  3PVS A;  1JQJ C;  3HU3 A;  4WW0 A;  2DZO B;  1XWI A;  1S3S A;  2QZ4 A;  1DO0 A;  3UK6 A;  4LJ9 A;  2BJV A;  3R8F A;  1QZM A;  1C1K A;  5EP2 A;  4LY6 A;  2DVW B;  1DO2 A;  1R7R A;  4Z8X A;  1IQP A;  1IN8 A;  1D2N A;  4L15 A;  3M0E A;  4GIT A;  4LCB A;  1G41 A;  1SXJ C;  1IN7 A;  1NY6 A;  2CEA A;  2C9C A;  3SYK A;  3CF2 A;  4KO8 A;  1SXJ B;  3EIE A;  5EP1 A;  1OFI A;  2KRK A;  1HQY E;  1SXJ D;  4QHS A;  5DYI A;  5FTN A;  3WHL A;  1IN5 A;  3PFI A;  4QNM A;  2C96 A;  2DZN B;  4FCT A;  2DWZ B;  3SYL A;  2QBY B;  4LRS A;  1IY1 A;  2C9O A;  3GLG A;  2QPA A;  2VII A;  3U5Z B;  3KW6 A;  1W5S A;  1G4A E;  1UM8 A;  3HU2 A;  2XSZ D;  3M6A A;  4LJ5 A;  1NJF A;  5C18 A;  4FWD A;  5FTM A;  2X8A A;  1XXH B;  2Z4S A;  1NSF A;  1LV7 A;  2R65 A;  1OJL A;  3GLH A;  3HWS A;  1IXZ A;  1HT2 E;  4QOS A;  3GLF A;  2ZAN A;  2FNA A;  4LRT A;  1R6B X;  4A3V B;  1X37 A;  3ZH9 B;  4D80 A;  2ZAO A;  1FNN A;  1KSF X; 
#chains in the Genus database with same CATH topology
 2DWM A;  2YFQ A;  3DFZ A;  1DV0 A;  2R4E A;  2JNH A;  3E9S A;  3J2P B;  2CV2 A;  4JV5 M;  1QAN A;  3LVW A;  2C98 A;  4PDG A;  4GC5 A;  4PCZ A;  1Q39 A;  3FTE A;  3VKG A;  3GLH B;  4IBK A;  1DGH A;  1V34 A;  1H6U A;  5EP4 A;  2L4F A;  2DZL A;  4DUZ M;  1PJJ A;  3PXG A;  1IBK M;  3UZU A;  2WSE F;  1T6O A;  2QSF X;  1F4I A;  2KRU A;  4P17 A;  4LZZ A;  5EXT A;  2YQZ A;  3I4V A;  3KOY E;  1I4W A;  4FWG A;  4YY3 M;  3GP1 A;  4ZPX A;  2LVO C;  3C3E A;  1YSY A;  1QAQ A;  3HJ8 A;  1IY0 A;  3I51 A;  2Y0T A;  3Q8G A;  4B3S M;  4LF7 M;  3UMM A;  2CP8 A;  3QYE A;  1IM2 A;  3VDP A;  4NL4 H;  4R7G A;  4WUR A;  3FKE A;  2D7H A;  3IG8 A;  4M0D A;  5EXX A;  4DR7 M;  1NV9 A;  2X49 A;  5IRE B;  1WR1 B;  2C99 A;  4JN6 A;  3J7B A;  4DR6 M;  2BJW A;  3KOW E;  4L78 A;  5C1B A;  5EXP A;  2KZU A;  3JR4 A;  3BXW A;  2XZU A;  2YNM D;  2DAM A;  5DNY A;  3U61 B;  3CGW A;  4CHT B;  3IHP A;  1TDZ A;  1WIV A;  3K92 A;  2VF7 A;  2JY5 A;  3D8B A;  2EA0 A;  1PJS A;  3QYB A;  2FFJ A;  1QYR A;  2JWS A;  4Q7J A;  3K1J A;  1DGG A;  1GVN A;  3U6D A;  2XF3 A;  2BWB A;  5ITT A;  1R5L A;  4GMQ A;  4IBF A;  4AKG A;  1PRB A;  1LTM A;  1E94 E;  1XMO M;  1QVR A;  3HU3 A;  