2E0NA

Crystal structure of cbil in complex with s-adenosylhomocysteine, a methyltransferase involved in anaerobic vitamin b12 biosynthesis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
238
structure length
229
Chain Sequence
b'GSIISVSLGPGDPGLITVKALSQLREADVIYYPGTVSASGAVTSVALDILKEFDLDPSKLRGMLVPMSYAANYASMAEEVQAGRRVAVVSVGDGGFYSTASAIIERARRDGLDCSMTPGIPAFIAAGSAAGMPLALQSDSVLVLAQIDEIGELERALVTHSTVVVMKLSTVRDELVSFLERYAKPFLYAEKVGMAGEFITMEVDALRSRAIPYFSLLVCSPHCRQSTLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Precorrin-2 C20-methyltransferase
publication title Crystal structures of CbiL, a methyltransferase involved in anaerobic vitamin B biosynthesis, and CbiL in complex with S-adenosylhomocysteine--implications for the reaction mechanism.
pubmed doi rcsb
source organism Chlorobaculum tepidum
molecule tags Transferase
total genus 61
structure length 229
sequence length 238
chains with identical sequence B
ec nomenclature ec 2.1.1.130: Precorrin-2 C(20)-methyltransferase.
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 2e0nA02
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 2e0nA01
2EJKA 2YBOA 2PB5A 2DXWA 2NPNA 1VCEA 2DV7A 2DV3A 2DXVA 1PJTA 2E8HA 1WDEA 2P6IA 1WNGA 2EEQA 2EGBA 1PJQA 2QBUA 2PCHA 2OWUA 3NEIA 2ELEA 2OWGA 2HUVA 2PCIA 2E4NA 2EN5A 2DEKA 2EK4A 2DXXA 2ELDA 2E8QA 2HUQA 1WYZA 2EHCA 2E16A 2E4RA 3ND1A 2E07A 2E8RA 1V9AA 1CBFA 2E15A 2EKAA 2P6KA 2HUXA 1VHVA 2OWFA 2EL0A 2ED3A 2EL3A 2EH5A 2EHLA 2OWVA 2E17A 2PB4A 1PJSA 2E0NA 2E08A 2ZVBA 2ZVCA 2P5FA 2DSHA 2P6DA 2ENIA 2HR8A 2E7RA 3NUTA 2DSIA 2PCKA 2P6LA 2EH4A 2EL1A 3FQ6A 2EK7A 2P5CA 2PB6A 2EMUA 2CBFA 1VA0A 2DV4A 2EGLA 2YBQA 3FFYA 2PCAA 2ED5A 3HH1A 2P2XA 1S4DA 2P9DA 3I4TA 2EL2A 4E16A 1VE2A 2EMRA 3KWPA 2BB3A 2E8SA 2PCGA 2EK2A 2DV5A 2EJZA 2HUTA 5HW4A 2PCMA 2EGSA 2OWKA 2EH2A 2EK3A 2Z6RA 3NDCA 2EJJA 2DSGA 2E0KA
chains in the Genus database with same CATH superfamily
2EJKA 2YBOA 2PB5A 2DXWA 4N7BA 2NPNA 1VCEA 2DV7A 2DV3A 2DXVA 4H4CA 1PJTA 2E8HA 1WDEA 2P6IA 1WNGA 2EEQA 3ZGNA 4MV5A 2EGBA 1PJQA 2QBUA 2PCHA 2OWUA 3NEIA 2ELEA 2OWGA 2HUVA 2PCIA 2E4NA 2EN5A 2KYYA 3DNFA 2DEKA 3KEMA 2EK4A 2DXXA 2ELDA 2E8QA 2HUQA 3LMMA 1WYZA 2EHCA 4MUYA 4MV0A 2E16A 2E4RA 3ND1A 2E07A 2E8RA 1V9AA 4EB3A 1CBFA 2E15A 2EKAA 3KE9A 2P6KA 2HUXA 1VHVA 2OWFA 2EL0A 2ED3A 4H4EA 2EL3A 4H4DA 3URKA 3UTDA 2EH5A 2EHLA 2OWVA 2E17A 2PB4A 1PJSA 2E0NA 2E08A 2ZVBA 3T0GA 2ZVCA 2P5FA 2DSHA 2P6DA 3UTCA 2ENIA 3SZUA 2HR8A 2E7RA 3NUTA 2DSIA 2PCKA 2P6LA 2EH4A 2EL1A 3SZOA 3FQ6A 3T0FA 2EK7A 2P5CA 2PB6A 3UV7A 3UV6A 2EMUA 2CBFA 3UWMA 4MUXA 1VA0A 2DV4A 2EGLA 2YBQA 3FFYA 3F7TA 2PCAA 2ED5A 3HH1A 2P2XA 3TIXB 1S4DA 2P9DA 3I4TA 3KELA 2EL2A 4E16A 1VE2A 2EMRA 3KWPA 3ZGLA 2BB3A 2E8SA 2PCGA 3KE8A 2EK2A 2DV5A 2EJZA 2HUTA 5HW4A 2PCMA 2EGSA 2OWKA 3SZLA 3KEFA 2EH2A 2EK3A 2Z6RA 3NDCA 3UV3A 2EJJA 2DSGA 2E0KA
