2E19A

Solution structure of the homeobox domain from human nil-2-a zinc finger protein, transcription factor 8
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
GSSGSSGQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription factor 8
publication title Solution structure of the homeobox domain from human NIL-2-A zinc finger protein, transcription factor 8
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 11
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2006-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2e19A01
2HOTA 5E3OA 2ECCA 1MBHA 5M5XJ 2WAQN 3JRFA 2FX0A 3O8HA 4AC0A 4BY7J 1P7JA 3IH3A 3WHCA 1ETXA 3TEDA 5EGOB 2DA6A 3MKLA 2MSYA 2WB1N 1B8IA 3TP0A 4M3FA 2KT0A 1JUPA 3JRHA 4DZJA 2XPUA 5C44J 2ME0A 4DYCA 4A3IJ 4G12A 1Z0XA 3H0GJ 5M5WJ 1JKOC 1HF0A 5FLMJ 1ZQ3P 3FKIJ 2DA2A 1RPWA 5EGOA 2KDZA 2E2JJ 1JJ6C 2LD5A 1ORKA 4CYCB 3SDGA 3CCYA 3OOUA 4XICA 4XRSA 2HXOA 3HM5A 2M8GX 4IHVA 3GTOJ 2G0EA 1ETKA 1FIPA 2DMNA 5EDNA 5FKMA 1MBJA 4A3FJ 2YU9J 1WH7A 2Y9ZA 5IYCJ 5DS9A 4FE4A 2O8KA 1ITYA 1QVUA 1JKRC 1QPIA 5M3MJ 4ABZA 1GT0C 4JYKA 3SJMA 2VKEA 5IP7J 4A3GJ 4A69C 2JN6A 1VFCA 4GFBA 3GBGA 5F0FA 3JRAA 2DA1A 4C3HJ 3QPSA 1H89C 4XK4A 2M9HA 2H8RA 1PUFB 3S17J 4C3IJ 4A3DJ 3JRIA 1ETVA 2NS8A 4DZPA 5E3NA 3FK6A 5FKOA 3BT9A 2XSDC 1JJ8C 2VKVA 3HKZN 3Q0WA 3I4MJ 3M3YJ 4MFDA 5FJ8J 4QSHA 2R93J 5IYDJ 2JJ7A 2ELKA 2CQXA 2DN0A 3FK7A 1APLC 3HOVJ 4D5FA 2L9RA 4RBOA 1I3QJ 3ZQGA 5DTDA 3HOXJ 2OPTA 4B1RA 5C4JJ 2JA8J 1AU7A 1JUMA 2DMUA 3BG3A 2R0QC 9ANTA 3H3VK 2JMWA 5IYBJ 4QTRA 1FEXA 3NAUA 2XGDA 2DA4A 5E3MA 2LP0A 1SANA 4B3AA 4LOCA 3IH2A 2VUMJ 4A3JJ 1X2NA 1DU6A 5GPCA 1W0UA 1IC8A 4A93J 4W97A 3BR1A 1ETQA 1TWHJ 1IV6A 1TWAJ 2ME6A 3CMYA 3M4OJ 1T56A 3OSFA 2HOSA 3D1NI 1POGA 2IAIA 2JA6J 1X2MA 3BR6A 2DA7A 3CQZJ 4FISA 3BR3A 2L0KA 1W0TA 3S1NJ 1MSEC 2Y31A 2QCOA 4M3EA 5K7ZA 4A3BJ 1BW5A 5E3LA 2DMTA 2X6OA 5FKKA 3VPRA 2MW8A 1MH4A 2NVQJ 2E1OA 3FIWA 2GBYA 1TC3C 1Q1VA 3IH4A 1IDZA 3LSRA 1MBKA 1I6HJ 1JTXA 1JTYA 5EG0B 4D5CA 3BQYA 3GTJJ 2GM4A 2L7FP 1IRZA 1QRYA 1UG2A 5EEAA 2E2HJ 1UHSA 3LOCA 3JR9A 1BA5A 3RZOJ 2FJ1A 1ETWA 4X6AJ 2DA3A 1G2HA 2IBDA 2HI3A 3S15J 3OIOA 5EYRA 5M5YJ 4V2FA 5FKNA 3ZQCA 2CJJA 3RQIA 2K9NA 1RKWA 1MBGA 4L5EA 5EG0A 5J1UA 4XIDA 3BR5A 2HQ5A 2DJNA 1ZR2A 3BQZA 2ID3A 2VI6A 1S7EA 2OF7A 2ZB9A 3PO2J 3RZDJ 2XGEA 4JX5A 1WPKA 3QQAA 3LNQA 5J1RA 4M3GA 2O7OA 1O4XA 4CYCA 2XRLA 3FISA 2LY9A 1ZKGA 1B72B 3LSPA 1ZR4A 5IOZA 2MG4A 4Y52J 1D5YA 1IUFA 5IOYA 5GP9A 4BBRJ 3ZQHA 2JK3A 3OSGA 1U9OA 1RESA 3S1QJ 2NOGA 2EH3A 1IG7A 1WCMJ 3B6CA 4JX6A 1FJLA 4M3DA 4FTHA 3E7LA 1YRNB 4AYBN 2L7ZA 3GTKJ 2E2IJ 2Y0SN 3S1RJ 2CUFA 1MSFC 4IHYA 3HOZJ 3JRCA 4DYQA 1R9TJ 1TWFJ 1IGNA 1U9NA 2R5YB 3DCFA 2DMQA 3SFIA 3ZOBA 3C2BA 3A03A 3G1LA 4C3JJ 2CQQA 3JRGA 1Z77A 2M34A 2MGQA 2XB5A 1H8AC 3O8GA 2TRTA 1F36A 5K7FA 1PUFA 2R92J 1ETYA 5JLXA 3GTLJ 2XB0X 3BTCA 2EZKA 4B4CA 1JKQC 2CRGA 3WHBA 1FTTA 2W48A 2R5YA 3S1MJ 2M2EA 3LSJA 3TW7A 4JP0A 2NS7A 1E3OC 3S2DJ 3GTPJ 4HNVA 1I50J 3JREA 4BBSJ 4S0HB 1MBEA 2HOAA 5C4XJ 3JRBA 4JX4A 1FIAA 4UUTA 2NVXJ 2DMPA 1JT6A 1CQTA 2EZHA 4BXXJ 2LFBA 5F0HA 1NK2P 1RKTA 2EZIA 5IP9J 3S14J 4IHXA 3HOYJ 1XS9A 2JWTA 1LE8B 2AHQA 2FD5A 3L1PA 2GLOA 1OFCX 4A3CJ 2XGCA 3BTIA 1MNMC 2B63J 4D7MA 2XPWA 2JA7J 2AO9A 1ETOA 4AUXA 2LTPA 4DYRA 3HB9A 3PM1A 3HOWJ 3G1MA 5HODA 1FTZA 3BR0A 5J3LA 5F27A 1LE8A 3G1OA 5FKLA 1GDTA 4A3EJ 1MH3A 3GTGJ 4A3KJ 4MIMA 2QF7A 4A3MJ 2FQ4A 5K7HA 3DEWA 5BNGA 4M3BA 1UMQA 3F0CA 4IHWA 2R7ZJ 3K7AJ 2L7MP 4XRSG 4A3LJ 1K61A 5IPAA 2LLKA 2ID6A 3JRDA 1T33A 3A01B 2K9QA 3Q0VA 4MO7A 2M0CA 3RKQA 1AHDP 1NK3P 4MLOA 5EZGA 2Y30A 3UKGA 1H88C 3BTJA 1VI0A 3ZQFA 1WGXA 1BJZA 1OCPA 2CU7A 5EZHA 4BKXA 1BL0A 5IP6A 1IJWC 3HGYA 3A02A 1GUUA 1JKPC 3GTQJ 2X48A 3A01A 2D5VA 2NVTJ 2Y2ZA 5F0CA 1JGGA 2N8GA 2YUSA 1WH5A 3BTLA 1MBFA 1XC5A 5FLVA 1JUSA 2K9SA 1A5JA 2HDDA 4MFEA 3IV5A 1TWGJ 1GV5A 3HOUJ 2NVYJ 4D7NA 2EBIA 4I76A 2I10A 2R5ZB 1Y1VJ 1XG1A 2X9DA 1ZTRA 3BG9A 1B72A 2WV1A 3S16J 2P81A 1GV2A 1BW6A 2COBA 5EF6A 2HYJA 1RR7A 1ZGWA 1U78A 1JT0A 3Q0UA 3TP3A 2DTZA 2E19A 1HCRA 1AKHB 3K2AA 4M6VA 3LSGA 1HDDC 4Y7NJ 2R5ZA 2LKXA 1OJLA 4V2GA 1YRNA 5F1JA 2EZLA 4NDLA 1WI3A 3ZQLA 1P7IA 2XPVA 3Q3SA 2YS9A 4BY1J 4FE7A 1HOMA 2DA5A 2HXIA 4FCYA 1ZK8A 4J19A 4XRMA 1AKHA 2IEKA 3HGGA 2Y9YA 4IEJA 5GPAA 2TCTA 3MVPA 2O9LA 1HDPA 3HBLA 1LFBA 1NTCA 1TWCJ 4QIWN 3S2HJ 1DU0A 4RDUA 3B6AA 1VF9A 4UUSB 4X1EA 5F08A 3TW6A 1U8BA 3ZQIA 2CUEA 3W6VA 1GVDA 3BR2A 3I4NJ 2LVSA 5C3EJ 5JLWA 1LFUP 2H1KA 4C2MJ 4I6ZA 3PO3J 4DW6A 3HEFA 1QVTA 2RAEA 3QPLA 3GTMJ 2K40A 3MN2A 1X58A 4UUSA 1EF4A 2LK2A 5M3FJ 4EEFG 1A6IA 1HLVA 1F43A 5J1YA 2LR8A 1ENHA 1Y1WJ 5F04A 2PMZN 3BG5A 2VPRA 1K83J 1VNDA 2EQRA 3NARA 2ECBA 1B8IB 1OCTC 1RETA 4W1UA 3CDLA 2JA5J 3HDDA 1IDYA 1SFOJ
chains in the Genus database with same CATH superfamily
2L5QA 4O6JA 1MBHA 5F1RA 4E7SA 3B02A 2FX0A 3O8HA 3TEDA 1R22A 1BI3A 4S05A 3H1CA 1X1DA 4HV5A 2H6BA 2WB1N 1B8IA 3OYKA 4CO8A 3L2VA 2O03A 5B1AH 1W7PA 5ICCA 5C44J 2ME0A 1C0WA 2CS3A 3O3KA 4KICA 3S32A 1KONA 4F92B 3I71A 1UB9A 2KKOA 3E0JB 1FLIA 1MJAA 1RPWA 1TBXA 2D1HA 3H5NA 3K2ZA 4F93B 3AG1H 3IWFA 2HYGD 3LQRA 3OYHA 3SDGA 4IOAF 4L0ZB 2DK5A 2KZGA 1V5EA 2M8GX 3O6BB 5L3BA 3AAFA 5BPIA 4IO9F 1MNEA 3Q9VA 5EDNA 2KDOA 1FWZA 3F9KA 3NWSA 2YU9J 4ZDOA 4J00A 1SD7A 4IRIA 4IPAA 1QVUA 1JKRC 1W36D 2W82A 3CJTB 3SJMA 3OIPA 5DUKA 4A3GJ 1ZRFA 1LDDA 1R1UA 4YG2F 2QM3A 3OL3A 1O57A 2BXYA 5DDGA 3BWGA 2OQRA 3CD6I 3JRAA 1HW5A 5E17F 2DW4A 4AVZA 1R6RA 5LRRA 4C3IJ 2M7AA 1XTAA 1FC3A 4HSRA 1MMNA 2STWA 2NS8A 2PFBA 1Y8QB 3FK6A 1EJ9A 1VQ7I 1JJ8C 2VKVA 2KISA 3HKZN 3I4MJ 3M3YJ 4MTDA 1FBQA 1P2FA 5IYDJ 4AVPA 3FK7A 1APLC 1VQ5I 3HOVJ 4D5FA 1BR2A 3BG6A 4N0BA 1IUYA 3ZQGA 5DTDA 2QKMB 4L5IA 4HDVA 1XDUA 1D8JA 2DT5A 2DMUA 4Y4RA 4BXFA 5CVIA 3DKWA 2R0QC 3ASOH 1QZZA 1XPXA 1Y39A 2JMWA 1FEXA 3NAUA 2XGDA 2DDBA 1BC8C 2QBYB 3QYBA 5E3MA 2LP0A 3CMAI 1Z6RA 4BU2A 3TL4X 3IH2A 1LJ9A 1X1AA 2WWYA 4BQAA 2DK8A 3G71I 1ETQA 1WVRA 4YIIA 1IV6A 2EFQA 2GXGA 3WG9A 2A5YB 2JZYA 4BUPA 2BE5F 4HF0A 1Z7UA 2VL8A 2HOSA 3LSMA 2X1CA 1OKRA 1D1BA 3BY6A 2IAIA 3W6KB 1X2MA 3PUFA 3R60A 1EV7A 4YIRX 3EUHA 2A6TA 4PJJA 1EA3A 2HTSA 2QCOA 4M3EA 3IAS2 1F4KA 2KP6A 1FOWA 3V7SA 3VPRA 3RCOA 3QYFA 2NAZA 3JCUC 4CXFA 4ON0A 1O3RA 4M71A 2BXZA 2E1OA 2GBYA 3CF2A 4ZYGA 4HAMA 4BQNA 5D5XB 1Y0UA 2LY1A 2KJBA 3FHZA 2EFWA 5EG0B 4D5CA 3BQYA 3I0TA 3IRRA 4P9UA 2E1MC 2LH9A 1VQOI 2VIXA 4D0PA 2EA2A 3CC4I 1BA5A 3RZOJ 2FJ1A 3WU0A 3SDBA 1G2HA 2IBDA 2HI3A 3E97A 3OIOA 5H6QA 4A6DA 1KU7A 3ZQCA 2M4KA 1I3AA 1RKWA 1TT5B 4PZJA 3MWMA 3ABMH 4KDPA 4PJLA 2VC1A 3BCBA 3SEQA 2EWNA 2QQ8A 1P4AA 1SMYF 3OYAA 2VI6A 4M9ZA 3EYIA 4G7OF 2Y69H 1VTNC 3M1EA 4JX5A 2JVHA 4Q4ZF 3F8CA 2GIZA 2OZ6A 3FM3A 1P4WA 2Z2SB 1D3YA 1J7KA 1U5TA 2B7EA 2DQLA 3I54A 3SYTA 2XRLA 3GLLA 4BJTA 1J2XA 2LY9A 4LITA 2V4JC 1B72B 1F1ZA 4HEA2 3RPUA 5GAEJ 1RIOH 2MG4A 1IRFA 4KIFA 3K4NA 1IUFA 5IOYA 5F6FA 4HNUA 2OCCH 2JK3A 1U9OA 1RESA 3S1QJ 2NOGA 2EH3A 4G6TB 3BPVA 1Z1DA 1FJLA 1ZGJA 1D1AA 2EV0A 2L7ZA 2ACJA 4Q5SF 3S1RJ 2JRMA 2CUFA 2FNAA 2HGCA 4IHYA 1XDSA 4RB0A 1R9TJ 1TWFJ 3DCFA 2DMQA 3H3ZA 1R4MB 2MLKA 1SAUA 2IS6A 3FBIB 3JRGA 3HUGA 2TRTA 3DWLE 3D0SA 2R92J 5JLXA 3L7WA 4JQFA 4OIRF 2M1BA 2EZKA 4B4CA 2R5YA 3S1MJ 3LSJA 2NNNA 3VSLA 3SXYA 3J80K 4MQVA 4E6KG 2A61A 1P6RA 3ABLH 4YFKF 4HNVA 3GTPJ 2QSHX 4E7HA 2HOAA 2VC0A 4JX4A 2GZWA 4LIUA 3L2UA 1MW7A 2NVUB 1JT6A 4BXXJ 2EZHA 2CFXA 1Z3YA 5F0HA 1YTYA 1RKTA 2BOLA 2RKHA 2HKXA 3AKZA 1R5HA 1K6OA 2F5DA 4KA4A 3I59B 1XCVA 3G73A 2E5ZA 2JWTA 3L1PA 3HRTA 1MDMB 2XGCA 3OS2A 2XPWA 2LC2A 5IY5H 3JSOA 3L2CA 3FHNA 4AUXA 2LTPA 4DYRA 1SAXA 2OD5A 1LEBA 1FBSA 3PM1A 2VBWA 1ACIA 1P92A 5HODA 2VLAA 5JFRA 2W4SA 2NOJB 5J3LA 5F27A 1LE8A 1NG6A 3OYJA 2PJRB 2OA4A 5HNFA 2K02A 1IXRC 1W7PD 3DEWA 2J5OA 3CJRB 4CGZA 2FQ3A 4CZZA 1UMQA 3F0CA 2HVRA 4A3LJ 1IV8A 4E7IA 2VE9A 2UXXA 3K10A 4HF1A 2BW3A 5CVRA 4ESBA 1DP7P 2L02A 2VJJA 4MO7A 2CFOA 3SFZA 3RKQA 2EIMH 3JTGA 1AHDP 4MLOA 1MMAA 3OMYA 2FBIA 3BTJA 1OYWA 3ZQFA 4I7HA 3I64A 5A2QK 3MKYB 2IS1A 2CU7A 2WAEA 3GFJA 1T8IA 2VODA 2YR2A 3A02A 2R7VA 3MCZA 1SD6A 3J7YJ 2ZJ2A 4E7ZA 1STZA 3F8NA 4LLLA 1KZHA 3BZKA 5JVGF 1BBYA 3DP7A 4CICA 5FLVA 1R58A 2FOWA 5ICEA 1A5JA 4GYGA 3ABUA 2H6CA 3ONQA 4L9NA 5JVTA 1HSTA 2A5WA 4ZYDA 2YU3A 3H92A 5L3CA 4EQQA 4IRHA 1XSVA 1KQ0A 3REOA 4ZDLA 1BIBA 3L2RA 4D7NA 1NG7A 2I10A 2KIQA 1EKEA 4HX8A 3OR1C 1ZTRA 1B72A 1DP3A 4EVIA 3MZYA 2HPIA 1GV2A 3LWFA 1D5VA 1RR7A 2LG4A 2P6SA 1JT0A 3HSEA 2D45A 1B6AA 2O6GE 3ZMTA 1QBJA 1LB2A 3GZ5A 2YX7A 3LSGA 4B48A 1OJLA 5KAFC 3I9V2 2KRCA 4NDLA 1R36A 1WI3A 2C6YA 1ZYRF 3H5RA 2FEZA 5FROA 2BHZA 2X6XA 2YS9A 1H9GA 1QHGA 2JSPA 3E5QA 2YSRA 6PAXA 1VQ6I 4FE7A 2RC4A 2GXAA 2HXIA 4FCYA 1YITI 2W57A 2K27A 3BP8A 3BPXA 4ETSA 4X0GA 3HGGA 4AWXB 3JAMK 1ZHFA 