2E0KA

Crystal structure of cbil, a methyltransferase involved in anaerobic vitamin b12 biosynthesis
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
245
structure length
241
Chain Sequence
b'MNNQGSIISVSLGPGDPGLITVKALSQLREADVIYYPGTVSASGAVTSVALDILKEFDLDPSKLRGMLVPMSRSRASYAANYASMAEEVQAGRRVAVVSVGDGGFYSTASAIIERARRDGLDCSMTPGIPAFIAAGSAAGMPLALQSDSVLVLAQIDEIGELERALVTHSTVVVMKLSTVRDELVSFLERYAKPFLYAEKVGMAGEFITMEVDALRSRAIPYFSLLVCSPHCRQSTLSPFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Precorrin-2 C20-methyltransferase
publication title Crystal structures of CbiL, a methyltransferase involved in anaerobic vitamin B biosynthesis, and CbiL in complex with S-adenosylhomocysteine--implications for the reaction mechanism.
pubmed doi rcsb
source organism Chlorobaculum tepidum
molecule tags Transferase
total genus 66
structure length 241
sequence length 245
chains with identical sequence B
ec nomenclature ec 2.1.1.130: Precorrin-2 C(20)-methyltransferase.
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 2e0kA02
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 2e0kA01
2P6DA 2EGSA 2NPNA 2PCGA 2DV5A 2YBQA 2EL2A 2E16A 2E8SA 2E7RA 2EH4A 2EK3A 2E0KA 2PCIA 2E4NA 2DEKA 2ZVBA 1PJSA 2OWFA 5HW4A 2PCMA 1CBFA 2E8RA 2P6IA 2BB3A 2EHCA 2EJJA 2EH2A 1VE2A 2E15A 2EGLA 3NDCA 4E16A 2EKAA 2Z6RA 2P6LA 1V9AA 1VA0A 2DV3A 2HUTA 2OWKA 2EL3A 2DSIA 3HH1A 3I4TA 1PJTA 2QBUA 2EGBA 2CBFA 2PB4A 2EEQA 2EHLA 2ED3A 2E0NA 1VHVA 2ELDA 2P5CA 2EL0A 1PJQA 2EMRA 1WNGA 2PB5A 2PCHA 1WYZA 2EL1A 2HUVA 2P6KA 3NUTA 2DXXA 2HUXA 2EJKA 2EK7A 3FFYA 2E08A 2EMUA 2P2XA 2ENIA 2ZVCA 3ND1A 2ED5A 1VCEA 3KWPA 2E07A 2ELEA 2E8QA 2P5FA 2OWVA 2HR8A 2PCKA 2PCAA 2E4RA 2DV7A 2P9DA 2OWGA 2EJZA 2DSGA 2YBOA 2HUQA 2EK4A 2DSHA 2DXVA 2DV4A 2EN5A 3FQ6A 2E17A 3NEIA 1S4DA 2DXWA 2EH5A 1WDEA 2EK2A 2PB6A 2E8HA 2OWUA
chains in the Genus database with same CATH superfamily
2P6DA 2EGSA 2NPNA 2PCGA 2DV5A 2YBQA 2EL2A 2E16A 2E8SA 2E7RA 2EH4A 2EK3A 2E0KA 2PCIA 3ZGNA 2E4NA 2DEKA 2ZVBA 1PJSA 2OWFA 5HW4A 2PCMA 1CBFA 3KE8A 2E8RA 2KYYA 3DNFA 2P6IA 3SZLA 2BB3A 2EHCA 2EJJA 3UTCA 4EB3A 2EH2A 1VE2A 2E15A 2EGLA 3NDCA 4E16A 3UV6A 4H4EA 2EKAA 2Z6RA 2P6LA 1V9AA 1VA0A 2DV3A 2HUTA 2OWKA 4MUYA 3T0FA 2EL3A 4H4CA 2DSIA 3HH1A 3I4TA 1PJTA 2QBUA 2EGBA 2CBFA 2PB4A 2EEQA 3TIXB 2EHLA 2ED3A 3LMMA 3KELA 3T0GA 2E0NA 1VHVA 2ELDA 2P5CA 2EL0A 1PJQA 2EMRA 1WNGA 2PB5A 2PCHA 1WYZA 2EL1A 3URKA 2HUVA 2P6KA 3KE9A 3NUTA 2DXXA 4H4DA 2HUXA 2EJKA 2EK7A 3FFYA 2E08A 2EMUA 3SZOA 3UTDA 2P2XA 4N7BA 2ENIA 2ZVCA 3ND1A 2ED5A 1VCEA 3KWPA 2E07A 2ELEA 2E8QA 2P5FA 2OWVA 2HR8A 2PCKA 2PCAA 2E4RA 3SZUA 2DV7A 3UV7A 2P9DA 2OWGA 4MV5A 2EJZA 2DSGA 2YBOA 4MUXA 2HUQA 2EK4A 2DSHA 3KEFA 4MV0A 2DXVA 3KEMA 2DV4A 2EN5A 3FQ6A 3UV3A 2E17A 3NEIA 3F7TA 1S4DA 2DXWA 3UWMA 2EH5A 1WDEA 2EK2A 2PB6A 2E8HA 3ZGLA 2OWUA