chains in the Genus database with same CATH topology
2EJKA 2YBOA 2PB5A 2DXWA 4N7BA 2NPNA 1VCEA 2DV7A 2DV3A 2DXVA 4H4CA 1PJTA 2E8HA 1WDEA 2P6IA 1WNGA 2EEQA 3ZGNA 4MV5A 2EGBA 1PJQA 2QBUA 2PCHA 2OWUA 3NEIA 2ELEA 2OWGA 2HUVA 2PCIA 2E4NA 2EN5A 2KYYA 3DNFA 2DEKA 3KEMA 2EK4A 2DXXA 2ELDA 2E8QA 2HUQA 3LMMA 1WYZA 2EHCA 4MUYA 4MV0A 2E16A 2E4RA 3ND1A 2E07A 2E8RA 1V9AA 4EB3A 1CBFA 2E15A 2EKAA 3KE9A 2P6KA 2HUXA 1VHVA 2OWFA 2EL0A 2ED3A 4H4EA 2EL3A 4H4DA 3URKA 3UTDA 2EH5A 2EHLA 2OWVA 2E17A 2PB4A 1PJSA 2E0NA 2E08A 2ZVBA 3T0GA 2ZVCA 2P5FA 2DSHA 2P6DA 3UTCA 2ENIA 3SZUA 2HR8A 2E7RA 3NUTA 2DSIA 2PCKA 2P6LA 2EH4A 2EL1A 3SZOA 3FQ6A 3T0FA 2EK7A 2P5CA 2PB6A 3UV7A 3UV6A 2EMUA 2CBFA 3UWMA 4MUXA 1VA0A 2DV4A 2EGLA 2YBQA 3FFYA 3F7TA 2PCAA 2ED5A 3HH1A 2P2XA 3TIXB 1S4DA 2P9DA 3I4TA 3KELA 2EL2A 4E16A 1VE2A 2EMRA 3KWPA 3ZGLA 2BB3A 2E8SA 2PCGA 3KE8A 2EK2A 2DV5A 2EJZA 2HUTA 5HW4A 2PCMA 2EGSA 2OWKA 3SZLA 3KEFA 2EH2A 2EK3A 2Z6RA 3NDCA 3UV3A 2EJJA 2DSGA 2E0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJK A;  2YBO A;  2PB5 A;  2DXW A;  2NPN A;  1VCE A;  2DV7 A;  2DV3 A;  2DXV A;  1PJT A;  2E8H A;  1WDE A;  2P6I A;  1WNG A;  2EEQ A;  2EGB A;  1PJQ A;  2QBU A;  2PCH A;  2OWU A;  3NEI A;  2ELE A;  2OWG A;  2HUV A;  2PCI A;  2E4N A;  2EN5 A;  2DEK A;  2EK4 A;  2DXX A;  2ELD A;  2E8Q A;  2HUQ A;  1WYZ A;  2EHC A;  2E16 A;  2E4R A;  3ND1 A;  2E07 A;  2E8R A;  1V9A A;  1CBF A;  2E15 A;  2EKA A;  2P6K A;  2HUX A;  1VHV A;  2OWF A;  2EL0 A;  2ED3 A;  2EL3 A;  2EH5 A;  2EHL A;  2OWV A;  2E17 A;  2PB4 A;  1PJS A;  2E0N A;  2E08 A;  2ZVB A;  2ZVC A;  2P5F A;  2DSH A;  2P6D A;  2ENI A;  2HR8 A;  2E7R A;  3NUT A;  2DSI A;  2PCK A;  2P6L A;  2EH4 A;  2EL1 A;  3FQ6 A;  2EK7 A;  2P5C A;  2PB6 A;  2EMU A;  2CBF A;  1VA0 A;  2DV4 A;  2EGL A;  2YBQ A;  3FFY A;  2PCA A;  2ED5 A;  3HH1 A;  2P2X A;  1S4D A;  2P9D A;  3I4T A;  2EL2 A;  4E16 A;  1VE2 A;  2EMR A;  3KWP A;  2BB3 A;  2E8S A;  2PCG A;  2EK2 A;  2DV5 A;  2EJZ A;  2HUT A;  5HW4 A;  2PCM A;  2EGS A;  2OWK A;  2EH2 A;  2EK3 A;  2Z6R A;  3NDC A;  2EJJ A;  2DSG A;  2E0K A; 
#chains in the Genus database with same CATH topology