4S12 A;  2DZO B;  1GJT A;  2G5G X;  3LCU A;  4WW0 A;  2DWN A;  4LG2 A;  1XB2 B;  3UK6 A;  4LGY A;  3R8F A;  1EFU B;  3GPP A;  1HNX M;  1E9S A;  2XEP A;  5EP2 A;  3FTC A;  3KSX A;  3LMM A;  3SAR A;  1R7R A;  2RRU A;  3C58 A;  3SAT A;  1R2Z A;  3M0E A;  4IBE A;  2O01 F;  2VF8 A;  4AG6 A;  2C9C A;  4L6V 6;  4IJF A;  4NC6 A;  2LTU A;  1OFI A;  3BBZ A;  1HQY E;  3KP0 E;  4IBG A;  2APL A;  5FTN A;  1XC8 A;  1XNQ M;  3CTW B;  1UFZ A;  3GQ5 A;  2D7E A;  2CV0 A;  4QNM A;  3FYC A;  4G6Z A;  2Z3X A;  3AKZ A;  2Z7J A;  1PJQ A;  4AG5 A;  3SAW A;  3T1H M;  4DV4 M;  1XMQ M;  2C9O A;  3LVV A;  3AV0 A;  3A98 B;  3GLG A;  4TUW A;  2LVP C;  4ITQ A;  3DOA A;  4LF8 M;  1W5S A;  1QUT A;  4JI3 M;  1NJF A;  4JI7 M;  3SHG B;  5L8R F;  1TF0 B;  5ITU A;  2L7H A;  1NSF A;  1LV7 A;  1MU5 A;  2I7P A;  3I04 M;  2R65 A;  5ITR A;  3U61 A;  2F5S A;  1Z5B A;  3J7A S;  5FLX S;  5GKN A;  4B7F A;  3GLF A;  1ZMU A;  3D8L A;  2J7O A;  5KPT A;  1R6B X;  3E46 A;  4X66 M;  5FTL A;  1FNN A;  1KSF X;  2YR0 A;  3WHL A;  2DAG A;  4AI6 A;  3L27 A;  1SXJ A;  4X64 M;  5E26 A;  1QZE A;  2ZAM A;  4JI8 M;  2EO2 A;  1N75 A;  3SHF A;  2CHV A;  3K9P A;  1IXS A;  2UUB M;  4LFC M;  2O25 A;  3M7G A;  2UUC M;  4KT0 F;  4X65 M;  2G3Q A;  4F1I A;  3FYD A;  2FH0 A;  2D7G A;  2LHG A;  1YLA A;  1XHB A;  4JI4 M;  2XSZ A;  3LCV B;  4LF5 M;  1TDH A;  1J7K A;  1QDR A;  3W0L B;  5FSW A;  3VK7 A;  4M9Z A;  2LBC A;  3GLG E;  1G8P A;  1GL7 A;  1K3W A;  4BLC A;  1Z5A A;  4LZJ A;  8CAT A;  3HHY A;  2UXC M;  4L16 A;  4FD2 A;  5BR8 M;  1NJG A;  4REZ A;  3IG5 A;  3TWM A;  2EKK A;  1TR8 A;  2JUJ A;  2XGN A;  1L8Q A;  2LHC A;  2K47 A;  4FCV A;  3ILK A;  4G4O A;  3SAV A;  3MHV C;  4GC9 A;  4D81 A;  3NBI A;  3WHK A;  2LVQ D;  2V1U A;  3HY5 A;  1MX0 A;  1Q3B A;  3SBJ A;  4LJ6 A;  1IBL M;  4Y28 F;  3FUW A;  2R18 A;  1L2C A;  2R4J A;  1VEG A;  2R62 A;  3U6C A;  1HR0 M;  2EUC A;  4GH9 A;  3AL0 C;  4QNR A;  3T15 A;  4G4N A;  1XXH A;  2V6Z M;  3QAU A;  4HLQ A;  3L29 A;  4RF1 A;  2P5T A;  1PGY A;  3TE6 A;  4JI6 M;  3J81 S;  1N78 A;  4WP2 A;  3LQR A;  2I7N A;  3U6Q A;  3GQ4 A;  3GLF B;  4OX9 M;  1JR3 D;  4AQY M;  2KZS A;  4GKK M;  3VKH A;  2XH9 A;  3U6M