chains in the Genus database with same CATH topology
2P6DA 2EGSA 2NPNA 2PCGA 2DV5A 2YBQA 2EL2A 2E16A 2E8SA 2E7RA 2EH4A 2EK3A 2E0KA 2PCIA 3ZGNA 2E4NA 2DEKA 2ZVBA 1PJSA 2OWFA 5HW4A 2PCMA 1CBFA 3KE8A 2E8RA 2KYYA 3DNFA 2P6IA 3SZLA 2BB3A 2EHCA 2EJJA 3UTCA 4EB3A 2EH2A 1VE2A 2E15A 2EGLA 3NDCA 4E16A 3UV6A 4H4EA 2EKAA 2Z6RA 2P6LA 1V9AA 1VA0A 2DV3A 2HUTA 2OWKA 4MUYA 3T0FA 2EL3A 4H4CA 2DSIA 3HH1A 3I4TA 1PJTA 2QBUA 2EGBA 2CBFA 2PB4A 2EEQA 3TIXB 2EHLA 2ED3A 3LMMA 3KELA 3T0GA 2E0NA 1VHVA 2ELDA 2P5CA 2EL0A 1PJQA 2EMRA 1WNGA 2PB5A 2PCHA 1WYZA 2EL1A 3URKA 2HUVA 2P6KA 3KE9A 3NUTA 2DXXA 4H4DA 2HUXA 2EJKA 2EK7A 3FFYA 2E08A 2EMUA 3SZOA 3UTDA 2P2XA 4N7BA 2ENIA 2ZVCA 3ND1A 2ED5A 1VCEA 3KWPA 2E07A 2ELEA 2E8QA 2P5FA 2OWVA 2HR8A 2PCKA 2PCAA 2E4RA 3SZUA 2DV7A 3UV7A 2P9DA 2OWGA 4MV5A 2EJZA 2DSGA 2YBOA 4MUXA 2HUQA 2EK4A 2DSHA 3KEFA 4MV0A 2DXVA 3KEMA 2DV4A 2EN5A 3FQ6A 3UV3A 2E17A 3NEIA 3F7TA 1S4DA 2DXWA 3UWMA 2EH5A 1WDEA 2EK2A 2PB6A 2E8HA 3ZGLA 2OWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6D A;  2EGS A;  2NPN A;  2PCG A;  2DV5 A;  2YBQ A;  2EL2 A;  2E16 A;  2E8S A;  2E7R A;  2EH4 A;  2EK3 A;  2E0K A;  2PCI A;  2E4N A;  2DEK A;  2ZVB A;  1PJS A;  2OWF A;  5HW4 A;  2PCM A;  1CBF A;  2E8R A;  2P6I A;  2BB3 A;  2EHC A;  2EJJ A;  2EH2 A;  1VE2 A;  2E15 A;  2EGL A;  3NDC A;  4E16 A;  2EKA A;  2Z6R A;  2P6L A;  1V9A A;  1VA0 A;  2DV3 A;  2HUT A;  2OWK A;  2EL3 A;  2DSI A;  3HH1 A;  3I4T A;  1PJT A;  2QBU A;  2EGB A;  2CBF A;  2PB4 A;  2EEQ A;  2EHL A;  2ED3 A;  2E0N A;  1VHV A;  2ELD A;  2P5C A;  2EL0 A;  1PJQ A;  2EMR A;  1WNG A;  2PB5 A;  2PCH A;  1WYZ A;  2EL1 A;  2HUV A;  2P6K A;  3NUT A;  2DXX A;  2HUX A;  2EJK A;  2EK7 A;  3FFY A;  2E08 A;  2EMU A;  2P2X A;  2ENI A;  2ZVC A;  3ND1 A;  2ED5 A;  1VCE A;  3KWP A;  2E07 A;  2ELE A;  2E8Q A;  2P5F A;  2OWV A;  2HR8 A;  2PCK A;  2PCA A;  2E4R A;  2DV7 A;  2P9D A;  2OWG A;  2EJZ A;  2DSG A;  2YBO A;  2HUQ A;  2EK4 A;  2DSH A;  2DXV A;  2DV4 A;  2EN5 A;  3FQ6 A;  2E17 A;  3NEI A;  1S4D A;  2DXW A;  2EH5 A;  1WDE A;  2EK2 A;  2PB6 A;  2E8H A;  2OWU A; 
#chains in the Genus database with same CATH topology
