2E18A

Crystal structure of project ph0182 from pyrococcus horikoshii ot3
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
256
structure length
256
Chain Sequence
MRILDYDKVIERILEFIREKGNNGVVIGISGGVDSATVAYLATKALGKEKVLGLIMPYFENKDVEDAKLVAEKLGIGYKVINIKPIVDSFVENLELNLDRKGLGNIMSRTRMIMLYAHANSLGRIVLGTSNRSEFLTGYFTKWGDGASDYAPIINLYKTEVWEIAKRIGVPERIVKKKPSAGLWEGQTDEDELGISYNLLDEILWRMIDLKIGKEEIAKDLGIPLSLVERVEELIKKSEHKRRLPIGPSFEDLIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords NH(3)-dependent NAD(+) synthetase
publication title Crystal structure of project PH0182 from Pyrococcus horikoshii OT3
rcsb
total genus 92
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 6.3.1.5: NAD(+) synthase.
pdb deposition date 2006-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02540 NAD_synthase NAD synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2e18A00
1JZSA 3P0JA 4YMIA 1YUMA 2QUHA 1NUPA 1EJ2A 1T6YA 1O97C 4NX2A 2VTBA 1UFVA 3INNA 3SP1A 4XFJA 3ZXSA 4RPIA 3PNBA 3SZ3A 1JGTA 3S3TA 3TQIA 4ZT5A 1KR2A 1N2IA 3HZRA 4QBTA 4MW0A 3SDBA 4WNYA 1O94D 1VBNA 2IP1A 3TQOA 4GRIA 4NDAA 1KQOA 4ZT4A 2I1LA 2QTNA 5IHXA 4ZCRA 3I05A 3U1VA 3D6UA 1EFVB 2PZ8A 1OBHA 1JEDA 3KT6A 1NP7A 2VXOA 4DDMA 3FETA 3RK0A 3CVXA 4JXXA 1MAWA 3X1KA 3CLSC 1N2GA 1M8FA 1QU2A 2CSXA 1H1TA 4ZCSA 2CYCA 3ILVA 2QJTA 2JANA 3COZA 2CUZA 3L92A 2ZUEA 1PFVA 5J5AA 3FY4A 2CFOA 2OQ2A 4MQ6A 4YP7A 2V0GA 2TS1A 3IVGA 2GM3A 5H16A 1MB9A 1WKBA 3IH5A 4ZCPA 1F4LA 1VBMA 1LI5A 1JEEA 5TEVA 4CDNA 3CVVA 1NUUA 2YXNA 4MW1A 1QJCA 4HJXA 3UC5A 3K32A 2DXIA 3AG5A 3UOWA 3CLRD 4DLPA 3P0HA 1Q77A 1J70A 2D13A 1KORA 3ZIUA 3RBAA 1PG2A 1OWNA 5KWVA 2Z08A 5J59A 4A91A 1WQ4A 1J1UA 3DLAA 4CQNA 3VU8A 3IOEA 1I6MA 4G5YA 5HUHA 3ZGZA 4G6ZA 1N78A 3Q4GA 1P7PA 1NUTA 1NUSA 1GPMA 4EG7A 4KR6A 3P0IA 1PFYA 4CDMA 3UY4A 4PY2A 5TEWA 5DB4A 4YP6A 2DERA 1FYDA 3RFFA 4EGAA 1WJGA 1IHOA 2QJOA 3N2YA 1QRTA 5AHWA 2A1TS 4MW7A 4KKVA 1M8KA 3TNJA 1KH1A 3KT3A 3N9IA 2XRYA 3IMGA 1BS2A 2DR2A 4U63A 1U3DA 1FFYA 1JZQA 1J21A 4L2IA 5FO0A 1U7DA 1R6XA 3E27A 1MOPA 3G5AA 1IRXA 3FNRA 4OJMX 1KH2A 3SZGA 4R2MA 1XNJA 3CLUC 1IQUA 1O95D 1NUQA 4MUHA 3PNYA 3GMIA 1JIKA 1OD6A 4JXZA 2ZUFA 5FO1A 3LOQA 3N8HA 5LM3A 2QJFA 5H7XA 1NURA 1TYBE 1WOYA 1D2RA 3SEZA 1N2EA 3UK2A 3ZXIA 1I6KA 2O5RA 3MMXA 1KP3A 3CVUA 1N2BA 2E0IA 3MLAA 4TS1A 4U8HA 2CV1A 1XNHA 3COVA 3QTTA 3CVWA 2PFSA 1X6VA 3PRHA 1JIIA 3H99A 1YIAA 1ZH6A 4MUJA 1EXDA 3X1MA 3HFJA 2JAXA 1NYLA 3M5WA 4J75A 5TS2A 4R2LA 1K4MA 1V8FA 2Z09A 1T9GS 3PNVA 3QE4A 1TQ8A 3A05A 1EUYA 2X3FA 3H9CA 1J09A 3VGJA 3CLTC 4EF6A 4MUIA 4ZT6A 1J1ZA 2A86A 3SEQA 2HMAA 3FI0A 4ND7A 2WQ7A 1G59A 1U7XA 3KT0A 4MVYA 4NZPA 1ULHA 4DDKA 3IVCA 4MWDA 3ZUGA 2CV2A 3X1JA 1DNPA 2GOYA 2HZ7A 3AKZA 1H3EA 3IOCA 4K0RA 4ARCA 1O0BA 1TYAE 3OP1A 1HYBA 4K03A 3OTWA 2J4DA 2QTRA 2A1UB 4KPUB 2G36A 4I6GA 1JILA 4MUGA 1EFPB 4QRDA 2QUKA 3NBAA 1JECA 3LCJA 3FG9A 3RJZA 1M1ZA 4MWEA 1XJQA 4F3RA 1N1DA 4G5FA 1N2OA 2YWBA 4UZEA 1N2HA 3A04A 1MB2A 3IUBA 4MWBA 3Q10A 4XFDA 3JXEA 1WXIA 1EFVA 4ZT3A 1COZA 1KH3A 3KT8A 4U7JA 3G6KA 1T6XA 4NATA 5HUJA 3COWA 2D54A 2HGZA 1B6TA 2CYAA 1O94C 3ND7A 4MLPA 1JHDA 4YBRA 2WB2A 1EUQA 1JIJA 2A1UA 4KPUA 4MVCA 4JFAA 1EFPA 3CLUD 3P52A 3ZJVA 5HG0A 5TGTA 1YUNA 1M8GA 2PZBA 3HMQA 1QTQA 3LE8A 4HK4A 1IQ0A 3H05A 4MW6A 5DEOA 4DNXA 3FWKA 3AG6A 3IODA 3FOCA 3SYTA 5K0TA 1GTSA 4EG8A 4S1OA 1KAMA 1O0CA 3HV0A 3HL4A 1IFXA 1OWOA 1QNFA 1GN8A 1O97D 4DJAA 1M8JA 2RE8A 1IQRA 1MJHA 5JBNA 3KFLA 4DDHA 2OV4A 1QRUA 3CA8A 1KAQA 3AIIA 4F4HA 1O6BA 2NZ2A 1M83A 1CT9A 2GKSA 3FH0A 1YI8A 2A7XA 1J20A 4BWVA 1O96B 1ZH0A 4DE5A 4KR9A 3IOBA 2J09A 1T6ZA 3IDFA 3GLVA 2WSIA 1Q15A 3CLTD 4OUDB 1NZJA 1KP2A 1TYDE 3DO8A 1SURA 1Y42X 1NSYA 1LW7A 1G8FA 1ILEA 3NBKA 3IMCA 2QUJA 3CLSD 3MLBA 4ZCQA 3GUZA 4HJRA 3CR8A 1G8GA 1IH8A 2H2AA 4MVXA 1G8HA 3CVYA 1WY5A 5FNZA 3UMVA 4GU5A 1K97A 4MVWA 3ZJTA 3G59A 4R0NA 4Q16A 2BYTA 4Q93A 1KKUA 5LFAA 3DPIA 3F3MA 2IJGX 4JYZA 3H9BA 1OWLA 3HGMA 1H3FA 2PZAA 1Q11A 1O96A 3AL0C 4FZJA 2R5WA 1OWPA 1MAUA 4P2BA 4PBRA 4PBTA 4OUDA 1ZJWA 4MW9A 4JZYA 1VBKA 1KQPA 4MW5A 1I6LA 1N2JA 1N75A 4WSOA 3COYA 1Q19A 4MWCA 5KHAA 4AQ7A 4XSVA 2CV0A 2DEUA 4KR7A 2A84A 3IMEA 5DASA 2V0CA 4CT0A 4H3SA 1QU3A 3ZJUA 2QUIA 1X8XA 2J5BA 1O95C 1GZUA 5EKDA 4MW2A 1TYCA 1ZUNA 4YP5A 4PBSA 2BTEA 1PFUA 1T9GR 2PIDA 4ZT2A 2ZP1A 1LI7A 2YY5A 2E89A 1F7VA 4MUEA 1EE1A 1A8HA 1M8PA 2CYBA 1O5TA 1VLHA 1IVSA 3A2KA 2X0KA 2A4MA 3D6VA 1OWMA 2EJCA 3IUEA 3L93A 3VRHA 4E1AA 4EFKA 4ND6A 5KCMA 2JA2A 2C5SA 3TZEA 2E18A 1U0BB 1MC1A 3A4IA 2YWCA 1VL2A 4AS1A 4RUKA 3ND6A 2AG6A 4MW4A 3TS1A 1GLNA 3AFHA 2WQ6A 2Z3VA 1WQ3A 4MAFA 5LLTA 4NAHA 1V47A 1N3LA 2DUMA 2QTMA 2RD2A 3K9WA 1U3CA 4MULA 2A88A 5BNZA 1TFUA 4HPWA 4NAUA 1H3NA 3MXTA 4UZFA 3ELBA 1WXFA 4L2IB 4EG1A 1MRZA 2X1MA 4EG6A 4MUNA 3TZLA 3ISJA 3MUEA 2J07A 2EL7A 1XNGA 2O8VA 2PXHA 3BL5A 4ZCTA 2AKEA 4QREA 3PXUA 3QTBA 1WZ2A 1YULA 1MBZA 2E21A 1R6UA 2D5BA 2NSYA 3ND5A 1N77A 1KQNA 2CT8A 4ARIA 3Q12A 3RHSA 2IELA 3FIUA 1GTRA 2DLCX 4J76A 2X1LA 1WXEA 1QQTA 1K4KA 2XRZA 1TEZA 4MUKA 5DK4A 4X0EA 3FDXA 4EG3A 5F23A 5IJXA 1WXHA 1F9AA 1YIDA 2DPLA 1R6TA 3CLRC 1WXGA 2DETA 3FHJA 2VTBB 4ZT7A 2AZXA 4MUFA 4I6EA 5J58A 2A1TR 1S4MA 3IVXA 1GAXA 1NI5A 3C8ZA 3H97A 1OBCA 3RK1A 4EG5A 1F7UA 3N05A 1I2DA 4I6JA 3NV7A 3DV2A 5K0SA 1JMVA 2B7LA 4EG4A 1PFWA 1K92A 2J08A 1RQGA 1QRSA 2PG3A 2H29A 1PG0A
