2E0NA

Crystal structure of cbil in complex with s-adenosylhomocysteine, a methyltransferase involved in anaerobic vitamin b12 biosynthesis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
238
structure length
229
Chain Sequence
GSIISVSLGPGDPGLITVKALSQLREADVIYYPGTVSASGAVTSVALDILKEFDLDPSKLRGMLVPMSYAANYASMAEEVQAGRRVAVVSVGDGGFYSTASAIIERARRDGLDCSMTPGIPAFIAAGSAAGMPLALQSDSVLVLAQIDEIGELERALVTHSTVVVMKLSTVRDELVSFLERYAKPFLYAEKVGMAGEFITMEVDALRSRAIPYFSLLVCSPHCRQSTLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of CbiL, a methyltransferase involved in anaerobic vitamin B biosynthesis, and CbiL in complex with S-adenosylhomocysteine--implications for the reaction mechanism.
pubmed doi rcsb
source organism Chlorobaculum tepidum
molecule tags Transferase
molecule keywords Precorrin-2 C20-methyltransferase
total genus 61
structure length 229
sequence length 238
chains with identical sequence B
ec nomenclature ec 2.1.1.130: Precorrin-2 C(20)-methyltransferase.
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 2e0nA02
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 2e0nA01
2E15A 1WYZA 3NEIA 1WDEA 2PCMA 3FQ6A 1PJTA 2HUXA 2EH4A 2OWVA 2EMRA 1PJSA 1PJQA 2E4NA 2DV7A 2EL3A 2E8SA 2HUQA 3ND1A 2P5FA 3KWPA 2EMUA 2Z6RA 2E4RA 2DSHA 2EHCA 2PCHA 2ZVBA 2EK3A 2OWGA 2PCAA 2DSIA 2EH2A 2BB3A 2E8QA 2PCKA 5HW4A 2DEKA 1S4DA 1V9AA 2P9DA 2EKAA 2P6KA 2EH5A 2E07A 2EL0A 2EJZA 2PB5A 2E8RA 2EK4A 2EJKA 1VE2A 2PCIA 2HUTA 2QBUA 2E0KA 3NDCA 2EK2A 3NUTA 2DV3A 2EK7A 2DXXA 2P6DA 2E7RA 2PB6A 3HH1A 1VA0A 2YBOA 2PB4A 2EGBA 2EL1A 2EN5A 2P2XA 2HR8A 2DXWA 2DXVA 2OWFA 2ENIA 2EHLA 2ZVCA 2EL2A 2E17A 2DV5A 2E16A 2DV4A 2ED5A 1VHVA 3I4TA 2EJJA 2YBQA 2OWKA 2E0NA 1CBFA 4E16A 2P6IA 2DSGA 1WNGA 2E08A 2ELEA 3FFYA 2EGLA 2ELDA 2HUVA 1VCEA 2P5CA 2NPNA 2P6LA 2PCGA 2OWUA 2E8HA 2ED3A 2EEQA 2CBFA 2EGSA
chains in the Genus database with same CATH superfamily
3LMMA 3UTCA 2E15A 1WYZA 3NEIA 1WDEA 2PCMA 3FQ6A 1PJTA 2HUXA 2EH4A 2OWVA 2EMRA 1PJSA 1PJQA 2E4NA 2DV7A 2EL3A 3URKA 2E8SA 3KEFA 3SZUA 2HUQA 3ND1A 2P5FA 3KWPA 2EMUA 3ZGNA 2Z6RA 2E4RA 2DSHA 2EHCA 2PCHA 2ZVBA 2EK3A 2OWGA 3T0FA 2PCAA 2DSIA 2EH2A 4MV0A 2BB3A 3UWMA 2E8QA 2PCKA 5HW4A 2DEKA 1S4DA 4N7BA 1V9AA 2P9DA 4MUXA 2EKAA 2P6KA 2EH5A 2E07A 4H4EA 3UV7A 2EL0A 2EJZA 2PB5A 3KELA 2E8RA 2EK4A 2EJKA 3KE9A 1VE2A 2PCIA 2HUTA 2QBUA 2E0KA 3DNFA 3NDCA 2EK2A 3NUTA 2DV3A 3SZOA 2EK7A 3ZGLA 2DXXA 2P6DA 2E7RA 2PB6A 3UV6A 4MV5A 3HH1A 1VA0A 2YBOA 2PB4A 4EB3A 2EGBA 2EL1A 2EN5A 4H4DA 2P2XA 3KE8A 2HR8A 3KEMA 4MUYA 3T0GA 2DXWA 3F7TA 2DXVA 2OWFA 3SZLA 2ENIA 2EHLA 2ZVCA 2EL2A 2E17A 2DV5A 2E16A 2DV4A 2ED5A 1VHVA 3I4TA 2EJJA 2YBQA 2OWKA 3UV3A 2E0NA 1CBFA 4E16A 2P6IA 2DSGA 1WNGA 2E08A 2ELEA 3FFYA 2EGLA 3UTDA 2ELDA 2HUVA 1VCEA 2P5CA 2NPNA 2P6LA 2PCGA 2OWUA 3TIXB 2E8HA 2ED3A 2EEQA 2CBFA 2KYYA 4H4CA 2EGSA
