2E0XA

Crystal structure of gamma-glutamyltranspeptidase from escherichia coli (monoclinic form)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
359
structure length
359
Chain Sequence
APPVSYGVEEDVFHPVRAKQGMVASVDATATQVGVDILKEGGNAVDAAVAVGYALAVTHPQAGNLGGGGFMLIRSKNGNTTAIDFREMAPAKATRDMFLDDQGNPDSKKSLTSHLASGTPGTVAGFSLALDKYGTMPLNKVVQPAFKLARDGFIVNDALADDLKTYGSEVLPNHENSKAIFWKEGEPLKKGDTLVQANLAKSLEMIAENGPDEFYKGTIAEQIAQEMQKNGGLITKEDLAAYKAVERTPISGDYRGYQVYSMPPPSSGGIHIVQILNILENFDMKKYGFGSADAMQIMAEAEKYAYADRSEYLGDPDFVKVPWQALTNKAYAKSIADQIDINKAKPSSEIRPGKLAPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-glutamyltranspeptidase
publication title Crystal structure of the gamma-glutamyltranspeptidase precursor protein from Escherichia coli. Structural changes upon autocatalytic processing and implications for the maturation mechanism
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Transferase
total genus 90
structure length 359
sequence length 359
chains with identical sequence C
ec nomenclature ec 2.3.2.2: Gamma-glutamyltransferase.
pdb deposition date 2006-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.130 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2e0xA02
4OTUA 5BPKA 2DBWA 2Z8KA 4GDXA 2E0YA 2DBUA 4ZC6A 4ZCGA 5B5TA 2E0XA 2DG5A 3WHSA 3A75A 2QM6A 2NQOA 3FNMA 3WHQA 2QMCA 2Z8JA 4OTTA 4GG2A 3WHRA 2DBXA 2Z8IA 4ZBKA 4Z9OA 2V36A
chains in the Genus database with same CATH superfamily
1H5WA 5BPKA 2DBWA 5IIUA 4G01A 3GQUA 2OT3A 4ZBRA 4F5SA 4HGKA 1O9XA 4BKEA 4F5TA 1E78A 4TQ0A 1MA9A 4ZC6A 3PLAA 1HK2A 2BX8A 1BJ5A 2E0XA 2BXGA 1JNBA 2CKXA 2XVUA 4L9QA 1HK4A 1VZSA 2KBZA 3MHSB 3SQJA 3BPJA 4EMXA 2QHBA 3KIKA 1E7HA 2XVWA 4MBEC 3TDLA 1E7GA 1MIWA 2BXNA 2GUTA 3WHRA 5IIHA 1MIVA 1BM0A 4WA6B 2BXOA 3CX9A 1FOUA 4GDLB 3V09A 2YDFA 3B9MA 4K71A 4NAWB 2BXLA 2DYMA 1E7IA 2VDBA 2VUEA 4FK5B 1KXPD 2EFCA 4LA0A 4OTUA 1E7BA 4PO0A 2AJEA 3LU7A 2NNWA 4GDXA 4F5UA 1E7CA 4JK4A 1E7AA 2LOQA 2OZBB 1GNJA 4ZCGA 4LB2A 4E99A 2DG5A 3WHSA 4IW2A 1KDXA 2BXEA 4OT2A 3ICXA 4N3ZA 3VQIA 2XSIA 3JRYA 4BY9C 1NT2B 1E7FA 5GINA 4G03A 1VFIA 2VUFA 3NMUA 2XMOA 4N0UD 4ZBQA 5ID7A 3NVKA 2BXMA 5IJFA 1LNSA 4N0FD 1MIYA 5IJEA 2BXBA 1SB0A 4C31B 2BXQA 2Z8KA 2EFEA 1HK1A 1TF0A 2BXKA 2BXHA 3FWBC 2E0YA 2DBUA 2XVQA 3ECPA 4M70B 5B5TA 5IIXA 3SIUB 2BXCA 1J78A 3LU6A 4FJCB 5IFOA 3UIVA 3A75A 