2E0NA

Crystal structure of cbil in complex with s-adenosylhomocysteine, a methyltransferase involved in anaerobic vitamin b12 biosynthesis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
238
structure length
229
Chain Sequence
GSIISVSLGPGDPGLITVKALSQLREADVIYYPGTVSASGAVTSVALDILKEFDLDPSKLRGMLVPMSYAANYASMAEEVQAGRRVAVVSVGDGGFYSTASAIIERARRDGLDCSMTPGIPAFIAAGSAAGMPLALQSDSVLVLAQIDEIGELERALVTHSTVVVMKLSTVRDELVSFLERYAKPFLYAEKVGMAGEFITMEVDALRSRAIPYFSLLVCSPHCRQSTLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of CbiL, a methyltransferase involved in anaerobic vitamin B biosynthesis, and CbiL in complex with S-adenosylhomocysteine--implications for the reaction mechanism.
pubmed doi rcsb
source organism Chlorobaculum tepidum
molecule tags Transferase
molecule keywords Precorrin-2 C20-methyltransferase
total genus 61
structure length 229
sequence length 238
chains with identical sequence B
ec nomenclature ec 2.1.1.130: Precorrin-2 C(20)-methyltransferase.
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 2e0nA02
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 2e0nA01
2EMUA 2EK4A 2PB6A 2ELDA 2Z6RA 2E17A 2E16A 2DXXA 2EGBA 3KWPA 2ENIA 2DSIA 1CBFA 2HUTA 2PB4A 2PCKA 1PJTA 2ED5A 2E07A 2DEKA 2OWKA 3ND1A 2BB3A 3NDCA 2EK3A 2EHLA 2P6LA 2E8HA 1S4DA 5HW4A 2DV3A 2EGSA 2P2XA 2QBUA 4E16A 2P6KA 2EL1A 2YBOA 3NEIA 2EGLA 1V9AA 2EL2A 2OWGA 2PCHA 2EH5A 2E8RA 2E4NA 2EK2A 2E15A 2P6DA 2EH2A 2EKAA 2HR8A 2DXVA 2E4RA 2ZVCA 3FFYA 2P9DA 1VE2A 2E08A 2DSHA 2P6IA 2CBFA 2DV4A 2E8SA 3HH1A 1PJQA 3I4TA 2E7RA 2EJKA 2EL0A 1WYZA 2DXWA 2PCGA 2E8QA 2P5CA 2EJZA 2EMRA 2OWUA 2HUXA 1PJSA 2EEQA 2DV7A 2EN5A 2DV5A 1WDEA 2P5FA 2EHCA 2OWVA 2YBQA 2DSGA 2EK7A 1VA0A 1VCEA 1VHVA 2ZVBA 2PCMA 2PCAA 3NUTA 2E0NA 2NPNA 2EH4A 2EL3A 2OWFA 3FQ6A 2ED3A 2HUQA 2PB5A 2HUVA 2EJJA 2E0KA 2ELEA 2PCIA 1WNGA
chains in the Genus database with same CATH superfamily
2EMUA 2EK4A 2PB6A 2ELDA 2Z6RA 3TIXB 2E17A 2E16A 2DXXA 2EGBA 3KWPA 2ENIA 3SZUA 2DSIA 1CBFA 2HUTA 2PB4A 2PCKA 3SZOA 1PJTA 2ED5A 2E07A 2DEKA 2OWKA 3ND1A 2BB3A 3NDCA 2EK3A 2EHLA 4MV0A 2P6LA 3UV6A 3UV7A 2E8HA 1S4DA 3ZGNA 5HW4A 2DV3A 2EGSA 2P2XA 2QBUA 4E16A 2P6KA 2EL1A 2YBOA 3T0FA 3NEIA 2EGLA 1V9AA 2EL2A 2OWGA 2PCHA 2EH5A 2E8RA 2E4NA 2EK2A 2E15A 2P6DA 2EH2A 2EKAA 2HR8A 2DXVA 3UTDA 3DNFA 3KEFA 2E4RA 2ZVCA 3FFYA 2P9DA 3KELA 1VE2A 2E08A 2DSHA 2P6IA 2CBFA 2DV4A 2E8SA 3HH1A 1PJQA 3I4TA 2E7RA 2EJKA 4H4DA 2EL0A 1WYZA 3UV3A 4MV5A 2KYYA 2DXWA 2PCGA 3KE9A 2E8QA 2P5CA 3UWMA 2EJZA 2EMRA 2OWUA 2HUXA 1PJSA 3F7TA 2EEQA 3SZLA 2DV7A 2EN5A 3ZGLA 2DV5A 1WDEA 2P5FA 2EHCA 2OWVA 3KEMA 4MUYA 3KE8A 3UTCA 2YBQA 2DSGA 2EK7A 1VA0A 4N7BA 4MUXA 4H4CA 1VCEA 1VHVA 2ZVBA 2PCMA 2PCAA 3NUTA 2E0NA 3URKA 2NPNA 2EH4A 3T0GA 2EL3A 2OWFA 3FQ6A 2ED3A 2HUQA 3LMMA 2PB5A 2HUVA 2EJJA 4H4EA 2E0KA 2ELEA 4EB3A 2PCIA 1WNGA