3C2GA 2RQQA 1V55H 3HBLA 1Y8RB 3VODA 5DYMA 3KE2A 1NTCA 3EDPA 1TWCJ 5B1BH 1YS6A 1LUJB 4UB8C 3RPQA 3B6AA 3N97A 2R4GA 1LVAA 3QU3A 5CQEA 3BR2A 4PJNA 5J8FA 2QQBA 5DUIA 3I4NJ 4XKCA 4KT6A 3ZRGA 2KIMA 2DDAA 2H1KA 5JLWA 2OUMA 2VXDA 1LFUP 4XLNF 3DKXA 3K70D 3PO3J 2QA4I 1K78A 2Z9OA 3GVAA 1QVTA 1DUXC 1A6QA 1V54H 4RAFA 4UUSA 1ZG5A 1WJBA 3C18A 4EEFG 3LAPA 3F23A 4CYDA 4ITVA 1T0FA 4EATA 5F04A 4KUMA 2BY3A 1NHAA 1MMSA 3VYUB 3SZPA 2VPRA 1DQUA 3TO9A 2EQRA 4XOTA 5HVQC 1B8IB 2FSWA 3CCRI 2A69F 1QZYA 3GYHX 3KP7A 4G9YA 1W7PB 2PMZA 1G59A 2VQCA 2HOTA 4PSXA 5E3OA 5M5XJ 3JRFA 2V6CA 2PG4A 2WY8Q 4U0WA 2E7WA 4LG0A 4BY7J 1P7JA 1BOAA 1HW2A 4IF4A 3L2WA 2FUG2 1QO0D 1Z05A 4DIQA 4CZCA 3TP0A 3H3UA 2KT0A 3ERED 4ESFA 3GUDA 3CUQA 4ZZLA 4DYCA 4CH7A 4G94A 3DPTA 1HF0A 3F72A 2HVSA 3AL0B 3RI4A 2WB1A 3FKIJ 2PLYA 5CVVA 5EGOA 4OU0A 4AM3A 3RKWA 1BI1A 2E2JJ 1JJ6C 2XV4S 2G9WA 3FWEA 4WF2A 5K5OA 1ORKA 3CCMI 4CA0A 3OOUA 4U0VA 3HM5A 3KZYA 4WX9A 3OS1A 2X4HA 1Z9CA 1JHHA 2X1EA 3HC7A 1D8KA 2G0EA 3VB2A 2VQLA 5KHDA 1E3PA 4P96A 4DNCA 4D9JA 4ZTFA 2DMNA 4A3FJ 3VYRB 3E1SA 2F4OB 1WH7A 2Y9ZA 2O8KA 5DS9A 4FE4A 4B8XA 1E2XA 2O0YA 3OYCA 2OTLI 1GT0C 1OISA 2HKOA 4JYKA 4WWCA 4UB6C 3F21A 4LB6B 1MZBA 1YJNI 2JN6A 2MD0A 3GBGA 2LOOA 3GO5A 4NQWB 1VQLI 2P7VB 3SZTA 1JE8A 4WXHA 2XAHA 1WJ5A 3OIQA 2CV1A 2OC6A 3HOTA 2QENA 2XKOA 4DBRA 4XK4A 3GX4X 3S17J 4A3DJ 3FMSA 2BV6A 1YX3A 1P4XA 1USSA 1QQIA 2BBYA 4DZPA 2W84A 4YFNF 2XRNA 3ZQ7A 5E3NA 5FKOA 1UZCA 3BT9A 5GTIC 1U3EM 1FYKA 4LIVA 1W5SA 4LG3A 4QSHA 1K79A 5K5RA 1WFXA 3I3LA 5HS9A 2JJ7A 2CW7A 3ZGKA 5JR3A 5LEKA 5FLXZ 2Y75A 2M87A 2V7FA 2CQXA 4A0ZA 1AA7A 4KN4X 4RBOA 1I3QJ 3CESA 3J81Z 4RGUA 3HOXJ 3DTIA 2X6WA 3HKZA 4CCJA 4OOIA 2DTRA 1FOYA 1T6SA 1ZGAA 4U88A 9ANTA 3L09A 2EB7A 3LAJA 3QPTA 5IYBJ 1LQ1A 1GVJA 5B66C 2EJRA 3PJRA 2KFDA 3KIOA 1O3TA 2RDPA 2BYVE 3BG7A 3K9TA 2LBFB 3E6MA 4A3JJ 4MEXF 1B59A 1DU6A 5K1YA 1IC8A 4HW0A 4A93J 2ZMEA 1JXSA 1D0XA 4FETA 4I0AA 3BR1A 3FXRA 3LSKA 4EJUA 2VPLA 2WAFA 2ZO4A 1TWAJ 4CCKA 1ZG1A 2ME6A 3C3WA 1POGA 1W36C 1MMGA 2DA7A 4M73A 3CQZJ 1W0TA 2HR3A 3BR3A 3KP4A 2BHYA 1MSEC 2Y31A 5K7ZA 3V8JA 4A3BJ 5CKTA 4BGDA 5L3FA 2DMTA 2BVLA 3M1CA 3RDIA 1YE9A 1MH4A 5IT9Z 2DI3A 2M4GA 1VQKI 1W4MA 3BDDA 4HPQA 1PUEE 2VKHA 1IDZA 2BY2A 5E18F 2LREA 1JTXA 1TQPA 4P9FA 1XGNA 3IKTA 2QLZA 5EEAA 3FXMA 4KN7X 2CQNA 2DFHA 1UHSA 2DO7A 3LOCA 5LRSA 2W25A 1T2KA 4I98B 1LEAA 3DPLC 4IL6C 3WGIA 1WJAA 1EH7A 1ZRDA 5L3EA 3W2AA 3RTRA 2F2EA 4GGGA 5EYRA 3V42A 4RAYA 3VOEA 5CVUA 5M5YJ 4ENKA 2HPMA 3WU1B 3RQIA 2K9NA 4HOBA 5KCMA 5D8KB 1K4SA 1MBGA 4WCGA 5J1UA 5D6EA 4DQ2A 4XIDA 1U5TB 2DJNA 4IHTA 3JW4A 2DT7B 2GA2A 3G2BA 4XOPA 1FP2A 3RZDJ 3MZ8A 3A2KA 1E17A 2ELJA 5B5EC 2MYSA 4IZZA 2FRHA 1K7AA 1S72I 4BQOA 2O7OA 1O4XA 1AWCA 3DV8A 5FRNA 2NYXA 5DD8A 4G7ZF 3KYCB 3I5UA 2VJ4A 4CCLA 2PJPA 3EPZA 3HYIA 4HNTA 4Y52J 2B0LA 4C9YA 1D5YA 5HLHA 3TO6A 1G3WA 3IAM2 2IA2A 2F5EA 4BBRJ 1TQMA 3A1YA 4PJ0C 3HTUA 3S2WA 5ILVA 3WG7H 3HUGB 1IG7A 3B6CA 1XMAA 4BNCA 4AYBN 3PL8A 3QOPA 3BOQA 4I01A 3HHHA 3DBLB 4UVAA 3K1MA 2R5YB 4NQWA 3C2BA 2ISYA 4LK0F 3S3OA 2LMDA 1MNDA 2AXTC 3ZMVA 4C3JJ 4CSWA 1N77A 4XKVA 1F36A 2RGVA 3T8RA 2KRFA 3J7ZI 2J5PA 3GTLJ 2XAUA 3FDYA 2MA3A 3F8FA 3BTCA 3LQQA 3VDXA 2L4AA 3WHBA 3IRQA 2LF8A 3JTHA 4RM3A 4IHSA 2M2EA 5D5VB 3WE3A 4JP0A 4RS8A 2CWEA 4XBFA 1KGSA 2RN7A 4P5OA 3GZ6A 1I27A 1OCCH 2IVMA 1MBEA 2CH0A 4BBSJ 1OYIA 1HKTA 4ENMA 1HKSA 2OCEA 2JA2A 4UUTA 1SD4A 2NVXJ 2P8TA 3S93A 1CQTA 3KEYA 5J4VA 2UXNA 1NK2P 4BXUA 4CCNA 2EZIA 3IHUA 5IP9J 1FYMA 2M5WA 4IHXA 3HOYJ 3CF5F 1LNWA 2XDVA 3MQ0A 4EJTA 2LBFA 3ECHA 2L54A 3ZMUA 2HZTA 1LE8B 2HDCA 5ILUA 1YJWI 1IW7F 5HLGA 3T0YA 3LA3A 2B63J 1VQPI 3P7NA 4D7MA 4A2UA 2AO9A 2V1UA 5HNHA 2JRTA 3AG3H 3GF2A 1J09A 3CZ6A 4PUSA 3S8PA 1BM9A 5LFAA 3KP5A 2OAZA 2QYOA 3G1MA 2IS2A 1LDKB 3CCJI 1FTZA 3K4LA 3TQNA 2Z33A 5CJ9A 3BR0A 4YFXF 4CHUA 1XSXA 2BW3B 5TISC 1Z91A 5FKLA 2MFZA 2PMUA 3FM5A 1GDTA 4ASNA 2R7QA 4A3KJ 4HRIA 3MEXA 2XF7A 4A3MJ 5CYVA 3DF8A 3K1PA 3CLOA 5BNGA 4A0YA 4M3BA 5E1WA 3DFGA 4IHWA 2R7ZJ 3K7AJ 2L7MP 3MZHA 1K61A 2E7XA 4O5VA 4Y33A 3NEUA 4C2TA 2AXLA 3MFKA 3LL7A 2IA0A 4KMUX 3PIOF 3OYMA 3CDHA 5EJCA 1SFEA 1ONVA 3SZGA 5ICGA 2K9QA 3QP5A 1R71A 3CCUI 4ANJA 2M0CA 5BOXA 1WJCA 2JSCA 3BZCA 1H88C 4G8XA 1VI0A 3M8JA 4XQFA 2E1NA 3OS0A 2MLGA 1TP4A 3LA2A 1V3FA 4NHJA 4CCOA 1JKPC 3FBNB 3OL4A 3PSIA 2I8DA 1BOBA 3A01A 2D5VA 3DXJF 2NVTJ 3PIPF 2Y2ZA 4TV7A 4GO1A 2V26A 4Y17A 1MBFA 5ED4A 4XORA 2JQ7A 1DPUA 4RGSA 2XASA 2RNJA 1LPQA 4MFEA 3WTYC 2L3DA 1GV5A 3RIRA 1ZH5A 2K85A 2V1NA 3EQLF 3F22A 2KIFA 4DJAA 2EBIA 3IWZA 2X9DA 1PVEA 3CCVI 1CGPA 2HZDA 3WTSC 1OQYA 3HL2A 2DPDA 2IA1A 2L01A 2KQRA 5BPDA 3ZN1A 3BZ6A 1QGPA 1Z6TA 3WU2C 3K4MA 5EF6A 1U78A 2HYJA 3Q0UA 1X3UA 2E19A 3DEUA 3QODA 1HCRA 3QAHA 4Z2YA 4DGWB 2R5ZA 4ZTJA 2FBHA 2ZXHA 1X1CA 2DYSH 2VBYA 3HRMA 1D1CA 5F1JA 4HLYA 2VJIA 3OR2C 2XPVA 1SFOJ 2IT0A 3AG2H 2P7CB 1ZK8A 4BDZA 1TZLA 4PFPA 4XSXF 2IW5A 3W3CA 2IEKA 2Y9YA 1KYZA 3AG4H 2DLLA 3KP3A 1R49A 2BEOA 2O9LA 1S3JA 4PK4A 4L9TA 4MHGA 1ZG3A 2HNHA 4QIWN 1K78B 1SVLA 1SFKA 4MNUA 1SEUA 1VF9A 4U0YA 4UUSB 5F08A 1E3HA 4XLHA 1VZ0A 1JHFA 1PP8F 4UV9A 1A31A 2ZXIA 3COAC 3I55I 2CW0F 3H36A 2DBBA 2QUFA 5J6XA 4HV6A 2HOEA 1MGTA 2VASA 2QVOA 2VKDA 5J40A 2ZJPF 2IXSA 3RYRA 1YIJI 3GTMJ 2K40A 2YPRA 2DOFA 2LK2A 5M3FJ 4XMYA 1A6IA 3B73A 4EMSA 2K5CA 5BS6A 4BQQA 5LLQA 2GOMA 2M3AA 1F43A 4O3MA 1GXPA 2LKSA 1ENHA 4AIDA 3WTXC 1KYWA 4LG0B 2Y0MA 1SD5A 1U0JA 3WTTC 2Z5UA 3CCSI 2QSFX 3DBHB 5KK1A 3ZP5A 1QU3A 4IXAA 5F64A 2ECBA 1OCTC 1OR7A 1SC7A 3CDLA 3L2QA 2JA5J 3HDDA 1Y56A 2EK5A 1IDYA 5L3GA 3E5XA 1BR1A 3CUQB 1DGWY 1GXQA 5IT3A 1G3YA 3NQOA 3OYFA 2WAQN 3K1NA 4ZJZA 4BHBA 3FKJA 3WHCA 5EGOB 4AIKA 3H9QA 2Z16A 3A0HC 4HYEA 2XSJC 1J75A 2FNPA 1T95A 3SHFA 3JRHA 3DEEA 1T08B 4PFOA 2XPUA 1UG0A 2DOEA 3M07A 4ZYHA 3X2QH 2R7XA 4G7HF 3N05A 2EIJH 3ZMSA 2VT3A 4A3IJ 1Z0XA 3ECOA 1WJEA 1TL8A 4E7KA 3H0GJ 3LFUA 5M5WJ 4H0EA 1FBUA 5FLMJ 1ZQ3P 1TW3A 1VQ8I 1WWXA 3ZMZA 2KDZA 5JHFA 3BLYA 1D0YA 2IPQX 4BJ5C 1S6LA 2MH2A 4CYCB 2F6CA 1YIOA 1XGMA 2DXIA 4XICA 2F4MB 4L0YB 1J59A 2Z3YA 2HXOA 2V1DA 3W2WA 3F8BA 4OIOF 4RA2A 3T1BA 3EUHC 1ETKA 2L9NA 1ZREA 1F5TA 2FU4A 1FMVA 1MD0A 2QQAA 4G6DA 3EYYA 5IYCJ 5LD2C 2F4IA 2HFHA 2PN6A 4HQMA 1QPIA 4XR6A 3KP2A 3V7RA 2COMA 3LSHA 1HSJA 1LVKA 5IP7J 4U87A 4U7BA 4G6QA 2M30A 5GAHJ 5F0FA 2ZFUA 3VYTB 2GXBA 2CV2A 3FXJA 2K7LA 2I5UA 3GWZA 3HJEA 4NBQA 4LB5A 2DA1A 3QPSA 4HX7A 2H8WA 4OINF 1PUFB 1LFPA 2BGCA 1ETVA 3ABTA 4UHTA 3GCMA 1O3SA 3Q0WA 3WGHA 2R93J 4Z6YA 1R23A 4IOCF 2ELKA 4QWQA 2KZVA 3EUAA 3M7GA 1B1BA 5TGTA 1YX5A 4XN0A 4Q48A 3TMOA 5C4JJ 2JA8J 1G3SA 2ZMEB 1OCZH 3H9JA 1I39A 1WI9A 1JUMA 3CCLI 3BG3A 1MMDA 3O2PE 1U5TC 5D4SA 1S9HA 1H9TA 2KJCA 3PQKA 4B3AA 2VUMJ 2AS5F 2DT6A 1JGSA 5GPCA 2R7FA 2OU2A 1W0UA 1JI8A 3HPGA 1ZRCA 5LEJA 1TWHJ 1UFMA 2KMUA 3CMYA 1VQ9I 1T56A 3KX2A 3WTVC 3PNYA 3OSFA 4A12A 3D1NI 2TDXA 2JA6J 2P6TA 3CCEI 4FHTA 4KIGA 3E6BA 3S1NJ 2X51A 1W5TA 2HVQA 5LGTA 4AIJA 1X4PA 2X6OA 1WQ2A 2R7WA 2LRDA 4IJAA 3RQ4A 3R4KA 4CCMA 1TC3C 3QPHA 1IN5A 2VBXA 1RI7A 2B9SA 4M9XA 2JT1A 2ZSHB 1JTYA 3GZNB 3BCAA 4IX7A 2DOAA 4NC6A 1ODDA 5CPRB 1X3ZB 1IRGA 2GM4A 1IRZA 2E34A 1QRYA 4BAYA 3RJPA 2E2HJ 2E5NA 4IKFA 3C7JA 2EILH 2ZBKA 4II3A 3HZJA 4X6AJ 2GIVA 5FD5A 1U2WA 2DA3A 2P5VA 5JI6A 2Q2EA 3GMEA 4MTEA 4LFUA 3PQJA 4EGZA 4V2FA 5FKNA 4BE0A 2CJJA 4IRGA 3D5SC 3OYIA 5E8GA 2R7UA 1R1VA 4F52A 4L5EA 4YEJA 2VE8A 2AQFA 3TOAA 2HQ5A 1ZR2A 2E71A 3CC7I 3BQZA 3S15J 1MIJA 4RLFA 2OF7A 3PO2J 1BR4A 1FMWA 3G6EI 4BH9A 2XGEA 1HKQA 1BC7C 1OCRH 2WA0A 4WXDA 2KHMA 4KJZA 5J1RA 2FF4A 2W24A 2W1OA 4CYCA 2JPCA 5E8IA 1G6NA 3FISA 1ZKGA 1TT0A 3OYLA 3LSPA 4PDKA 1YFHA 1ZR4A 5IOZA 3FXOA 4L9JA 3KETA 3ZQHA 1EH8A 1WCMJ 3W2VA 4JX6A 2V79A 5LHIA 4J01A 2R7SA 5FFZA 3TO7A 2QWWA 2P5KA 4UVBA 4FTHA 4M72A 3GTKJ 3E6DA 2WC2A 2Y0SN 4DOZA 2HQNA 2EV5A 1DGRM 2O5RA 1MSFC 3HOZJ 2G7UA 4E7LA 1VQ4I 1YYVA 1IGNA 1U9NA 1S8NA 3ZOBA 1HXDA 1KU2A 4L18B 3OYBA 2A05A 1FOXA 3IKVA 2CQQA 3BJOA 4AYBA 1Z77A 3ISPA 1H8AC 4EGYA 1P9QC 4RGXA 3V4GA 1GLNA 1PUFA 1FSEA 2CUZA 2VBZA 2V9VA 1W1WE 2R3SA 4KIBA 4BEHA 1SVMA 2CRGA 3HTSB 3KLNA 2W48A 3I56I 1RUNA 4LMYA 1N78A 3HSRA 3CJNA 5D4RA 2NS7A 1E3OC 1L0OC 3HOSA 1SFXA 4A0XA 5DM6F 2A3SA 4LLGF 4YIFA 3PNTA 3JREA 4RB1A 3E6CC 5C4XJ 3JRBA 2VQGA 5D8LB 1XGOA 2MC3A 3JSPA 2Z99A 3H5AA 1XMXA 2GQQA 2RV8A 4I99C 3WE2A 2XVCA 1TTYA 2LFBA 2QQ9A 2XUBA 4MGRA 2HDWA 4ZYAA 3D5RC 4N4OB 3BJ6A 3OYDA 3KP6A 3S14J 1LKXA 2LKPA 4P55A 2M7BA 2HQAA 3ELKA 1YS7A 1XS9A 5FLXK 4R79A 1FSHA 2AHQA 2FD5A 2KL4A 2GLOA 2XAQA 1Y6IA 3HXLA 4A3CJ 1KQ8A 3BTIA 5LGNA 3J81K 2JA7J 3FXQA 2CG4A 1N75A 4N9IA 2XF5A 1KU9A 3P5JA 4EJWA 1WRJA 4EV0A 2KIUA 4LLNA 3LA7A 5H6RA 2MC4A 4HSTA 4E4HA 2CSOA 1V5FA 1CF7A 1GHCA 3KCCA 3SEZA 4M74A 3U1KA 3G1OA 3EETA 4BS9A 1SFUA 