5GHKA 2QM6A 3FNMA 3LU8A 1LOTA 4LUHA 2LXSA 1UORA 1KW2A 3M99C 1AO6A 2BXFA 4I9OA 2BXIA 4GDKB 4G04A 4J2VA 3GA9L 4OTTA 1HK5A 3GQXA 4GG2A 3W1SA 2DBXA 2LQHA 2DYOA 1TXUA 5DBYA 2XW0A 1BKEA 4ZBKA 5FUOA 2EFDA 2ROHA 1J7EA 1H9ZA 5ID9A 4TQ1A 1IJGA 4LUFA 2BXAA 3H37A 4IW1A 1N5UA 5IJ5A 5GIPA 2LXTA 5HOZA 1MUSA 2KWFA 3FWCC 1HK3A 2BXDA 2EFHA 3JQZA 1GNIA 2AGHB 4K2CA 4DHXB 4FIPB 4HGMB 4W4UB 3V03A 2BXPA 2LQIA 5DQFA 3B9LA 2XW1A 2I2ZA 3MHHB 4LB9A 4D7XA 2NQOA 3WHQA 4DM0A 3SIVB 3KJLA 4L9KA 2QMCA 2Z8JA 3A73A 4OR0A 4L8UA 3H3AA 2I30A 1MUHA 3NVIA 4ZUXV 2Z8IA 5GIOA 3G9KD 2K0NA 4F5VA 2XVVA 3V08A 4Z9OA 4S1YA 1HA2A 1E7EA 3NVMA 5D7GA 2V36A 4Z69A 1MM8A 2JUHA
chains in the Genus database with same CATH topology
1H5WA 5BPKA 2DBWA 5IIUA 4G01A 3GQUA 2OT3A 4ZBRA 4F5SA 4HGKA 1O9XA 4BKEA 4F5TA 1E78A 4TQ0A 1MA9A 4ZC6A 3PLAA 1HK2A 2BX8A 1BJ5A 2E0XA 2BXGA 1JNBA 2CKXA 2XVUA 4L9QA 1HK4A 1VZSA 2KBZA 3MHSB 3SQJA 4EMXA 2QHBA 3KIKA 1E7HA 2XVWA 4MBEC 3TDLA 1E7GA 1MIWA 2BXNA 5IIHA 3WHRA 1MIVA 1BM0A 4WA6B 2BXOA 3CX9A 1FOUA 4GDLB 3V09A 2YDFA 3B9MA 4K71A 4NAWB 2BXLA 2DYMA 1E7IA 2VDBA 2VUEA 4FK5B 1KXPD 2EFCA 4LA0A 4OTUA 1E7BA 4PO0A 2AJEA 3LU7A 2NNWA 4GDXA 4F5UA 1E7CA 4JK4A 1E7AA 2LOQA 2OZBB 1GNJA 4ZCGA 4LB2A 4E99A 2DG5A 3WHSA 4IW2A 2BXEA 4OT2A 3ICXA 4N3ZA 3VQIA 2XSIA 3JRYA 4BY9C 1NT2B 1E7FA 5GINA 4G03A 1VFIA 2VUFA 3NMUA 2XMOA 4N0UD 4ZBQA 5ID7A 3NVKA 2BXMA 5IJFA 1LNSA 4N0FD 1MIYA 5IJEA 2BXBA 4C31B 2BXQA 2Z8KA 2EFEA 1HK1A 1TF0A 2BXKA 2BXHA 3FWBC 2E0YA 2DBUA 2XVQA 4M70B 5B5TA 5IIXA 3SIUB 2BXCA 1J78A 3LU6A 4FJCB 5IFOA 3UIVA 3A75A 5GHKA 2QM6A 3FNMA 3LU8A 1LOTA 4LUHA 1UORA 1KW2A 3M99C 1AO6A 2BXFA 2BXIA 4GDKB 4G04A 4J2VA 3GA9L 4OTTA 1HK5A 3GQXA 4GG2A 3W1SA 2DBXA 2DYOA 1TXUA 5DBYA 2XW0A 1BKEA 4ZBKA 5FUOA 2EFDA 2ROHA 1J7EA 1H9ZA 5ID9A 4TQ1A 1IJGA 4LUFA 2BXAA 3H37A 4IW1A 1N5UA 5IJ5A 5GIPA 5HOZA 3FWCC 3JQZA 1HK3A 2BXDA 2EFHA 4DHXB 1GNIA 4K2CA 4FIPB 4HGMB 4W4UB 3V03A 2BXPA 5DQFA 3B9LA 2XW1A 2I2ZA 3MHHB 4LB9A 3SIVB 2NQOA 3WHQA 3KJLA 4L9KA 2QMCA 2Z8JA 3A73A 4OR0A 4L8UA 3H3AA 2I30A 3NVIA 4ZUXV 2Z8IA 5GIOA 3G9KD 4F5VA 2XVVA 3V08A 4Z9OA 4S1YA 1HA2A 1E7EA 3NVMA 5D7GA 2V36A 4Z69A 2JUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OTU A;  5BPK A;  2DBW A;  2Z8K A;  4GDX A;  2E0Y A;  2DBU A;  4ZC6 A;  4ZCG A;  5B5T A;  2E0X A;  2DG5 A;  3WHS A;  3A75 A;  2QM6 A;  2NQO A;  3FNM A;  3WHQ A;  2QMC A;  2Z8J A;  4OTT A;  4GG2 A;  3WHR A;  2DBX A;  2Z8I A;  4ZBK A;  4Z9O A;  2V36 A; 