A;  3RE8 A;  4PT5 A;  4JI0 M;  2OQ4 A;  3U6P A;  2Q2E B;  4ANR A;  1OFH A;  4LJ7 A;  3ZCB B;  3KVW A;  3W67 A;  4X62 M;  1N77 A;  1JQJ C;  4W5W A;  4DV3 M;  4JI2 M;  1VG5 A;  1D0L A;  1TH4 A;  2LVN C;  4IBD A;  4G4R A;  1R2Y A;  4BBA A;  2KEB A;  3FUV A;  3C3D A;  1QZM A;  1C1K A;  4LY6 A;  1L2D A;  4G3O A;  1DO2 A;  1I94 M;  4K0K M;  1AUA A;  2KNA A;  4GIT A;  1C7Y A;  3T6P A;  3MJ5 A;  2KA6 B;  1IN7 A;  1NY6 A;  2V1C A;  1D0M A;  2NQ8 C;  3SYK A;  4KO8 A;  3DA1 A;  1SXJ B;  3L25 A;  3EIE A;  3K2L A;  3U60 B;  5EP1 A;  2DXI A;  2KRK A;  2F5O A;  3W68 A;  2MJ5 B;  2FOI C;  5IT9 S;  2CUZ A;  1PJT A;  3V76 A;  4OU7 A;  2DAI A;  2DNA A;  3RGP A;  3B74 A;  1N32 M;  4DR1 M;  3R9X B;  4R3D A;  2QBY B;  2CRU A;  4GHA A;  1WXQ A;  2BNK A;  3HHX A;  4DR3 M;  5KPR A;  3GRV A;  3TPZ A;  2UU9 M;  4IBI A;  4DR5 M;  3VK8 A;  4IJE A;  4RKU F;  2VII A;  4PDI A;  3U5Z B;  2QHO B;  2ZTC A;  1G4A E;  1ZV1 A;  3VDU A;  1UM8 A;  2UXB M;  1D0K A;  2XSZ D;  3B7N A;  4LJ5 A;  4KHP M;  2LXE A;  4LF6 M;  3AOE A;  1GAB A;  4B7G A;  3JR5 A;  3W0F A;  3RFW A;  1A5T A;  4OVZ B;  2J7N A;  4RNA A;  4DBG B;  3HWS A;  4XK8 F;  1GO5 A;  3SAU A;  3HJS A;  2ZBK B;  3T38 A;  2FNA A;  5H37 D;  1X37 A;  4LRT A;  3A45 A;  5DYG A;  4F2L A;  2HL7 A;  4FCW A;  4FVM A;  4Z6Y A;  1QDT A;  3GLI E;  3U60 A;  4NRW A;  2LWX A;  1W5T A;  2FS1 A;  3AFH A;  4NSO B;  3UGJ A;  2BWE A;  3ZC7 B;  4HL4 A;  1TGU A;  1HT1 E;  5FTK A;  5KQD A;  1JB0 F;  1MJG M;  4DV1 M;  2L4E A;  4CJ6 A;  4LFB M;  4YHH M;  3CF0 A;  4IIW A;  1QAO A;  4I5S A;  4KLN A;  1E9R A;  4FWH A;  2QQ8 A;  2E5L M;  3H4J A;  4B3T M;  3AOG A;  3MK6 A;  1FJG M;  3H4M A;  2Z8Y M;  5JI3 E;  1IN6 A;  3A46 A;  3E21 A;  1OIP A;  1OKS A;  2KXE A;  3KXE C;  3RGS A;  1IBM M;  2UUA M;  1IY2 A;  2ERC A;  3AOE C;  3BOS A;  3HU1 A;  4B3R M;  5JI2 E;  5EJC A;  3DZD A;  1GL6 A;  1CUK A;  2CE7 A;  2GQF A;  3I01 M;  4JI5 M;  2W82 A;  1JR3 A;  2F5Q A;  3GLG B;  2JA2 A;  2QEN A;  3KS4 A;  4I4L A;  4I8O A;  4LF9 M;  4JYA M;  4XGI A;  2DHR A;  2R6F A;  3NWL A;  4M0W A;  3L28 A;  3SMS A;  3I4Y A;  1GKI A;  2CV1 A;  4IBJ A;  4QHT A;  1NVM A;  2AHM A;  3VFD A;  2OPF A;  1N34 M;  