chains in the Genus database with same CATH superfamily
4DPMA 2KBEA 4O4IF 1YUMA 2DUNA 4ESHA 3LAWA 3NT4A 5EWJB 3ISTA 2C94A 2UKDA 4D3FA 2PT9A 2Q99A 3C4JA 3IVRA 3VYWA 4F5YA 1GA4A 1N8SA 2I2WA 3F7MA 4KE8A 5DXAA 4BIMA 5HYVA 3VA7A 1U02A 1HEUA 2G1JA 3PTAA 4ATNA 3RC7A 3SHVA 2NV6A 1BOOA 1SXJE 4QYIA 4JQZA 1N0IA 3H1TA 4E2WA 1NVWQ 4QT0A 3L7CA 3ETGA 1QVRA 3Q87B 4AJ1A 1Y9JA 4GM4A 2QJWA 3FDZB 2G3YA 2ORVA 2OXEA 5CEJA 4N39A 3ZXXA 5J43A 3R8XA 1KK1A 1NONA 2P8SA 3NAGA 3EARA 4DV6B 4UHEA 3VUEA 1JTFA 3THYA 3ZU6A 1JEAA 1O94D 3JALB 5LDGA 3C1AA 1B8PA 2EFCB 5HK9A 3PGA1 5DW3A 1Z6ZA 4L9AA 1U7OA 3HJGA 4WKPA 3WWCA 3MCTA 4XSGA 3EIWA 2WDPA 3K1AB 3S8YA 4MCIA 3V46A 2X23A 4H16A 3ACDA 5DLYA 3ZK7A 4C88A 5K4GA 4BNYA 2QZJA 2VJLA 5JALA 4LF8B 4PSKA 1DIHA 1C3JA 3QFHA 3VHQA 3WMGA 1W36C 3UPDA 4XB6B 1JEDA 3PLNA 5AXAA 4BBZA 1PJ2A 3THWA 2WY2D 2PDAA 3GXOA 2JFOA 1CQIB 1WCV1 3KSMA 1SBHA 4ENPA 3VAAA 1HGXA 2EP5A 2R7AA 5PNTA 2C2YA 2RHLA 4R81A 1KVUA 1FX1A 1VZ3A 3K1JA 1QYRA 3SQOA 3HBMA 3LA6A 4H1WA 4DWWA 2CB0A 4E14A 1RKVA 3NKFA 2EQAA 8ATCA 5JS6A 3ESBA 4YCNA 4MRMB 2QQGA 4MVJF 1JEQA 3GOQA 4F1JA 2XDQB 1AK9A 1Y1TA 4FK8A 1KI9A 3FY4A 5A71A 3ZX4A 1IULA 4ENUA 3VTFA 1EB9A 1CVIA 1WTCA 2X13A 4KQJA 2R00C 3DFKA 1A9XB 4MK4A 4Y2HA 4U4AA 3ZWKA 4F5ZA 5JRZA 3G2QA 4NHEA 4TWBA 3P2JA 5H1YA 4C87A 5TMPA 3WLNA 1QQBA 1PNRA 2XE7A 4RXMA 4R6WA 3BK1A 1DX9A 1UJ2A 1XNRB 1DXQA 4HJXA 5I6DA 2FPGB 2VCHA 5HRCA 1YUBA 5ALMA 1Q20A 4CCYB 5CITA 1QFSA 1FP4B 2FMFA 4J1SA 3D8HA 2NYUA 5KWVA 2IYTA 1GKYA 5J59A 1GZSA 5CVCA 1AO3A 2CL6X 3SIRA 1QK4A 3KG2A 5JO0A 1HTWA 4J4BA 1G20B 1UBOS 2I1VB 5I9SA 1G6HA 4BY9E 4XWYA 5JG7A 3TBHA 1J1UA 2OZVA 5BNIA 5AVYA 4A6EA 3ZV4A 3ZWOA 1SCDA 4PN3A 3EVEA 1UWLA 2Z9DA 1QIFA 2QNIA 1LD3A 1U5CA 2RARA 4QLOA 1ZK2A 4RIIA 4HNRA 1Z13A 3F6PA 5DF1A 5BN5B 3RSHA 3PG5A 1YJBA 1GTJ1 2EFJA 4F8YA 4KWEA 1H2YA 2PS9A 2H4YA 3H9EO 4NYJR 3NM4A 3W0LB 1YQ9A 1W4ZA 5CH5A 3RKSA 6REQA 1E8NA 1QRAA 4ENQA 5CAEA 1DT5A 3ENWA 1WZIA 4ZV4A 1XE3A 3NCTA 5TDHA 4UPDA 3PFKA 2QLBA 1OX5A 1XT6A 2AD1A 2AFHB 3CH5A 5EXPA 3FTFA 4HDQB 1S8FA 4DREA 5FYDA 5ICFA 3IPLA 2WKPA 4ZDWA 3ZVMA 1DSSG 3AL3A 3X43A 1BS2A 3G0CA 2AMVA 2PSHA 1E6LA 4S1VA 2O8EB 1GZ3A 3EG9A 1EK1A 4HLNA 3PHIA 3G5AA 3SR3A 1P5FA 5K3SA 2RAPA 5B64A 4FONA 1E98A 3QPBA 1SK8A 2ORED 3GLGE 5GM1A 3AI7A 4HN2A 3NM5A 4HDSA 2R6DA 3H4VA 4JJ8A 4XRRA 4ZO9A 1A4RA 1KIFA 4CEIB 2ZIGA 1TO2E 3PUXA 5KI6A 3LUJA 2DM6A 2OO3A 2PZEA 3ISVA 4A10A 5CDHA 3FYUC 2JJ1D 4A0HA 2QB5A 3KB6A 3WLMA 1EE9A 1NOKA 1TYBE 3JQBC 4JD5A 2CVOA 1N2EA 2LKCA 4OHXA 3K94A 3FMVA 5JQGF 5ALXA 4DV4B 2P77A 3DL7A 2N9UA 3N59A 3H9JA 4XX1A 2O5RA 5DTIA 1B0ZA 4E51A 2FTKE 4D8TA 4EY7A 1I7NA 3N2KB 1AB5A 2ODEA 3HA5A 3HDJA 4BRSA 3BEDA 3NRCA 4WNCA 3DMYA 3D6NB 3I6MA 1EK2A 4DIUA 1J0AA 1NP6A 2FZWA 2PS1A 2P6UA 4ZOLF 4ERXA 2H7YA 4L4SA 4R1QA 5FNVF 4CQMD 3QNUA 1JHAA 2P62A 3RT9A 3U4GA 2DQZA 4L0MA 2BGGA 2OL4A 1U3UA 1ZHFA 3B3AA 5GONB 1UZNA 2PMBA 2XMGA 3ELUA 5CH8A 6NULA 3L4KA 2AFIB 2J6CA 2X3FA 1J9GA 4TYQA 1QSGA 3ANXA 2DJ5A 4NYMQ 2HFJA 1ZMOA 3USES 2WWXA 4ZT6A 3DAOA 1WV1A 4JYPA 2LKDA 3OQMA 3A36A 4PEVA 1JDUA 2A9VA 3MWJA 4MNTA 3QF4A 5E1DA 1C8KA 1ULHA 5A02A 3ZUGA 1ULBA 2GOYA 3ASUA 3B6ZA 4RFLA 5ARDA 1JIVA 1WW8A 2VP3A 3AHGA 3LG2A 3P9KA 4X84A 1G55A 3M6LA 3TLMA 3WYGA 3L1JA 1K8XB 2CL5A 5FUQA 3ZG6A 1JG3A 2W6NA 3BN3A 3NWOA 3RKRA 3AF1A 3WO0A 3D54D 1FRFS 4V0NA 5HIIA 4E08A 3KTAA 4EY5A 1DAHA 5EHZA 2QUKA 2P2SA 2QRJA 4GICA 4U7HA 5F35A 3T9AA 4ENRA 3Q0IA 1D8TA 1NBME 3WOHA 2DY0A 2CLSA 4IF6A 1K88A 3CNQS 3MJTA 1ZNYA 4RV9A 4MR9A 4YJFA 5HFNA 3RC3A 3T3GA 3DP7A 1JZTA 2ZUVA 2L42A 3OO1A 4RK5A 3N70A 3ZR4B 1ISHA 5CNIA 3UA4A 2NUAA 1A9RA 1IHDA 3D7RA 3O4HA 4RABA 2XI4A 2W2TA 3UV3A 1AA9A 5BSEA 3VVBA 5FWAA 5HOQA 1W85A 1H85A 1FDVA 5BVGB 1K7FB 2OILA 2X86A 2NXCA 4K9LA 1SVOA 1X8LA 2PA3A 1S1CA 4ZEWA 3LW8A 2BFEA 4FIDA 4X24A 4AQYB 3WNDA 1LF5A 3GL9A 1QVZA 4AZSA 4BNXA 3JR3A 3CH4B 2QD4A 4OBEA 4AUKA 4WQMA 2IOHA 1KJYA 4FQ7A 3UGJA 3PGVA 1GQ2A 1BIFA 4BMSA 1D2MA 3BH7A 4PCLA 1QE0A 2D2EA 4PFKA 1PSDA 4W1QA 4EF4A 1EFPA 5JANA 3U7FB 1KI8A 3L7AA 2WFMA 1W2GA 1QONA 2VAPA 1BE6A 3LNCA 3OT1A 1FSSA 4V2IA 2PM8A 2B37A 4CM1A 1ISJA 2Z2KA 3E82A 2RCNA 2DOKA 4N5MA 4QPJC 3S2UA 1VIVA 4HGYA 1PQPA 4ETIA 2C9MA 1SVSA 3PF8A 5BSMA 5LXTB 5TT0A 1H6CA 1NLYA 4X6XA 4EKNB 5C5CA 3SYTA 3B12A 1V7ZA 2ZBFA 2ROQA 2VJMA 1NDQA 1EIWA 2BEUA 3FPJA 4NARA 1W0JD 4ND3A 4U2EA 4O3MA 2ZUCA 3A1EA 3CONA 1I7PA 4KI7A 5KQPA 2JGFA 3HJTA 2PMFA 1QH1B 3WK5A 1CEXA 2RJNA 2HMTA 1N0VC 1A8QA 2PCLA 2RE8A 1MV8A 3K8YA 1B8UA 3LQFA 4HAYA 1IJBA 1QX3A 2B25A 2I6FA 2HDOA 4QSHA 5BW4A 3EBLA 1RVV1 1UWKA 3PDHA 2Q07A 3FH0A 4F6RA 5FBVB 4G5GA 1TGVA 3CEJA 3G88A 4BWVA 4DGQA 2Z6AA 2G4VA 3GLFA 3EODA 3KD2A 1GRQA 1HT3A 2YJTD 2NO6A 3HLTA 1IONA 4EPYA 16PKA 3HY3A 1NLFA 4QTZA 3OIUA 2RSLA 5AT1A 5CB8A 1MAHA 1W36D 3LXRA 4ME6A 3PUWA 1ILEA 4BP3A 3FROA 1X15A 1P0PA 1M2GA 3JSXA 2NXJA 1WB5A 3MCUA 4EX6A 3IIKA 4YALA 2AC2A 5REQB 3STYA 1TA0A 4G1UC 1GN9A 1I2BA 3OQJA 4LBYA 3V8MA 4BNMA 2FR8C 4Y67A 4CLDA 2ZRIA 