#chains in the Genus database with same CATH topology
 1H5W A;  5BPK A;  2DBW A;  5IIU A;  4G01 A;  3GQU A;  2OT3 A;  4ZBR A;  4F5S A;  4HGK A;  1O9X A;  4BKE A;  4F5T A;  1E78 A;  4TQ0 A;  1MA9 A;  4ZC6 A;  3PLA A;  1HK2 A;  2BX8 A;  1BJ5 A;  2E0X A;  2BXG A;  1JNB A;  2CKX A;  2XVU A;  4L9Q A;  1HK4 A;  1VZS A;  2KBZ A;  3MHS B;  3SQJ A;  3BPJ A;  4EMX A;  2QHB A;  3KIK A;  1E7H A;  2XVW A;  4MBE C;  3TDL A;  1E7G A;  1MIW A;  2BXN A;  2GUT A;  3WHR A;  5IIH A;  1MIV A;  1BM0 A;  4WA6 B;  2BXO A;  3CX9 A;  1FOU A;  4GDL B;  3V09 A;  2YDF A;  3B9M A;  4K71 A;  4NAW B;  2BXL A;  2DYM A;  1E7I A;  2VDB A;  2VUE A;  4FK5 B;  1KXP D;  2EFC A;  4LA0 A;  4OTU A;  1E7B A;  4PO0 A;  2AJE A;  3LU7 A;  2NNW A;  4GDX A;  4F5U A;  1E7C A;  4JK4 A;  1E7A A;  2LOQ A;  2OZB B;  1GNJ A;  4ZCG A;  4LB2 A;  4E99 A;  2DG5 A;  3WHS A;  4IW2 A;  1KDX A;  2BXE A;  4OT2 A;  3ICX A;  4N3Z A;  3VQI A;  2XSI A;  3JRY A;  4BY9 C;  1NT2 B;  1E7F A;  5GIN A;  4G03 A;  1VFI A;  2VUF A;  3NMU A;  2XMO A;  4N0U D;  4ZBQ A;  5ID7 A;  3NVK A;  2BXM A;  5IJF A;  1LNS A;  4N0F D;  1MIY A;  5IJE A;  2BXB A;  1SB0 A;  4C31 B;  2BXQ A;  2Z8K A;  2EFE A;  1HK1 A;  1TF0 A;  2BXK A;  2BXH A;  3FWB C;  2E0Y A;  2DBU A;  2XVQ A;  3ECP A;  4M70 B;  5B5T A;  5IIX A;  3SIU B;  2BXC A;  1J78 A;  3LU6 A;  4FJC B;  5IFO A;  3UIV A;  3A75 A;  5GHK A;  2QM6 A;  3FNM A;  3LU8 A;  1LOT A;  4LUH A;  2LXS A;  1UOR A;  1KW2 A;  3M99 C;  1AO6 A;  2BXF A;  4I9O A;  2BXI A;  4GDK B;  4G04 A;  4J2V A;  3GA9 L;  4OTT A;  1HK5 A;  3GQX A;  4GG2 A;  3W1S A;  2DBX A;  2LQH A;  2DYO A;  1TXU A;  5DBY A;  2XW0 A;  1BKE A;  4ZBK A;  5FUO A;  2EFD A;  2ROH A;  1J7E A;  1H9Z A;  5ID9 A;  4TQ1 A;  1IJG A;  4LUF A;  2BXA A;  3H37 A;  4IW1 A;  1N5U A;  5IJ5 A;  5GIP A;  2LXT A;  5HOZ A;  1MUS A;  2KWF A;  3FWC C;  1HK3 A;  2BXD A;  2EFH A;  3JQZ A;  1GNI A;  2AGH B;  4K2C A;  4DHX B;  4FIP B;  4HGM B;  4W4U B;  3V03 A;  2BXP A;  2LQI A;  5DQF A;  3B9L A;  2XW1 A;  2I2Z A;  3MHH B;  4LB9 A;  4D7X A;  2NQO A;  3WHQ A;  4DM0 A;  3SIV B;  3KJL A;  4L9K A;  2QMC A;  2Z8J A;  3A73 A;  4OR0 A;  4L8U A;  3H3A A;  2I30 A;  1MUH A;  3NVI A;  4ZUX V;  2Z8I A;  5GIO A;  3G9K D;  2K0N A;  4F5V A;  2XVV A;  3V08 A;  4Z9O A;  4S1Y A;  1HA2 A;  1E7E A;  3NVM A;  5D7G A;  2V36 A;  4Z69 A;  1MM8 A;  2JUH A; 