1IF1A 5LBQA 1U8RA 2PEXA 5ILSA 2EV6A 4MIMA 2QF7A 4M6XA 2K86A 1ZLJA 2FQ4A 5K7HA 1R5GA 3PFYA 3IP4B 5EEGA 4ZDPA 1YO5C 3TOBA 3QRFF 4NNJA 4C2UA 4XLPF 1S7AA 3EUKL 3WTWC 4KYWA 1FP1D 2ICWG 1UJ8A 2O3FA 3T8TA 2FMLA 2RREA 1KA8A 2ID6A 3JRDA 1L3LA 3A01B 4HF2A 3FXKA 4XKBA 4F91B 5HS8A 2A6EF 1NK3P 2Z1DA 4PGGA 5EZGA 1O7LA 2EPFA 2ESNA 1FT9A 1ZAOA 1BJZA 1OCPA 2V6EA 2LY2A 5ICFA 5IT9K 1BL0A 1R4NB 2QKLB 2H27A 5IP6A 1SMTA 2E60A 3IL2A 3GTQJ 2IGMA 4B3XA 3K6GA 2X1DA 5F0CA 2N8GA 3BTLA 1WH5A 1Q1HA 2PQ8A 4KT5C 4A5MA 2F5VA 3FF5A 1MJ9A 2K9SA 1T0FC 4AU7A 4UVCA 2HDDA 3QYEA 2UWMA 3HOUJ 2R7OA 4LD5A 2WTEA 2A07F 1ON2A 2K4JA 3E5UA 2XC7A 3VYSB 3M8EA 4I76A 5FD6A 2R5ZB 1HBXG 3M9AA 1XX5A 1V5GA 2PBIA 3BG9A 3KPHA 2XF6A 2ZKZA 3D5LA 5AIQA 3KLOA 3S16J 2P81A 4E7JA 2DFFA 2DPUA 3U1DA 2COBA 4HA8A 3RYPA 1I6XA 1ZELA 3TP3A 1IO2A 3K2AA 1S29A 2G7HA 4V19K 4Y7NJ 4RB3C 2DQRA 2LKXA 3NWTA 1PYVA 4DBQA 4AIHA 1ULYA 3CUQC 1KQ9A 4V2GA 3CMEI 5HDNA 2IGOA 3ZN0A 1P7IA 3T5XA 2WBMA 4UXNA 2KRHA 2L7KA 5D5UB 2DA5A 2E36A 2ELHA 4XRMA 1AKHA 3MKWB 4IEJA 3MVPA 3FZVA 3CO6C 3A0BC 4LK1F 3MAJA 1J5YA 1NH3A 1QZEA 3BJAA 2YX4A 5HLTA 4KNYA 2GOXB 3S2HJ 4B09A 4RDUA 1DU0A 1XCBA 4RGRA 1QA6A 1YJ9I 2V9PA 2IGKA 2JUGA 2DFIA 2OQGA 4X1EA 3V8LA 3TW6A 1U8BA 2M45A 3ZQIA 5DCMA 3W6VA 2H94A 3CC2I 4P1WA 4BL0B 2QGUA 2K9LA 3M8FA 5DM7F 3OYNA 3QP6A 1DDNA 3GXOA 2ZJRF 1FZPB 1SVOA 2VOOA 4C2MJ 2F5FA 5GAGJ 1DPRA 4HBLA 2R7TA 3CUOA 3K69A 2OTJI 1O7FA 3I53A 1X58A 2L2OA 3PUBA 5E1XA 2HEOA 5JHUA 5J47A 1HLVA 5E20A 2ESHA 2K3PA 3GW2A 5J1YA 3ZQQA 2LR8A 4BJ6C 3HIFA 2FBKA 1Y1WJ 3HHGA 5LHGA 2NXNB 1ZN2A 4OAZA 4RAZA 1FX7A 2IGNA 3BG5A 4ESJA 2ISZA 2CV0A 4NC7A 4XLAA 3BC8A 4GDFA 3WGGA 4D1QA 1XN7A 1TQIA 1VQNI 2RQPA 3GLXA 1FOKA 3KZZA 1XSDA 1WKMA 5H2FC 3IC7A 2ECCA 1YQAA 1FPQA 5HDGA 4GRIA 4LJZF 4AC0A 3ESWB 3IH3A 1E0EA 2ZNZA 1ETXA 2DA6A 3MD2A 3MKLA 1XMKA 5KNLA 1QPMA 3V8KA 4RLQA 2MSYA 3K4CA 1M1EB 4B47A 3IUOA 4M3FA 1JUPA 4DZJA 2WAQA 4BYYA 5D6FA 4G12A 4N9HA 3CTAA 3K0LA 1JKOC 2H1LA 3K4BA 2X6YA 3LSIA 1D0ZA 2DA2A 4WXCA 3DKYA 1FNNA 2ZMEC 3UR3C 2E35A 1B9NA 2LD5A 2EA4A 3DQVC 1IN6A 3CCYA 2W7NA 2WY7Q 3J7AY 4GXOA 4CDGA 4XRSA 3TBIA 2JPBA 4HQEA 4IHVA 2EFPA 1XD7A 3I4PA 3GTOJ 1FIPA 4ZYEA 2VT2A 2W00A 1ZLKA 3HPHA 5FKMA 1MBJA 2K4BA 2XROA 5LGUA 5K5QA 1UHMA 1ITYA 2XKPA 3N4MA 5M3MJ 1X4OA 5HS7A 4ABZA 2VKEA 4I0BA 1X19A 4A69C 3J80Z 2BVMA 4I09A 3FMQA 1VFCA 3ZMDA 4GFBA 4HX4A 3A4CA 3CP8A 1WHUA 2AQEA 2DJIA 4L5JA 2F5CA 4C3HJ 4ZC3A 1H89C 4UNOA 2M9HA 2H8RA 5FO5A 2L9SA 3JRIA 3ABKH 4NUBA 2HWVA 2BZTA 2IP2A 3CLQA 5D5WB 2XAJA 5HLIA 2XSDC 1MKMA 4IVNA 3OV8A 4MFDA 2DU9A 2O8XA 5FJ8J 2ETHA 2ZSIB 3OYEA 1TW2A 3Q5FA 4C30A 2DN0A 2R7DA 4KFCA 3U2RA 2L9RA 3F3XA 3R6SA 5FRMA 1YG2A 1BIAA 1J0RA 4QPQA 2WADA 2OPTA 4B1RA 3AL0C 5FGMA 1AU7A 5FB2A 3BROA 1B4AA 2XAFA 4ENJA 3LFKA 3QWLA 3ERMA 1AOYA 3H3VK 4QTRA 3L9FA 2Q1ZB 4Y15A 3CDIA 2DA4A 4A6EA 3S3MA 1SANA 1IZ1A 1HC8A 4LOCA 1Z21A 2P5LC 3TDUC 1X2NA 4L9VA 2V1XA 2Q0OA 4W97A 5E1ZB 3GFIA 2ZFWA 1FY7A 3OYGA 5BMZA 4CUGA 2EFNA 1O3QA 3DTKA 2M8EA 3M4OJ 4FX4A 1X3WB 2X0LA 3KYLA 2QBYA 2M0MA 2X85A 2V9KA 3BR6A 3K4JA 3KZIC 1PDNC 1A36A 4FISA 2L0KA 4HDUA 1ON1A 1QNTA 4YELA 1BW5A 1X1BA 4NC8A 5E3LA 3CJQB 5FKKA 4OIPF 2MW8A 3OOPA 5A2QZ 3ZXSA 1IXSB 1YLFA 2NVQJ 3FIWA 2Q2EB 1Q1VA 3IH4A 4Y3OA 3LSRA 4IQJA 3J7AO 1MBKA 1I6HJ 3DTEA 3DU6A 4B43A 4EM0B 1I1SA 3E3VA 2OZUA 3GTJJ 3P9IA 2L7FP 4OMYA 1RZ4A 1UG2A 4FQGA 4HG2A 4UUVA 3JR9A 4FASD 1ETWA 4XNFA 3H35A 1WJDA 2KPMA 3F8MA 2GA1A 2HU9A 4GYIA 2DODA 5GADJ 2IJLA 1R5ID 1S5LC 1K4TA 1YW7A 1T39A 2Y48A 4GCVA 4A5NA 3KFWX 5EG0A 1USTA 1BJAA 3BR5A 2FMYA 2MBFA 1Z67A 3DBRB 2ID3A 1S7OA 3K4KA 3C2HA 3V7CA 5HOOA 3GFLA 4B44A 1BN5A 3ZPLA 1S7EA 2ZB9A 2FOKA 2R7RA 5HDKA 4BHCA 4KITB 3FX3A 3KEQA 2FE3A 4LGWA 2IS4A 2PMHA 4R1HA 3ROUA 2FXAA 1WPKA 3QQAA 4FT8A 2HYFA 4PSWA 3LNQA 1OLTA 2P0WA 3K70C 2EINH 4M3GA 2OBPA 2ZC2A 4PJMA 5AIPA 1F9NA 2LSOA 2DCEA 2VB6A 3GEZA 3TKYA 3NRVA 2ZCWA 5ERIA 1XGSA 3HG9A 1A35A 1WZ2A 1HA8A 2CMPA 2VXZA 4IQ4A 3JAMZ 2MABA 1IXCA 5GP9A 3OWTA 2VONA 2ADUA 3OSGA 3DPUA 5EEHA 2PI0A 3PNVA 1IN8A 4JK1X 4M3DA 4XRFA 2HTJA 3E7LA 1YRNB 1RUOA 1PJRA 2E2IJ 4N4NB 4BEHB 3F6OA 3ZR8X 3JRCA 1PP7U 4DYQA 4XLEA 3LSTA 2NRAC 2E1MB 2GAUA 5AONA 2W85A 1QHHD 4EM1A 3SFIA 4ZZDA 2VQHA 3A03A 2EFOA 3G1LA 2M34A 2MGQA 2XB5A 3AFHA 2Y0SA 2JVGA 3ML6A 3O8GA 4PGHA 4JOMA 5K7FA 1ETYA 2CUJA 4BDYA 2EIKH 3VEPA 2XB0X 2BY1A 4U7DA 2PX9A 2HQRA 3CP2A 5DD4A 5BQTA 4Y13A 2P4WA 1RR8C 1OMIA 1JKQC 1FTTA 2LNBA 2LF7A 3TW7A 3I58A 3S2DJ 5LHHA 4XLFA 3TGNA 3P9KA 3MKZA 1I50J 3CO7C 1I5ZA 4R8HA 4S0HB 3DLAA 1TNSA 1VQMI 1G3TA 1FIAA 2UV1A 2L4MA 2DMPA 4XN3A 2UZKA 4YRVA 2L9VA 3KYDB 5TRDA 2K9MA 3DLLF 3LMMA 3SQNA 2O61A 2OV7A 3U9GA 1FYLA 1OCOH 1CF7B 4F3QA 4EJOA 3G3ZA 1UHWA 2XHKA 1OYYA 1OFCX 3TDZC 5CQGA 5E79C 1MNMC 1ETOA 3MMYB 2ZXWH 3FXLA 2D1VA 3HB9A 3RSNA 2FA5A 2KLOA 4BHPA 1IRXA 3WTZA 1WJFA 4QLCU 3HOWJ 3WTUC 3I59A 4E70A 4ENNA 1YI2I 4H4KC 1BI2A 1YW9A 3R0AA 4UY8I 3L00A 2STTA 1MDMA 4A3EJ 1MH3A 4KISA 3GTGJ 3QU6A 4XKWA 4OAYA 1U6GA 2A6HF 5J4YA 3VFZA 1YW8A 4XRSG 2VJ5A 2MD5A 3VWBA 5IPAA 5B3SH 2LLKA 1T33A 2PJRA 3U21A 4BACA 3Q0VA 4OMZA 2UUZA 5DCFA 4HZFA 1V4RA 2A68F 2Y30A 3QOEA 3UKGA 1N25A 1UAAA 1WGXA 1X1PA 2CQ7A 1YOVB 2GWRA 3CMMA 5EZHA 4BKXA 4EM2A 1A04A 1IN7A 1IJWC 4NB5A 3HGYA 1Z7LA 2HS5A 1GUUA 1G8XA 3RKYA 1RC9A 2X48A 5TJJA 5L3DA 2JTVA 2OJED 4I02A 2CW8A 4OIQF 1JGGA 4K2EA 2YUSA 3ASNH 1XC5A 1JUSA 3PSFA 4JBAA 4BE2A 1WSUA 4I2OA 2XGXA 3RPUD 4KMFA 1T98A 2BY0A 3IV5A 1HQCA 1EH6A 4XM3A 3G4SI 1TWGJ 1RRJA 2QEXI 3R61A 3VSKA 1T38A 2NVYJ 2F48A 1OR7C 5H20A 3Q9SA 1Y1VJ 1XG1A 1Y0NA 2XIGA 4QPOA 2WV1A 2CO5A 4XL9A 2JUCA 3H9GA 4RM2A 1K6YA 4RB2C 1BW6A 1H0MA 2E1CA 1ZGWA 2DFEA 4XLCA 1R7JA 4FX0A 2DTZA 5GTHC 3RKXA 1AKHB 4RAGA 4AD9A 2CGPA 3HRSA 2DYRH 4M6VA 1HDDC 2CQKA 2ZNYA 1YRNA 2VOPA 4Q47A 1RNLA 2EZLA 1BI0A 3P9CA 3ZQLA 3Q3SA 4XSZF 3DU5A 4PCQA 5CVJA 4BY1J 1HOMA 4J19A 1MJBA 1R00A 5DCMB 3C1DA 4F55A 5GPAA 2TCTA 4M6YA 4MEYF 3KEOA 1HDPA 2LDUA 1W5CC 3FMRA 1LFBA 3WODF 1ZARA 2QZ8A 3FXUA 2H09A 4OWRB 2Q8KA 3UNGC 4RMNA 4EJVA 1XB4A 3W6JB 2RVCA 4S04A 2CUEA 2DAOA 1REPC 1GVDA 1B9MA 2CYYA 5KAIC 1Z3XA 1R1TA 1UCRA 4BE1A 2D2WA 3OY9A 2LVSA 4MQ9F 1IAWA 5C3EJ 1LDJA 1YHQI 2VN2A 4I6ZA 4XONA 2ZXJA 3HEFA 4DW6A 1TLHB 2RAEA 3QPLA 2ZJQF 1EF4A 3MN2A 5DV5A 2MH9A 2RNGA 3ZCOA 5DEQA 1IN4A 4ZH4F 2LYCA 3HSFA 4HLXA 2QSGX 3HRUA 1HW1A 1KU3A 1G4DA 3GFMA 3PFIA 2PMZN 1ERDA 1UELB 3ULQB 3H0DA 5FFXA 5J8CA 1K83J 1VNDA 1J9IA 5CLSA 3NARA 1TNTA 1OPCA 4F7ZA 1RETA 4W1UA 5KVRA 3R0JA 2NNYA 3F6VA 3S3NA 4M9SA 1I1GA 2XAGA 2IRFG 2NS0A 4WK8F 4UV8A 4II2A 2K3FA 3CCQI 2WV0A
chains in the Genus database with same CATH topology
2HOTA 5E3OA 2ECCA 1MBHA 5M5XJ 2WAQN 3JRFA 2FX0A 3O8HA 4AC0A 4BY7J 1P7JA 3IH3A 3WHCA 1ETXA 3TEDA 5EGOB 2DA6A 3MKLA 2MSYA 2WB1N 1B8IA 3TP0A 4M3FA 2KT0A 1JUPA 3JRHA 4DZJA 2XPUA 5C44J 2ME0A 4DYCA 4A3IJ 4G12A 1Z0XA 3H0GJ 5M5WJ 1JKOC 1HF0A 5FLMJ 1ZQ3P 3FKIJ 2DA2A 1RPWA 5EGOA 2KDZA 2E2JJ 1JJ6C 2LD5A 1ORKA 4CYCB 3SDGA 3CCYA 3OOUA 4XICA 4XRSA 2HXOA 3HM5A 2M8GX 4IHVA 3GTOJ 2G0EA 1ETKA 1FIPA 2DMNA 5EDNA 5FKMA 1MBJA 4A3FJ 2YU9J 1WH7A 2Y9ZA 5IYCJ 5DS9A 4FE4A 2O8KA 1ITYA 1QVUA 1JKRC 1QPIA 5M3MJ 4ABZA 1GT0C 4JYKA 3SJMA 2VKEA 5IP7J 4A3GJ 4A69C 2JN6A 1VFCA 4GFBA 3GBGA 5F0FA 3JRAA 2DA1A 4C3HJ 3QPSA 1H89C 4XK4A 2M9HA 2H8RA 1PUFB 3S17J 4C3IJ 4A3DJ 3JRIA 1ETVA 2NS8A 4DZPA 5E3NA 3FK6A 5FKOA 3BT9A 2XSDC 1JJ8C 2VKVA 3HKZN 3Q0WA 3I4MJ 3M3YJ 4MFDA 5FJ8J 4QSHA 2R93J 5IYDJ 2JJ7A 2ELKA 2CQXA 2DN0A 3FK7A 1APLC 3HOVJ 4D5FA 2L9RA 4RBOA 1I3QJ 3ZQGA 5DTDA 3HOXJ 2OPTA 4B1RA 5C4JJ 2JA8J 1AU7A 1JUMA 2DMUA 3BG3A 2R0QC 9ANTA 3H3VK 2JMWA 5IYBJ 4QTRA 1FEXA 3NAUA 2XGDA 2DA4A 5E3MA 2LP0A 1SANA 4B3AA 4LOCA 3IH2A 2VUMJ 4A3JJ 1X2NA 1DU6A 5GPCA 1W0UA 1IC8A 4A93J 4W97A 3BR1A 1ETQA 1TWHJ 1IV6A 1TWAJ 2ME6A 3CMYA 3M4OJ 1T56A 3OSFA 2HOSA 3D1NI 1POGA 2IAIA 2JA6J 1X2MA 3BR6A 2DA7A 3CQZJ 4FISA 3BR3A 2L0KA 1W0TA 3S1NJ 1MSEC 2Y31A 2QCOA 4M3EA 5K7ZA 4A3BJ 1BW5A 5E3LA 2DMTA 2X6OA 5FKKA 3VPRA 2MW8A 1MH4A 2NVQJ 2E1OA 3FIWA 2GBYA 1TC3C 1Q1VA 3IH4A 1IDZA 3LSRA 1MBKA 1I6HJ 1JTXA 1JTYA 5EG0B 4D5CA 3BQYA 3GTJJ 2GM4A 2L7FP 1IRZA 1QRYA 1UG2A 5EEAA 2E2HJ 1UHSA 3LOCA 3JR9A 1BA5A 3RZOJ 2FJ1A 1ETWA 4X6AJ 2DA3A 1G2HA 2IBDA 2HI3A 3S15J 3OIOA 5EYRA 5M5YJ 4V2FA 5FKNA 3ZQCA 2CJJA 3RQIA 2K9NA 1RKWA 1MBGA 4L5EA 5EG0A 5J1UA 4XIDA 3BR5A 2HQ5A 2DJNA 1ZR2A 3BQZA 2ID3A 2VI6A 1S7EA 2OF7A 2ZB9A 3PO2J 3RZDJ 2XGEA 4JX5A 1WPKA 3QQAA 3LNQA 5J1RA 4M3GA 2O7OA 1O4XA 4CYCA 2XRLA 3FISA 2LY9A 1ZKGA 1B72B 3LSPA 1ZR4A 5IOZA 2MG4A 4Y52J 1D5YA 1IUFA 5IOYA 5GP9A 4BBRJ 3ZQHA 2JK3A 3OSGA 1U9OA 1RESA 3S1QJ 2NOGA 2EH3A 1IG7A 1WCMJ 3B6CA 4JX6A 1FJLA 4M3DA 4FTHA 3E7LA 1YRNB 4AYBN 2L7ZA 3GTKJ 2E2IJ 2Y0SN 3S1RJ 2CUFA 1MSFC 4IHYA 3HOZJ 3JRCA 4DYQA 