3BD9A 2BZ0A 2Q46A 3LW7A 4R1LA 1LX6A 1NZFA 2FN8A 5ALDA 5THKA 3H8SA 1GRCA 4DSAA 5IX8A 1ADJA 1F2TA 4WT7A 1Y5RA 3E22A 3DFUA 2UZ1B 1JU9A 5G0UA 4IIFA 5TJHA 5FCDA 3TB4A 4KXXA 1T25A 5K1ZA 3TDNA 3V7FA 3EXHB 5EKSA 5JSFA 1O6FA 4JUBA 1F9EA 3CNEA 1FUYB 1U0SY 2YXEA 2O2ZA 4HSGA 2QVLA 3WRYA 4EYEA 3PRJA 4MIEA 2PMDA 4B4UA 2FWIA 2GSWA 4CHTA 1XXHA 4P2BA 5B2FA 2JI8A 1C1XB 5L3SB 1KGSA 2CWWA 1T2VA 1TL7C 3WO1A 2UYHA 1F60A 3KAQA 1DRUA 4JZYA 5CXSA 3T1TA 3B51X 4IO0A 3I9KA 1J5PA 2BRUA 2R1TB 1A95A 1R10A 4AKIA 1XVAA 2C5EA 4F8JA 2HO5A 2HAEA 4EW2A 2VDOB 5TMEA 3LS2A 4AQ7A 5DMHA 2KJQA 3K53A 1IL0A 4FP9A 1ADFA 4LOAA 4B3IA 3MILA 2MINA 1ML3A 3IMEA 4OQDA 4P0QB 1RKBA 1ARZA 3TUZC 1A7JA 3ZNNA 1GAEO 2NO5A 4QTTB 1J0DA 1IEWA 1FS4A 3FCEA 1Y5LA 3Q98A 4G26A 4PHGA 3QVSA 3W5SA 1KSFX 2PIDA 4BN4A 4KR3A 3E7XA 2B0CA 2ZP1A 2XRFA 3Q5DA 2VYND 5LOVF 3HWX1 1NW9B 1KFCB 2WBLC 3MIZA 1RYMA 2PWAA 1ZD8A 3ONDA 1PDVA 2W70A 1ZCFA 4O2AB 2Q6IA 2P6RA 4KO4S 1X94A 1YZKA 4YUZA 4B33A 1UF9A 3UWMA 3LBYA 3EGOA 4M9SA 1RYBA 1SR8A 5DHFA 4J7XA 2JFWA 5DW0A 1NAIA 5ULLA 4UUAA 2NQ2C 2X2FA 3KSZO 2XV1A 3WYCA 2VG8A 4ZHQF 5FFFA 2V7EA 2HWYA 4PR3A 4BXOA 2ATCA 3VVLA 1MVOA 1Z56C 1RWKA 5CDYA 2NPIA 2Q5CA 2CXPA 3R3XA 4Y9TA 1GZ4A 3K7EA 4K9RA 1Q92A 4MICA 4BKOA 4EO9A 2HIAA 3OVMA 3IR6A 1AURA 2Q8PA 3WDKA 5E0OA 2BTQA 5E7MA 3JQPA 1K3UB 1PT8A 1QR6A 2I7CA 3KKMA 1P5RA 4M49A 5BSUA 3W77A 3MTJA 721PA 2R0QC 1J7JA 4CI0B 2I6SA 8ABPA 5JCJA 2VA9A 3EIEA 2PX4A 1D0SA 2PYDA 3R5HA 3ITEA 1VHLA 1MPXA 2ZBUA 3OIDA 3IAAA 4Q3EA 2C2KA 2LPMA 5D6OA 4OYYA 4TYPA 2C2BA 1JR3A 1L4UA 4DLLA 5A6VA 2RD2A 4RTNA 3RM3A 2J3LA 1H94A 2UZIR 3LKBA 2ZS9A 2OBYA 4X92A 4B2IA 1NJ5A 2QQFA 1T4GA 5T57A 4Y9SA 1ZGAA 3OESA 1HLPA 2ZIUB 4TQUS 5H80A 4P4NA 1H3NA 3JAMA 5ADUS 3CZQA 1FJGB 3H8WA 4JSRA 4YRFA 1W1IA 5FLYA 2P27A 5ALTA 3QPAA 2OAGA 2WE8A 3JD2A 4OM7A 3LDAA 4ER7A 4C7XA 3GPLA 1GUZA 2FHPA 3FB1A 4G0ZA 1RYNA 1MXFA 4K88A 1LK7A 4QELA 1XZIA 4UCXA 4DMKA 1NX9A 3CW2A 1H8HD 2D5BA 1BVYF 1J42A 2FGKA 4G89A 2OBFA 4GBED 4O6VA 3W8RA 5JASA 4OHYA 4W5JA 3WIEA 1RBMA 2OFWA 5DISB 1QVWA 1E6KA 3WGGA 4RF5A 1EAMA 4ARIA 2DLCX 4B17A 3RC9A 3U61B 2X1LA 2JLWA 3RNLA 3R4VA 3PPXA 1EUDB 1XB2A 1RMQA 4Y9DA 4TTPA 1WXHA 3L4BC 4L9WA 4ZVMA 3VC3A 1X86B 4WY8A 3IQEA 1OAKA 1CE8B 1PWYE 4L5AA 5E6RB 4MINA 3VYUB 1T0UA 1Y7TA 2OESA 5FOXA 4C0AC 1NF3A 3B1VA 3ZU3A 1SGWA 5KSOA 4YDHB 5CX1A 1KI3A 3DAPA 3S2EA 1C7RA 1CYEA 2Y1CA 4JI0B 1YOVB 1MJGM 1RM5A 1VCNA 1OBCA 1JDJA 1QHHA 2BKUA 4GPBA 3F4LA 5EPOA 3WJAA 3PEYA 5LKRA 4Q03A 5FR1A 3S2FA 1HQDA 1M1UA 4K1XA 2JGMA 1FDRA 3SAJA 2Y1GA 3TLYA 5LP1A 4EPVA 4CF4A 3O21A 1E2KA 2FPPA 4UQOA 1H5UA 1FVXA 1VKRA 3NTOA 1BDHA 1VMIA 3GLRA 5FP0A 1EFRD 3CNHA 2WJ4A 3K0CA 2ASVA 3LC2O 3ABOB 3LD9A 1I13A 2OKCA 1V26A 1R0YA 3HCFA 3L77A 4I4TF 4X44A 2NU6B 1B2LA 4ND5A 1TC1A 2FFRA 4ZVVA 4HB4A 2WYVA 4R1MA 4CF6A 2DR3A 5CXUA 2DHQA 2QUHA 2O48X 1PX2A 1EJ2A 4NPCA 5DN9A 1K27A 3H1EA 5FOWA 1FFXA 3L7LA 3SJUA 4DLTA 5KVQA 3JWHA 2R6HA 4MUYA 5LDHA 5SZJA 3PPVA 4J4TA 3HDYA 4JYCA 3IPYA 4YT2A 4LZJA 3AJEA 1Z3IX 3L1VA 4XM0A 3C74A 1NNLA 3ZJYA 1Y34E 2OFOA 4UU0A 3P9NA 2VTBA 3KTAB 1KDTA 4C6TB 2BHRA 2QVXX 3QGMA 4RKWA 4RPIA 4ZJPA 1TTQB 4IIYA 2AN1A 3KR2A 1MJNA 2NSDA 3KZXA 4OXIA 1HE2A 1PTJA 2BI7A 3L8DA 2A5GA 4HWPA 2PQ0A 4QBTA 4RMJA 1J0XO 2O8CB 4DBLE 2A9QA 2VZ0A 2JGRA 4MR9B 5IYZF 4DR3B 3CG0A 5CNKA 2WSYB 4DYHA 1QIEA 4ER0A 2O7QA 1A5SB 3H19A 4CKXA 2IK8A 4NBVA 3IIJA 5AKEA 4DCSA 3ZXYA 3DT6A 3TKLA 4Z4IA 2JAOA 5IHPA 1U3TA 1NF8A 2PA0A 4BEBA 1DIRA 1DEXA 1L5GB 1R0XA 2NO7A 3KVNA 4GPIB 3S2GA 1KHTA 2F1HA 2YNMC 5A5EA 2XXBA 4E70A 4W5TA 4ML3A 5HFJA 4DEYA 4YDQA 4ZODA 4JEHA 2WWVD 2OMKA 5LNK1 4URZR 1DIAA 3C3AA 4M7RA 5EP3A 4S04A 2QZPA 2BFDB 4JR0A 3RS8A 4KFCA 1GY8A 1XFAA 1Z4QA 2QJTA 2WICA 1MEJA 2WF7A 3P9QA 3Q2IA 5G1PA 5T4BA 1CR4A 1EXMA 2BAGA 4B3XA 4DC0A 1EHIA 1ZCZA 3CYFA 1XZLA 3OT1B 3RE1A 3ZIDA 4DB2A 2VNIA 2RMKA 2VJPA 3H86A 4IH4A 4KLCA 3TPFA 3KV1A 1P17A 4MJXA 4UAUA 3CB2A 4ZEMA 1E1LA 1RHKA 4U00A 5J4YA 4YJKA 3L0BA 5LA6A 5HUQA 2CJWA 1JT9A 1UWVA 1IDN1 2FFHA 3NQ41 5SY4A 3CVVA 2VJMB 3NCHA 4XIYA 2BEUB 3M81A 2NACA 1YBAA 2FHSA 4XDYA 3N86A 4O4LA 5LPNA 4B71A 1JXAA 1JN0A 2XD4A 2J7KA 3RBAA 4C04A 3VSCA 4NE2A 4PPQA 4XLLA 1GU7A 1E8MA 3I6ZA 1HR0B 1S7GA 4Q18A 1Q7CA 2GPTA 4GI5A 2WJYA 2QX4A 3CX8A 4YJDA 2OGSA 3MWKA 2Q2VA 1Q1ZA 3HABA 4WBNF 2QQEA 3EG5A 1QHNA 1J24A 5C31A 1KF0A 4JR1A 2NADA 1ZINA 4A8PA 4BVGA 3VHXB 3BT7A 1U2DA 4EY8A 2ID8A 4IRUB 4ZAGA 4G9GA 1X1BA 4MTCA 4MXDA 2BKLA 3B89A 2O9JA 4ZDIA 5JC1A 4X3OA 2PUGA 7ADHA 4JDPA 4EKGA 2O07A 1CRQA 4CKCB 5M7EA 1LBQA 1KU6A 1Q21A 1Y48E 2XMBA 4YRDA 3DTVD 1BN6A 4PTLA 1UMKA 1XVLA 1KXZA 1O6GA 2XVXA 1EP2B 2PRIA 3DKRA 3MBIA 4Z54A 1KSJA 4H1HA 1BU5A 2PWZA 1VMKA 2OVFA 1OI3A 2A78A 4KIWA 3FPHA 4EJ0A 1RC1A 3D02A 3NBMA 3I8XA 3RRMA 4D0SA 2XT9A 1DWUA 1EH5A 1I24A 1CIVA 2JIOA 2ZIXB 3K0BA 1TZKA 4AKGA 2I78A 1BKDR 1EESA 5JOQA 1JR4A 3N5CA 4ENSA 5FUYA 5BRNA 1HF3A 1R1DA 3A1DA 2FQXA 2W6IA 2GASA 1J4AA 2P30A 4Z8XA 1Y1RA 4ALKA 4RHYA 1D6NA 5EJ2A 2ZKIA 3RVSA 1YC2A 3AVPA 1V41E 2HNAA 1ONSA 2ZRCA 1FNBA 4LXIA 3VPBA 5HRAA 5CH3A 4G3XA 2QY9A 3FNRA 3GEEA 2AZMA 1XJCA 2WSSD 4I14A 5A5DA 4G07A 2PFGA 4QNRA 4HY3A 5KREA 2UVQA 2E1PA 1DC4A 1T3TA 