#chains in the Genus database with same CATH homology
 1H5W A;  5BPK A;  2DBW A;  5IIU A;  4G01 A;  3GQU A;  2OT3 A;  4ZBR A;  4F5S A;  4HGK A;  1O9X A;  4BKE A;  4F5T A;  1E78 A;  4TQ0 A;  1MA9 A;  4ZC6 A;  3PLA A;  1HK2 A;  2BX8 A;  1BJ5 A;  2E0X A;  2BXG A;  1JNB A;  2CKX A;  2XVU A;  4L9Q A;  1HK4 A;  1VZS A;  2KBZ A;  3MHS B;  3SQJ A;  4EMX A;  2QHB A;  3KIK A;  1E7H A;  2XVW A;  4MBE C;  3TDL A;  1E7G A;  1MIW A;  2BXN A;  5IIH A;  3WHR A;  1MIV A;  1BM0 A;  4WA6 B;  2BXO A;  3CX9 A;  1FOU A;  4GDL B;  3V09 A;  2YDF A;  3B9M A;  4K71 A;  4NAW B;  2BXL A;  2DYM A;  1E7I A;  2VDB A;  2VUE A;  4FK5 B;  1KXP D;  2EFC A;  4LA0 A;  4OTU A;  1E7B A;  4PO0 A;  2AJE A;  3LU7 A;  2NNW A;  4GDX A;  4F5U A;  1E7C A;  4JK4 A;  1E7A A;  2LOQ A;  2OZB B;  1GNJ A;  4ZCG A;  4LB2 A;  4E99 A;  2DG5 A;  3WHS A;  4IW2 A;  2BXE A;  4OT2 A;  3ICX A;  4N3Z A;  3VQI A;  2XSI A;  3JRY A;  4BY9 C;  1NT2 B;  1E7F A;  5GIN A;  4G03 A;  1VFI A;  2VUF A;  3NMU A;  2XMO A;  4N0U D;  4ZBQ A;  5ID7 A;  3NVK A;  2BXM A;  5IJF A;  1LNS A;  4N0F D;  1MIY A;  5IJE A;  2BXB A;  4C31 B;  2BXQ A;  2Z8K A;  2EFE A;  1HK1 A;  1TF0 A;  2BXK A;  2BXH A;  3FWB C;  2E0Y A;  2DBU A;  2XVQ A;  4M70 B;  5B5T A;  5IIX A;  3SIU B;  2BXC A;  1J78 A;  3LU6 A;  4FJC B;  5IFO A;  3UIV A;  3A75 A;  5GHK A;  2QM6 A;  3FNM A;  3LU8 A;  1LOT A;  4LUH A;  1UOR A;  1KW2 A;  3M99 C;  1AO6 A;  2BXF A;  2BXI A;  4GDK B;  4G04 A;  4J2V A;  3GA9 L;  4OTT A;  1HK5 A;  3GQX A;  4GG2 A;  3W1S A;  2DBX A;  2DYO A;  1TXU A;  5DBY A;  2XW0 A;  1BKE A;  4ZBK A;  5FUO A;  2EFD A;  2ROH A;  1J7E A;  1H9Z A;  5ID9 A;  4TQ1 A;  1IJG A;  4LUF A;  2BXA A;  3H37 A;  4IW1 A;  1N5U A;  5IJ5 A;  5GIP A;  5HOZ A;  3FWC C;  3JQZ A;  1HK3 A;  2BXD A;  2EFH A;  4DHX B;  1GNI A;  4K2C A;  4FIP B;  4HGM B;  4W4U B;  3V03 A;  2BXP A;  5DQF A;  3B9L A;  2XW1 A;  2I2Z A;  3MHH B;  4LB9 A;  3SIV B;  2NQO A;  3WHQ A;  3KJL A;  4L9K A;  2QMC A;  2Z8J A;  3A73 A;  4OR0 A;  4L8U A;  3H3A A;  2I30 A;  3NVI A;  4ZUX V;  2Z8I A;  5GIO A;  3G9K D;  4F5V A;  2XVV A;  3V08 A;  4Z9O A;  4S1Y A;  1HA2 A;  1E7E A;  3NVM A;  5D7G A;  2V36 A;  4Z69 A;  2JUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...