1QUS A;  3GLH E;  2J5Y A;  2B3T A;  1K3X A;  2RGH A;  4EIW A;  2WSC F;  4PD2 A;  7CAT A;  1NNJ A;  3HGI A;  1TTE A;  1VDD A;  1ORY B;  4LJA A;  3EIH A;  3K8Z A;  4LJ8 A;  4B7H A;  1K82 A;  4NXM M;  2XFS A;  3NBX X;  3MMP A;  2CWB A;  2C5R A;  2WSF F;  5ITY A;  3TL4 X;  2JY7 A;  5EXS A;  3HZJ A;  3PVS A;  1Q02 A;  5KO3 A;  4UN2 B;  4CIS A;  3HX3 A;  2EJS A;  1DO0 A;  2KNV A;  3TWK A;  3FE3 A;  4LJ9 A;  1RU3 A;  1IFY A;  3QWL A;  1NHW C;  4G4Q A;  1ZAE A;  3J80 S;  4MH0 E;  3T1Y M;  3U6S A;  3SAS A;  3HHZ A;  4Z8X A;  1IQP A;  1IN8 A;  1D2N A;  1V92 A;  1L2B A;  1L1Z A;  2XFT A;  3IEC A;  1QQW A;  1G41 A;  2L7I A;  2HHH M;  3CF2 A;  3PNV A;  2XLJ A;  1QAM A;  4MB7 A;  2LH0 A;  2GNO A;  1SXJ D;  4QHS A;  3GO8 A;  1IN5 A;  3PFI A;  2OOB A;  3KS8 A;  1Y8G A;  4NOO B;  2C96 A;  1NNU C;  2DZN B;  2DWZ B;  1DGH B;  4FCT A;  4B3M M;  4LRS A;  1IY1 A;  2RGO A;  1OQY A;  4MGH A;  5E6J A;  4R71 A;  4MM3 B;  1WGL A;  2Y21 A;  1ZMV A;  4MGI E;  3FTF A;  1Z5C A;  3KW6 A;  4GEW A;  2DWL A;  4LFA M;  3HU2 A;  3M6A A;  4JI1 M;  1NO1 A;  4HEO A;  4FWD A;  5FTM A;  2DI0 A;  1XXH B;  3KP1 E;  2F4V M;  3KSJ A;  3GPU A;  1OAI A;  1T43 A;  3GLH A;  3FTD A;  1IXZ A;  1HT2 E;  4QOS A;  3U6L A;  3FRH A;  5A2Q S;  2A5Y B;  3FRI A;  4GRI A;  4D80 A;  3GQ3 A;  5IZ7 D;  4CIZ A;  2L6O A;  2RKO A;  4DR4 M;  2QCU A;  1IN4 A;  3VLF B;  3FUT A;  1PJI A;  1GJS A;  5DFL A;  4FW9 A;  1XXH E;  3GPX A;  1WHC A;  3U6O A;  2X4A A;  3SFZ A;  3F92 A;  5ITQ A;  1N33 M;  1VDL A;  5FTJ A;  1YUB A;  2EKF A;  2Z4R A;  2QNJ A;  1P3Q Q;  2JZ0 A;  3AJI B;  3B7Q A;  2L09 A;  2K6B A;  2HWJ A;  1KYI A;  1IXS B;  1IXR C;  1V33 A;  3GRU A;  4GIP A;  4IBC A;  4KOD A;  1T3T A;  3KOZ E;  4NXN M;  1Z6T A;  1VQ1 A;  3OTO M;  1Z59 A;  2JXN A;  3KDS E;  4I81 A;  1NY5 A;  4LF4 M;  4DUY M;  3L2A A;  1E32 A;  2HCB A;  3J27 B;  4OVZ A;  4XBO A;  3B9P A;  3PNY A;  4II7 A;  2ZTD A;  3FD9 A;  1XNR M;  3CF6 E;  2M5Z A;  5LMN M;  2CHG A;  3SC3 A;  3GPY A;  1NV8 A;  3ZQJ A;  3TQS A;  2N35 A;  3KFU G;  2JP7 A;  3LQQ A;  2OO9 A;  1PM5 A;  1HNW M;  2JZ1 A;  4BB9 A;  1G3I A;  2R0I A;  1AIP C;  1NHG C;  2KW0 A;  5KPZ A;  2CHQ A;  4LJ4 A;  