4RLFA 3O7MA 3TH5A 4D0RA 4BZQA 1XXHB 1E5TA 1CIJA 3OIVA 4BQSA 3HXLA 2D74A 2QS9A 3P8ZA 1JAXA 1HMPA 1IXKA 4MWZA 4NEHB 4NENA 4PRLA 1GM5A 3MMSA 4NZZA 3WNBA 1GPLA 1C0LA 5KYKA 3N8HA 3CQ9A 3A4LA 3Q3JB 4LK2A 2ZJFA 1VHDA 1C4WA 2G8NA 3FHCB 3SR4A 1KK2A 1LRKA 2CL0X 1HTBA 3GRAA 1Z06A 3E9MA 4R84A 3QVJA 1M1YB 1NBHA 1NZDA 4Q1DA 2RKOA 4Q4LA 4LFAB 2ZYHA 3AJRA 3ZZUA 4L6IA 4US1R 3SC4A 1E1CA 5C35A 4CIBA 2P9ZA 4HAZA 1CBUA 3K8QA 1Z7BA 1PWEA 3CVOA 3ETEA 3HYTA 3OF5A 4JQOA 5DBIA 3GYGA 3TCKA 3EEYA 1E1RD 1E0SA 5LCXA 2QM7A 3OFKA 3GLQA 3PEUA 4M9UA 1T8TA 2GBLC 4HRXA 5E9QA 3NV9A 9LDBA 1T5IA 1XKQA 4JUIA 4PIMA 2WPDA 1M5RA 1CNEA 1Z08A 3AIMA 4HN9A 3GWGA 5DBHX 1V1RA 3H9CA 5KB3A 3DVSX 2ON6A 2V4MA 1EA5A 2PWBA 2ZDHA 3QOXA 1KU0A 3R09A 3TFQA 2WQ7A 2BBOA 1JFSA 2YYYA 3KT0A 1M6WA 4GWKA 3E9YA 3IVCA 4CFSA 3BAFA 3LYHA 1DNPA 3OIWA 3PR1A 2HZ7A 5IH3A 1JFFA 4JQYA 5FHQA 2ZJ6A 3WLIA 5ITSA 3QPVA 4D26A 2J5XA 1TAUA 1HYQA 1ZJZA 3G49A 4JP8A 3S1LA 5BWMA 4TYNA 1N9GA 1DUVG 2DULA 3GAFA 5AI8A 1E2MA 1OGJA 1PUJA 4IFTA 4KPUB 5KYVA 1XDWA 2YYZA 1ZN9A 5LJIA 3T54A 1FFEA 2L18A 1CB7A 5C8XA 3ICCA 3NAMA 2XDYA 5BUCA 3HVJA 2ZBDA 3RRBA 3UXHA 2J0QA 3E2MA 3EGIA 2PJRA 1YACA 2VBFA 3T15A 3DEFA 1NIJA 2WMDA 3LUKA 5HMLA 1W48A 2MYPA 3GUCA 3R20A 1C3EA 2B83A 3VGPA 1JHPA 3VU9B 2BDUA 5FI1B 2GGSA 4ITVA 4MCHA 2OENG 3QI7A 2RGRA 1DPFA 2MHCA 1SB9A 2VH1A 3HZZA 3FTPA 3L6BA 3NR2A 3ZGXA 1UK6A 2Q2NA 4JODA 3CX4A 3ZI7A 4M8LA 4ZJYA 5CG1A 4QDOA 4AO7A 4MKZA 1FLDA 3M3DA 3HCBA 2ZYGA 5TQJA 2BV3A 1OX6A 4OGKA 2Z3WA 3D31A 3VI3B 3HKBA 3EVFA 1UP4A 3E4CA 1D0VA 4OOFA 5HOEA 3H11A 4YBRA 1FYEA 4TUYA 4WLEA 2WB2A 3VR1A 4FM9A 4GQIA 2W2MA 4FCWA 2FUG1 4W6QA 2DTEA 2YHAA 1YS9A 5GOZA 1JQAA 3TMKA 3U44B 3F73A 3ZQ4A 4TVOA 1DBSA 1MGOA 3RVKA 1E2EA 2JIZD 5F7ZA 1DGQA 1F8GA 1XRSB 2JVIA 3PEVA 3STHA 4O5OA 3DBOB 4W1RA 1VZ2A 1JRLA 1RHUA 5CX1B 3OZEA 1DU4A 4ZGGA 1I4TD 3C3YA 1TZJA 1ZSNA 2QAGC 3RBVA 3E5RA 2HC9A 3C15C 3GBSA 2EGUA 3BXXA 4S1OA 1CR6A 2OO7A 3KXPA 4XVQA 1ZJ4A 4U9UA 1C0KA 4JNKA 3R0XA 1DKUA 2KSQA 3DDWA 2AF4C 2Z6QA 2FPPB 1VE6A 4TM7A 1FRQA 3H9GA 4EG0A 4XVCA 1VJDA 1VYUA 2HSGA 3NONA 3VNSA 2HQBA 1UKYA 1XEFA 3WI7A 3R3ZA 3JQ7A 3URMA 4E46A 1J2YA 1D03A 1E9RA 4E03A 5JH7B 3OH8A 4KSCA 2PV0A 3TTYA 5BV8A 3T9BA 5DX0A 2JIPA 1E0KA 2WIAA 2FZVA 4G65A 2XVYA 1RMTA 2VYQA 5E8JA 2N42A 1NVUQ 3IOBA 4GOJA 1H2BA 4J0KA 3AL2A 3PFNA 3PRYA 1T6ZA 5ERYA 3VDXA 3C6BA 3KVVA 4QFDA 3OJEA 1PO7A 4IWNA 2Y1DA 1Q15A 1WU8A 5F52A 1BCRB 4OGGA 4KQEA 1QPBA 1V9LA 2HWKA 1Z6AA 2FSSA 4B75A 1Y1KE 2O54A 2ZSIA 3G79A 3NBKA 4D57A 1R50A 5CLIA 2C3YA 1ONOA 2JBAB 2YNMD 3C87A 1IB6A 3DQPA 2GTPA 3EUFA 3G3EA 4BBJA 2A9RA 4ZKEA 1GWNA 1YL5A 5FFNA 3LSTA 3O83A 1K7SN 1QHIA 2HK9A 4OFZA 4Q3KA 1V1MA 1OPXA 2WF8A 4C4XA 2WJJA 5HIJA 3V4FA 5I4IA 5KEIA 3HA3A 2CC2A 5M5BA 2ZDQA 4ER3A 1I1HA 1QCDA 2JAUA 5JYDA 4M1TA 2UUOA 5KVAA 2Y1KA 4BV8A 2FAXA 3PEFA 1N7HA 4WZAE 3HUUA 4V24A 5AKYA 4JB0A 5KWEA 1CEQA 4HYQA 4JYZA 1JSZA 1RWBA 4DZZA 4DXDA 4EVQA 4KP7A 5A4IS 2ZRBA 3QW2A 4HF7A 1E2DA 1QF6A 4I5EA 5K3BA 2FMUA 1RAGA 3VO8A 1PTJC 3VO2A 2B78A 3PPYA 4N6GA 5K01A 1PS9A 1NVDA 2KLBA 2P9TA 3QVWA 1HKUA 2P41A 2HJGA 2ATVA 4MW9A 2R87A 3IC5A 3TLGA 2UUCB 1Z35A 3VOTA 2I8LA 4LDZA 3F5FA 3VZPA 1J39A 4IVQA 1YRLA 4N7RA 3OT4A 4M21A 4BX3A 3S6JA 3HY6A 1S8OA 1TU0A 2A9KA 4LZZA 2CHFA 3QHAA 4TGLA 4BQIA 3KQHA 4R7ZA 2G0NA 4KI0A 4RF4A 4MHTA 4OD0A 3NRJA 1U0NA 4MMZB 1MX5A 1S3FA 2JJ1A 2HA2A 2Y1WA 4R9UC 4ASUA 4EJ2A 1M2HA 4OKSA 2ZKLA 4EO7A 3K9FC 1A04A 1OXMA 4U9HS 5DKFA 1B2RA 3MA0A 4URYR 3KQKA 4I1PA 3LLCA 3HVRA 4ZQCB 3QLUA 4LMPA 5ALWA 5DO9A 1OC4A 2PIAA 1ZCBA 2PRKA 3AEZA 2QY6A 4XVRA 1F7VA 1N2SA 3KUCA 1N5LA 2GJ8A 1RQPA 3BERA 3GH3A 4RNDB 1WZCA 4B7CA 4BAUA 5JSZB 4PGAA 2IPXA 4QM7A 3LPLA 3AESA 3BK7A 4LX8A 4IGEA 1ZQ9A 3JVIA 4COOA 3NEYA 3R6WA 1ZNZA 1Z62A 1YD7A 4JEMA 4Y18A 3NDPA 1SQFA 4HGRA 3EISA 3C3EA 2GCOA 2PGAA 1VOTA 3IUEA 1KRHA 2EYQA 3M4ZA 4M0PA 3RLIA 3CSUA 1DQNA 2RHOA 4EFKA 5AD1A 1V48A 3MTEA 1KK3A 4BJHB 1W7AA 4HAIA 3WRXA 1V7CA 1XELA 5C3UA 3ZU5A 2EZ4A 4GQAA 4WHMA 1G21A 3DL2A 3SKVA 5LD2C 1G5RA 1NRJB 3GEPA 2HLDD 3ENZA 5M3BA 3P5SA 2QE7A 4LYHA 5CDSA 3FDJA 3PI6A 1RQRA 1XA0A 3U26A 3NHWA 1Y6JA 5E4FA 4ZVRA 4JUCA 4LHXA 1XMIA 1E2UA 4ZOBA 4RELA 3NBFA 2I33A 3DE3X 1OAOC 1BXRB 3DMTA 3SF8B 1PKXA 2W2PA 1XEWX 3BFXA 3VNUA 1Z4MA 4MB0A 2PGDA 3EIXA 4EB6A 2V7QD 1GAQA 2H11A 2HLHA 3DQQA 3PP8A 3A3OA 4KPEC 3GNQA 2H8KA 1QV6A 1DWQA 1E9BA 7ABPA 3QQ5A 2QJRA 5JNRA 5FPKA 1W0KA 3UWPA 4QUAA 2ZYDA 5HIMA 3BL5A 3ZH9B 1B1AA 2CWDA 4B3CA 1XBTA 3EJ6A 2O0JA 5ICCA 4IDGA 1BCSA 2OQIA 3GGDA 3OQPA 3EQ7A 1EQUA 3S29A 5EE3A 2VJAA 4WY5A 1IY8A 2Z5FA 4Q0MA 4JLVA 3DWFA 3V9AA 3GH1A 5F3WB 1ODKA 4HDKB 4E2XA 1WX1A 1N1MA 1C7QA 1KIAA 3OHSX 4AJKA 1W25A 2EKQA 2OTCA 2H08A 4BO3A 1O7JA 4ND8A 3TKAA 3W5JA 4EPRA 1N6PA 4Y2UA 4JJ4A 3TRFA 2P2ZA 2AZXA 5ARBA 4K9QA 3MWFA 1P2DA 2YRFA 2IQ5A 3BE5A 5AVTA 5KQSA 1RXIA 1II8A 3O8OA 2VL7A 1XJWA 1XK7A 2JASA 4MUXA 4GM0A 4RLQA 4W7IA 3URKA 3QY9A 5EEHA 2QORA 1WW3A 5E2AA 4PLFA 5A1TA 2WF5A 1A4UA 1ST2A 4YCJA 1Z22A 1YS2X 3V48A 5DI3A 1P4GA 7REQA 2WLSA 4FDVA 4JI6B 1CUVA 2MSNA 3BSWA 3F67A 1R15A 1V1RB 3OJCA 4RPGA 3VR3A 3BRCA 4A16A 5B58C 3H5RA 1Y1PA 2KWIA 3OU7A 4C0SA 2I6UA 4JL8A 1HG0A 