chains in the Genus database with same CATH topology
3LMMA 3UTCA 2E15A 1WYZA 3NEIA 1WDEA 2PCMA 3FQ6A 1PJTA 2HUXA 2EH4A 2OWVA 2EMRA 1PJSA 1PJQA 2E4NA 2DV7A 2EL3A 3URKA 2E8SA 3KEFA 3SZUA 2HUQA 3ND1A 2P5FA 3KWPA 2EMUA 3ZGNA 2Z6RA 2E4RA 2DSHA 2EHCA 2PCHA 2ZVBA 2EK3A 2OWGA 3T0FA 2PCAA 2DSIA 2EH2A 4MV0A 2BB3A 3UWMA 2E8QA 2PCKA 5HW4A 2DEKA 1S4DA 4N7BA 1V9AA 2P9DA 4MUXA 2EKAA 2P6KA 2EH5A 2E07A 4H4EA 3UV7A 2EL0A 2EJZA 2PB5A 3KELA 2E8RA 2EK4A 2EJKA 3KE9A 1VE2A 2PCIA 2HUTA 2QBUA 2E0KA 3DNFA 3NDCA 2EK2A 3NUTA 2DV3A 3SZOA 2EK7A 3ZGLA 2DXXA 2P6DA 2E7RA 2PB6A 3UV6A 4MV5A 3HH1A 1VA0A 2YBOA 2PB4A 4EB3A 2EGBA 2EL1A 2EN5A 4H4DA 2P2XA 3KE8A 2HR8A 3KEMA 4MUYA 3T0GA 2DXWA 3F7TA 2DXVA 2OWFA 3SZLA 2ENIA 2EHLA 2ZVCA 2EL2A 2E17A 2DV5A 2E16A 2DV4A 2ED5A 1VHVA 3I4TA 2EJJA 2YBQA 2OWKA 3UV3A 2E0NA 1CBFA 4E16A 2P6IA 2DSGA 1WNGA 2E08A 2ELEA 3FFYA 2EGLA 3UTDA 2ELDA 2HUVA 1VCEA 2P5CA 2NPNA 2P6LA 2PCGA 2OWUA 3TIXB 2E8HA 2ED3A 2EEQA 2CBFA 2KYYA 4H4CA 2EGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E15 A;  1WYZ A;  3NEI A;  1WDE A;  2PCM A;  3FQ6 A;  1PJT A;  2HUX A;  2EH4 A;  2OWV A;  2EMR A;  1PJS A;  1PJQ A;  2E4N A;  2DV7 A;  2EL3 A;  2E8S A;  2HUQ A;  3ND1 A;  2P5F A;  3KWP A;  2EMU A;  2Z6R A;  2E4R A;  2DSH A;  2EHC A;  2PCH A;  2ZVB A;  2EK3 A;  2OWG A;  2PCA A;  2DSI A;  2EH2 A;  2BB3 A;  2E8Q A;  2PCK A;  5HW4 A;  2DEK A;  1S4D A;  1V9A A;  2P9D A;  2EKA A;  2P6K A;  2EH5 A;  2E07 A;  2EL0 A;  2EJZ A;  2PB5 A;  2E8R A;  2EK4 A;  2EJK A;  1VE2 A;  2PCI A;  2HUT A;  2QBU A;  2E0K A;  3NDC A;  2EK2 A;  3NUT A;  2DV3 A;  2EK7 A;  2DXX A;  2P6D A;  2E7R A;  2PB6 A;  3HH1 A;  1VA0 A;  2YBO A;  2PB4 A;  2EGB A;  2EL1 A;  2EN5 A;  2P2X A;  2HR8 A;  2DXW A;  2DXV A;  2OWF A;  2ENI A;  2EHL A;  2ZVC A;  2EL2 A;  2E17 A;  2DV5 A;  2E16 A;  2DV4 A;  2ED5 A;  1VHV A;  3I4T A;  2EJJ A;  2YBQ A;  2OWK A;  2E0N A;  1CBF A;  4E16 A;  2P6I A;  2DSG A;  1WNG A;  2E08 A;  2ELE A;  3FFY A;  2EGL A;  2ELD A;  2HUV A;  1VCE A;  2P5C A;  2NPN A;  2P6L A;  2PCG A;  2OWU A;  2E8H A;  2ED3 A;  2EEQ A;  2CBF A;  2EGS A; 
#chains in the Genus database with same CATH topology