1R9TJ 1TWFJ 1IGNA 1U9NA 2R5YB 3DCFA 2DMQA 3SFIA 3ZOBA 3C2BA 3A03A 3G1LA 4C3JJ 2CQQA 3JRGA 1Z77A 2M34A 2MGQA 2XB5A 1H8AC 3O8GA 2TRTA 1F36A 5K7FA 1PUFA 2R92J 1ETYA 5JLXA 3GTLJ 2XB0X 3BTCA 2EZKA 4B4CA 1JKQC 2CRGA 3WHBA 1FTTA 2W48A 2R5YA 3S1MJ 2M2EA 3LSJA 3TW7A 4JP0A 2NS7A 1E3OC 3S2DJ 3GTPJ 4HNVA 1I50J 3JREA 4BBSJ 4S0HB 1MBEA 2HOAA 5C4XJ 3JRBA 4JX4A 1FIAA 4UUTA 2NVXJ 2DMPA 1JT6A 1CQTA 2EZHA 4BXXJ 2LFBA 5F0HA 1NK2P 1RKTA 2EZIA 5IP9J 3S14J 4IHXA 3HOYJ 1XS9A 2JWTA 1LE8B 2AHQA 2FD5A 3L1PA 2GLOA 1OFCX 4A3CJ 2XGCA 3BTIA 1MNMC 2B63J 4D7MA 2XPWA 2JA7J 2AO9A 1ETOA 4AUXA 2LTPA 4DYRA 3HB9A 3PM1A 3HOWJ 3G1MA 5HODA 1FTZA 3BR0A 5J3LA 5F27A 1LE8A 3G1OA 5FKLA 1GDTA 4A3EJ 1MH3A 3GTGJ 4A3KJ 4MIMA 2QF7A 4A3MJ 2FQ4A 5K7HA 3DEWA 5BNGA 4M3BA 1UMQA 3F0CA 4IHWA 2R7ZJ 3K7AJ 2L7MP 4XRSG 4A3LJ 1K61A 5IPAA 2LLKA 2ID6A 3JRDA 1T33A 3A01B 2K9QA 3Q0VA 4MO7A 2M0CA 3RKQA 1AHDP 1NK3P 4MLOA 5EZGA 2Y30A 3UKGA 1H88C 3BTJA 1VI0A 3ZQFA 1WGXA 1BJZA 1OCPA 2CU7A 5EZHA 4BKXA 1BL0A 5IP6A 1IJWC 3HGYA 3A02A 1GUUA 1JKPC 3GTQJ 2X48A 3A01A 2D5VA 2NVTJ 2Y2ZA 5F0CA 1JGGA 2N8GA 2YUSA 1WH5A 3BTLA 1MBFA 1XC5A 5FLVA 1JUSA 2K9SA 1A5JA 2HDDA 4MFEA 3IV5A 1TWGJ 1GV5A 3HOUJ 2NVYJ 4D7NA 2EBIA 4I76A 2I10A 2R5ZB 1Y1VJ 1XG1A 2X9DA 1ZTRA 3BG9A 1B72A 2WV1A 3S16J 2P81A 1GV2A 1BW6A 2COBA 5EF6A 2HYJA 1RR7A 1ZGWA 1U78A 1JT0A 3Q0UA 3TP3A 2DTZA 2E19A 1HCRA 1AKHB 3K2AA 4M6VA 3LSGA 1HDDC 4Y7NJ 2R5ZA 2LKXA 1OJLA 4V2GA 1YRNA 5F1JA 2EZLA 4NDLA 1WI3A 3ZQLA 1P7IA 2XPVA 3Q3SA 2YS9A 4BY1J 4FE7A 1HOMA 2DA5A 2HXIA 4FCYA 1ZK8A 4J19A 4XRMA 1AKHA 2IEKA 3HGGA 2Y9YA 4IEJA 5GPAA 2TCTA 3MVPA 2O9LA 1HDPA 3HBLA 1LFBA 1NTCA 1TWCJ 4QIWN 3S2HJ 1DU0A 4RDUA 3B6AA 1VF9A 4UUSB 4X1EA 5F08A 3TW6A 1U8BA 3ZQIA 2CUEA 3W6VA 1GVDA 3BR2A 3I4NJ 2LVSA 5C3EJ 5JLWA 1LFUP 2H1KA 4C2MJ 4I6ZA 3PO3J 4DW6A 3HEFA 1QVTA 2RAEA 3QPLA 3GTMJ 2K40A 3MN2A 1X58A 4UUSA 1EF4A 2LK2A 5M3FJ 4EEFG 1A6IA 1HLVA 1F43A 5J1YA 2LR8A 1ENHA 1Y1WJ 5F04A 2PMZN 3BG5A 2VPRA 1K83J 1VNDA 2EQRA 3NARA 2ECBA 1B8IB 1OCTC 1RETA 4W1UA 3CDLA 2JA5J 3HDDA 1IDYA 1SFOJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HOT A;  5E3O A;  2ECC A;  1MBH A;  5M5X J;  2WAQ N;  3JRF A;  2FX0 A;  3O8H A;  4AC0 A;  4BY7 J;  1P7J A;  3IH3 A;  3WHC A;  1ETX A;  3TED A;  5EGO B;  2DA6 A;  3MKL A;  2MSY A;  2WB1 N;  1B8I A;  3TP0 A;  4M3F A;  2KT0 A;  1JUP A;  3JRH A;  4DZJ A;  2XPU A;  5C44 J;  2ME0 A;  4DYC A;  4A3I J;  4G12 A;  1Z0X A;  3H0G J;  5M5W J;  1JKO C;  1HF0 A;  5FLM J;  1ZQ3 P;  3FKI J;  2DA2 A;  1RPW A;  5EGO A;  2KDZ A;  2E2J J;  1JJ6 C;  2LD5 A;  1ORK A;  4CYC B;  3SDG A;  3CCY A;  3OOU A;  4XIC A;  4XRS A;  2HXO A;  3HM5 A;  2M8G X;  4IHV A;  3GTO J;  2G0E A;  1ETK A;  1FIP A;  2DMN A;  5EDN A;  5FKM A;  1MBJ A;  4A3F J;  2YU9 J;  1WH7 A;  2Y9Z A;  5IYC J;  5DS9 A;  4FE4 A;  2O8K A;  1ITY A;  1QVU A;  1JKR C;  1QPI A;  5M3M J;  4ABZ A;  1GT0 C;  4JYK A;  3SJM A;  2VKE A;  5IP7 J;  4A3G J;  4A69 C;  2JN6 A;  1VFC A;  4GFB A;  3GBG A;  5F0F A;  3JRA A;  2DA1 A;  4C3H J;  3QPS A;  1H89 C;  4XK4 A;  2M9H A;  2H8R A;  1PUF B;  3S17 J;  4C3I J;  4A3D J;  3JRI A;  1ETV A;  2NS8 A;  4DZP A;  5E3N A;  3FK6 A;  5FKO A;  3BT9 A;  2XSD C;  1JJ8 C;  2VKV A;  3HKZ N;  3Q0W A;  3I4M J;  3M3Y J;  4MFD A;  5FJ8 J;  4QSH A;  2R93 J;  5IYD J;  2JJ7 A;  2ELK A;  2CQX A;  2DN0 A;  3FK7 A;  1APL C;  3HOV J;  4D5F A;  2L9R A;  4RBO A;  1I3Q J;  3ZQG A;  5DTD A;  3HOX J;  2OPT A;  4B1R A;  5C4J J;  2JA8 J;  1AU7 A;  1JUM A;  2DMU A;  3BG3 A;  2R0Q C;  9ANT A;  3H3V K;  2JMW A;  5IYB J;  4QTR A;  1FEX A;  3NAU A;  2XGD A;  2DA4 A;  5E3M A;  2LP0 A;  1SAN A;  4B3A A;  4LOC A;  3IH2 A;  2VUM J;  4A3J J;  1X2N A;  1DU6 A;  5GPC A;  1W0U A;  1IC8 A;  4A93 J;  4W97 A;  3BR1 A;  1ETQ A;  1TWH J;  1IV6 A;  1TWA J;  2ME6 A;  3CMY A;  3M4O J;  1T56 A;  3OSF A;  2HOS A;  3D1N I;  1POG A;  2IAI A;  2JA6 J;  1X2M A;  3BR6 A;  2DA7 A;  3CQZ J;  4FIS A;  3BR3 A;  2L0K A;  1W0T A;  3S1N J;  1MSE C;  2Y31 A;  2QCO A;  4M3E A;  5K7Z A;  4A3B J;  1BW5 A;  5E3L A;  2DMT A;  2X6O A;  5FKK A;  3VPR A;  2MW8 A;  1MH4 A;  2NVQ J;  2E1O A;  3FIW A;  2GBY A;  1TC3 C;  1Q1V A;  3IH4 A;  1IDZ A;  3LSR A;  1MBK A;  1I6H J;  1JTX A;  1JTY A;  5EG0 B;  4D5C A;  3BQY A;  3GTJ J;  2GM4 A;  2L7F P;  1IRZ A;  1QRY A;  1UG2 A;  5EEA A;  2E2H J;  1UHS A;  3LOC A;  3JR9 A;  1BA5 A;  3RZO J;  2FJ1 A;  1ETW A;  4X6A J;  2DA3 A;  1G2H A;  2IBD A;  2HI3 A;  3S15 J;  3OIO A;  5EYR A;  5M5Y J;  4V2F A;  5FKN A;  3ZQC A;  2CJJ A;  3RQI A;  2K9N A;  1RKW A;  1MBG A;  4L5E A;  5EG0 A;  5J1U A;  4XID A;  3BR5 A;  2HQ5 A;  2DJN A;  1ZR2 A;  3BQZ A;  2ID3 A;  2VI6 A;  1S7E A;  2OF7 A;  2ZB9 A;  3PO2 J;  3RZD J;  2XGE A;  4JX5 A;  1WPK A;  3QQA A;  3LNQ A;  5J1R A;  4M3G A;  2O7O A;  1O4X A;  4CYC A;  2XRL A;  3FIS A;  2LY9 A;  1ZKG A;  1B72 B;  3LSP A;  1ZR4 A;  5IOZ A;  2MG4 A;  4Y52 J;  1D5Y A;  1IUF A;  5IOY A;  5GP9 A;  4BBR J;  3ZQH A;  2JK3 A;  3OSG A;  1U9O A;  1RES A;  3S1Q J;  2NOG A;  2EH3 A;  1IG7 A;  1WCM J;  3B6C A;  4JX6 A;  1FJL A;  4M3D A;  4FTH A;  3E7L A;  1YRN B;  4AYB N;  2L7Z A;  3GTK J;  2E2I J;  2Y0S N;  3S1R J;  2CUF A;  1MSF C;  4IHY A;  3HOZ J;  3JRC A;  4DYQ A;  1R9T J;  1TWF J;  1IGN A;  1U9N A;  2R5Y B;  3DCF A;  2DMQ A;  3SFI A;  3ZOB A;  3C2B A;  3A03 A;  3G1L A;  4C3J J;  2CQQ A;  3JRG A;  1Z77 A;  2M34 A;  2MGQ A;  2XB5 A;  1H8A C;  3O8G A;  2TRT A;  1F36 A;  5K7F A;  1PUF A;  2R92 J;  1ETY A;  5JLX A;  3GTL J;  2XB0 X;  3BTC A;  2EZK A;  4B4C A;  1JKQ C;  2CRG A;  3WHB A;  1FTT A;  2W48 A;  2R5Y A;  3S1M J;  2M2E A;  3LSJ A;  3TW7 A;  4JP0 A;  2NS7 A;  1E3O C;  3S2D J;  3GTP J;  4HNV A;  1I50 J;  3JRE A;  4BBS J;  4S0H B;  1MBE A;  2HOA A;  5C4X J;  3JRB A;  4JX4 A;  1FIA A;  4UUT A;  2NVX J;  2DMP A;  1JT6 A;  1CQT A;  2EZH A;  4BXX J;  2LFB A;  5F0H A;  1NK2 P;  1RKT A;  2EZI A;  5IP9 J;  3S14 J;  4IHX A;  3HOY J;  1XS9 A;  2JWT A;  1LE8 B;  2AHQ A;  2FD5 A;  3L1P A;  2GLO A;  1OFC X;  4A3C J;  2XGC A;  3BTI A;  1MNM C;  2B63 J;  4D7M A;  2XPW A;  2JA7 J;  2AO9 A;  1ETO A;  4AUX A;  2LTP A;  4DYR A;  3HB9 A;  3PM1 A;  3HOW J;  3G1M A;  5HOD A;  1FTZ A;  3BR0 A;  5J3L A;  5F27 A;  1LE8 A;  3G1O A;  5FKL A;  1GDT A;  4A3E J;  1MH3 A;  3GTG J;  4A3K J;  4MIM A;  2QF7 A;  4A3M J;  2FQ4 A;  5K7H A;  3DEW A;  5BNG A;  4M3B A;  1UMQ A;  3F0C A;  4IHW A;  2R7Z J;  3K7A J;  2L7M P;  4XRS G;  4A3L J;  1K61 A;  5IPA A;  2LLK A;  2ID6 A;  3JRD A;  1T33 A;  3A01 B;  2K9Q A;  3Q0V A;  4MO7 A;  2M0C A;  3RKQ A;  1AHD P;  1NK3 P;  4MLO A;  5EZG A;  2Y30 A;  3UKG A;  1H88 C;  3BTJ A;  1VI0 A;  3ZQF A;  1WGX A;  1BJZ A;  1OCP A;  2CU7 A;  5EZH A;  4BKX A;  1BL0 A;  5IP6 A;  1IJW C;  3HGY A;  3A02 A;  1GUU A;  1JKP C;  3GTQ J;  2X48 A;  3A01 A;  2D5V A;  2NVT J;  2Y2Z A;  5F0C A;  1JGG A;  2N8G A;  2YUS A;  1WH5 A;  3BTL A;  1MBF A;  1XC5 A;  5FLV A;  1JUS A;  2K9S A;  1A5J A;  2HDD A;  4MFE A;  3IV5 A;  1TWG J;  1GV5 A;  3HOU J;  2NVY J;  4D7N A;  2EBI A;  4I76 A;  2I10 A;  2R5Z B;  1Y1V J;  1XG1 A;  2X9D A;  1ZTR A;  3BG9 A;  1B72 A;  2WV1 A;  3S16 J;  2P81 A;  1GV2 A;  1BW6 A;  2COB A;  5EF6 A;  2HYJ A;  1RR7 A;  1ZGW A;  1U78 A;  1JT0 A;  3Q0U A;  3TP3 A;  2DTZ A;  2E19 A;  1HCR A;  1AKH B;  3K2A A;  4M6V A;  3LSG A;  1HDD C;  4Y7N J;  2R5Z A;  2LKX A;  1OJL A;  4V2G A;  1YRN A;  5F1J A;  2EZL A;  4NDL A;  1WI3 A;  3ZQL A;  1P7I A;  2XPV A;  3Q3S A;  2YS9 A;  4BY1 J;  4FE7 A;  1HOM A;  2DA5 A;  2HXI A;  4FCY A;  1ZK8 A;  4J19 A;  4XRM A;  1AKH A;  2IEK A;  3HGG A;  2Y9Y A;  4IEJ A;  5GPA A;  2TCT A;  3MVP A;  2O9L A;  1HDP A;  3HBL A;  1LFB A;  1NTC A;  1TWC J;  4QIW N;  3S2H J;  1DU0 A;  4RDU A;  3B6A A;  1VF9 A;  4UUS B;  4X1E A;  5F08 A;  3TW6 A;  1U8B A;  3ZQI A;  2CUE A;  3W6V A;  1GVD A;  3BR2 A;  3I4N J;  2LVS A;  5C3E J;  5JLW A;  1LFU P;  2H1K A;  4C2M J;  4I6Z A;  3PO3 J;  4DW6 A;  3HEF A;  1QVT A;  2RAE A;  3QPL A;  3GTM J;  2K40 A;  3MN2 A;  1X58 A;  4UUS A;  1EF4 A;  2LK2 A;  5M3F J;  4EEF G;  1A6I A;  1HLV A;  1F43 A;  5J1Y A;  2LR8 A;  1ENH A;  1Y1W J;  5F04 A;  2PMZ N;  3BG5 A;  2VPR A;  1K83 J;  1VND A;  2EQR A;  3NAR A;  2ECB A;  1B8I B;  1OCT C;  1RET A;  4W1U A;  3CDL A;  2JA5 J;  3HDD A;  1IDY A;  1SFO J; 
#chains in the Genus database with same CATH topology