chains in the Genus database with same CATH topology
2EMUA 2EK4A 2PB6A 2ELDA 2Z6RA 3TIXB 2E17A 2E16A 2DXXA 2EGBA 3KWPA 2ENIA 3SZUA 2DSIA 1CBFA 2HUTA 2PB4A 2PCKA 3SZOA 1PJTA 2ED5A 2E07A 2DEKA 2OWKA 3ND1A 2BB3A 3NDCA 2EK3A 2EHLA 4MV0A 2P6LA 3UV6A 3UV7A 2E8HA 1S4DA 3ZGNA 5HW4A 2DV3A 2EGSA 2P2XA 2QBUA 4E16A 2P6KA 2EL1A 2YBOA 3T0FA 3NEIA 2EGLA 1V9AA 2EL2A 2OWGA 2PCHA 2EH5A 2E8RA 2E4NA 2EK2A 2E15A 2P6DA 2EH2A 2EKAA 2HR8A 2DXVA 3UTDA 3DNFA 3KEFA 2E4RA 2ZVCA 3FFYA 2P9DA 3KELA 1VE2A 2E08A 2DSHA 2P6IA 2CBFA 2DV4A 2E8SA 3HH1A 1PJQA 3I4TA 2E7RA 2EJKA 4H4DA 2EL0A 1WYZA 3UV3A 4MV5A 2KYYA 2DXWA 2PCGA 3KE9A 2E8QA 2P5CA 3UWMA 2EJZA 2EMRA 2OWUA 2HUXA 1PJSA 3F7TA 2EEQA 3SZLA 2DV7A 2EN5A 3ZGLA 2DV5A 1WDEA 2P5FA 2EHCA 2OWVA 3KEMA 4MUYA 3KE8A 3UTCA 2YBQA 2DSGA 2EK7A 1VA0A 4N7BA 4MUXA 4H4CA 1VCEA 1VHVA 2ZVBA 2PCMA 2PCAA 3NUTA 2E0NA 3URKA 2NPNA 2EH4A 3T0GA 2EL3A 2OWFA 3FQ6A 2ED3A 2HUQA 3LMMA 2PB5A 2HUVA 2EJJA 4H4EA 2E0KA 2ELEA 4EB3A 2PCIA 1WNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMU A;  2EK4 A;  2PB6 A;  2ELD A;  2Z6R A;  2E17 A;  2E16 A;  2DXX A;  2EGB A;  3KWP A;  2ENI A;  2DSI A;  1CBF A;  2HUT A;  2PB4 A;  2PCK A;  1PJT A;  2ED5 A;  2E07 A;  2DEK A;  2OWK A;  3ND1 A;  2BB3 A;  3NDC A;  2EK3 A;  2EHL A;  2P6L A;  2E8H A;  1S4D A;  5HW4 A;  2DV3 A;  2EGS A;  2P2X A;  2QBU A;  4E16 A;  2P6K A;  2EL1 A;  2YBO A;  3NEI A;  2EGL A;  1V9A A;  2EL2 A;  2OWG A;  2PCH A;  2EH5 A;  2E8R A;  2E4N A;  2EK2 A;  2E15 A;  2P6D A;  2EH2 A;  2EKA A;  2HR8 A;  2DXV A;  2E4R A;  2ZVC A;  3FFY A;  2P9D A;  1VE2 A;  2E08 A;  2DSH A;  2P6I A;  2CBF A;  2DV4 A;  2E8S A;  3HH1 A;  1PJQ A;  3I4T A;  2E7R A;  2EJK A;  2EL0 A;  1WYZ A;  2DXW A;  2PCG A;  2E8Q A;  2P5C A;  2EJZ A;  2EMR A;  2OWU A;  2HUX A;  1PJS A;  2EEQ A;  2DV7 A;  2EN5 A;  2DV5 A;  1WDE A;  2P5F A;  2EHC A;  2OWV A;  2YBQ A;  2DSG A;  2EK7 A;  1VA0 A;  1VCE A;  1VHV A;  2ZVB A;  2PCM A;  2PCA A;  3NUT A;  2E0N A;  2NPN A;  2EH4 A;  2EL3 A;  2OWF A;  3FQ6 A;  2ED3 A;  2HUQ A;  2PB5 A;  2HUV A;  2EJJ A;  2E0K A;  2ELE A;  2PCI A;  1WNG A; 
#chains in the Genus database with same CATH topology