 3LMM A;  3UTC A;  2E15 A;  1WYZ A;  3NEI A;  1WDE A;  2PCM A;  3FQ6 A;  1PJT A;  2HUX A;  2EH4 A;  2OWV A;  2EMR A;  1PJS A;  1PJQ A;  2E4N A;  2DV7 A;  2EL3 A;  3URK A;  2E8S A;  3KEF A;  3SZU A;  2HUQ A;  3ND1 A;  2P5F A;  3KWP A;  2EMU A;  3ZGN A;  2Z6R A;  2E4R A;  2DSH A;  2EHC A;  2PCH A;  2ZVB A;  2EK3 A;  2OWG A;  3T0F A;  2PCA A;  2DSI A;  2EH2 A;  4MV0 A;  2BB3 A;  3UWM A;  2E8Q A;  2PCK A;  5HW4 A;  2DEK A;  1S4D A;  4N7B A;  1V9A A;  2P9D A;  4MUX A;  2EKA A;  2P6K A;  2EH5 A;  2E07 A;  4H4E A;  3UV7 A;  2EL0 A;  2EJZ A;  2PB5 A;  3KEL A;  2E8R A;  2EK4 A;  2EJK A;  3KE9 A;  1VE2 A;  2PCI A;  2HUT A;  2QBU A;  2E0K A;  3DNF A;  3NDC A;  2EK2 A;  3NUT A;  2DV3 A;  3SZO A;  2EK7 A;  3ZGL A;  2DXX A;  2P6D A;  2E7R A;  2PB6 A;  3UV6 A;  4MV5 A;  3HH1 A;  1VA0 A;  2YBO A;  2PB4 A;  4EB3 A;  2EGB A;  2EL1 A;  2EN5 A;  4H4D A;  2P2X A;  3KE8 A;  2HR8 A;  3KEM A;  4MUY A;  3T0G A;  2DXW A;  3F7T A;  2DXV A;  2OWF A;  3SZL A;  2ENI A;  2EHL A;  2ZVC A;  2EL2 A;  2E17 A;  2DV5 A;  2E16 A;  2DV4 A;  2ED5 A;  1VHV A;  3I4T A;  2EJJ A;  2YBQ A;  2OWK A;  3UV3 A;  2E0N A;  1CBF A;  4E16 A;  2P6I A;  2DSG A;  1WNG A;  2E08 A;  2ELE A;  3FFY A;  2EGL A;  3UTD A;  2ELD A;  2HUV A;  1VCE A;  2P5C A;  2NPN A;  2P6L A;  2PCG A;  2OWU A;  3TIX B;  2E8H A;  2ED3 A;  2EEQ A;  2CBF A;  2KYY A;  4H4C A;  2EGS A; 
#chains in the Genus database with same CATH homology
 3LMM A;  3UTC A;  2E15 A;  1WYZ A;  3NEI A;  1WDE A;  2PCM A;  3FQ6 A;  1PJT A;  2HUX A;  2EH4 A;  2OWV A;  2EMR A;  1PJS A;  1PJQ A;  2E4N A;  2DV7 A;  2EL3 A;  3URK A;  2E8S A;  3KEF A;  3SZU A;  2HUQ A;  3ND1 A;  2P5F A;  3KWP A;  2EMU A;  3ZGN A;  2Z6R A;  2E4R A;  2DSH A;  2EHC A;  2PCH A;  2ZVB A;  2EK3 A;  2OWG A;  3T0F A;  2PCA A;  2DSI A;  2EH2 A;  4MV0 A;  2BB3 A;  3UWM A;  2E8Q A;  2PCK A;  5HW4 A;  2DEK A;  1S4D A;  4N7B A;  1V9A A;  2P9D A;  4MUX A;  2EKA A;  2P6K A;  2EH5 A;  2E07 A;  4H4E A;  3UV7 A;  2EL0 A;  2EJZ A;  2PB5 A;  3KEL A;  2E8R A;  2EK4 A;  2EJK A;  3KE9 A;  1VE2 A;  2PCI A;  2HUT A;  2QBU A;  2E0K A;  3DNF A;  3NDC A;  2EK2 A;  3NUT A;  2DV3 A;  3SZO A;  2EK7 A;  3ZGL A;  2DXX A;  2P6D A;  2E7R A;  2PB6 A;  3UV6 A;  4MV5 A;  3HH1 A;  1VA0 A;  2YBO A;  2PB4 A;  4EB3 A;  2EGB A;  2EL1 A;  2EN5 A;  4H4D A;  2P2X A;  3KE8 A;  2HR8 A;  3KEM A;  4MUY A;  3T0G A;  2DXW A;  3F7T A;  2DXV A;  2OWF A;  3SZL A;  2ENI A;  2EHL A;  2ZVC A;  2EL2 A;  2E17 A;  2DV5 A;  2E16 A;  2DV4 A;  2ED5 A;  1VHV A;  3I4T A;  2EJJ A;  2YBQ A;  2OWK A;  3UV3 A;  2E0N A;  1CBF A;  4E16 A;  2P6I A;  2DSG A;  1WNG A;  2E08 A;  2ELE A;  3FFY A;  2EGL A;  3UTD A;  2ELD A;  2HUV A;  1VCE A;  2P5C A;  2NPN A;  2P6L A;  2PCG A;  2OWU A;  3TIX B;  2E8H A;  2ED3 A;  2EEQ A;  2CBF A;  2KYY A;  4H4C A;  2EGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...