 2L5Q A;  4O6J A;  1MBH A;  5F1R A;  4E7S A;  3B02 A;  2FX0 A;  3O8H A;  3TED A;  1R22 A;  1BI3 A;  4S05 A;  3H1C A;  1X1D A;  4HV5 A;  2H6B A;  2WB1 N;  1B8I A;  3OYK A;  4CO8 A;  3L2V A;  2O03 A;  5B1A H;  1W7P A;  5ICC A;  5C44 J;  2ME0 A;  1C0W A;  2CS3 A;  3O3K A;  4KIC A;  3S32 A;  1KON A;  4F92 B;  3I71 A;  1UB9 A;  2KKO A;  3E0J B;  1FLI A;  1MJA A;  1RPW A;  1TBX A;  2D1H A;  3H5N A;  3K2Z A;  4F93 B;  3AG1 H;  3IWF A;  2HYG D;  3LQR A;  3OYH A;  3SDG A;  4IOA F;  4L0Z B;  2DK5 A;  2KZG A;  1V5E A;  2M8G X;  3O6B B;  5L3B A;  3AAF A;  5BPI A;  4IO9 F;  1MNE A;  3Q9V A;  5EDN A;  2KDO A;  1FWZ A;  3F9K A;  3NWS A;  2YU9 J;  4ZDO A;  4J00 A;  1SD7 A;  4IRI A;  4IPA A;  1QVU A;  1JKR C;  1W36 D;  2W82 A;  3CJT B;  3SJM A;  3OIP A;  5DUK A;  4A3G J;  1ZRF A;  1LDD A;  1R1U A;  4YG2 F;  2QM3 A;  3OL3 A;  1O57 A;  2BXY A;  5DDG A;  3BWG A;  2OQR A;  3CD6 I;  3JRA A;  1HW5 A;  5E17 F;  2DW4 A;  4AVZ A;  1R6R A;  5LRR A;  4C3I J;  2M7A A;  1XTA A;  1FC3 A;  4HSR A;  1MMN A;  2STW A;  2NS8 A;  2PFB A;  1Y8Q B;  3FK6 A;  1EJ9 A;  1VQ7 I;  1JJ8 C;  2VKV A;  2KIS A;  3HKZ N;  3I4M J;  3M3Y J;  4MTD A;  1FBQ A;  1P2F A;  5IYD J;  4AVP A;  3FK7 A;  1APL C;  1VQ5 I;  3HOV J;  4D5F A;  1BR2 A;  3BG6 A;  4N0B A;  1IUY A;  3ZQG A;  5DTD A;  2QKM B;  4L5I A;  4HDV A;  1XDU A;  1D8J A;  2DT5 A;  2DMU A;  4Y4R A;  4BXF A;  5CVI A;  3DKW A;  2R0Q C;  3ASO H;  1QZZ A;  1XPX A;  1Y39 A;  2JMW A;  1FEX A;  3NAU A;  2XGD A;  2DDB A;  1BC8 C;  2QBY B;  3QYB A;  5E3M A;  2LP0 A;  3CMA I;  1Z6R A;  4BU2 A;  3TL4 X;  3IH2 A;  1LJ9 A;  1X1A A;  2WWY A;  4BQA A;  2DK8 A;  3G71 I;  1ETQ A;  1WVR A;  4YII A;  1IV6 A;  2EFQ A;  2GXG A;  3WG9 A;  2A5Y B;  2JZY A;  4BUP A;  2BE5 F;  4HF0 A;  1Z7U A;  2VL8 A;  2HOS A;  3LSM A;  2X1C A;  1OKR A;  1D1B A;  3BY6 A;  2IAI A;  3W6K B;  1X2M A;  3PUF A;  3R60 A;  1EV7 A;  4YIR X;  3EUH A;  2A6T A;  4PJJ A;  1EA3 A;  2HTS A;  2QCO A;  4M3E A;  3IAS 2;  1F4K A;  2KP6 A;  1FOW A;  3V7S A;  3VPR A;  3RCO A;  3QYF A;  2NAZ A;  3JCU C;  4CXF A;  4ON0 A;  1O3R A;  4M71 A;  2BXZ A;  2E1O A;  2GBY A;  3CF2 A;  4ZYG A;  4HAM A;  4BQN A;  5D5X B;  1Y0U A;  2LY1 A;  2KJB A;  3FHZ A;  2EFW A;  5EG0 B;  4D5C A;  3BQY A;  3I0T A;  3IRR A;  4P9U A;  2E1M C;  2LH9 A;  1VQO I;  2VIX A;  4D0P A;  2EA2 A;  3CC4 I;  1BA5 A;  3RZO J;  2FJ1 A;  3WU0 A;  3SDB A;  1G2H A;  2IBD A;  2HI3 A;  3E97 A;  3OIO A;  5H6Q A;  4A6D A;  1KU7 A;  3ZQC A;  2M4K A;  1I3A A;  1RKW A;  1TT5 B;  4PZJ A;  3MWM A;  3ABM H;  4KDP A;  4PJL A;  2VC1 A;  3BCB A;  3SEQ A;  2EWN A;  2QQ8 A;  1P4A A;  1SMY F;  3OYA A;  2VI6 A;  4M9Z A;  3EYI A;  4G7O F;  2Y69 H;  1VTN C;  3M1E A;  4JX5 A;  2JVH A;  4Q4Z F;  3F8C A;  2GIZ A;  2OZ6 A;  3FM3 A;  1P4W A;  2Z2S B;  1D3Y A;  1J7K A;  1U5T A;  2B7E A;  2DQL A;  3I54 A;  3SYT A;  2XRL A;  3GLL A;  4BJT A;  1J2X A;  2LY9 A;  4LIT A;  2V4J C;  1B72 B;  1F1Z A;  4HEA 2;  3RPU A;  5GAE J;  1RIO H;  2MG4 A;  1IRF A;  4KIF A;  3K4N A;  1IUF A;  5IOY A;  5F6F A;  4HNU A;  2OCC H;  2JK3 A;  1U9O A;  1RES A;  3S1Q J;  2NOG A;  2EH3 A;  4G6T B;  3BPV A;  1Z1D A;  1FJL A;  1ZGJ A;  1D1A A;  2EV0 A;  2L7Z A;  2ACJ A;  4Q5S F;  3S1R J;  2JRM A;  2CUF A;  2FNA A;  2HGC A;  4IHY A;  1XDS A;  4RB0 A;  1R9T J;  1TWF J;  3DCF A;  2DMQ A;  3H3Z A;  1R4M B;  2MLK A;  1SAU A;  2IS6 A;  3FBI B;  3JRG A;  3HUG A;  2TRT A;  3DWL E;  3D0S A;  2R92 J;  5JLX A;  3L7W A;  4JQF A;  4OIR F;  2M1B A;  2EZK A;  4B4C A;  2R5Y A;  3S1M J;  3LSJ A;  2NNN A;  3VSL A;  3SXY A;  3J80 K;  4MQV A;  4E6K G;  2A61 A;  1P6R A;  3ABL H;  4YFK F;  4HNV A;  3GTP J;  2QSH X;  4E7H A;  2HOA A;  2VC0 A;  4JX4 A;  2GZW A;  4LIU A;  3L2U A;  1MW7 A;  2NVU B;  1JT6 A;  4BXX J;  2EZH A;  2CFX A;  1Z3Y A;  5F0H A;  1YTY A;  1RKT A;  2BOL A;  2RKH A;  2HKX A;  3AKZ A;  1R5H A;  1K6O A;  2F5D A;  4KA4 A;  3I59 B;  1XCV A;  3G73 A;  2E5Z A;  2JWT A;  3L1P A;  3HRT A;  1MDM B;  2XGC A;  3OS2 A;  2XPW A;  2LC2 A;  5IY5 H;  3JSO A;  3L2C A;  3FHN A;  4AUX A;  2LTP A;  4DYR A;  1SAX A;  2OD5 A;  1LEB A;  1FBS A;  3PM1 A;  2VBW A;  1ACI A;  1P92 A;  5HOD A;  2VLA A;  5JFR A;  2W4S A;  2NOJ B;  5J3L A;  5F27 A;  1LE8 A;  1NG6 A;  3OYJ A;  2PJR B;  2OA4 A;  5HNF A;  2K02 A;  1IXR C;  1W7P D;  3DEW A;  2J5O A;  3CJR B;  4CGZ A;  2FQ3 A;  4CZZ A;  1UMQ A;  3F0C A;  2HVR A;  4A3L J;  1IV8 A;  4E7I A;  2VE9 A;  2UXX A;  3K10 A;  4HF1 A;  2BW3 A;  5CVR A;  4ESB A;  1DP7 P;  2L02 A;  2VJJ A;  4MO7 A;  2CFO A;  3SFZ A;  3RKQ A;  2EIM H;  3JTG A;  1AHD P;  4MLO A;  1MMA A;  3OMY A;  2FBI A;  3BTJ A;  1OYW A;  3ZQF A;  4I7H A;  3I64 A;  5A2Q K;  3MKY B;  2IS1 A;  2CU7 A;  2WAE A;  3GFJ A;  1T8I A;  2VOD A;  2YR2 A;  3A02 A;  2R7V A;  3MCZ A;  1SD6 A;  3J7Y J;  2ZJ2 A;  4E7Z A;  1STZ A;  3F8N A;  4LLL A;  1KZH A;  3BZK A;  5JVG F;  1BBY A;  3DP7 A;  4CIC A;  5FLV A;  1R58 A;  2FOW A;  5ICE A;  1A5J A;  4GYG A;  3ABU A;  2H6C A;  3ONQ A;  4L9N A;  5JVT A;  1HST A;  2A5W A;  4ZYD A;  2YU3 A;  3H92 A;  5L3C A;  4EQQ A;  4IRH A;  1XSV A;  1KQ0 A;  3REO A;  4ZDL A;  1BIB A;  3L2R A;  4D7N A;  1NG7 A;  2I10 A;  2KIQ A;  1EKE A;  4HX8 A;  3OR1 C;  1ZTR A;  1B72 A;  1DP3 A;  4EVI A;  3MZY A;  2HPI A;  1GV2 A;  3LWF A;  1D5V A;  1RR7 A;  2LG4 A;  2P6S A;  1JT0 A;  3HSE A;  2D45 A;  1B6A A;  2O6G E;  3ZMT A;  1QBJ A;  1LB2 A;  3GZ5 A;  2YX7 A;  3LSG A;  4B48 A;  1OJL A;  5KAF C;  3I9V 2;  2KRC A;  4NDL A;  1R36 A;  1WI3 A;  2C6Y A;  1ZYR F;  3H5R A;  2FEZ A;  5FRO A;  2BHZ A;  2X6X A;  2YS9 A;  1H9G A;  1QHG A;  2JSP A;  3E5Q A;  2YSR A;  6PAX A;  1VQ6 I;  4FE7 A;  2RC4 A;  2GXA A;  2HXI A;  4FCY A;  1YIT I;  2W57 A;  2K27 A;  3BP8 A;  3BPX A;  4ETS A;  4X0G A;  3HGG A;  4AWX B;  3JAM K;  1ZHF A;  3C2G A;  2RQQ A;  1V55 H;  3HBL A;  1Y8R B;  3VOD A;  5DYM A;  3KE2 A;  1NTC A;  3EDP A;  1TWC J;  5B1B H;  1YS6 A;  1LUJ B;  4UB8 C;  3RPQ A;  3B6A A;  3N97 A;  2R4G A;  1LVA A;  3QU3 A;  5CQE A;  3BR2 A;  4PJN A;  5J8F A;  2QQB A;  5DUI A;  3I4N J;  4XKC A;  4KT6 A;  3ZRG A;  2KIM A;  2DDA A;  2H1K A;  5JLW A;  2OUM A;  2VXD A;  1LFU P;  4XLN F;  3DKX A;  3K70 D;  3PO3 J;  2QA4 I;  1K78 A;  2Z9O A;  3GVA A;  1QVT A;  1DUX C;  1A6Q A;  1V54 H;  4RAF A;  4UUS A;  1ZG5 A;  1WJB A;  3C18 A;  4EEF G;  3LAP A;  3F23 A;  4CYD A;  4ITV A;  1T0F A;  4EAT A;  5F04 A;  4KUM A;  2BY3 A;  1NHA A;  1MMS A;  3VYU B;  3SZP A;  2VPR A;  1DQU A;  3TO9 A;  2EQR A;  4XOT A;  5HVQ C;  1B8I B;  2FSW A;  3CCR I;  2A69 F;  1QZY A;  3GYH X;  3KP7 A;  4G9Y A;  1W7P B;  2PMZ A;  1G59 A;  2VQC A;  2HOT A;  4PSX A;  5E3O A;  5M5X J;  3JRF A;  2V6C A;  2PG4 A;  2WY8 Q;  4U0W A;  2E7W A;  4LG0 A;  4BY7 J;  1P7J A;  1BOA A;  1HW2 A;  4IF4 A;  3L2W A;  2FUG 2;  1QO0 D;  1Z05 A;  4DIQ A;  4CZC A;  3TP0 A;  3H3U A;  2KT0 A;  3ERE D;  4ESF A;  3GUD A;  3CUQ A;  4ZZL A;  4DYC A;  4CH7 A;  4G94 A;  3DPT A;  1HF0 A;  3F72 A;  2HVS A;  3AL0 B;  3RI4 A;  2WB1 A;  3FKI J;  2PLY A;  5CVV A;  5EGO A;  4OU0 A;  4AM3 A;  3RKW A;  1BI1 A;  2E2J J;  1JJ6 C;  2XV4 S;  2G9W A;  3FWE A;  4WF2 A;  5K5O A;  1ORK A;  3CCM I;  4CA0 A;  3OOU A;  4U0V A;  3HM5 A;  3KZY A;  4WX9 A;  3OS1 A;  2X4H A;  1Z9C A;  1JHH A;  2X1E A;  3HC7 A;  1D8K A;  2G0E A;  3VB2 A;  2VQL A;  5KHD A;  1E3P A;  4P96 A;  4DNC A;  4D9J A;  4ZTF A;  2DMN A;  4A3F J;  3VYR B;  3E1S A;  2F4O B;  1WH7 A;  2Y9Z A;  2O8K A;  5DS9 A;  4FE4 A;  4B8X A;  1E2X A;  2O0Y A;  3OYC A;  2OTL I;  1GT0 C;  1OIS A;  2HKO A;  4JYK A;  4WWC A;  4UB6 C;  3F21 A;  4LB6 B;  1MZB A;  1YJN I;  2JN6 A;  2MD0 A;  3GBG A;  2LOO A;  3GO5 A;  4NQW B;  1VQL I;  2P7V B;  3SZT A;  1JE8 A;  4WXH A;  2XAH A;  1WJ5 A;  3OIQ A;  2CV1 A;  2OC6 A;  3HOT A;  2QEN A;  2XKO A;  4DBR A;  4XK4 A;  3GX4 X;  3S17 J;  4A3D J;  3FMS A;  2BV6 A;  1YX3 A;  1P4X A;  1USS A;  1QQI A;  2BBY A;  4DZP A;  2W84 A;  4YFN F;  2XRN A;  3ZQ7 A;  5E3N A;  5FKO A;  1UZC A;  3BT9 A;  5GTI C;  1U3E M;  1FYK A;  4LIV A;  1W5S A;  4LG3 A;  4QSH A;  1K79 A;  5K5R A;  1WFX A;  3I3L A;  5HS9 A;  2JJ7 A;  2CW7 A;  3ZGK A;  5JR3 A;  5LEK A;  5FLX Z;  2Y75 A;  2M87 A;  2V7F A;  2CQX A;  4A0Z A;  1AA7 A;  4KN4 X;  4RBO A;  1I3Q J;  3CES A;  3J81 Z;  4RGU A;  3HOX J;  3DTI A;  2X6W A;  3HKZ A;  4CCJ A;  4OOI A;  2DTR A;  1FOY A;  1T6S A;  1ZGA A;  4U88 A;  9ANT A;  3L09 A;  2EB7 A;  3LAJ A;  3QPT A;  5IYB J;  1LQ1 A;  1GVJ A;  5B66 C;  2EJR A;  3PJR A;  2KFD A;  3KIO A;  1O3T A;  2RDP A;  2BYV E;  3BG7 A;  3K9T A;  2LBF B;  3E6M A;  4A3J J;  4MEX F;  1B59 A;  1DU6 A;  5K1Y A;  1IC8 A;  4HW0 A;  4A93 J;  2ZME A;  1JXS A;  1D0X A;  4FET A;  4I0A A;  3BR1 A;  3FXR A;  3LSK A;  4EJU A;  2VPL A;  2WAF A;  2ZO4 A;  1TWA J;  4CCK A;  1ZG1 A;  2ME6 A;  3C3W A;  1POG A;  1W36 C;  1MMG A;  2DA7 A;  4M73 A;  3CQZ J;  1W0T A;  2HR3 A;  3BR3 A;  3KP4 A;  