5BPV A;  5IWA M;  1BVS A;  3C9P A;  4DR2 M;  4LGM A;  3K9O A;  4M9S A;  1KFV A;  1YE9 A;  2WZJ A;  2MH8 A;  5EQT A;  4QOZ C;  4IBB A;  1SXJ E;  1EE8 A;  2F5P A;  4GHL A;  1GLN A;  3U6E A;  2H1R A;  2MR9 A;  5ITX E;  1TH3 A;  2KNZ A;  2R45 A;  2O5R A;  4AKH A;  2JY6 B;  2ZAO A;  3GLI A;  2FE8 A;  3E4R A;  2CFO A;  2K9D A;  2QBY A;  2Y0Q A;  3LW5 F;  1SG9 A;  3HHW A;  4P16 A;  3GLF E;  2QP9 X;  4NRV A;  2HAK A;  2LNH C;  4L4U A;  3SMP A;  1ZQ9 A;  4D82 A;  4DV0 M;  3Q8X A;  2M60 A;  4AW4 A;  4AKI A;  3UJN A;  2LVA A;  5EP3 A;  1HQC A;  1WJ7 A;  2KDL A;  1MN3 A;  3JAM S;  2UXD M;  1DGF A;  1DGB A;  4AZF A;  2OOA A;  1XWI A;  1G71 A;  1S3S A;  2QZ4 A;  4CGY B;  1VEK A;  5KQ8 A;  3FUX A;  2BJV A;  2DAE A;  2DVW B;  4DV5 M;  3A42 A;  2K0B X;  2G8L A;  2DKL A;  3TWL A;  1G59 A;  4L15 A;  4MGK E;  4LCB A;  1SXJ C;  2CEA A;  2L2D A;  1Q3C A;  4M9X A;  2ZM6 M;  2F5N A;  4DV6 M;  1R4G A;  1JR3 E;  2KHH A;  1WGN A;  4B08 A;  5DYI A;  2R44 A;  4MGY E;  2JY8 A;  3B7Z A;  4OW0 A;  4RF0 A;  1J5E M;  1N36 M;  3GRY A;  1HJP A;  1OAO C;  3SYL A;  3HKP A;  2DHY A;  4JXJ A;  4GKJ M;  2DEN A;  2QPA A;  2MGW A;  3FUU A;  3GRR A;  3HJQ A;  2DAK A;  5LMU M;  1TH2 A;  4NSR A;  4DV7 M;  4L8R C;  3L26 A;  2HKJ A;  3B89 A;  4DV2 M;  3KOX E;  3THG A;  5C18 A;  1L1T A;  2X8A A;  2VQF M;  2H5X A;  1HNZ M;  2Z4S A;  2VQE M;  2MRO B;  2Y20 A;  4MGZ E;  3U5Z A;  1OJL A;  1OTR A;  1VEJ A;  1ZMW A;  5F3W A;  2ZAN A;  2R46 A;  5ITX A;  1J09 A;  4A3V B;  2XZF A;  3ZH9 B;  3GLI B;  2VDB B;  1OIZ A;  1EIJ A; 
#chains in the Genus database with same CATH homology
 2DWM A;  2YFQ A;  3DFZ A;  2R4E A;  3J2P B;  3E9S A;  2CV2 A;  4JV5 M;  1QAN A;  3LVW A;  2C98 A;  4PDG A;  4GC5 A;  4PCZ A;  1Q39 A;  3FTE A;  3VKG A;  3GLH B;  4IBK A;  1DGH A;  1H6U A;  5EP4 A;  4DUZ M;  1PJJ A;  3PXG A;  1IBK M;  3UZU A;  2KRU A;  5EXT A;  4LZZ A;  2YQZ A;  3I4V A;  3KOY E;  1I4W A;  4FWG A;  4YY3 M;  3GP1 A;  4ZPX A;  1YSY A;  1QAQ A;  3HJ8 A;  1IY0 A;  3I51 A;  2Y0T A;  4B3S M;  4LF7 M;  3UMM A;  1IM2 A;  3VDP A;  4NL4 H;  4R7G A;  4WUR A;  3FKE A;  2D7H A;  3IG8 A;  4M0D A;  5EXX A;  4DR7 M;  2X49 A;  5IRE B;  2C99 A;  4JN6 