 2EJK A;  2YBO A;  2PB5 A;  2DXW A;  4N7B A;  2NPN A;  1VCE A;  2DV7 A;  2DV3 A;  2DXV A;  4H4C A;  1PJT A;  2E8H A;  1WDE A;  2P6I A;  1WNG A;  2EEQ A;  3ZGN A;  4MV5 A;  2EGB A;  1PJQ A;  2QBU A;  2PCH A;  2OWU A;  3NEI A;  2ELE A;  2OWG A;  2HUV A;  2PCI A;  2E4N A;  2EN5 A;  2KYY A;  3DNF A;  2DEK A;  3KEM A;  2EK4 A;  2DXX A;  2ELD A;  2E8Q A;  2HUQ A;  3LMM A;  1WYZ A;  2EHC A;  4MUY A;  4MV0 A;  2E16 A;  2E4R A;  3ND1 A;  2E07 A;  2E8R A;  1V9A A;  4EB3 A;  1CBF A;  2E15 A;  2EKA A;  3KE9 A;  2P6K A;  2HUX A;  1VHV A;  2OWF A;  2EL0 A;  2ED3 A;  4H4E A;  2EL3 A;  4H4D A;  3URK A;  3UTD A;  2EH5 A;  2EHL A;  2OWV A;  2E17 A;  2PB4 A;  1PJS A;  2E0N A;  2E08 A;  2ZVB A;  3T0G A;  2ZVC A;  2P5F A;  2DSH A;  2P6D A;  3UTC A;  2ENI A;  3SZU A;  2HR8 A;  2E7R A;  3NUT A;  2DSI A;  2PCK A;  2P6L A;  2EH4 A;  2EL1 A;  3SZO A;  3FQ6 A;  3T0F A;  2EK7 A;  2P5C A;  2PB6 A;  3UV7 A;  3UV6 A;  2EMU A;  2CBF A;  3UWM A;  4MUX A;  1VA0 A;  2DV4 A;  2EGL A;  2YBQ A;  3FFY A;  3F7T A;  2PCA A;  2ED5 A;  3HH1 A;  2P2X A;  3TIX B;  1S4D A;  2P9D A;  3I4T A;  3KEL A;  2EL2 A;  4E16 A;  1VE2 A;  2EMR A;  3KWP A;  3ZGL A;  2BB3 A;  2E8S A;  2PCG A;  3KE8 A;  2EK2 A;  2DV5 A;  2EJZ A;  2HUT A;  5HW4 A;  2PCM A;  2EGS A;  2OWK A;  3SZL A;  3KEF A;  2EH2 A;  2EK3 A;  2Z6R A;  3NDC A;  3UV3 A;  2EJJ A;  2DSG A;  2E0K A; 
#chains in the Genus database with same CATH homology
 2EJK A;  2YBO A;  2PB5 A;  2DXW A;  4N7B A;  2NPN A;  1VCE A;  2DV7 A;  2DV3 A;  2DXV A;  4H4C A;  1PJT A;  2E8H A;  1WDE A;  2P6I A;  1WNG A;  2EEQ A;  3ZGN A;  4MV5 A;  2EGB A;  1PJQ A;  2QBU A;  2PCH A;  2OWU A;  3NEI A;  2ELE A;  2OWG A;  2HUV A;  2PCI A;  2E4N A;  2EN5 A;  2KYY A;  3DNF A;  2DEK A;  3KEM A;  2EK4 A;  2DXX A;  2ELD A;  2E8Q A;  2HUQ A;  3LMM A;  1WYZ A;  2EHC A;  4MUY A;  4MV0 A;  2E16 A;  2E4R A;  3ND1 A;  2E07 A;  2E8R A;  1V9A A;  4EB3 A;  1CBF A;  2E15 A;  2EKA A;  3KE9 A;  2P6K A;  2HUX A;  1VHV A;  2OWF A;  2EL0 A;  2ED3 A;  4H4E A;  2EL3 A;  4H4D A;  3URK A;  3UTD A;  2EH5 A;  2EHL A;  2OWV A;  2E17 A;  2PB4 A;  1PJS A;  2E0N A;  2E08 A;  2ZVB A;  3T0G A;  2ZVC A;  2P5F A;  2DSH A;  2P6D A;  3UTC A;  2ENI A;  3SZU A;  2HR8 A;  2E7R A;  3NUT A;  2DSI A;  2PCK A;  2P6L A;  2EH4 A;  2EL1 A;  3SZO A;  3FQ6 A;  3T0F A;  2EK7 A;  2P5C A;  2PB6 A;  3UV7 A;  3UV6 A;  2EMU A;  2CBF A;  3UWM A;  4MUX A;  1VA0 A;  2DV4 A;  2EGL A;  2YBQ A;  3FFY A;  3F7T A;  2PCA A;  2ED5 A;  3HH1 A;  2P2X A;  3TIX B;  1S4D A;  2P9D A;  3I4T A;  3KEL A;  2EL2 A;  4E16 A;  1VE2 A;  2EMR A;  3KWP A;  3ZGL A;  2BB3 A;  2E8S A;  2PCG A;  3KE8 A;  2EK2 A;  2DV5 A;  2EJZ A;  2HUT A;  5HW4 A;  2PCM A;  2EGS A;  2OWK A;  3SZL A;  3KEF A;  2EH2 A;  2EK3 A;  2Z6R A;  3NDC A;  3UV3 A;  2EJJ A;  2DSG A;  2E0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...