2AC7A 3H5LA 1ENOA 4K26A 4Y9RA 1YJQA 3R76A 2F6RA 1ND6A 4JLKA 4N6NA 2W93A 1P1HA 2PZKA 4YGYA 1U0OC 5J63A 4Z7JA 2J41A 1BRTA 1NUPA 5JNVA 1JFFB 2O2XA 4DPLA 3TIXB 1WUTA 2H18A 3OQHA 2DQ4A 4I1YA 2ZZNA 1CNFA 3JTMA 4LIPD 1WNFA 3UJ7A 1Z29A 5JNWA 1RKUA 3QW4B 4QXMA 4Y1GA 2JIDA 1Q0UA 1UFVA 3GBPA 2HA4A 4YEDA 4YRSA 4L3VA 5I9BA 1RYZA 3WWPA 2ERYA 5DSZA 2UUBB 4JJIA 4H0NA 3REQA 4EEXA 2Q3DA 3HZRA 3ELWA 4OYHA 1BS1A 4QO7A 5A3QA 2UYCA 4K87A 3CR3C 4H6XA 4WRRA 1K6MA 1R0CA 2VUTA 1KKMA 3K09A 3LECA 4Z0HO 3REGA 4HGZA 1BRMA 4OJNA 4AS2A 4K6OA 4UD6A 4G5HA 5IAGA 4G1MB 1GNPA 3FA2A 5KYUA 3UOAB 2AOTA 5AH0A 1JBEA 1ZG3A 1QYVA 2CXRA 3P94A 4R4JA 4NCNA 1MENA 1NV9A 5CTJA 1DRJA 3X3HA 4EUHA 3QKTA 4RO0A 1E4OA 4B9AA 2JCBA 1OBHA 5JVDB 4INPA 4QWMA 4Q4AA 1NXSA 2O8BA 5BN4B 3MG9A 2DR0A 2VSNA 3IKMB 2XUHA 3IOYA 3GJ7A 4IZIA 4C3ZA 2NYAA 3KB1A 2G28A 2JZNA 2QZ9A 1HC7A 1QZZA 1TYEB 2IYLD 4JXKA 3HKBB 5C7OO 3GOHA 4ZYVA 1CS0A 1H2RS 2C58A 3SNHA 3H11B 4BQOA 2P5YA 5IG2A 3EH2A 3P0RA 1NFQA 4PLCA 4TUYB 5FRDA 1G66A 1VPWA 1K86A 1XDZA 4QQRA 2Q6OA 4LXHA 4HWRA 1DOZA 4E4TA 2V8BA 3L07A 2P7HA 4M8SA 5D85A 5TB5A 4EUNA 3SBEA 4CIAA 1QUFA 2QW0X 3OKFA 4JH0A 4D4MA 5LP6C 3I23A 5CLFA 1D1PA 1Z6XA 3E2IA 2X1HA 1ORHA 1OIVA 1UFRA 2FW6A 4FOLA 4PQGA 2DLNA 2UZ3A 4LJ7A 1W76A 2X6RA 2R7MA 4Q3AA 5AW5A 1MIHA 5EWLA 4KVFA 3R1IA 2CLFB 1UZMA 1R4MA 2ZRHA 3K32A 1VG1A 3NOVA 4I8XA 4W82A 4R6XA 4O2LA 4LI3X 3OJWA 3AY3A 3RTEA 3VR4H 4ENVA 2VN8A 1ZO8A 2Y66A 2YZNA 5HSGA 1YU9A 4PLHA 4HVLA 1GG9A 5ITWA 4RIFA 3A9RA 1OQAA 3B5IA 4HAVA 3GU3A 3JQ7B 4IY1A 4TXLA 5B3KA 1C4KA 3E8MA 3H2SA 5K3EA 2VYNA 1LBHA 2BEVA 3PQ7A 1ZXXA 4UTNA 2Y67A 2Q9UA 3FPAA 4XASA 2VDRB 4FDAA 2HSJA 1TYZA 4NOJA 5EE9A 3M1YA 3RV3A 1P7PA 4QDXA 3KJHA 5BPFA 2IC5A 1OLSB 3MGBA 3TLJA 5BWLA 1XU4A 5A2QA 1QZUA 5DP1A 1XYGA 1FSFA 4OBWA 1ZHHA 2DBRA 2GETA 3IE2A 1V5EA 1PLLA 3JW8A 2OV6A 3LHSA 3JQCA 4YROA 2R97A 4YP6A 4PHCA 4NYIQ 3T0GA 4E5PA 3U3MA 1WABA 3BE4A 5COBA 2E1RA 2B8WA 1U0TA 4LSZA 3NP9A 2QNBA 3OOHA 5AR1A 5B2ZA 2O8NA 4AN4A 2XUGA 4URHA 3UNXA 2YRXA 2GEUA 3PZRA 1GU1A 4R1NA 2GVDC 3NVDA 1QCCA 3GRCA 1MD9A 4FFBA 1QGOA 2OORC 3BMOB 5BNFA 1RJEA 4D1YA 4U63A 3WQRA 4DLAA 3YASA 3WISA 1R5BA 2DKOA 3M6MD 3QXJA 5SYNA 2RHJA 4EJSA 4NY1A 5DTJA 2UZ0A 2I2AA 3SQLA 1TK2A 1M34A 1IRXA 1USIA 3K2EA 4OJMX 2AV6A 2HMVA 3F6SA 3N07A 3Q7SA 1XNJA 1CY7A 4WESA 3CLUC 4KZPA 5HKKA 2Z1MA 3RUIA 1N2XA 2QGNA 4Q7MB 4WN3A 3SYMA 2ZRKA 4MS1A 5KYXA 2AT1A 1SG6A 2CBGA 1LPOA 3LQ4A 1UBKS 2HMYB 1UEJA 1SRQA 1JIKA 1Z2CA 2BDEA 1U3VA 3GMIA 4M88A 4Y6PA 3TLGB 5FO1A 5A0TA 2CSUA 2FQ1A 3CISA 2IW3A 2OV8A 3KOYA 2ZUTA 4A0QA 3DVRX 4F2GA 4RNCA 4M9QA 1BKYA 5J2UF 1BKSB 2HF2A 5K4HA 1M3SA 3O8DA 2PRSA 2YTZA 3L5OA 1OCEA 4NXMB 1DV2A 3GPCA 2PMCA 4C0JA 5KX5A 5FBZA 3KLMX 2J0SA 3KVRA 2Q1XA 3LUAA 2R86A 4RHUA 2IODA 1V7QA 3GROA 2VXBA 2CLMB 2FLKA 1DBQA 5BMOA 1GXSB 1XNHA 5CA0A 1UOQA 3AMVA 4HQFA 4YP9A 4Y1RA 4EVSA 2YWDA 4ECEA 1KTIA 1FDUA 2NZJA 3M4JA 4Y6RA 4B81A 1J9EA 1X6VA 4QRIA 4FMCB 3OWXA 3CSDA 3QI2A 1Q0ZA 3QP9A 1AQ6A 4IIJB 4M54A 4NQRA 4DZTA 3TFOA 2FX2A 2B61A 2JF0A 4J75A 1XTZA 1G3RA 3ZWDA 5T7BA 4CQMB 3WK4A 2Q5FA 1M75A 3B6MA 1FDTA 2IHKA 4HH3C 4QJIA 4TYYA 3DDZX 3QEBZ 3KJQA 1SZDA 3CLTC 3I58A 2IV7A 4E30A 5CDGA 4W9MC 3I62A 4UFPA 3FI0A 4PYRA 1NXTA 3DWGA 2IX9A 3ER9A 2Z1NA 4RH1A 4U6SA 3DE1X 3HKEA 1NLUA 1TU4A 3ICWA 4US0R 3Q9NA 3RR2A 3WMEA 4ODIA 4JA2A 4G9EA 1RJ9A 1EFRA 1U80A 3X1JA 3B1YA 4A26A 4AZVA 2C9BA 2V54A 5C8YF 4Y2SA 1G21B 4QD3A 1II0A 1X1QA 2GFQA 1YL7A 1C30B 3OP1A 3KEMA 1K1EA 4GMGA 3CF2A 5AOBA 5JDCC 4FYIA 5LMZA 1PUXA 4O2RA 3T61A 4K03A 5KNCD 1NN0A 3ZW9A 4RTOA 1UOPA 3UCFA 1BNCA 3NAQA 1G4UR 4I6GA 5A7FA 2JFGA 1E66A 1EINA 1LWOA 4N65A 4NU5A 2XF2A 1ZIXA 1Q1BA 3ROPA 5LZ8A 4UBJA 1ISRA 1TZMA 4ND4A 4F3RA 3JASB 4WH0A 2PQ6A 4EB6B 4I9FA 2Q3FA 3NHKA 4U3JB 4A2PA 1EFAA 3AUJB 2IWRA 4GOND 3DOEA 3JD0A 2HA7A 1MB2A 2PKXA 2VO1A 4TMKA 3DOCA 3Q10A 2I91A 4C0LA 3PJRA 3I6BA 3JQ9A 4ZT3A 2W42A 1YB2A 1KH3A 4O63O 3W06A 1GA6A 2QLLA 1N3BA 1QKKA 1R6AA 1UC4B 4FMBB 4PONA 5DNAA 4HH0A 3EIHA 3C41J 2WUWE 3MELA 3Q8WA 3FVWA 1DAFA 3U3JA 2H4XA 5BT8A 1WLSA 2J7PA 4TLCA 3GEHA 2B1RA 2MR6A 1KI6B 2OUKA 2Y05A 1EVKA 3AEKA 2B69A 2ZUUA 1DBWA 1WBJB 3NC4A 4Y30A 1MQAA 4CMHA 1MDBA 3C8DA 3I3OA 1T35A 2QTCA 3EIFA 2FEOA 2GWHA 5FPTA 4KR2A 2B7CA 3OZIA 2A1UA 1N0UA 1J97A 2XTMA 4JFAA 3UATA 4INJA 4BYGA 1LQTA 3FLAA 4AJLA 4BKQA 2HCFA 4HTFA 4ND8B 4I4LA 2BCJQ 3NHYA 4MPPA 1RACA 3DDNA 5CB4A 1W88A 3O1JC 1L4EA 4KRFA 2JI9A 1KS2A 2RG7A 2B9EA 3OM1A 1V5GA 4L8VA 4C5BA 1P0CA 4ZCIA 5DYWA 2A5JA 4Y7DA 4RTPA 4Q34A 1ZRNA 1KEKA 2CMDA 4JJ7A 3G8DA 4GWLA 1VKHA 2J4FA 3Q3GE 4HWOA 3AB7A 1M0SA 4B45A 4YCLA 8MHTA 3QX9A 1CF2O 5J5CA 4V1CA 4ARZA 4BO7A 5EJ5A 3O38A 2WUGA 4L4YA 4LDNA 1UDXA 5EP2A 4DYDA 2WWFA 4AB1A 2OM6A 3K9BA 5LZ5A 3DDHA 2DFTA 5DYNA 2WWTA 2GAFA 4U3JA 3PHCA 3TG2A 2A7XA 3IB6A 3LRTA 3V7WA 6Q21A 2UXBB 4CMEC 3T12A 4Q4CA 1WF3A 4JZKA 3OFND 4JITA 4RJLA 4RZIA 4C4PA 4IKEA 3PFCA 1TLLA 2ZIWB 4R2IA 2ZJZA 3P45A 5AESA 2UYOA 1RRGA 4QIHA 2WMOB 1BU8A 2EJBA 4W5WA 4Y1EA 3FGNA 4FFPA 4BASA 1J56A 2HPVA 2QYTA 2R11A 4L5YA 4Q6WA 3WA6A 1XMQB 3SE0A 3SR0A 3ZD8A 2BJVA 2DKNA 4F1KA 4JI7B 1VL0A 1I6WA 1G8GA 2OZPA 1PJAA 3DTVA 4ALJA 5A9RA 2PE5A 