2BHY A;  1MSE C;  2Y31 A;  5K7Z A;  3V8J A;  4A3B J;  5CKT A;  4BGD A;  5L3F A;  2DMT A;  2BVL A;  3M1C A;  3RDI A;  1YE9 A;  1MH4 A;  5IT9 Z;  2DI3 A;  2M4G A;  1VQK I;  1W4M A;  3BDD A;  4HPQ A;  1PUE E;  2VKH A;  1IDZ A;  2BY2 A;  5E18 F;  2LRE A;  1JTX A;  1TQP A;  4P9F A;  1XGN A;  3IKT A;  2QLZ A;  5EEA A;  3FXM A;  4KN7 X;  2CQN A;  2DFH A;  1UHS A;  2DO7 A;  3LOC A;  5LRS A;  2W25 A;  1T2K A;  4I98 B;  1LEA A;  3DPL C;  4IL6 C;  3WGI A;  1WJA A;  1EH7 A;  1ZRD A;  5L3E A;  3W2A A;  3RTR A;  2F2E A;  4GGG A;  5EYR A;  3V42 A;  4RAY A;  3VOE A;  5CVU A;  5M5Y J;  4ENK A;  2HPM A;  3WU1 B;  3RQI A;  2K9N A;  4HOB A;  5KCM A;  5D8K B;  1K4S A;  1MBG A;  4WCG A;  5J1U A;  5D6E A;  4DQ2 A;  4XID A;  1U5T B;  2DJN A;  4IHT A;  3JW4 A;  2DT7 B;  2GA2 A;  3G2B A;  4XOP A;  1FP2 A;  3RZD J;  3MZ8 A;  3A2K A;  1E17 A;  2ELJ A;  5B5E C;  2MYS A;  4IZZ A;  2FRH A;  1K7A A;  1S72 I;  4BQO A;  2O7O A;  1O4X A;  1AWC A;  3DV8 A;  5FRN A;  2NYX A;  5DD8 A;  4G7Z F;  3KYC B;  3I5U A;  2VJ4 A;  4CCL A;  2PJP A;  3EPZ A;  3HYI A;  4HNT A;  4Y52 J;  2B0L A;  4C9Y A;  1D5Y A;  5HLH A;  3TO6 A;  1G3W A;  3IAM 2;  2IA2 A;  2F5E A;  4BBR J;  1TQM A;  3A1Y A;  4PJ0 C;  3HTU A;  3S2W A;  5ILV A;  3WG7 H;  3HUG B;  1IG7 A;  3B6C A;  1XMA A;  4BNC A;  4AYB N;  3PL8 A;  3QOP A;  3BOQ A;  4I01 A;  3HHH A;  3DBL B;  4UVA A;  3K1M A;  2R5Y B;  4NQW A;  3C2B A;  2ISY A;  4LK0 F;  3S3O A;  2LMD A;  1MND A;  2AXT C;  3ZMV A;  4C3J J;  4CSW A;  1N77 A;  4XKV A;  1F36 A;  2RGV A;  3T8R A;  2KRF A;  3J7Z I;  2J5P A;  3GTL J;  2XAU A;  3FDY A;  2MA3 A;  3F8F A;  3BTC A;  3LQQ A;  3VDX A;  2L4A A;  3WHB A;  3IRQ A;  2LF8 A;  3JTH A;  4RM3 A;  4IHS A;  2M2E A;  5D5V B;  3WE3 A;  4JP0 A;  4RS8 A;  2CWE A;  4XBF A;  1KGS A;  2RN7 A;  4P5O A;  3GZ6 A;  1I27 A;  1OCC H;  2IVM A;  1MBE A;  2CH0 A;  4BBS J;  1OYI A;  1HKT A;  4ENM A;  1HKS A;  2OCE A;  2JA2 A;  4UUT A;  1SD4 A;  2NVX J;  2P8T A;  3S93 A;  1CQT A;  3KEY A;  5J4V A;  2UXN A;  1NK2 P;  4BXU A;  4CCN A;  2EZI A;  3IHU A;  5IP9 J;  1FYM A;  2M5W A;  4IHX A;  3HOY J;  3CF5 F;  1LNW A;  2XDV A;  3MQ0 A;  4EJT A;  2LBF A;  3ECH A;  2L54 A;  3ZMU A;  2HZT A;  1LE8 B;  2HDC A;  5ILU A;  1YJW I;  1IW7 F;  5HLG A;  3T0Y A;  3LA3 A;  2B63 J;  1VQP I;  3P7N A;  4D7M A;  4A2U A;  2AO9 A;  2V1U A;  5HNH A;  2JRT A;  3AG3 H;  3GF2 A;  1J09 A;  3CZ6 A;  4PUS A;  3S8P A;  1BM9 A;  5LFA A;  3KP5 A;  2OAZ A;  2QYO A;  3G1M A;  2IS2 A;  1LDK B;  3CCJ I;  1FTZ A;  3K4L A;  3TQN A;  2Z33 A;  5CJ9 A;  3BR0 A;  4YFX F;  4CHU A;  1XSX A;  2BW3 B;  5TIS C;  1Z91 A;  5FKL A;  2MFZ A;  2PMU A;  3FM5 A;  1GDT A;  4ASN A;  2R7Q A;  4A3K J;  4HRI A;  3MEX A;  2XF7 A;  4A3M J;  5CYV A;  3DF8 A;  3K1P A;  3CLO A;  5BNG A;  4A0Y A;  4M3B A;  5E1W A;  3DFG A;  4IHW A;  2R7Z J;  3K7A J;  2L7M P;  3MZH A;  1K61 A;  2E7X A;  4O5V A;  4Y33 A;  3NEU A;  4C2T A;  2AXL A;  3MFK A;  3LL7 A;  2IA0 A;  4KMU X;  3PIO F;  3OYM A;  3CDH A;  5EJC A;  1SFE A;  1ONV A;  3SZG A;  5ICG A;  2K9Q A;  3QP5 A;  1R71 A;  3CCU I;  4ANJ A;  2M0C A;  5BOX A;  1WJC A;  2JSC A;  3BZC A;  1H88 C;  4G8X A;  1VI0 A;  3M8J A;  4XQF A;  2E1N A;  3OS0 A;  2MLG A;  1TP4 A;  3LA2 A;  1V3F A;  4NHJ A;  4CCO A;  1JKP C;  3FBN B;  3OL4 A;  3PSI A;  2I8D A;  1BOB A;  3A01 A;  2D5V A;  3DXJ F;  2NVT J;  3PIP F;  2Y2Z A;  4TV7 A;  4GO1 A;  2V26 A;  4Y17 A;  1MBF A;  5ED4 A;  4XOR A;  2JQ7 A;  1DPU A;  4RGS A;  2XAS A;  2RNJ A;  1LPQ A;  4MFE A;  3WTY C;  2L3D A;  1GV5 A;  3RIR A;  1ZH5 A;  2K85 A;  2V1N A;  3EQL F;  3F22 A;  2KIF A;  4DJA A;  2EBI A;  3IWZ A;  2X9D A;  1PVE A;  3CCV I;  1CGP A;  2HZD A;  3WTS C;  1OQY A;  3HL2 A;  2DPD A;  2IA1 A;  2L01 A;  2KQR A;  5BPD A;  3ZN1 A;  3BZ6 A;  1QGP A;  1Z6T A;  3WU2 C;  3K4M A;  5EF6 A;  1U78 A;  2HYJ A;  3Q0U A;  1X3U A;  2E19 A;  3DEU A;  3QOD A;  1HCR A;  3QAH A;  4Z2Y A;  4DGW B;  2R5Z A;  4ZTJ A;  2FBH A;  2ZXH A;  1X1C A;  2DYS H;  2VBY A;  3HRM A;  1D1C A;  5F1J A;  4HLY A;  2VJI A;  3OR2 C;  2XPV A;  1SFO J;  2IT0 A;  3AG2 H;  2P7C B;  1ZK8 A;  4BDZ A;  1TZL A;  4PFP A;  4XSX F;  2IW5 A;  3W3C A;  2IEK A;  2Y9Y A;  1KYZ A;  3AG4 H;  2DLL A;  3KP3 A;  1R49 A;  2BEO A;  2O9L A;  1S3J A;  4PK4 A;  4L9T A;  4MHG A;  1ZG3 A;  2HNH A;  4QIW N;  1K78 B;  1SVL A;  1SFK A;  4MNU A;  1SEU A;  1VF9 A;  4U0Y A;  4UUS B;  5F08 A;  1E3H A;  4XLH A;  1VZ0 A;  1JHF A;  1PP8 F;  4UV9 A;  1A31 A;  2ZXI A;  3COA C;  3I55 I;  2CW0 F;  3H36 A;  2DBB A;  2QUF A;  5J6X A;  4HV6 A;  2HOE A;  1MGT A;  2VAS A;  2QVO A;  2VKD A;  5J40 A;  2ZJP F;  2IXS A;  3RYR A;  1YIJ I;  3GTM J;  2K40 A;  2YPR A;  2DOF A;  2LK2 A;  5M3F J;  4XMY A;  1A6I A;  3B73 A;  4EMS A;  2K5C A;  5BS6 A;  4BQQ A;  5LLQ A;  2GOM A;  2M3A A;  1F43 A;  4O3M A;  1GXP A;  2LKS A;  1ENH A;  4AID A;  3WTX C;  1KYW A;  4LG0 B;  2Y0M A;  1SD5 A;  1U0J A;  3WTT C;  2Z5U A;  3CCS I;  2QSF X;  3DBH B;  5KK1 A;  3ZP5 A;  1QU3 A;  4IXA A;  5F64 A;  2ECB A;  1OCT C;  1OR7 A;  1SC7 A;  3CDL A;  3L2Q A;  2JA5 J;  3HDD A;  1Y56 A;  2EK5 A;  1IDY A;  5L3G A;  3E5X A;  1BR1 A;  3CUQ B;  1DGW Y;  1GXQ A;  5IT3 A;  1G3Y A;  3NQO A;  3OYF A;  2WAQ N;  3K1N A;  4ZJZ A;  4BHB A;  3FKJ A;  3WHC A;  5EGO B;  4AIK A;  3H9Q A;  2Z16 A;  3A0H C;  4HYE A;  2XSJ C;  1J75 A;  2FNP A;  1T95 A;  3SHF A;  3JRH A;  3DEE A;  1T08 B;  4PFO A;  2XPU A;  1UG0 A;  2DOE A;  3M07 A;  4ZYH A;  3X2Q H;  2R7X A;  4G7H F;  3N05 A;  2EIJ H;  3ZMS A;  2VT3 A;  4A3I J;  1Z0X A;  3ECO A;  1WJE A;  1TL8 A;  4E7K A;  3H0G J;  3LFU A;  5M5W J;  4H0E A;  1FBU A;  5FLM J;  1ZQ3 P;  1TW3 A;  1VQ8 I;  1WWX A;  3ZMZ A;  2KDZ A;  5JHF A;  3BLY A;  1D0Y A;  2IPQ X;  4BJ5 C;  1S6L A;  2MH2 A;  4CYC B;  2F6C A;  1YIO A;  1XGM A;  2DXI A;  4XIC A;  2F4M B;  4L0Y B;  1J59 A;  2Z3Y A;  2HXO A;  2V1D A;  3W2W A;  3F8B A;  4OIO F;  4RA2 A;  3T1B A;  3EUH C;  1ETK A;  2L9N A;  1ZRE A;  1F5T A;  2FU4 A;  1FMV A;  1MD0 A;  2QQA A;  4G6D A;  3EYY A;  5IYC J;  5LD2 C;  2F4I A;  2HFH A;  2PN6 A;  4HQM A;  1QPI A;  4XR6 A;  3KP2 A;  3V7R A;  2COM A;  3LSH A;  1HSJ A;  1LVK A;  5IP7 J;  4U87 A;  4U7B A;  4G6Q A;  2M30 A;  5GAH J;  5F0F A;  2ZFU A;  3VYT B;  2GXB A;  2CV2 A;  3FXJ A;  2K7L A;  2I5U A;  3GWZ A;  3HJE A;  4NBQ A;  4LB5 A;  2DA1 A;  3QPS A;  4HX7 A;  2H8W A;  4OIN F;  1PUF B;  1LFP A;  2BGC A;  1ETV A;  3ABT A;  4UHT A;  3GCM A;  1O3S A;  3Q0W A;  3WGH A;  2R93 J;  4Z6Y A;  1R23 A;  4IOC F;  2ELK A;  4QWQ A;  2KZV A;  3EUA A;  3M7G A;  1B1B A;  5TGT A;  1YX5 A;  4XN0 A;  4Q48 A;  3TMO A;  5C4J J;  2JA8 J;  1G3S A;  2ZME B;  1OCZ H;  3H9J A;  1I39 A;  1WI9 A;  1JUM A;  3CCL I;  3BG3 A;  1MMD A;  3O2P E;  1U5T C;  5D4S A;  1S9H A;  1H9T A;  2KJC A;  3PQK A;  4B3A A;  2VUM J;  2AS5 F;  2DT6 A;  1JGS A;  5GPC A;  2R7F A;  2OU2 A;  1W0U A;  1JI8 A;  3HPG A;  1ZRC A;  5LEJ A;  1TWH J;  1UFM A;  2KMU A;  3CMY A;  1VQ9 I;  1T56 A;  3KX2 A;  3WTV C;  3PNY A;  3OSF A;  4A12 A;  3D1N I;  2TDX A;  2JA6 J;  2P6T A;  3CCE I;  4FHT A;  4KIG A;  3E6B A;  3S1N J;  2X51 A;  1W5T A;  2HVQ A;  5LGT A;  4AIJ A;  1X4P A;  2X6O A;  1WQ2 A;  2R7W A;  2LRD A;  4IJA A;  3RQ4 A;  3R4K A;  4CCM A;  1TC3 C;  3QPH A;  1IN5 A;  2VBX A;  1RI7 A;  2B9S A;  4M9X A;  2JT1 A;  2ZSH B;  1JTY A;  3GZN B;  3BCA A;  4IX7 A;  2DOA A;  4NC6 A;  1ODD A;  5CPR B;  1X3Z B;  1IRG A;  2GM4 A;  1IRZ A;  2E34 A;  1QRY A;  4BAY A;  3RJP A;  2E2H J;  2E5N A;  4IKF A;  3C7J A;  2EIL H;  2ZBK A;  4II3 A;  3HZJ A;  4X6A J;  2GIV A;  5FD5 A;  1U2W A;  2DA3 A;  2P5V A;  5JI6 A;  2Q2E A;  3GME A;  4MTE A;  4LFU A;  3PQJ A;  4EGZ A;  4V2F A;  5FKN A;  4BE0 A;  2CJJ A;  4IRG A;  3D5S C;  3OYI A;  5E8G A;  2R7U A;  1R1V A;  4F52 A;  4L5E A;  4YEJ A;  2VE8 A;  2AQF A;  3TOA A;  2HQ5 A;  1ZR2 A;  2E71 A;  3CC7 I;  3BQZ A;  3S15 J;  1MIJ A;  4RLF A;  2OF7 A;  3PO2 J;  1BR4 A;  1FMW A;  3G6E I;  4BH9 A;  2XGE A;  1HKQ A;  1BC7 C;  1OCR H;  2WA0 A;  4WXD A;  2KHM A;  4KJZ A;  5J1R A;  2FF4 A;  2W24 A;  2W1O A;  4CYC A;  2JPC A;  5E8I A;  1G6N A;  3FIS A;  1ZKG A;  1TT0 A;  3OYL A;  3LSP A;  4PDK A;  1YFH A;  1ZR4 A;  5IOZ A;  3FXO A;  4L9J A;  3KET A;  3ZQH A;  1EH8 A;  1WCM J;  3W2V A;  4JX6 A;  2V79 A;  5LHI A;  4J01 A;  2R7S A;  5FFZ A;  3TO7 A;  2QWW A;  2P5K A;  4UVB A;  4FTH A;  4M72 A;  3GTK J;  3E6D A;  2WC2 A;  2Y0S N;  4DOZ A;  2HQN A;  2EV5 A;  1DGR M;  2O5R A;  1MSF C;  3HOZ J;  2G7U A;  4E7L A;  1VQ4 I;  1YYV A;  1IGN A;  1U9N A;  1S8N A;  3ZOB A;  1HXD A;  1KU2 A;  4L18 B;  3OYB A;  2A05 A;  1FOX A;  