 2P6D A;  2EGS A;  2NPN A;  2PCG A;  2DV5 A;  2YBQ A;  2EL2 A;  2E16 A;  2E8S A;  2E7R A;  2EH4 A;  2EK3 A;  2E0K A;  2PCI A;  3ZGN A;  2E4N A;  2DEK A;  2ZVB A;  1PJS A;  2OWF A;  5HW4 A;  2PCM A;  1CBF A;  3KE8 A;  2E8R A;  2KYY A;  3DNF A;  2P6I A;  3SZL A;  2BB3 A;  2EHC A;  2EJJ A;  3UTC A;  4EB3 A;  2EH2 A;  1VE2 A;  2E15 A;  2EGL A;  3NDC A;  4E16 A;  3UV6 A;  4H4E A;  2EKA A;  2Z6R A;  2P6L A;  1V9A A;  1VA0 A;  2DV3 A;  2HUT A;  2OWK A;  4MUY A;  3T0F A;  2EL3 A;  4H4C A;  2DSI A;  3HH1 A;  3I4T A;  1PJT A;  2QBU A;  2EGB A;  2CBF A;  2PB4 A;  2EEQ A;  3TIX B;  2EHL A;  2ED3 A;  3LMM A;  3KEL A;  3T0G A;  2E0N A;  1VHV A;  2ELD A;  2P5C A;  2EL0 A;  1PJQ A;  2EMR A;  1WNG A;  2PB5 A;  2PCH A;  1WYZ A;  2EL1 A;  3URK A;  2HUV A;  2P6K A;  3KE9 A;  3NUT A;  2DXX A;  4H4D A;  2HUX A;  2EJK A;  2EK7 A;  3FFY A;  2E08 A;  2EMU A;  3SZO A;  3UTD A;  2P2X A;  4N7B A;  2ENI A;  2ZVC A;  3ND1 A;  2ED5 A;  1VCE A;  3KWP A;  2E07 A;  2ELE A;  2E8Q A;  2P5F A;  2OWV A;  2HR8 A;  2PCK A;  2PCA A;  2E4R A;  3SZU A;  2DV7 A;  3UV7 A;  2P9D A;  2OWG A;  4MV5 A;  2EJZ A;  2DSG A;  2YBO A;  4MUX A;  2HUQ A;  2EK4 A;  2DSH A;  3KEF A;  4MV0 A;  2DXV A;  3KEM A;  2DV4 A;  2EN5 A;  3FQ6 A;  3UV3 A;  2E17 A;  3NEI A;  3F7T A;  1S4D A;  2DXW A;  3UWM A;  2EH5 A;  1WDE A;  2EK2 A;  2PB6 A;  2E8H A;  3ZGL A;  2OWU A; 
#chains in the Genus database with same CATH homology
 2P6D A;  2EGS A;  2NPN A;  2PCG A;  2DV5 A;  2YBQ A;  2EL2 A;  2E16 A;  2E8S A;  2E7R A;  2EH4 A;  2EK3 A;  2E0K A;  2PCI A;  3ZGN A;  2E4N A;  2DEK A;  2ZVB A;  1PJS A;  2OWF A;  5HW4 A;  2PCM A;  1CBF A;  3KE8 A;  2E8R A;  2KYY A;  3DNF A;  2P6I A;  3SZL A;  2BB3 A;  2EHC A;  2EJJ A;  3UTC A;  4EB3 A;  2EH2 A;  1VE2 A;  2E15 A;  2EGL A;  3NDC A;  4E16 A;  3UV6 A;  4H4E A;  2EKA A;  2Z6R A;  2P6L A;  1V9A A;  1VA0 A;  2DV3 A;  2HUT A;  2OWK A;  4MUY A;  3T0F A;  2EL3 A;  4H4C A;  2DSI A;  3HH1 A;  3I4T A;  1PJT A;  2QBU A;  2EGB A;  2CBF A;  2PB4 A;  2EEQ A;  3TIX B;  2EHL A;  2ED3 A;  3LMM A;  3KEL A;  3T0G A;  2E0N A;  1VHV A;  2ELD A;  2P5C A;  2EL0 A;  1PJQ A;  2EMR A;  1WNG A;  2PB5 A;  2PCH A;  1WYZ A;  2EL1 A;  3URK A;  2HUV A;  2P6K A;  3KE9 A;  3NUT A;  2DXX A;  4H4D A;  2HUX A;  2EJK A;  2EK7 A;  3FFY A;  2E08 A;  2EMU A;  3SZO A;  3UTD A;  2P2X A;  4N7B A;  2ENI A;  2ZVC A;  3ND1 A;  2ED5 A;  1VCE A;  3KWP A;  2E07 A;  2ELE A;  2E8Q A;  2P5F A;  2OWV A;  2HR8 A;  2PCK A;  2PCA A;  2E4R A;  3SZU A;  2DV7 A;  3UV7 A;  2P9D A;  2OWG A;  4MV5 A;  2EJZ A;  2DSG A;  2YBO A;  4MUX A;  2HUQ A;  2EK4 A;  2DSH A;  3KEF A;  4MV0 A;  2DXV A;  3KEM A;  2DV4 A;  2EN5 A;  3FQ6 A;  3UV3 A;  2E17 A;  3NEI A;  3F7T A;  1S4D A;  2DXW A;  3UWM A;  2EH5 A;  1WDE A;  2EK2 A;  2PB6 A;  2E8H A;  3ZGL A;  2OWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...