A;  3J7B A;  4DR6 M;  2BJW A;  3KOW E;  4L78 A;  5C1B A;  5EXP A;  2KZU A;  3JR4 A;  2XZU A;  2YNM D;  5DNY A;  3U61 B;  4CHT B;  1TDZ A;  3K92 A;  3D8B A;  2EA0 A;  2FFJ A;  1QYR A;  3K1J A;  1DGG A;  1GVN A;  3U6D A;  2XF3 A;  5ITT A;  4GMQ A;  4IBF A;  4AKG A;  1E94 E;  1XMO M;  1QVR A;  3HU3 A;  4S12 A;  2DZO B;  2G5G X;  4WW0 A;  2DWN A;  4LG2 A;  3UK6 A;  4LGY A;  3R8F A;  1HNX M;  3GPP A;  1E9S A;  2XEP A;  5EP2 A;  3FTC A;  3KSX A;  3LMM A;  3SAR A;  1R7R A;  3C58 A;  3SAT A;  1R2Z A;  3M0E A;  4IBE A;  4AG6 A;  2C9C A;  4IJF A;  1XNQ M;  1OFI A;  3KP0 E;  1HQY E;  4IBG A;  5FTN A;  1XC8 A;  3CTW B;  2D7E A;  2CV0 A;  4QNM A;  3FYC A;  4G6Z A;  2Z3X A;  3AKZ A;  2Z7J A;  3T1H M;  4AG5 A;  3SAW A;  4DV4 M;  1XMQ M;  2C9O A;  3LVV A;  3AV0 A;  3A98 B;  3GLG A;  4TUW A;  4ITQ A;  3DOA A;  4LF8 M;  1W5S A;  4JI3 M;  1NJF A;  4JI7 M;  3SHG B;  5ITU A;  2L7H A;  1NSF A;  1LV7 A;  1MU5 A;  2I7P A;  3U61 A;  2R65 A;  5ITR A;  2F5S A;  3J7A S;  1Z5B A;  5FLX S;  5GKN A;  4B7F A;  3GLF A;  3D8L A;  2J7O A;  5KPT A;  1R6B X;  4X66 M;  5FTL A;  1FNN A;  2YR0 A;  1KSF X;  3WHL A;  4AI6 A;  3L27 A;  1SXJ A;  4X64 M;  5E26 A;  2ZAM A;  4JI8 M;  2EO2 A;  1N75 A;  3SHF A;  2CHV A;  2UUB M;  4LFC M;  3M7G A;  2UUC M;  4X65 M;  3FYD A;  2D7G A;  1XHB A;  4JI4 M;  2XSZ A;  4LF5 M;  1TDH A;  1J7K A;  3W0L B;  5FSW A;  3VK7 A;  4M9Z A;  1G8P A;  1GL7 A;  1K3W A;  4BLC A;  1Z5A A;  4LZJ A;  8CAT A;  3HHY A;  2UXC M;  4L16 A;  4FD2 A;  5BR8 M;  1NJG A;  4REZ A;  3IG5 A;  3TWM A;  2XGN A;  1L8Q A;  2K47 A;  4FCV A;  3ILK A;  4G4O A;  3SAV A;  3MHV C;  4GC9 A;  4D81 A;  3NBI A;  3WHK A;  2V1U A;  1MX0 A;  1Q3B A;  3SBJ A;  4LJ6 A;  1IBL M;  3FUW A;  2R18 A;  1L2C A;  2R4J A;  2R62 A;  3U6C A;  1HR0 M;  2EUC A;  4GH9 A;  3AL0 C;  4QNR A;  3T15 A;  4G4N A;  1XXH A;  2V6Z M;  3QAU A;  4HLQ A;  3L29 A;  4RF1 A;  2P5T A;  3TE6 A;  4JI6 M;  3J81 S;  1N78 A;  3LQR A;  2I7N A;  3U6Q A;  3GQ4 A;  3GLF B;  4OX9 M;  1JR3 D;  4AQY M;  2KZS A;  4GKK M;  3VKH A;  2XH9 A;  3U6M A;  3RE8 A;  4PT5 A;  4JI0 M;  2OQ4 A;  3U6P A;  2Q2E B;  1OFH A;  4LJ7 A;  3ZCB B;  3KVW A;  4X62 M;  1N77 A;  1JQJ C;  