2E0KA

Crystal structure of cbil, a methyltransferase involved in anaerobic vitamin b12 biosynthesis
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
245
structure length
241
Chain Sequence
MNNQGSIISVSLGPGDPGLITVKALSQLREADVIYYPGTVSASGAVTSVALDILKEFDLDPSKLRGMLVPMSRSRASYAANYASMAEEVQAGRRVAVVSVGDGGFYSTASAIIERARRDGLDCSMTPGIPAFIAAGSAAGMPLALQSDSVLVLAQIDEIGELERALVTHSTVVVMKLSTVRDELVSFLERYAKPFLYAEKVGMAGEFITMEVDALRSRAIPYFSLLVCSPHCRQSTLSPFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of CbiL, a methyltransferase involved in anaerobic vitamin B biosynthesis, and CbiL in complex with S-adenosylhomocysteine--implications for the reaction mechanism.
pubmed doi rcsb
source organism Chlorobaculum tepidum
molecule tags Transferase
molecule keywords Precorrin-2 C20-methyltransferase
total genus 66
structure length 241
sequence length 245
chains with identical sequence B
ec nomenclature ec 2.1.1.130: Precorrin-2 C(20)-methyltransferase.
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 2e0kA02
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 2e0kA01
2HR8A 2EJZA 2ED5A 2P5FA 5HW4A 2ELDA 2EL3A 2P6LA 2EEQA 1VA0A 2DEKA 1VCEA 1CBFA 2EHLA 2DV5A 3NUTA 2EH5A 3NDCA 2E07A 2BB3A 2CBFA 2OWVA 2PB6A 3FFYA 1PJTA 2EH4A 2EHCA 2E17A 2EK7A 2DSHA 3KWPA 2PCGA 2EK4A 3I4TA 3NEIA 2DXVA 1WNGA 2DXXA 2OWGA 2EL0A 2PCIA 1WYZA 2ENIA 2P6DA 2HUVA 2EJJA 2EN5A 1WDEA 2NPNA 1PJSA 2YBQA 2HUXA 2E8HA 2DV3A 2E8QA 2E8RA 2P6IA 2DV4A 2E8SA 2EKAA 1PJQA 2E7RA 2PCKA 2EL1A 2ED3A 2PCHA 2EL2A 2PCMA 2OWFA 2EMUA 2P5CA 2EK3A 4E16A 2OWUA 2P2XA 2E4NA 1VE2A 2E16A 2EMRA 3HH1A 2QBUA 2E0KA 1S4DA 2EGLA 2ZVCA 2DSIA 2HUTA 2DV7A 2PB5A 2E4RA 2P9DA 2DXWA 3ND1A 2OWKA 2E15A 2EGSA 2ZVBA 3FQ6A 2P6KA 2Z6RA 2E0NA 2ELEA 1V9AA 2PB4A 1VHVA 2PCAA 2EH2A 2EGBA 2DSGA 2E08A 2EK2A 2EJKA 2HUQA 2YBOA
chains in the Genus database with same CATH superfamily
2KYYA 3SZUA 2HR8A 2EJZA 3KE9A 3KEMA 2ED5A 3UV7A 2P5FA 5HW4A 2ELDA 2EL3A 3SZLA 3KELA 2P6LA 2EEQA 1VA0A 2DEKA 1VCEA 1CBFA 2EHLA 2DV5A 3NUTA 2EH5A 3NDCA 2E07A 3F7TA 4MUYA 3ZGNA 2BB3A 2CBFA 2OWVA 4MUXA 4MV5A 2PB6A 3FFYA 1PJTA 2EH4A 2EHCA 2E17A 2EK7A 3URKA 2DSHA 3KWPA 2PCGA 2EK4A 3LMMA 3I4TA 3NEIA 2DXVA 1WNGA 2DXXA 3KEFA 4H4DA 3T0FA 2OWGA 2EL0A 2PCIA 1WYZA 2ENIA 2P6DA 3KE8A 2HUVA 3ZGLA 3DNFA 2EJJA 2EN5A 1WDEA 4H4CA 2NPNA 1PJSA 2YBQA 2HUXA 2E8HA 2DV3A 2E8QA 2E8RA 2P6IA 2DV4A 2E8SA 2EKAA 1PJQA 2E7RA 2PCKA 2EL1A 2ED3A 2PCHA 2EL2A 3UV3A 2PCMA 2OWFA 4MV0A 2EMUA 2P5CA 2EK3A 3UWMA 4E16A 2OWUA 2P2XA 2E4NA 1VE2A 2E16A 2EMRA 3HH1A 3SZOA 3UV6A 3T0GA 2QBUA 2E0KA 1S4DA 2EGLA 2ZVCA 2DSIA 4H4EA 2HUTA 2DV7A 2PB5A 2E4RA 2P9DA 2DXWA 3UTDA 3TIXB 4N7BA 3ND1A 2OWKA 2E15A 2EGSA 2ZVBA 3FQ6A 2P6KA 2Z6RA 3UTCA 2E0NA 2ELEA 1V9AA 2PB4A 1VHVA 2PCAA 2EH2A 2EGBA 2DSGA 2E08A 2EK2A 4EB3A 2EJKA 2HUQA 2YBOA