3IKV A;  2CQQ A;  3BJO A;  4AYB A;  1Z77 A;  3ISP A;  1H8A C;  4EGY A;  1P9Q C;  4RGX A;  3V4G A;  1GLN A;  1PUF A;  1FSE A;  2CUZ A;  2VBZ A;  2V9V A;  1W1W E;  2R3S A;  4KIB A;  4BEH A;  1SVM A;  2CRG A;  3HTS B;  3KLN A;  2W48 A;  3I56 I;  1RUN A;  4LMY A;  1N78 A;  3HSR A;  3CJN A;  5D4R A;  2NS7 A;  1E3O C;  1L0O C;  3HOS A;  1SFX A;  4A0X A;  5DM6 F;  2A3S A;  4LLG F;  4YIF A;  3PNT A;  3JRE A;  4RB1 A;  3E6C C;  5C4X J;  3JRB A;  2VQG A;  5D8L B;  1XGO A;  2MC3 A;  3JSP A;  2Z99 A;  3H5A A;  1XMX A;  2GQQ A;  2RV8 A;  4I99 C;  3WE2 A;  2XVC A;  1TTY A;  2LFB A;  2QQ9 A;  2XUB A;  4MGR A;  2HDW A;  4ZYA A;  3D5R C;  4N4O B;  3BJ6 A;  3OYD A;  3KP6 A;  3S14 J;  1LKX A;  2LKP A;  4P55 A;  2M7B A;  2HQA A;  3ELK A;  1YS7 A;  1XS9 A;  5FLX K;  4R79 A;  1FSH A;  2AHQ A;  2FD5 A;  2KL4 A;  2GLO A;  2XAQ A;  1Y6I A;  3HXL A;  4A3C J;  1KQ8 A;  3BTI A;  5LGN A;  3J81 K;  2JA7 J;  3FXQ A;  2CG4 A;  1N75 A;  4N9I A;  2XF5 A;  1KU9 A;  3P5J A;  4EJW A;  1WRJ A;  4EV0 A;  2KIU A;  4LLN A;  3LA7 A;  5H6R A;  2MC4 A;  4HST A;  4E4H A;  2CSO A;  1V5F A;  1CF7 A;  1GHC A;  3KCC A;  3SEZ A;  4M74 A;  3U1K A;  3G1O A;  3EET A;  4BS9 A;  1SFU A;  1IF1 A;  5LBQ A;  1U8R A;  2PEX A;  5ILS A;  2EV6 A;  4MIM A;  2QF7 A;  4M6X A;  2K86 A;  1ZLJ A;  2FQ4 A;  5K7H A;  1R5G A;  3PFY A;  3IP4 B;  5EEG A;  4ZDP A;  1YO5 C;  3TOB A;  3QRF F;  4NNJ A;  4C2U A;  4XLP F;  1S7A A;  3EUK L;  3WTW C;  4KYW A;  1FP1 D;  2ICW G;  1UJ8 A;  2O3F A;  3T8T A;  2FML A;  2RRE A;  1KA8 A;  2ID6 A;  3JRD A;  1L3L A;  3A01 B;  4HF2 A;  3FXK A;  4XKB A;  4F91 B;  5HS8 A;  2A6E F;  1NK3 P;  2Z1D A;  4PGG A;  5EZG A;  1O7L A;  2EPF A;  2ESN A;  1FT9 A;  1ZAO A;  1BJZ A;  1OCP A;  2V6E A;  2LY2 A;  5ICF A;  5IT9 K;  1BL0 A;  1R4N B;  2QKL B;  2H27 A;  5IP6 A;  1SMT A;  2E60 A;  3IL2 A;  3GTQ J;  2IGM A;  4B3X A;  3K6G A;  2X1D A;  5F0C A;  2N8G A;  3BTL A;  1WH5 A;  1Q1H A;  2PQ8 A;  4KT5 C;  4A5M A;  2F5V A;  3FF5 A;  1MJ9 A;  2K9S A;  1T0F C;  4AU7 A;  4UVC A;  2HDD A;  3QYE A;  2UWM A;  3HOU J;  2R7O A;  4LD5 A;  2WTE A;  2A07 F;  1ON2 A;  2K4J A;  3E5U A;  2XC7 A;  3VYS B;  3M8E A;  4I76 A;  5FD6 A;  2R5Z B;  1HBX G;  3M9A A;  1XX5 A;  1V5G A;  2PBI A;  3BG9 A;  3KPH A;  2XF6 A;  2ZKZ A;  3D5L A;  5AIQ A;  3KLO A;  3S16 J;  2P81 A;  4E7J A;  2DFF A;  2DPU A;  3U1D A;  2COB A;  4HA8 A;  3RYP A;  1I6X A;  1ZEL A;  3TP3 A;  1IO2 A;  3K2A A;  1S29 A;  2G7H A;  4V19 K;  4Y7N J;  4RB3 C;  2DQR A;  2LKX A;  3NWT A;  1PYV A;  4DBQ A;  4AIH A;  1ULY A;  3CUQ C;  1KQ9 A;  4V2G A;  3CME I;  5HDN A;  2IGO A;  3ZN0 A;  1P7I A;  3T5X A;  2WBM A;  4UXN A;  2KRH A;  2L7K A;  5D5U B;  2DA5 A;  2E36 A;  2ELH A;  4XRM A;  1AKH A;  3MKW B;  4IEJ A;  3MVP A;  3FZV A;  3CO6 C;  3A0B C;  4LK1 F;  3MAJ A;  1J5Y A;  1NH3 A;  1QZE A;  3BJA A;  2YX4 A;  5HLT A;  4KNY A;  2GOX B;  3S2H J;  4B09 A;  4RDU A;  1DU0 A;  1XCB A;  4RGR A;  1QA6 A;  1YJ9 I;  2V9P A;  2IGK A;  2JUG A;  2DFI A;  2OQG A;  4X1E A;  3V8L A;  3TW6 A;  1U8B A;  2M45 A;  3ZQI A;  5DCM A;  3W6V A;  2H94 A;  3CC2 I;  4P1W A;  4BL0 B;  2QGU A;  2K9L A;  3M8F A;  5DM7 F;  3OYN A;  3QP6 A;  1DDN A;  3GXO A;  2ZJR F;  1FZP B;  1SVO A;  2VOO A;  4C2M J;  2F5F A;  5GAG J;  1DPR A;  4HBL A;  2R7T A;  3CUO A;  3K69 A;  2OTJ I;  1O7F A;  3I53 A;  1X58 A;  2L2O A;  3PUB A;  5E1X A;  2HEO A;  5JHU A;  5J47 A;  1HLV A;  5E20 A;  2ESH A;  2K3P A;  3GW2 A;  5J1Y A;  3ZQQ A;  2LR8 A;  4BJ6 C;  3HIF A;  2FBK A;  1Y1W J;  3HHG A;  5LHG A;  2NXN B;  1ZN2 A;  4OAZ A;  4RAZ A;  1FX7 A;  2IGN A;  3BG5 A;  4ESJ A;  2ISZ A;  2CV0 A;  4NC7 A;  4XLA A;  3BC8 A;  4GDF A;  3WGG A;  4D1Q A;  1XN7 A;  1TQI A;  1VQN I;  2RQP A;  3GLX A;  1FOK A;  3KZZ A;  1XSD A;  1WKM A;  5H2F C;  3IC7 A;  2ECC A;  1YQA A;  1FPQ A;  5HDG A;  4GRI A;  4LJZ F;  4AC0 A;  3ESW B;  3IH3 A;  1E0E A;  2ZNZ A;  1ETX A;  2DA6 A;  3MD2 A;  3MKL A;  1XMK A;  5KNL A;  1QPM A;  3V8K A;  4RLQ A;  2MSY A;  3K4C A;  1M1E B;  4B47 A;  3IUO A;  4M3F A;  1JUP A;  4DZJ A;  2WAQ A;  4BYY A;  5D6F A;  4G12 A;  4N9H A;  3CTA A;  3K0L A;  1JKO C;  2H1L A;  3K4B A;  2X6Y A;  3LSI A;  1D0Z A;  2DA2 A;  4WXC A;  3DKY A;  1FNN A;  2ZME C;  3UR3 C;  2E35 A;  1B9N A;  2LD5 A;  2EA4 A;  3DQV C;  1IN6 A;  3CCY A;  2W7N A;  2WY7 Q;  3J7A Y;  4GXO A;  4CDG A;  4XRS A;  3TBI A;  2JPB A;  4HQE A;  4IHV A;  2EFP A;  1XD7 A;  3I4P A;  3GTO J;  1FIP A;  4ZYE A;  2VT2 A;  2W00 A;  1ZLK A;  3HPH A;  5FKM A;  1MBJ A;  2K4B A;  2XRO A;  5LGU A;  5K5Q A;  1UHM A;  1ITY A;  2XKP A;  3N4M A;  5M3M J;  1X4O A;  5HS7 A;  4ABZ A;  2VKE A;  4I0B A;  1X19 A;  4A69 C;  3J80 Z;  2BVM A;  4I09 A;  3FMQ A;  1VFC A;  3ZMD A;  4GFB A;  4HX4 A;  3A4C A;  3CP8 A;  1WHU A;  2AQE A;  2DJI A;  4L5J A;  2F5C A;  4C3H J;  4ZC3 A;  1H89 C;  4UNO A;  2M9H A;  2H8R A;  5FO5 A;  2L9S A;  3JRI A;  3ABK H;  4NUB A;  2HWV A;  2BZT A;  2IP2 A;  3CLQ A;  5D5W B;  2XAJ A;  5HLI A;  2XSD C;  1MKM A;  4IVN A;  3OV8 A;  4MFD A;  2DU9 A;  2O8X A;  5FJ8 J;  2ETH A;  2ZSI B;  3OYE A;  1TW2 A;  3Q5F A;  4C30 A;  2DN0 A;  2R7D A;  4KFC A;  3U2R A;  2L9R A;  3F3X A;  3R6S A;  5FRM A;  1YG2 A;  1BIA A;  1J0R A;  4QPQ A;  2WAD A;  2OPT A;  4B1R A;  3AL0 C;  5FGM A;  1AU7 A;  5FB2 A;  3BRO A;  1B4A A;  2XAF A;  4ENJ A;  3LFK A;  3QWL A;  3ERM A;  1AOY A;  3H3V K;  4QTR A;  3L9F A;  2Q1Z B;  4Y15 A;  3CDI A;  2DA4 A;  4A6E A;  3S3M A;  1SAN A;  1IZ1 A;  1HC8 A;  4LOC A;  1Z21 A;  2P5L C;  3TDU C;  1X2N A;  4L9V A;  2V1X A;  2Q0O A;  4W97 A;  5E1Z B;  3GFI A;  2ZFW A;  1FY7 A;  3OYG A;  5BMZ A;  4CUG A;  2EFN A;  1O3Q A;  3DTK A;  2M8E A;  3M4O J;  4FX4 A;  1X3W B;  2X0L A;  3KYL A;  2QBY A;  2M0M A;  2X85 A;  2V9K A;  3BR6 A;  3K4J A;  3KZI C;  1PDN C;  1A36 A;  4FIS A;  2L0K A;  4HDU A;  1ON1 A;  1QNT A;  4YEL A;  1BW5 A;  1X1B A;  4NC8 A;  5E3L A;  3CJQ B;  5FKK A;  4OIP F;  2MW8 A;  3OOP A;  5A2Q Z;  3ZXS A;  1IXS B;  1YLF A;  2NVQ J;  3FIW A;  2Q2E B;  1Q1V A;  3IH4 A;  4Y3O A;  3LSR A;  4IQJ A;  3J7A O;  1MBK A;  1I6H J;  3DTE A;  3DU6 A;  4B43 A;  4EM0 B;  1I1S A;  3E3V A;  2OZU A;  3GTJ J;  3P9I A;  2L7F P;  4OMY A;  1RZ4 A;  1UG2 A;  4FQG A;  4HG2 A;  4UUV A;  3JR9 A;  4FAS D;  1ETW A;  4XNF A;  3H35 A;  1WJD A;  2KPM A;  3F8M A;  2GA1 A;  2HU9 A;  4GYI A;  2DOD A;  5GAD J;  2IJL A;  1R5I D;  1S5L C;  1K4T A;  1YW7 A;  1T39 A;  2Y48 A;  4GCV A;  4A5N A;  3KFW X;  5EG0 A;  1UST A;  1BJA A;  3BR5 A;  2FMY A;  2MBF A;  1Z67 A;  3DBR B;  2ID3 A;  1S7O A;  3K4K A;  3C2H A;  3V7C A;  5HOO A;  3GFL A;  4B44 A;  1BN5 A;  3ZPL A;  1S7E A;  2ZB9 A;  2FOK A;  2R7R A;  5HDK A;  4BHC A;  4KIT B;  3FX3 A;  3KEQ A;  2FE3 A;  4LGW A;  2IS4 A;  2PMH A;  4R1H A;  3ROU A;  2FXA A;  1WPK A;  3QQA A;  4FT8 A;  2HYF A;  4PSW A;  3LNQ A;  1OLT A;  2P0W A;  3K70 C;  2EIN H;  4M3G A;  2OBP A;  2ZC2 A;  4PJM A;  5AIP A;  1F9N A;  2LSO A;  2DCE A;  2VB6 A;  3GEZ A;  3TKY A;  3NRV A;  2ZCW A;  5ERI A;  1XGS A;  3HG9 A;  1A35 A;  1WZ2 A;  1HA8 A;  2CMP A;  2VXZ A;  4IQ4 A;  3JAM Z;  2MAB A;  1IXC A;  5GP9 A;  3OWT A;  2VON A;  2ADU A;  3OSG A;  3DPU A;  5EEH A;  2PI0 A;  3PNV A;  1IN8 A;  4JK1 X;  4M3D A;  4XRF A;  2HTJ A;  3E7L A;  1YRN B;  1RUO A;  1PJR A;  2E2I J;  4N4N B;  4BEH B;  3F6O A;  3ZR8 X;  3JRC A;  1PP7 U;  4DYQ A;  4XLE A;  3LST A;  2NRA C;  2E1M B;  2GAU A;  5AON A;  2W85 A;  1QHH D;  4EM1 A;  3SFI A;  4ZZD A;  2VQH A;  3A03 A;  2EFO A;  3G1L A;  2M34 A;  2MGQ A;  2XB5 A;  3AFH A;  2Y0S A;  2JVG A;  3ML6 A;  3O8G A;  4PGH A;  4JOM A;  5K7F A;  1ETY A;  2CUJ A;  4BDY A;  2EIK H;  3VEP A;  2XB0 X;  2BY1 A;  4U7D A;  2PX9 A;  2HQR A;  3CP2 A;  5DD4 A;  5BQT A;  4Y13 A;  2P4W A;  1RR8 C;  1OMI A;  1JKQ C;  1FTT A;  2LNB A;  2LF7 A;  3TW7 A;  3I58 A;  3S2D J;  5LHH A;  4XLF A;  3TGN A;  3P9K A;  3MKZ A;  1I50 J;  3CO7 C;  1I5Z A;  4R8H A;  4S0H B;  3DLA A;  1TNS A;  1VQM I;  1G3T A;  1FIA A;  2UV1 A;  2L4M A;  2DMP A;  4XN3 A;  2UZK A;  4YRV A;  2L9V A;  3KYD B;  5TRD A;  2K9M A;  3DLL F;  3LMM A;  3SQN A;  2O61 A;  2OV7 A;  3U9G A;  1FYL A;  1OCO H;  1CF7 B;  4F3Q A;  4EJO A;  3G3Z A;  1UHW A;  2XHK A;  1OYY A;  1OFC X;  3TDZ C;  5CQG A;  5E79 C;  1MNM C;  1ETO A;  3MMY B;  2ZXW H;  3FXL A;  2D1V A;  3HB9 A;  3RSN A;  2FA5 A;  2KLO A;  4BHP A;  1IRX A;  3WTZ A;  1WJF A;  4QLC U;  3HOW J;  3WTU C;  3I59 A;  4E70 A;  4ENN A;  1YI2 I;  4H4K C;  1BI2 A;  1YW9 A;  3R0A A;  4UY8 I;  3L00 A;  2STT A;  1MDM A;  4A3E J;  1MH3 A;  4KIS A;  3GTG J;  3QU6 A;  4XKW A;  4OAY A;  1U6G A;  2A6H F;  