1W36B 3H1PA 1XTQA 1Z0IA 1NYTA 1QX4A 2EERA 2BKVA 2FSVA 1MTZA 4HXEB 4YRKA 4BHTA 1KNQA 4U2DA 2AOTB 5C8DA 2I1QA 3G23A 5I9TA 2REQA 1ZNXA 4DQDA 1PR2A 1ZW6A 1M1NA 1U2RA 3CG4A 1SVWA 3KOMA 1IOZA 4GXTA 1GEEA 4B5KA 9LDTA 2J6HA 1A1VA 3PR2B 3TIIA 3G5UA 5LFAA 3E18A 1NQTA 1QFYA 4L08A 2XECA 3IT0A 3OF3A 2FPRA 2QYSA 2FWNA 2XXAA 1UM8A 1A7UA 2ZETA 3WIUA 1GCIA 4AX8A 4EB3A 2Y1OA 1MIOA 4BGDA 1MOSA 1HYGA 1IZ0A 1CS0B 1A69A 1BEUB 4AX4A 4PFSA 5A0VA 2HPAA 3DS8A 4GI1A 3SIWA 3WLRA 5KWIA 3OHPA 1HYEA 4LDRA 1HEIA 1SWWA 3WDSA 1UBSB 3UUEA 1FPQA 1GFWA 3IT3A 2VOJA 2XBUA 2JW5A 1WZ2A 4HPXB 3BTVA 2Z58A 4D79A 5IULC 3S7TA 2V1UA 4PC6A 4RF3A 3IELA 4U7FA 2YJ5A 4MWCA 5ALLA 2W7TA 1OBVA 4TRMA 1NXPA 2F3PA 2VDWA 3JYQA 2V0CA 2VPWA 3AF0A 3O5AA 2R6R1 3ZWXA 3NIDB 4UE3S 3CWZA 1FU8A 3GARA 4C2UA 1PFUA 1XLWA 2FCAA 1TMKA 4UBOA 1NXQA 3UMGA 4X63A 1WCIA 5JWOA 4BTEA 1E9DA 2W0SA 5MDHA 5HWSA 4FNOA 4G0YA 1L5RA 3GF4A 4P3XA 5DMXA 4MPRA 1R66A 4OIFA 5EFZA 5F2KA 2WV9A 1FLNA 2CYBA 1HE4A 1ABEA 1TTHA 1M54A 1JKFA 3GUUA 1GPBA 2BEVB 4DRYA 4I9HA 3I01M 4M0EA 4AIIA 2KLHA 5AJUA 2A4MA 3LHDA 3BHNA 1OKKA 2PRYA 2QTVA 3L49A 1U5BA 1WOMA 4QBGB 5DCUA 4MVJA 4RCVA 3W1VA 2SBTA 3EWIA 2C4KA 1NVVQ 4AXXA 3C4VA 4IJUA 2C4HA 3IHTA 1KY3A 1BQ3A 4U2CA 4BNIA 1MU0A 2X40A 1MR3F 1R6VA 2AG6A 4ZK6A 2YJZA 4G23A 4OJKA 4QASA 4P3OA 1EXWA 3LCCA 1ZL2A 2LXNA 1H5QA 1ZSVA 1GL7A 1LNSA 4HS4A 5F76A 4C5CA 3IUJA 4JT8A 5LLTA 1Y6ZA 5LQMA 1A98A 1U6KA 1XL0A 2ATXA 3NYIA 3WNCA 1C80A 3LWNA 2RAFA 3MIIA 1AQJA 1WEHA 2XPCA 2ZLBA 1H4TA 3QFTA 2IZZA 2J9XB 1NSTA 2G25A 3E15A 2GLTA 3GVPA 4HS9A 3UWDA 3DB1A 4R1PA 4CF7A 5EUBA 4UNPA 4G84A 4YAOA 5GPBA 4CIVA 5JATA 5DHRA 3THSA 5DDIP 4OF4A 3S44A 2D1RA 1CS4C 1YAJA 3WB2A 2J07A 2MCFA 4OH7A 5IM4F 1U4SA 4INAA 3FYUB 4DARA 5KTYA 1C9YA 1N25A 4C7JA 1TCVA 1YULA 3PDJA 3TTUA 4MS1B 4PPNA 1UPUA 4F7WA 1YFLA 2KI5A 2RGEA 4FLFA 1KQNA 5JD4A 3F74A 1AN0A 4PZZA 1JHXA 4MH0R 4S2UA 1JIQA 2YJNA 4ZVTA 2BGJA 2VVTA 2IH2A 1Z16A 4HQRA 1DC5A 3QKWA 4LDQA 1Y7IA 3PC4A 4F7DA 1A9QA 1BMFD 1H9BA 1S3SA 4UE2A 4QPPA 4WJLA 3N8KA 1L5MA 3Q3EA 3KE9A 4JWKA 5IAEA 4YCMA 5F1OA 3BFKA 5JZOA 3BCSA 5KX5B 2B20A 1EVIA 2BONA 2FZKA 3QJGA 2NUPA 5CA0B 1XFDA 1UT6A 1OUMA 2NU8B 1UMCB 5BSWA 3WYDA 2YY6A 3TD9A 4OB7A 5IFKA 3E9DA 1JWBB 4OXQA 4HAWA 4F4FA 2WU0A 1DBVO 5DX8A 2G77B 3FZNA 5JS8A 4QAQA 5C1DA 3CT6A 3PNOA 1J2JA 1OT5A 3PWKA 3QMPA 3ZY5A 2AI3A 2H1CA 3HVHA 1UPXA 4BLVA 3T3NA 3ZZTA 3DKVA 4MQEA 1YR7A 3ZH2A 1IHXA 1QYDA 2B7LA 3MJDA 4FEEA 4BAZA 5ADWA 1N3YA 1UK8A 1JAZA 2ZAYA 2RGGA 2HR1A 1QRSA 4OOEA 1HORA 4G41A 1RM0A 4BECA 2ZZMA 2VHTA 4KDCA 4XJXA 3DO5A 4MB6A 1Y9ZA 3R7DA 1H4VB 2C29D 3SE7A 5FKJA 3IL2A 1QH8A 4J03A 3AKDA 4DDUA 4I0WB 2XWBF 1JDSA 4EM6A 5JQGA 3HXQA 3EQ9A 1JG6A 3GDGA 4YHHB 1K6IA 4YDSA 521PA 3ZDEA 1EWKA 1O97C 1U2ZA 5F5LA 1NP3A 3OZSA 1ECGA 4PG4A 5ALNA 4NBRA 4NOLA 3DNFA 1MVNA 2WWRA 3H0CA 2OC9A 1P3JA 1P1CA 1QYIA 2R62A 2SKEA 4IDOA 5F51A 2QMOA 3AI1A 1OLUB 3BQMB 4FGSA 4ZYYA 3PL1A 2FSGA 4NU0A 4HADA 4UDXX 5EGSA 3OQ6A 1EIZA 2IP1A 4PX2A 2G09A 3C98A 1KYTA 1H9CA 3F4BA 5IHXA 1K0UA 1BG6A 3LC7O 2DZDA 3HV2A 3D6UA 4FINA 3SC3A 2COEA 2QN3A 4BOYA 5HHTA 2H8GA 1S2OA 4GR9A 2P6OA 2ZJ0A 3EF1A 1KEZA 2XVAA 2GBFA 1DVRA 2R60A 1BN7A 2YZKA 3U3KA 3V4VB 1JQJC 4B82A 1YH3A 3SIXA 4KITB 3CIFA 1AIPA 1N2GA 3AEKB 2AL7A 3ICVA 4P08A 3A2KA 1U8ZA 1C8BA 3HMKA 3HBLA 3KDAA 3TL3A 4ZCSA 4ITUA 5BYAA 4UMVA 2NO9A 1PR5A 3QYPA 3LPAA 1YS7A 2CUZA 2JIQA 3L0CA 2AX3A 4EHBA 5E0KB 4I19A 1F17A 1PGQA 3PUKA 3EEIA 1ZWLA 4NJOA 3SIPA 2LR0A 4KFRA 3QEJA 1X3SA 5TR9A 3U56A 2LCFA 1WKBA 2EX0A 5B37A 3IPAA 4YI3A 5JCXA 4YJ2A 1A88A 4BP9A 3QKRB 3GD5A 1SUPA 1Q0HA 3WK7A 1L8XA 1ZXLA 1MP0A 4UEWA 5I51A 4EFNA 2IHYA 1CTQA 2CY0A 1U8YA 2FUCA 5D5HA 4QDKA 1E59A 1NUUA 1JHRA 4BO9A 2I7VA 4GYWA 1PJQA 1SUEA 2XUAA 4Z2AA 1OHHD 3PU6A 2P65A 1Y9DA 1JQDA 4KXUA 3UHJA 1IBKB 121PA 1JLLB 1G64A 2Q50A 4F38A 2D13A 3L0ZA 2XT6A 3CNOA 4C7MA 3OZTA 5IU6A 1QH0A 3RU3A 3UCEA 2BGRA 1YCFA 3NTUA 2ZCJA 3I42A 3LY9A 1L4NA 1I3OA 4PGHA 4B40A 3F1KA 3CXUA 2NW6A 3JZMA 2WA2A 3RADC 2H2GA 3RIEA 4DANA 4Y6QA 1D9XA 1Q1NA 4U6NA 4N6OA 3BMQB 3NO4A 4A0SA 1B23P 4G6ZA 3H5NA 2GK6A 1KZ7B 2G83A 2P4UA 1F2UB 3FVTA 4I4CA 4NMMA 2WTXA 4NTZA 2Q4EA 5GZ6A 3EOBI 4WI1A 2QRQA 3HP4A 3KDSE 3QX8A 1V7PC 1WEKA 3CCCA 2QLTA 2OHVA 2Q2QA 1BHQ1 2OCKA 3JATA 1JX6A 4FE3A 1XKLA 4S1PA 3EAQA 5JAQA 3NWJA 4PSUA 2C3PA 1FNDA 2EC5A 2VRCA 3JQGA 3UG6A 3ZHSA 5K6RA 5IJ0A 2WAMA 4JJZA 4QOFA 3RIXA 4D46A 4S0ZA 3JQEA 3DTVB 3U62A 4RJ2A 5HS6A 3CN7A 2CD9A 3JWEA 3EGCA 1E77A 2FUG6 1FBTA 3IUMA 3B9PA 3OPNA 4DSUA 4DY4A 4PYMA 4N12A 1L1FA 1X7HA 2GFHA 3V8EA 1T29A 5D84A 1M1NB 1DJPA 2QXTA 2AJCA 5AHKA 5AOVA 2J85A 3H7IA 3EZ7A 1VYHA 4B6JA 2QAJA 3ADKA 1L4LA 1EHCA 4EI8A 2QU8A 2E2WA 3AWDA 5CCXA 2AR0A 5DHUA 4FSDA 4JJFA 2ZRGA 3D2LA 4W7SA 1MIOB 2EATA 1QOZA 3UBTA 2OCYC 2V7QA 3BL6A 4WCDA 2A9PA 3OZDA 2TRSB 1H0KA 3I4CA 2MYNA 1CR0A 3T5GA 2PYZA 4AG3A 1H8ED 5B53A 2IIPA 4MA5A 4B4WA 3G2HA 1P5HA 2C83A 1DAMA 3BF7A 2ZUFA 3CMMA 1VI5A 4FYVA 4RHEA 3IJ5A 4C20A 5EMMA 1CNMA 1ULAA 1U90A 2I66A 5J47A 5DTMA 3FVVA 2FPKA 4Q4HB 1FSZA 3CC8A 1KJIA 2ZRAA 1KYYA 3UMJA 3WTCA 5B7PA 3HP7A 1KPHA 5I7UA 1J90A 3LI2A 3MERA 5EL0A 3BQNB 3RPEA 2EAUA 5KBYA 2XQVA 1HBJA 