4W5W A;  4DV3 M;  4JI2 M;  1TH4 A;  4IBD A;  4G4R A;  1R2Y A;  4BBA A;  2KEB A;  3FUV A;  1QZM A;  1C1K A;  4LY6 A;  1L2D A;  1DO2 A;  1I94 M;  4K0K M;  4GIT A;  3MJ5 A;  2KA6 B;  1IN7 A;  1NY6 A;  2V1C A;  2NQ8 C;  3SYK A;  3L25 A;  4KO8 A;  3DA1 A;  1SXJ B;  3EIE A;  3K2L A;  2DXI A;  5EP1 A;  2KRK A;  2F5O A;  5IT9 S;  2FOI C;  2CUZ A;  4OU7 A;  3RGP A;  1N32 M;  4DR1 M;  3R9X B;  4R3D A;  2QBY B;  4GHA A;  1WXQ A;  2BNK A;  3HHX A;  4DR3 M;  5KPR A;  3GRV A;  3TPZ A;  2UU9 M;  4IBI A;  4DR5 M;  3VK8 A;  4IJE A;  4PDI A;  2VII A;  3U5Z B;  1G4A E;  3VDU A;  2UXB M;  1UM8 A;  2XSZ D;  4KHP M;  4LJ5 A;  2LXE A;  4LF6 M;  3AOE A;  4B7G A;  3JR5 A;  3W0F A;  3RFW A;  4OVZ B;  2J7N A;  4RNA A;  3HWS A;  3SAU A;  3HJS A;  2ZBK B;  3T38 A;  2FNA A;  5H37 D;  1X37 A;  4LRT A;  3A45 A;  5DYG A;  2HL7 A;  4FCW A;  4FVM A;  4Z6Y A;  3U60 A;  4NRW A;  2LWX A;  1W5T A;  3AFH A;  4NSO B;  3UGJ A;  3ZC7 B;  4HL4 A;  1TGU A;  1HT1 E;  5FTK A;  5KQD A;  4DV1 M;  4LFB M;  4YHH M;  3CF0 A;  4IIW A;  1QAO A;  4I5S A;  4KLN A;  1E9R A;  4FWH A;  2E5L M;  4B3T M;  3AOG A;  3MK6 A;  1FJG M;  3H4M A;  5JI3 E;  1IN6 A;  3A46 A;  2KXE A;  3KXE C;  3RGS A;  1IBM M;  2UUA M;  1IY2 A;  2ERC A;  3AOE C;  3BOS A;  3HU1 A;  4B3R M;  5JI2 E;  5EJC A;  3DZD A;  1GL6 A;  2CE7 A;  4JI5 M;  2W82 A;  1JR3 A;  2F5Q A;  3GLG B;  2JA2 A;  2QEN A;  3KS4 A;  4I4L A;  4I8O A;  4LF9 M;  4JYA M;  4XGI A;  2DHR A;  4M0W A;  3NWL A;  3L28 A;  3SMS A;  3I4Y A;  1GKI A;  2CV1 A;  4IBJ A;  4QHT A;  1NVM A;  2AHM A;  3VFD A;  2OPF A;  1N34 M;  1K3X A;  2RGH A;  4EIW A;  4PD2 A;  7CAT A;  1NNJ A;  3HGI A;  1VDD A;  1ORY B;  4LJA A;  3EIH A;  3K8Z A;  4LJ8 A;  4B7H A;  1K82 A;  4NXM M;  2XFS A;  2C5R A;  5ITY A;  3TL4 X;  5EXS A;  4CIS A;  3PVS A;  5KO3 A;  1DO0 A;  3TWK A;  4LJ9 A;  3QWL A;  1NHW C;  4G4Q A;  1ZAE A;  3J80 S;  4MH0 E;  3T1Y M;  3U6S A;  3SAS A;  3HHZ A;  4Z8X A;  1IQP A;  1IN8 A;  1D2N A;  1L2B A;  1L1Z A;  2XFT A;  1QQW A;  1G41 A;  2L7I A;  2HHH M;  3CF2 A;  3PNV A;  2XLJ A;  1QAM A;  4MB7 A;  2LH0 A;  1SXJ D;  4QHS A;  3GO8 A;  1IN5 A;  3PFI A;  3KS8 A;  4NOO B;  2C96 A;  1NNU C;  2DZN B;  