5J4Y A;  3VFZ A;  1YW8 A;  4XRS G;  2VJ5 A;  2MD5 A;  3VWB A;  5IPA A;  5B3S H;  2LLK A;  1T33 A;  2PJR A;  3U21 A;  4BAC A;  3Q0V A;  4OMZ A;  2UUZ A;  5DCF A;  4HZF A;  1V4R A;  2A68 F;  2Y30 A;  3QOE A;  3UKG A;  1N25 A;  1UAA A;  1WGX A;  1X1P A;  2CQ7 A;  1YOV B;  2GWR A;  3CMM A;  5EZH A;  4BKX A;  4EM2 A;  1A04 A;  1IN7 A;  1IJW C;  4NB5 A;  3HGY A;  1Z7L A;  2HS5 A;  1GUU A;  1G8X A;  3RKY A;  1RC9 A;  2X48 A;  5TJJ A;  5L3D A;  2JTV A;  2OJE D;  4I02 A;  2CW8 A;  4OIQ F;  1JGG A;  4K2E A;  2YUS A;  3ASN H;  1XC5 A;  1JUS A;  3PSF A;  4JBA A;  4BE2 A;  1WSU A;  4I2O A;  2XGX A;  3RPU D;  4KMF A;  1T98 A;  2BY0 A;  3IV5 A;  1HQC A;  1EH6 A;  4XM3 A;  3G4S I;  1TWG J;  1RRJ A;  2QEX I;  3R61 A;  3VSK A;  1T38 A;  2NVY J;  2F48 A;  1OR7 C;  5H20 A;  3Q9S A;  1Y1V J;  1XG1 A;  1Y0N A;  2XIG A;  4QPO A;  2WV1 A;  2CO5 A;  4XL9 A;  2JUC A;  3H9G A;  4RM2 A;  1K6Y A;  4RB2 C;  1BW6 A;  1H0M A;  2E1C A;  1ZGW A;  2DFE A;  4XLC A;  1R7J A;  4FX0 A;  2DTZ A;  5GTH C;  3RKX A;  1AKH B;  4RAG A;  4AD9 A;  2CGP A;  3HRS A;  2DYR H;  4M6V A;  1HDD C;  2CQK A;  2ZNY A;  1YRN A;  2VOP A;  4Q47 A;  1RNL A;  2EZL A;  1BI0 A;  3P9C A;  3ZQL A;  3Q3S A;  4XSZ F;  3DU5 A;  4PCQ A;  5CVJ A;  4BY1 J;  1HOM A;  4J19 A;  1MJB A;  1R00 A;  5DCM B;  3C1D A;  4F55 A;  5GPA A;  2TCT A;  4M6Y A;  4MEY F;  3KEO A;  1HDP A;  2LDU A;  1W5C C;  3FMR A;  1LFB A;  3WOD F;  1ZAR A;  2QZ8 A;  3FXU A;  2H09 A;  4OWR B;  2Q8K A;  3UNG C;  4RMN A;  4EJV A;  1XB4 A;  3W6J B;  2RVC A;  4S04 A;  2CUE A;  2DAO A;  1REP C;  1GVD A;  1B9M A;  2CYY A;  5KAI C;  1Z3X A;  1R1T A;  1UCR A;  4BE1 A;  2D2W A;  3OY9 A;  2LVS A;  4MQ9 F;  1IAW A;  5C3E J;  1LDJ A;  1YHQ I;  2VN2 A;  4I6Z A;  4XON A;  2ZXJ A;  3HEF A;  4DW6 A;  1TLH B;  2RAE A;  3QPL A;  2ZJQ F;  1EF4 A;  3MN2 A;  5DV5 A;  2MH9 A;  2RNG A;  3ZCO A;  5DEQ A;  1IN4 A;  4ZH4 F;  2LYC A;  3HSF A;  4HLX A;  2QSG X;  3HRU A;  1HW1 A;  1KU3 A;  1G4D A;  3GFM A;  3PFI A;  2PMZ N;  1ERD A;  1UEL B;  3ULQ B;  3H0D A;  5FFX A;  5J8C A;  1K83 J;  1VND A;  1J9I A;  5CLS A;  3NAR A;  1TNT A;  1OPC A;  4F7Z A;  1RET A;  4W1U A;  5KVR A;  3R0J A;  2NNY A;  3F6V A;  3S3N A;  4M9S A;  1I1G A;  2XAG A;  2IRF G;  2NS0 A;  4WK8 F;  4UV8 A;  4II2 A;  2K3F A;  3CCQ I;  2WV0 A; 
#chains in the Genus database with same CATH homology
 2HOT A;  5E3O A;  2ECC A;  1MBH A;  5M5X J;  2WAQ N;  3JRF A;  2FX0 A;  3O8H A;  4AC0 A;  4BY7 J;  1P7J A;  3IH3 A;  3WHC A;  1ETX A;  3TED A;  5EGO B;  2DA6 A;  3MKL A;  2MSY A;  2WB1 N;  1B8I A;  3TP0 A;  4M3F A;  2KT0 A;  1JUP A;  3JRH A;  4DZJ A;  2XPU A;  5C44 J;  2ME0 A;  4DYC A;  4A3I J;  4G12 A;  1Z0X A;  3H0G J;  5M5W J;  1JKO C;  1HF0 A;  5FLM J;  1ZQ3 P;  3FKI J;  2DA2 A;  1RPW A;  5EGO A;  2KDZ A;  2E2J J;  1JJ6 C;  2LD5 A;  1ORK A;  4CYC B;  3SDG A;  3CCY A;  3OOU A;  4XIC A;  4XRS A;  2HXO A;  3HM5 A;  2M8G X;  4IHV A;  3GTO J;  2G0E A;  1ETK A;  1FIP A;  2DMN A;  5EDN A;  5FKM A;  1MBJ A;  4A3F J;  2YU9 J;  1WH7 A;  2Y9Z A;  5IYC J;  5DS9 A;  4FE4 A;  2O8K A;  1ITY A;  1QVU A;  1JKR C;  1QPI A;  5M3M J;  4ABZ A;  1GT0 C;  4JYK A;  3SJM A;  2VKE A;  5IP7 J;  4A3G J;  4A69 C;  2JN6 A;  1VFC A;  4GFB A;  3GBG A;  5F0F A;  3JRA A;  2DA1 A;  4C3H J;  3QPS A;  1H89 C;  4XK4 A;  2M9H A;  2H8R A;  1PUF B;  3S17 J;  4C3I J;  4A3D J;  3JRI A;  1ETV A;  2NS8 A;  4DZP A;  5E3N A;  3FK6 A;  5FKO A;  3BT9 A;  2XSD C;  1JJ8 C;  2VKV A;  3HKZ N;  3Q0W A;  3I4M J;  3M3Y J;  4MFD A;  5FJ8 J;  4QSH A;  2R93 J;  5IYD J;  2JJ7 A;  2ELK A;  2CQX A;  2DN0 A;  3FK7 A;  1APL C;  3HOV J;  4D5F A;  2L9R A;  4RBO A;  1I3Q J;  3ZQG A;  5DTD A;  3HOX J;  2OPT A;  4B1R A;  5C4J J;  2JA8 J;  1AU7 A;  1JUM A;  2DMU A;  3BG3 A;  2R0Q C;  9ANT A;  3H3V K;  2JMW A;  5IYB J;  4QTR A;  1FEX A;  3NAU A;  2XGD A;  2DA4 A;  5E3M A;  2LP0 A;  1SAN A;  4B3A A;  4LOC A;  3IH2 A;  2VUM J;  4A3J J;  1X2N A;  1DU6 A;  5GPC A;  1W0U A;  1IC8 A;  4A93 J;  4W97 A;  3BR1 A;  1ETQ A;  1TWH J;  1IV6 A;  1TWA J;  2ME6 A;  3CMY A;  3M4O J;  1T56 A;  3OSF A;  2HOS A;  3D1N I;  1POG A;  2IAI A;  2JA6 J;  1X2M A;  3BR6 A;  2DA7 A;  3CQZ J;  4FIS A;  3BR3 A;  2L0K A;  1W0T A;  3S1N J;  1MSE C;  2Y31 A;  2QCO A;  4M3E A;  5K7Z A;  4A3B J;  1BW5 A;  5E3L A;  2DMT A;  2X6O A;  5FKK A;  3VPR A;  2MW8 A;  1MH4 A;  2NVQ J;  2E1O A;  3FIW A;  2GBY A;  1TC3 C;  1Q1V A;  3IH4 A;  1IDZ A;  3LSR A;  1MBK A;  1I6H J;  1JTX A;  1JTY A;  5EG0 B;  4D5C A;  3BQY A;  3GTJ J;  2GM4 A;  2L7F P;  1IRZ A;  1QRY A;  1UG2 A;  5EEA A;  2E2H J;  1UHS A;  3LOC A;  3JR9 A;  1BA5 A;  3RZO J;  2FJ1 A;  1ETW A;  4X6A J;  2DA3 A;  1G2H A;  2IBD A;  2HI3 A;  3S15 J;  3OIO A;  5EYR A;  5M5Y J;  4V2F A;  5FKN A;  3ZQC A;  2CJJ A;  3RQI A;  2K9N A;  1RKW A;  1MBG A;  4L5E A;  5EG0 A;  5J1U A;  4XID A;  3BR5 A;  2HQ5 A;  2DJN A;  1ZR2 A;  3BQZ A;  2ID3 A;  2VI6 A;  1S7E A;  2OF7 A;  2ZB9 A;  3PO2 J;  3RZD J;  2XGE A;  4JX5 A;  1WPK A;  3QQA A;  3LNQ A;  5J1R A;  4M3G A;  2O7O A;  1O4X A;  4CYC A;  2XRL A;  3FIS A;  2LY9 A;  1ZKG A;  1B72 B;  3LSP A;  1ZR4 A;  5IOZ A;  2MG4 A;  4Y52 J;  1D5Y A;  1IUF A;  5IOY A;  5GP9 A;  4BBR J;  3ZQH A;  2JK3 A;  3OSG A;  1U9O A;  1RES A;  3S1Q J;  2NOG A;  2EH3 A;  1IG7 A;  1WCM J;  3B6C A;  4JX6 A;  1FJL A;  4M3D A;  4FTH A;  3E7L A;  1YRN B;  4AYB N;  2L7Z A;  3GTK J;  2E2I J;  2Y0S N;  3S1R J;  2CUF A;  1MSF C;  4IHY A;  3HOZ J;  3JRC A;  4DYQ A;  1R9T J;  1TWF J;  1IGN A;  1U9N A;  2R5Y B;  3DCF A;  2DMQ A;  3SFI A;  3ZOB A;  3C2B A;  3A03 A;  3G1L A;  4C3J J;  2CQQ A;  3JRG A;  1Z77 A;  2M34 A;  2MGQ A;  2XB5 A;  1H8A C;  3O8G A;  2TRT A;  1F36 A;  5K7F A;  1PUF A;  2R92 J;  1ETY A;  5JLX A;  3GTL J;  2XB0 X;  3BTC A;  2EZK A;  4B4C A;  1JKQ C;  2CRG A;  3WHB A;  1FTT A;  2W48 A;  2R5Y A;  3S1M J;  2M2E A;  3LSJ A;  3TW7 A;  4JP0 A;  2NS7 A;  1E3O C;  3S2D J;  3GTP J;  4HNV A;  1I50 J;  3JRE A;  4BBS J;  4S0H B;  1MBE A;  2HOA A;  5C4X J;  3JRB A;  4JX4 A;  1FIA A;  4UUT A;  2NVX J;  2DMP A;  1JT6 A;  1CQT A;  2EZH A;  4BXX J;  2LFB A;  5F0H A;  1NK2 P;  1RKT A;  2EZI A;  5IP9 J;  3S14 J;  4IHX A;  3HOY J;  1XS9 A;  2JWT A;  1LE8 B;  2AHQ A;  2FD5 A;  3L1P A;  2GLO A;  1OFC X;  4A3C J;  2XGC A;  3BTI A;  1MNM C;  2B63 J;  4D7M A;  2XPW A;  2JA7 J;  2AO9 A;  1ETO A;  4AUX A;  2LTP A;  4DYR A;  3HB9 A;  3PM1 A;  3HOW J;  3G1M A;  5HOD A;  1FTZ A;  3BR0 A;  5J3L A;  5F27 A;  1LE8 A;  3G1O A;  5FKL A;  1GDT A;  4A3E J;  1MH3 A;  3GTG J;  4A3K J;  4MIM A;  2QF7 A;  4A3M J;  2FQ4 A;  5K7H A;  3DEW A;  5BNG A;  4M3B A;  1UMQ A;  3F0C A;  4IHW A;  2R7Z J;  3K7A J;  2L7M P;  4XRS G;  4A3L J;  1K61 A;  5IPA A;  2LLK A;  2ID6 A;  3JRD A;  1T33 A;  3A01 B;  2K9Q A;  3Q0V A;  4MO7 A;  2M0C A;  3RKQ A;  1AHD P;  1NK3 P;  4MLO A;  5EZG A;  2Y30 A;  3UKG A;  1H88 C;  3BTJ A;  1VI0 A;  3ZQF A;  1WGX A;  1BJZ A;  1OCP A;  2CU7 A;  5EZH A;  4BKX A;  1BL0 A;  5IP6 A;  1IJW C;  3HGY A;  3A02 A;  1GUU A;  1JKP C;  3GTQ J;  2X48 A;  3A01 A;  2D5V A;  2NVT J;  2Y2Z A;  5F0C A;  1JGG A;  2N8G A;  2YUS A;  1WH5 A;  3BTL A;  1MBF A;  1XC5 A;  5FLV A;  1JUS A;  2K9S A;  1A5J A;  2HDD A;  4MFE A;  3IV5 A;  1TWG J;  1GV5 A;  3HOU J;  2NVY J;  4D7N A;  2EBI A;  4I76 A;  2I10 A;  2R5Z B;  1Y1V J;  1XG1 A;  2X9D A;  1ZTR A;  3BG9 A;  1B72 A;  2WV1 A;  3S16 J;  2P81 A;  1GV2 A;  1BW6 A;  2COB A;  5EF6 A;  2HYJ A;  1RR7 A;  1ZGW A;  1U78 A;  1JT0 A;  3Q0U A;  3TP3 A;  2DTZ A;  2E19 A;  1HCR A;  1AKH B;  3K2A A;  4M6V A;  3LSG A;  1HDD C;  4Y7N J;  2R5Z A;  2LKX A;  1OJL A;  4V2G A;  1YRN A;  5F1J A;  2EZL A;  4NDL A;  1WI3 A;  3ZQL A;  1P7I A;  2XPV A;  3Q3S A;  2YS9 A;  4BY1 J;  4FE7 A;  1HOM A;  2DA5 A;  2HXI A;  4FCY A;  1ZK8 A;  4J19 A;  4XRM A;  1AKH A;  2IEK A;  3HGG A;  2Y9Y A;  4IEJ A;  5GPA A;  2TCT A;  3MVP A;  2O9L A;  1HDP A;  3HBL A;  1LFB A;  1NTC A;  1TWC J;  4QIW N;  3S2H J;  1DU0 A;  4RDU A;  3B6A A;  1VF9 A;  4UUS B;  4X1E A;  5F08 A;  3TW6 A;  1U8B A;  3ZQI A;  2CUE A;  3W6V A;  1GVD A;  3BR2 A;  3I4N J;  2LVS A;  5C3E J;  5JLW A;  1LFU P;  2H1K A;  4C2M J;  4I6Z A;  3PO3 J;  4DW6 A;  3HEF A;  1QVT A;  2RAE A;  3QPL A;  3GTM J;  2K40 A;  3MN2 A;  1X58 A;  4UUS A;  1EF4 A;  2LK2 A;  5M3F J;  4EEF G;  1A6I A;  1HLV A;  1F43 A;  5J1Y A;  2LR8 A;  1ENH A;  1Y1W J;  5F04 A;  2PMZ N;  3BG5 A;  2VPR A;  1K83 J;  1VND A;  2EQR A;  3NAR A;  2ECB A;  1B8I B;  1OCT C;  1RET A;  4W1U A;  3CDL A;  2JA5 J;  3HDD A;  1IDY A;  1SFO J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...