3ACCA 1VKNA 2E0IA 3VKHA 2DWPA 4KAXA 1T3HA 1B73A 1V43A 2YZMA 4B46A 1KRXA 1KC3A 2XGSA 3E9ZA 3L05A 5J1TB 3SICE 2FN3A 1WCIB 4GVXA 4S35A 4D81A 3AJ8A 4B43A 1M73E 3FGPA 1Y33E 4YJ3A 2JAXA 4QU5A 4O0MA 1J2EA 1JQ3A 3AO0B 4PINA 4QICA 4BKUA 1VG9B 3A70A 3K0AB 2YHIA 3FFAA 2R6FA 1T91A 4N3NA 2Q3LA 1P6XA 3OEEA 1FP7A 1IK4A 2P3QA 1UWCA 3F97A 3QUSA 4W9NC 3JZDA 1DJLA 1NTOA 2HMAA 2J3KA 3DVQX 3HVIA 1P3DA 2NQTA 3E61A 5IUKC 3UMRA 2CHQA 3D3WA 4KBGA 1SPXA 1QQ5A 3U7HB 3JD3A 1XCMA 3HLKA 2L0XA 1E7SA 3I6YA 3QX7A 3N2EA 5DU2A 1N4AA 3U37A 1P39A 2BGIA 5JBIA 3PC6A 1HXHA 3IAM1 1W6UA 2GN6A 2PL3A 2A59A 3NYWA 3TNLA 4D9NA 2P35A 3WL7A 4TLDA 1UBTS 2E7ZA 1T8PA 4RK7A 3GFOA 2BGMA 3G2IA 2JGEA 3LLMA 2ZWPA 4ZMRA 1IC6A 3LL4A 3DPUA 2YC4C 5D3ZA 4BQQA 4ZAZA 3SG0A 2ZRQA 4M36A 3I9OA 3LTNC 2W6PA 4H17A 4CKWB 1BYIA 1VL6A 2GTIA 1XQYA 2QSYA 3E1GA 1NKSA 2V9ZA 3FCAA 3WB0A 4DADA 4EPXA 4BVKA 2PVPA 2ZXUA 1Y6GA 2BKAA 2NP6A 4ND2A 5LOVA 1IN5A 4M0DA 5L45A 5EQJB 5EXXA 3M3HA 3B9QA 2VHJA 3FKJA 2WWGA 3WL5A 1K06A 3RVPA 3RQIA 1DTWB 2ZB3A 3Q15C 1IBLB 3AUFA 2HYDA 4ZTZB 3BTUA 3ZW7A 1XMOB 1UQRA 2Y76A 1LJ8A 1ZDMA 1M6YA 2JGIA 1N0WA 2RC5A 3KT8A 3NG1A 2XE8A 4RPKA 3HDTA 3HH8A 5TT1A 1NQXA 4YXWD 3D7NA 1QCYA 1GADO 5ALPA 2Z1DA 3BICA 5EMNA 3WG9A 2IU3A 3COWA 3V34A 1GCOA 4LXYA 4B74A 3TDKA 4JBYA 2Q7OE 4LJSA 1QIGA 2ZJ2A 3LYLA 1GKIA 5BSFA 1X1AA 2EF0A 4BC1A 4YMTA 1Q1EA 3EASA 2GM5A 3MTBA 3F2VA 3EXAA 2GN9A 2G9VA 2ZUBA 2WU3A 4A2WA 2GDZA 4N54A 4OHUA 1WUKS 1F20A 4Q3CA 1F48A 2PZBA 4OJYA 3JQ8B 3FPKA 1UZUA 1KMHA 4X60A 1FTWA 2VDKB 3LE8A 2PKQO 3IO3A 3L7BA 3H05A 3BDVA 1W5EA 3A7EA 3RIMA 3SX2A 9MHTA 1CY1A 1T3ZA 4PSDA 3W2HA 3FWKA 4D9BA 3C39A 5I47A 2VZLA 4CE6A 3DZBA 3PE4A 3V1NA 2DF8A 4LEIA 5E3JA 2FUKA 4EG8A 3KE8A 3OQNA 4ECAA 1GUYA 4WLOA 4KO2S 4ZRMA 5ESWA 1UPCA 1CETA 4JOSA 2HHLA 4DIBA 2B2NA 4JP5A 4II7A 2FEXA 1IBMB 2BBTA 1O97D 3RU7A 4Z3OA 2XUZA 3TR5A 2X76A 1SKMA 4MQEB 4UHJA 2JAWA 2AEEA 4R01A 2JEZA 1OGYA 2J30A 4DDHA 1UK9A 4YVFA 1XLUA 3L1KA 3BIXA 3EOZA 3FHOA 3W6PA 1C9NA 1G2IA 2VNAA 3D3KA 3KIPA 4I46A 2MSDB 1FXWF 2VCEA 3NHLA 2FJUA 4MZDA 5KAPA 4BU1A 4TWRA 3N0WA 5TSDA 1ZH0A 5HM8A 2C7GA 2HHCA 1HMYA 2EBFX 1A1SA 1W46A 3JWIA 4AMBA 3SHQA 2BSQA 1PK7A 3AM1A 4DMGA 4KMMA 1XWIA 4WY2A 3T1YB 3PHGA 2J0UA 1QHGA 3OE7D 4EI9A 1KP2A 1RWVA 4XARA 4XE5A 2C2GA 4BFLA 2WKWA 5I7WA 2Z4TA 2FZ4A 2QUAA 5F12A 3V2UA 3V1KA 3EX7C 2IE0A 5M2QA 3DZJA 1ZXBA 1WMFA 3JRXA 2PQMA 3JV7A 4IICA 4ZCLA 4DA9A 2BKXA 2HV9A 1AKNA 2GN0A 3T7IA 3F5MA 3C70A 4GBGA 5HM6A 3CF4A 2DMRA 1KEWA 1WY5A 4NZOA 5DGCA 1G1AA 4ZYLA 4ZAWA 1IBSA 2EF1A 3WA7A 2ZQZA 2CXTA 1KOGA 2Y6UA 3IBGA 1YMUA 4TMVA 2OD2A 1JFLA 5D51S 1JQLB 5T4HA 3FI9A 3STXA 5HKAA 1FYWA 1V3TA 2OEPA 1E18A 5C51B 3FKSA 1CY6A 3GG9A 3NHPA 1OWLA 5HDQA 3UB3A 3ZDFA 1RRFA 1BJKA 3OQIB 1AUPA 3AU8A 1F1JA 4PIVA 2PZAA 1YFKA 2J0EA 4QUIA 1TJYA 1RI1A 4KNWA 2Z5VA 1NW4A 4BDSA 5EJ6A 4M86A 3K0FB 1D5WA 2HDWA 3CZCA 4O4HF 1FQWA 1S5PA 3BXOA 3I28A 3IAFA 2PYIA 3UTCA 2Q3MA 4D92A 4RVNA 1EUZA 4CCSA 2MMGA 4E1VA 2RHCA 1NF2A 3GCWA 4O8CA 2C7QA 3FJYA 1RM4A 2I65A 3W2GA 4A36A 5G1OA 1C29B 1PS0A 3CRNA 1FQOA 1FYFA 2WSMA 1U8FO 4KHPB 2QL9A 5L7YA 3KOZA 2VXCA 5J1SB 2ZWVA 4KXFB 1GQRA 5DASA 4F1WA 1LCIA 1X8XA 3WK8A 5JPIA 4QYSA 4J8PA 5FOUA 3G1UA 4TTSA 1P0MA 1YB5A 2RC6A 3S2YA 4EQ6B 1T9GR 4RWZA 4IXDA 1AKYA 1LI7A 4OAQA 4O02B 2HA0A 2E89A 4M1EA 3C24A 3OUZA 4IV8A 4MUEA 3EXG1 3ZXUB 3O26A 1E3WB 1IEQA 5GONF 2YYSA 3OCVA 5F4BA 5HILA 2ZM6B 1YRBA 2C5HA 3LT2A 1NMYA 4ZFNA 3ECCA 3I9V6 3AI2A 3NAZA 1Y3AA 4LA4A 3TJMA 2DPXA 2GESA 4AD8A 3N6RA 2EJCA 2HN9A 4WAUA 3VHRA 1LFDB 1EA7A 2OZLB 5DM60 4DT1B 3A25A 3R9XB 2NVBA 2Y4OA 4RVOA 3C2QA 2M2IA 2ISCA 2O2GA 4ZI3A 3O92A 2ZVQX 4ZVKA 5HBGA 3JATB 1AQNA 3GLHA 3KAJA 1WWKA 2IHBA 1PK9A 3EYWA 2GRUA 3QVUA 4G8CA 5AW4A 1Q1GA 4B6EA 2GF0A 4HP8A 3SLRA 3JQGB 1M6VB 1Z5OA 2HXSA 2ZRFA 5TIIA 2FUEA 5JAIA 3RVOA 3BK2A 2LGJA 5DLQC 4RZ3A 1A5ZA 2OCBA 3EULA 1DL5A 3O82A 4PQYA 1XF1A 4CLEA 2WHYA 1XRNA 1ZKMA 1N3LA 1NR5A 2NM0A 3A6DA 5A05A 4RIEA 5J2TA 1G5HA 1G17A 4DQUA 1VC2A 3WC4A 5CG2A 5K09A 4LJRA 3K5PA 4CF5A 4MULA 5GZ1A 3QU2A 2PAAA 2QX9A 3WXMA 1W34A 1XU7A 1ENYA 2AN4A 3CXRA 4R1SA 3P9YA 2PUTA 2MT9A 3IULA 4HNHA 2AIRA 5L3ZA 2XH8A 3KYJB 2CVFA 5EJAA 5BV1A 2ZRPA 4XDGA 2HPHA 3G8YA 2APJA 3LBIA 4NLLA 1A7KA 5FL7A 3WBJA 1OC2A 3E3OA 4D4JA 1G6OA 3OE5A 5L53A 1JF8A 5EJ7A 2YVUA 3ASZA 4PLVA 3R7SA 4PSCA 3T7AA 4RGYA 3TZ6A 1YA8A 2NUBA 2QR5A 2VDMB 1XVVA 3EB9A 4AVYA 2GCPA 1VE9A 2WYUA 3VV3A 1E0JA 1U7UA 2GPJA 2VHZA 4KVZA 3RHSA 2WNSA 1B4DA 1YJXA 2O57A 1TZ2A 2ALJA 2N0SA 3D4NA 1C3LA 4Q9IA 4BVEA 3WKAA 2YJ4A 3NUGA 4EG3A 2Q41A 1GGKA 3HFGA 3NGXA 5IJXA 3RSCA 1IM2A 3S4YA 5CIWA 4LN1A 4REOA 1R6TA 2WJWA 3CSSA 3HFSA 4RVSA 4OQLA 5F2EA 3S8EA 1KMNA 1PDOA 3TG8A 5COAA 4K6FA 1RZ3A 3QLVA 1I2ZA 4YUYA 4I6EA 1LY1A 2IXTA 1GFSA 1XLVA 4OHOA 2NUTA 5CIQA 5LXTF 4D3YA 4PM4A 1GAXA 2VF4X 3W4IA 4KRYA 6CHYA 5K0JA 4YJ3B 4BVLA 1CZHA 4GNRA 3RYFB 1NDHA 4LF4B 3DDSA 3ZGYA 2DHEA 3T7SA 2QZZA 6PFKA 1XL1A 3UFBA 2J9FA 4C3OB 2WILA 1KDOA 5EIBC 2D8AA 2YOHA 1K92A 4NBUA 1RT9A 3Q7QA 1NI3A 2C3OA 1RQGA 2UVDA 3CBGA 2WTEA 3D3WB 1N6KA 3LUPA 4R8KA 2QL6A 3DL0A 3TAUA 3OOEA 5F1YA 2RHDA 4RV4A 1E3JA 2DLDA 4M3NA 2VH2A 4YDRA 1TUBA 5FUMA 