 2EMU A;  2EK4 A;  2PB6 A;  2ELD A;  2Z6R A;  3TIX B;  2E17 A;  2E16 A;  2DXX A;  2EGB A;  3KWP A;  2ENI A;  3SZU A;  2DSI A;  1CBF A;  2HUT A;  2PB4 A;  2PCK A;  3SZO A;  1PJT A;  2ED5 A;  2E07 A;  2DEK A;  2OWK A;  3ND1 A;  2BB3 A;  3NDC A;  2EK3 A;  2EHL A;  4MV0 A;  2P6L A;  3UV6 A;  3UV7 A;  2E8H A;  1S4D A;  3ZGN A;  5HW4 A;  2DV3 A;  2EGS A;  2P2X A;  2QBU A;  4E16 A;  2P6K A;  2EL1 A;  2YBO A;  3T0F A;  3NEI A;  2EGL A;  1V9A A;  2EL2 A;  2OWG A;  2PCH A;  2EH5 A;  2E8R A;  2E4N A;  2EK2 A;  2E15 A;  2P6D A;  2EH2 A;  2EKA A;  2HR8 A;  2DXV A;  3UTD A;  3DNF A;  3KEF A;  2E4R A;  2ZVC A;  3FFY A;  2P9D A;  3KEL A;  1VE2 A;  2E08 A;  2DSH A;  2P6I A;  2CBF A;  2DV4 A;  2E8S A;  3HH1 A;  1PJQ A;  3I4T A;  2E7R A;  2EJK A;  4H4D A;  2EL0 A;  1WYZ A;  3UV3 A;  4MV5 A;  2KYY A;  2DXW A;  2PCG A;  3KE9 A;  2E8Q A;  2P5C A;  3UWM A;  2EJZ A;  2EMR A;  2OWU A;  2HUX A;  1PJS A;  3F7T A;  2EEQ A;  3SZL A;  2DV7 A;  2EN5 A;  3ZGL A;  2DV5 A;  1WDE A;  2P5F A;  2EHC A;  2OWV A;  3KEM A;  4MUY A;  3KE8 A;  3UTC A;  2YBQ A;  2DSG A;  2EK7 A;  1VA0 A;  4N7B A;  4MUX A;  4H4C A;  1VCE A;  1VHV A;  2ZVB A;  2PCM A;  2PCA A;  3NUT A;  2E0N A;  3URK A;  2NPN A;  2EH4 A;  3T0G A;  2EL3 A;  2OWF A;  3FQ6 A;  2ED3 A;  2HUQ A;  3LMM A;  2PB5 A;  2HUV A;  2EJJ A;  4H4E A;  2E0K A;  2ELE A;  4EB3 A;  2PCI A;  1WNG A; 
#chains in the Genus database with same CATH homology
 2EMU A;  2EK4 A;  2PB6 A;  2ELD A;  2Z6R A;  3TIX B;  2E17 A;  2E16 A;  2DXX A;  2EGB A;  3KWP A;  2ENI A;  3SZU A;  2DSI A;  1CBF A;  2HUT A;  2PB4 A;  2PCK A;  3SZO A;  1PJT A;  2ED5 A;  2E07 A;  2DEK A;  2OWK A;  3ND1 A;  2BB3 A;  3NDC A;  2EK3 A;  2EHL A;  4MV0 A;  2P6L A;  3UV6 A;  3UV7 A;  2E8H A;  1S4D A;  3ZGN A;  5HW4 A;  2DV3 A;  2EGS A;  2P2X A;  2QBU A;  4E16 A;  2P6K A;  2EL1 A;  2YBO A;  3T0F A;  3NEI A;  2EGL A;  1V9A A;  2EL2 A;  2OWG A;  2PCH A;  2EH5 A;  2E8R A;  2E4N A;  2EK2 A;  2E15 A;  2P6D A;  2EH2 A;  2EKA A;  2HR8 A;  2DXV A;  3UTD A;  3DNF A;  3KEF A;  2E4R A;  2ZVC A;  3FFY A;  2P9D A;  3KEL A;  1VE2 A;  2E08 A;  2DSH A;  2P6I A;  2CBF A;  2DV4 A;  2E8S A;  3HH1 A;  1PJQ A;  3I4T A;  2E7R A;  2EJK A;  4H4D A;  2EL0 A;  1WYZ A;  3UV3 A;  4MV5 A;  2KYY A;  2DXW A;  2PCG A;  3KE9 A;  2E8Q A;  2P5C A;  3UWM A;  2EJZ A;  2EMR A;  2OWU A;  2HUX A;  1PJS A;  3F7T A;  2EEQ A;  3SZL A;  2DV7 A;  2EN5 A;  3ZGL A;  2DV5 A;  1WDE A;  2P5F A;  2EHC A;  2OWV A;  3KEM A;  4MUY A;  3KE8 A;  3UTC A;  2YBQ A;  2DSG A;  2EK7 A;  1VA0 A;  4N7B A;  4MUX A;  4H4C A;  1VCE A;  1VHV A;  2ZVB A;  2PCM A;  2PCA A;  3NUT A;  2E0N A;  3URK A;  2NPN A;  2EH4 A;  3T0G A;  2EL3 A;  2OWF A;  3FQ6 A;  2ED3 A;  2HUQ A;  3LMM A;  2PB5 A;  2HUV A;  2EJJ A;  4H4E A;  2E0K A;  2ELE A;  4EB3 A;  2PCI A;  1WNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...