2DWZ B;  1DGH B;  4FCT A;  4B3M M;  4LRS A;  1IY1 A;  2RGO A;  5E6J A;  4MGH A;  4MM3 B;  2Y21 A;  4MGI E;  3FTF A;  1Z5C A;  3KW6 A;  2DWL A;  4LFA M;  3HU2 A;  3M6A A;  4JI1 M;  4FWD A;  5FTM A;  1XXH B;  3KP1 E;  2F4V M;  3KSJ A;  3GPU A;  3GLH A;  3FTD A;  1IXZ A;  1HT2 E;  4QOS A;  3U6L A;  5A2Q S;  2A5Y B;  4GRI A;  4D80 A;  3GQ3 A;  5IZ7 D;  2L6O A;  2RKO A;  4DR4 M;  2QCU A;  1IN4 A;  3VLF B;  3FUT A;  1PJI A;  4FW9 A;  3GPX A;  3U6O A;  2X4A A;  3SFZ A;  5ITQ A;  1N33 M;  5FTJ A;  1YUB A;  2Z4R A;  3U60 B;  3AJI B;  3GQ5 A;  2L09 A;  4GIP A;  1KYI A;  1IXS B;  1IXR C;  3GRU A;  4IBC A;  4KOD A;  3OTO M;  4GHL A;  1T3T A;  3KOZ E;  4NXN M;  1Z6T A;  1Z59 A;  3KDS E;  4I81 A;  1NY5 A;  4LF4 M;  4DUY M;  3L2A A;  1E32 A;  2HCB A;  3J27 B;  4OVZ A;  4XBO A;  3B9P A;  3PNY A;  4II7 A;  3FD9 A;  1XNR M;  3CF6 E;  2M5Z A;  5LMN M;  2CHG A;  3SC3 A;  3GPY A;  3TQS A;  3KFU G;  1PM5 A;  3LQQ A;  1HNW M;  4BB9 A;  1G3I A;  5KPZ A;  2KW0 A;  1NHG C;  2CHQ A;  4LJ4 A;  5BPV A;  5IWA M;  4DR2 M;  4LGM A;  4M9S A;  1KFV A;  1YE9 A;  5EQT A;  4QOZ C;  4IBB A;  1SXJ E;  1EE8 A;  2F5P A;  1GLN A;  3U6E A;  2H1R A;  5ITX E;  1TH3 A;  2R45 A;  2O5R A;  4AKH A;  3GLI A;  2FE8 A;  3E4R A;  2CFO A;  2QBY A;  2Y0Q A;  3HHW A;  4P16 A;  2QP9 X;  4NRV A;  4L4U A;  2LNH C;  3SMP A;  4D82 A;  1ZQ9 A;  4DV0 M;  3Q8X A;  2M60 A;  4AW4 A;  4AKI A;  3UJN A;  5EP3 A;  1HQC A;  2UXD M;  3JAM S;  1DGF A;  1DGB A;  4AZF A;  4CGY B;  1XWI A;  1S3S A;  2QZ4 A;  5KQ8 A;  3FUX A;  2BJV A;  2DVW B;  4DV5 M;  3A42 A;  2G8L A;  3TWL A;  1G59 A;  4L15 A;  4MGK E;  4LCB A;  1SXJ C;  2CEA A;  2ZM6 M;  1Q3C A;  4M9X A;  2F5N A;  4DV6 M;  4B08 A;  5DYI A;  4MGY E;  4OW0 A;  4RF0 A;  1J5E M;  1N36 M;  3GRY A;  3SYL A;  3HKP A;  4JXJ A;  4GKJ M;  2QPA A;  3FUU A;  3GRR A;  3HJQ A;  5LMU M;  1TH2 A;  4NSR A;  4DV7 M;  4L8R C;  3L26 A;  2HKJ A;  4DV2 M;  3KOX E;  3THG A;  5C18 A;  1L1T A;  2X8A A;  2VQF M;  1HNZ M;  2Z4S A;  2VQE M;  2Y20 A;  4MGZ E;  3U5Z A;  1OJL A;  5F3W A;  2ZAN A;  2R46 A;  5ITX A;  1J09 A;  4A3V B;  2XZF A;  3ZH9 B;  3GLI B;  2ZAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...