1E20A 1ZLXA 5JTUA 3OWOA 3H4MA 4WNAA 3ZHZA 3LDGA 1EK5A 2BFNA 2GKOA 1V96A 1ZOLA 4TRRA 3LKVA 4UJ3A 4BFVA 1X0XA 2CF5A 5AO9A 1SVUA 1KDVA 2PUDA 1PVOA 1IY2A 2O3JA 2QDXA 3EF3A 1JGTA 2AB0A 3KHSA 3OFNA 2PXCA 3TKYA 4E2YA 1VJTA 4CMGA 3E6AA 3SDBA 3W79A 3K1ZA 5D1NA 2I4TA 3A3NA 2DKFA 1BDJA 1X7ZB 3B36A 4BRZA 4E88A 3FBWA 2PBFA 4A92A 1KQOA 4DR5B 2I3AA 2HT1A 3KQOA 3FHLA 3BC1A 2QD3A 4KLRA 4R8SA 4XB1A 5FTWA 2QG4A 3LOUA 4OATA 3CLKA 1UUFA 4NMXB 1XCJA 1Y6RA 3QJ5A 2Q1SA 5CYPA 1Z2PX 4NH4A 3V4LA 4FFRA 3R3WA 3FETA 2HREA 2R6JA 5EVCA 2AE1A 1YTLA 4CG3A 4E5YA 1XEWY 2VJQA 2XDAA 2VA8A 3EQ6A 4X93A 2IE8A 3WWDA 3CEHA 3DLBA 4AKHA 1I14A 4JL6A 3VOBA 1NW7A 2DQKA 4KE9A 1JYSA 4BBPA 4BCCA 3RTCA 2IA5A 3H3JA 4N9QA 2LD4A 4MYRA 3L92A 5C8ZA 1ZU5A 1F14A 4REQB 1K7XB 3C3DA 2WTAA 4NI5A 2QAGB 4TRJA 3UMFA 3SWWA 4MKFA 5WRFA 1W59A 3CKKA 2GEBA 1LXCA 4BB0A 5HK8A 1KMHB 5BSGA 1ZR4A 1CB0A 1NDUA 1XTJA 1EFDN 4Z9BA 2RI1A 3IEUA 5IS2A 1CUHA 1TM2A 2JAHA 5IMBA 4RTJA 1JW9B 1VBMA 4RHXA 4J0CA 4LY0A 1MJGA 1K8QA 4CMCA 1ISGA 1O58A 1M2EA 1YO6A 2YXNA 4Z86A 5JH7A 1OREA 1UXHA 2Y2UA 3FRJA 1NC3A 3OY2A 1VG0B 3JD1A 4C01A 2OCXA 1SOWA 3AHJA 5F7XA 4P3YA 3OEWA 2R8PA 3EVBA 1Q77A 4X7RA 1XMVA 2YN0A 3U19A 1NC1A 3IEPA 3GFFA 3NPMA 4LK3A 2I4RA 2XMPA 3HCDA 2M6LA 3VNBA 2P1ZA 5I7AA 3FPCA 3MFQA 1ZVMA 4E12A 1GAWA 3R3JA 2B21A 2SCUA 2ZXFA 1XTRA 2O2JA 2H5EA 3EPRA 4LNUB 3GLFE 1R4NA 3QVMA 4P5EA 2QVCA 4WCFB 4EGFA 3ZV6A 1I6MA 1RBZA 2XR1A 4ZN6A 5AHXA 2EJTA 2WINI 3ZGZA 3VOSA 4WE3A 1E3MA 1RM3A 1JQ5A 3T8YA 2VKQA 1KI2A 2H9AA 2J6IA 2PZMA 3DJFA 2AJ8A 3EZXA 3QBJA 2Q5IA 4L4RA 3V8QA 2I1WA 3UAVA 5B5SA 3HFRA 5JLAA 3C4QA 1ZVJA 1TJ4A 2YKGA 4DQKA 1E3IA 2XYHA 1WPXA 4OP2A 3W34A 4BV2A 1KP9A 1P4SA 4LY6A 2ODTX 1P3Y1 3N2YA 4AU1A 3P32A 2QOEA 1Y1QA 1JKMA 1YB6A 3C5VA 4BO2A 2GJSA 1IXSB 3EW7A 3G7UA 5TNXA 5CNJA 1D2EA 1V3QE 1ZIYA 2COKA 1KJZA 2VJKA 3HB7A 4H3HB 2ZTHA 1E2BA 5SZIA 4IUCS 1JU3A 2WABA 3BWXA 4OQ4A 5CVDA 2OQVA 3FOFC 4C5AA 2YVAA 3WTBA 5EJGA 1T3GA 3KOWA 4OL0A 4P36A 3KFVA 1NQVA 4Y6GB 5KAMA 3ZVNA 1ADYA 5KTNA 1YZNA 3H83A 4TN1A 2H16A 4LJKA 5TPZD 1C9JA 2XITA 3BXGA 4M7OA 2BR3A 3IILA 1V8OA 3G2LA 1IDOA 2EIXA 2VLBA 3AM4A 4H7JA 1CRPA 1E5VA 3IJPA 1Y3CE 3WGIA 3SJAA 1V6SA 1QCZA 1WW2A 2QSZA 4KUHA 3K9CA 1V9SA 3N8DA 2DPHA 5C81A 2CW5A 1FUKA 3C7DB 1C1DB 1D09A 1P7VA 4KODA 1XTPA 2EFHB 3D1LA 5FOSA 5CM2Z 2ZOSA 3UK0A 6ADHA 5AI4A 1L2TA 5BR7A 1EFLA 4RKFA 4Z9XA 4P5PA 3ROZA 1H2HA 2D1QA 4CM9D 3W5HA 4XYEA 3AXSA 2JFZA 4G8DA 2Q9AA 4Q9NA 2BEWA 1QUEA 1X42A 3TPCA 3BFJA 4TSKA 4JLOA 1ZRSA 2YBDA 1SNYA 3KO8A 4BLRA 1WZUA 3GJTA 5T8KC 1AGRA 1TPZA 4ER6A 4DJTA 4AY2A 1L5LA 2Q3HA 4HL6A 2ZSEA 3W2IA 4XTCS 3TQSA 4JI8B 3I04M 1E8DA 3H99A 1B74A 3UAYA 4IMJB 3AUSA 4JKIA 3H5IA 1R0LA 1ECLA 3KM0A 2PKRA 1UDAA 3D3QA 4FFLA 4MR7A 3ZK9A 2YXLA 4DZRA 3DOUA 3AKCA 4PRKA 1PHRA 3HADA 5EAIA 1AKVA 1LRLA 2GEFA 1AMNA 1MHTA 4UTXA 5LD2B 4ZRNA 5ESXA 5I5GA 4RKYA 1ZM3A 4BQRA 3DXZA 3L82B 2XZDA 1G59A 2PLRA 1G8KA 2FWAA 2BHTA 1X7DA 2RK6A 4NZPA 2IVZA 3RNOA 2RGUA 1MAAA 1T5TA 3JPWA 2G17A 2WUVA 3BX1A 4P53A 3GLHB 1G8SA 2QM0A 2QTTA 4Q15A 3X1WA 5BXYA 4FW9A 1QANA 4F4DA 1NQ5A 2R48A 5G3ZA 5ADHA 1PV1A 1EGMB 2W6CX 2SECE 4UTOA 2R5FA 5IUJC 3ZNOA 1SFRA 2AUMA 3RGWS 1MTOA 4L74A 1MB3A 1OSNA 1XAJA 2FF7A 3KJXA 5C5DA 5CYGA 3EVGA 4F45A 5J2TB 1BHJA 4NFHA 4YY3B 3DD1A 3ZHVA 2DT8A 3O6VA 3HPQA 2X2EA 3EBPA 4DA8A 2VK4A 1XXLA 2D3WA 3HHEA 4KOAA 4AJOA 4BTLA 1AF7A 3GLTA 4AMYA 5EZ5A 1PT7A 1HZJA 1QZXA 4UZEA 4DLBA 5ITZA 3I9LA 5JTTA 5LJLA 1WKCA 2BFFA 1X1SA 1U28C 3SZMA 3D8SA 2V74B 2VRWA 5K8IA 5JJCA 3ZI4A 4GKBA 2HX1A 4TV9B 2F8MA 1GZHB 2AYXA 1DDOA 1TXGA 4A0RA 3HCNA 1EVJA 3FTCA 2O2CA 3AFOA 3HNPA 3SGLA 3WAKA 4DNPA 4F11A 2NO0A 2NVUA 5LB4A 4YV1A 4PLWA 4AWBA 5I7RA 1JUDA 1DJMA 2HO4A 1RQNA 4D6YA 4FHDA 4J0IA 4FD2A 4ZZ0A 1GARA 1NT4A 1USUA 4MQFA 3OJFA 4PYOA 2PWYA 3BIWA 1IPFA 4R7TA 5ALSA 2XMCA 3T1OA 4Z0TA 3HVUA 3G0IA 3IEVA 1NHGA 4OIMA 2FK7A 2QN7A 5F9HA 2XCIA 2IPNA 2ZATA 2Q7XA 3KFXA 4RQUA 2P3SA 5LBUA 1YGPA 3C3XA 4GZ6A 4L5CA 1UIRA 3EHEA 3KTDA 4BRUA 1MH9A 1KC1A 4YN3A 2ES4A 2YDYA 5IAJA 4TZ0A 1ZD5A 3BBLA 5DYYA 4JI3B 2LNDA 1RYDA 2W2KA 3Q9UA 4ZREA 2CHEA 1T2EA 1E79D 3PC2A 3SSAA 3TRJA 2EX1A 2ZJ5A 1PJBA 1IK6A 4X1KB 1HFEL 2OGUA 3ZN2A 3ELYA 4X91A 3RSGA 1S01A 4IX1A 4D02A 4A8JA 4JP3A 3W5VA 1TEVA 3QXXA 4KMRA 5CFZA 4PGMA 4FDMA 4H7EA 5HPYB 1E5LA 2EX4A 2VDNB 5IBQA 1RVDA 2CKMA 2DWUA 1OZ0A 5IFLA 1ND5A 2FOLA 1CQZA 3CA8A 1RADA 4MEAA 2RI0A 4D3DA 2QTZA 4DHWA 2ZI9A 3RABA 3TE6A 2GKSA 3RJTA 3VH4A 4BE4A 2AN5A 1BAPA 1XAHA 3I6IA 1SCBA 4HDRA 5ENDA 1MG5A 4AJ2A 5ADVA 2RK4A 1P9WA 3QU4A 3SHFA 4C6RA 2O0HA 4D3ZA 3UAWA 1HDXA 2PGNA 3GVCA 4UEJA 4JA0A 3CNBA 4XLZA 3OTQA 4RVUA 4HUQB 4PCAA 4JYAB 3Q2OA 3BGVA 1J2RA 1NSYA 3ABZA 1LW7A 3MB8A 2OQRA 5GVSA 1MO2A 1TO6A 1IVNA 3IMCA 4EGQA 1AF4A 2XVZA 4AWXA 5H3CA 2XIQA 3RUPA 4AJJA 1I1QB 4IUBS 3O0TA 4ZMBA 3PC8C 3A28A 4NZ9A 4ZAVA 2Z57A 3ESDA 2YH2A 3KUXA 1IXYA 2H2AA 2FFJA 3T3MB 1EDBA 1PGOA 1RQ7A 5H82A 3WLTA 2VYVA 4XB2A 1E1KA 2LCIA 5FNZA 1SCUA 2O7SA 1GPNA 2FQQA 3P9ZA 5D2CA 4OVKA 1ETUA 2ZZKA 3A37A 3N0XA 2G5PA 1TMYA 2IXGA 1JH8A 2OM2A 2VZ9A 2VP0A 3LP5A 1L8QA 3GC6A 3TR6A 2P90A 5KTRA 3CWQA 1JPNA 4L6AA 2JCXA 4QWWA 3I1YA 1NI4A 4EA8A 3FSJX