chains in the Genus database with same CATH topology
2KYYA 3SZUA 2HR8A 2EJZA 3KE9A 3KEMA 2ED5A 3UV7A 2P5FA 5HW4A 2ELDA 2EL3A 3SZLA 3KELA 2P6LA 2EEQA 1VA0A 2DEKA 1VCEA 1CBFA 2EHLA 2DV5A 3NUTA 2EH5A 3NDCA 2E07A 3F7TA 4MUYA 3ZGNA 2BB3A 2CBFA 2OWVA 4MUXA 4MV5A 2PB6A 3FFYA 1PJTA 2EH4A 2EHCA 2E17A 2EK7A 3URKA 2DSHA 3KWPA 2PCGA 2EK4A 3LMMA 3I4TA 3NEIA 2DXVA 1WNGA 2DXXA 3KEFA 4H4DA 3T0FA 2OWGA 2EL0A 2PCIA 1WYZA 2ENIA 2P6DA 3KE8A 2HUVA 3ZGLA 3DNFA 2EJJA 2EN5A 1WDEA 4H4CA 2NPNA 1PJSA 2YBQA 2HUXA 2E8HA 2DV3A 2E8QA 2E8RA 2P6IA 2DV4A 2E8SA 2EKAA 1PJQA 2E7RA 2PCKA 2EL1A 2ED3A 2PCHA 2EL2A 3UV3A 2PCMA 2OWFA 4MV0A 2EMUA 2P5CA 2EK3A 3UWMA 4E16A 2OWUA 2P2XA 2E4NA 1VE2A 2E16A 2EMRA 3HH1A 3SZOA 3UV6A 3T0GA 2QBUA 2E0KA 1S4DA 2EGLA 2ZVCA 2DSIA 4H4EA 2HUTA 2DV7A 2PB5A 2E4RA 2P9DA 2DXWA 3UTDA 3TIXB 4N7BA 3ND1A 2OWKA 2E15A 2EGSA 2ZVBA 3FQ6A 2P6KA 2Z6RA 3UTCA 2E0NA 2ELEA 1V9AA 2PB4A 1VHVA 2PCAA 2EH2A 2EGBA 2DSGA 2E08A 2EK2A 4EB3A 2EJKA 2HUQA 2YBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HR8 A;  2EJZ A;  2ED5 A;  2P5F A;  5HW4 A;  2ELD A;  2EL3 A;  2P6L A;  2EEQ A;  1VA0 A;  2DEK A;  1VCE A;  1CBF A;  2EHL A;  2DV5 A;  3NUT A;  2EH5 A;  3NDC A;  2E07 A;  2BB3 A;  2CBF A;  2OWV A;  2PB6 A;  3FFY A;  1PJT A;  2EH4 A;  2EHC A;  2E17 A;  2EK7 A;  2DSH A;  3KWP A;  2PCG A;  2EK4 A;  3I4T A;  3NEI A;  2DXV A;  1WNG A;  2DXX A;  2OWG A;  2EL0 A;  2PCI A;  1WYZ A;  2ENI A;  2P6D A;  2HUV A;  2EJJ A;  2EN5 A;  1WDE A;  2NPN A;  1PJS A;  2YBQ A;  2HUX A;  2E8H A;  2DV3 A;  2E8Q A;  2E8R A;  2P6I A;  2DV4 A;  2E8S A;  2EKA A;  1PJQ A;  2E7R A;  2PCK A;  2EL1 A;  2ED3 A;  2PCH A;  2EL2 A;  2PCM A;  2OWF A;  2EMU A;  2P5C A;  2EK3 A;  4E16 A;  2OWU A;  2P2X A;  2E4N A;  1VE2 A;  2E16 A;  2EMR A;  3HH1 A;  2QBU A;  2E0K A;  1S4D A;  2EGL A;  2ZVC A;  2DSI A;  2HUT A;  2DV7 A;  2PB5 A;  2E4R A;  2P9D A;  2DXW A;  3ND1 A;  2OWK A;  2E15 A;  2EGS A;  2ZVB A;  3FQ6 A;  2P6K A;  2Z6R A;  2E0N A;  2ELE A;  1V9A A;  2PB4 A;  1VHV A;  2PCA A;  2EH2 A;  2EGB A;  2DSG A;  2E08 A;  2EK2 A;  2EJK A;  2HUQ A;  2YBO A; 
#chains in the Genus database with same CATH topology
 2KYY A;  3SZU A;  2HR8 A;  2EJZ A;  3KE9 A;  3KEM A;  2ED5 A;  3UV7 A;  2P5F A;  5HW4 A;  2ELD A;  2EL3 A;  3SZL A;  3KEL A;  2P6L A;  2EEQ A;  1VA0 A;  2DEK A;  1VCE A;  1CBF A;  2EHL A;  2DV5 A;  3NUT A;  2EH5 A;  3NDC A;  2E07 A;  3F7T A;  4MUY A;  3ZGN A;  2BB3 A;  2CBF A;  2OWV A;  4MUX A;  4MV5 A;  2PB6 A;  3FFY A;  1PJT A;  2EH4 A;  2EHC A;  2E17 A;  2EK7 A;  3URK A;  2DSH A;  3KWP A;  2PCG A;  2EK4 A;  3LMM A;  3I4T A;  3NEI A;  2DXV A;  1WNG A;  2DXX A;  3KEF A;  4H4D A;  3T0F A;  2OWG A;  2EL0 A;  2PCI A;  1WYZ A;  2ENI A;  2P6D A;  3KE8 A;  2HUV A;  3ZGL A;  3DNF A;  2EJJ A;  2EN5 A;  1WDE A;  4H4C A;  2NPN A;  1PJS A;  2YBQ A;  2HUX A;  2E8H A;  2DV3 A;  2E8Q A;  2E8R A;  2P6I A;  2DV4 A;  2E8S A;  2EKA A;  1PJQ A;  2E7R A;  2PCK A;  2EL1 A;  2ED3 A;  2PCH A;  2EL2 A;  3UV3 A;  2PCM A;  2OWF A;  4MV0 A;  2EMU A;  2P5C A;  2EK3 A;  3UWM A;  4E16 A;  2OWU A;  2P2X A;  2E4N A;  1VE2 A;  2E16 A;  2EMR A;  3HH1 A;  3SZO A;  3UV6 A;  3T0G A;  2QBU A;  2E0K A;  1S4D A;  2EGL A;  2ZVC A;  2DSI A;  4H4E A;  2HUT A;  2DV7 A;  2PB5 A;  2E4R A;  2P9D A;  2DXW A;  3UTD A;  3TIX B;  4N7B A;  3ND1 A;  2OWK A;  2E15 A;  2EGS A;  2ZVB A;  3FQ6 A;  2P6K A;  2Z6R A;  3UTC A;  2E0N A;  2ELE A;  1V9A A;  2PB4 A;  1VHV A;  2PCA A;  2EH2 A;  2EGB A;  2DSG A;  2E08 A;  2EK2 A;  4EB3 A;  2EJK A;  2HUQ A;  2YBO A; 
#chains in the Genus database with same CATH homology
 2KYY A;  3SZU A;  2HR8 A;  2EJZ A;  3KE9 A;  3KEM A;  2ED5 A;  3UV7 A;  2P5F A;  5HW4 A;  2ELD A;  2EL3 A;  3SZL A;  3KEL A;  2P6L A;  2EEQ A;  1VA0 A;  2DEK A;  1VCE A;  1CBF A;  2EHL A;  2DV5 A;  3NUT A;  2EH5 A;  3NDC A;  2E07 A;  3F7T A;  4MUY A;  3ZGN A;  2BB3 A;  2CBF A;  2OWV A;  4MUX A;  4MV5 A;  2PB6 A;  3FFY A;  1PJT A;  2EH4 A;  2EHC A;  2E17 A;  2EK7 A;  3URK A;  2DSH A;  3KWP A;  2PCG A;  2EK4 A;  3LMM A;  3I4T A;  3NEI A;  2DXV A;  1WNG A;  2DXX A;  3KEF A;  4H4D A;  3T0F A;  2OWG A;  2EL0 A;  2PCI A;  1WYZ A;  2ENI A;  2P6D A;  3KE8 A;  2HUV A;  3ZGL A;  3DNF A;  2EJJ A;  2EN5 A;  1WDE A;  4H4C A;  2NPN A;  1PJS A;  2YBQ A;  2HUX A;  2E8H A;  2DV3 A;  2E8Q A;  2E8R A;  2P6I A;  2DV4 A;  2E8S A;  2EKA A;  1PJQ A;  2E7R A;  2PCK A;  2EL1 A;  2ED3 A;  2PCH A;  2EL2 A;  3UV3 A;  2PCM A;  2OWF A;  4MV0 A;  2EMU A;  2P5C A;  2EK3 A;  3UWM A;  4E16 A;  2OWU A;  2P2X A;  2E4N A;  1VE2 A;  2E16 A;  2EMR A;  3HH1 A;  3SZO A;  3UV6 A;  3T0G A;  2QBU A;  2E0K A;  1S4D A;  2EGL A;  2ZVC A;  2DSI A;  4H4E A;  2HUT A;  2DV7 A;  2PB5 A;  2E4R A;  2P9D A;  2DXW A;  3UTD A;  3TIX B;  4N7B A;  3ND1 A;  2OWK A;  2E15 A;  2EGS A;  2ZVB A;  3FQ6 A;  2P6K A;  2Z6R A;  3UTC A;  2E0N A;  2ELE A;  1V9A A;  2PB4 A;  1VHV A;  2PCA A;  2EH2 A;  2EGB A;  2DSG A;  2E08 A;  2EK2 A;  4EB3 A;  2EJK A;  2HUQ A;  2YBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...