2E19A

Solution structure of the homeobox domain from human nil-2-a zinc finger protein, transcription factor 8
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
b'GSSGSSGQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription factor 8
publication title Solution structure of the homeobox domain from human NIL-2-A zinc finger protein, transcription factor 8
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 11
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2006-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2e19A01
5C4XJ 3C2BA 3MVPA 2HXIA 5K7HA 5IOZA 3OIOA 1ETOA 2YU9J 2H1KA 2DMTA 2Y30A 4JX6A 2NS7A 3GTJJ 2NS8A 1GVDA 2B63J 2W48A 2DA6A 1MBEA 1BL0A 4MIMA 3TP3A 1TWHJ 3TW6A 4A3EJ 1JKQC 2LVSA 4X1EA 3HOWJ 2VI6A 2MGQA 2R7ZJ 1VF9A 2X9DA 2DMQA 1JJ6C 5E3OA 4FTHA 2G0EA 3LSJA 2QF7A 1X2MA 1IRZA 3NARA 2DA3A 3IV5A 5C4JJ 1F43A 4A3MJ 4FE7A 4A3KJ 2XB0X 4I76A 1MSFC 5GPCA 2JK3A 2Y0SN 3S1RJ 3QPSA 1NK2P 1JKOC 3HDDA 1MBHA 1UHSA 2CRGA 4D7NA 1S7EA 1OJLA 3BR5A 1XG1A 1AKHA 1VNDA 1ZR2A 3S1QJ 1H8AC 1P7IA 1A6IA 1GV5A 2YS9A 4BBRJ 4D5CA 1IUFA 1K83J 1IC8A 1H88C 2ECBA 4MLOA 2R5ZB 3JRFA 1UG2A 5M3FJ 2TCTA 1TWAJ 3QPLA 1APLC 1HDDC 4FE4A 5C3EJ 2ELKA 1Q1VA 2VKEA 3GTPJ 2FD5A 5K7FA 1HCRA 3K2AA 3G1LA 3RQIA 5E3MA 2M8GX 2XPUA 3GTMJ 1QRYA 1HF0A 2IAIA 1BJZA 5M5WJ 3ZQLA 5GPAA 5EGOA 2CUFA 1WCMJ 1F36A 3BR1A 4AYBN 4XRSA 4A3GJ 1PUFA 3IH3A 1ETXA 2JA7J 3IH2A 1B8IA 1BW5A 1NTCA 2WB1N 1WH5A 1BW6A 4BKXA 5EEAA 3S2DJ 3HOZJ 3I4NJ 4DW6A 5IYDJ 1U78A 1E3OC 5M3MJ 1MH4A 1FTZA 5IYBJ 3GTOJ 1ETVA 3SDGA 2EQRA 1DU6A 5M5YJ 4MFEA 1AKHB 4B1RA 1FIPA 3OSFA 2EBIA 1W0UA 4XICA 2K9SA 1MH3A 5J1RA 2EZLA 3SFIA 3BR0A 5HODA 4IEJA 1QVTA 4D7MA 1WPKA 4M3FA 3H3VK 3S14J 2X48A 2EH3A 2PMZN 3M4OJ 1IG7A 2E2HJ 3Q0UA 4A3IJ 2ZB9A 1AHDP 4LOCA 2XGCA 4M6VA 2LP0A 1MNMC 2XPVA 1XC5A 3S17J 2Y9ZA 2M0CA 3HB9A 5F08A 1BA5A 1JT0A 3RZDJ 3SJMA 3GBGA 2DA5A 2HYJA 4JX5A 3BG5A 5EGOB 1ZK8A 1I6HJ 3FKIJ 2Y9YA 4QSHA 5DTDA 4A3CJ 4A3JJ 2ME0A 1PUFB 3HOXJ 5FKMA 2R5ZA 1ZR4A 2XGDA 1B8IB 5FLMJ 3FISA 4AC0A 1HDPA 2HOAA 5E3LA 3HM5A 4J19A 4XK4A 3S16J 1Z0XA 2LK2A 2M9HA 5FKKA 4DZPA 2KT0A 1CQTA 3I4MJ 3G1OA 3TW7A 3LOCA 3B6AA 2ECCA 1ZKGA 5K7ZA 2XGEA 2H8RA 3ZQIA 2LY9A 1ZGWA 2ME6A 2LD5A 4A93J 3JR9A 3PO3J 4V2FA 1U8BA 1U9NA 1O4XA 3BT9A 1OCTC 2MSYA 2JWTA 2K40A 2P81A 2R93J 1JKPC 5IP6A 1MSEC 2CU7A 3MN2A 3ZQCA 2VPRA 2VUMJ 4A69C 3HOVJ 3E7LA 2WAQN 3PO2J 3A02A 4JX4A 1RKTA 2DMNA 2NOGA 2EZKA 2TRTA 4JYKA 1ENHA 2R0QC 5EYRA 2CQQA 5EDNA 1YRNA 3JRIA 1SFOJ 5E3NA 1QVUA 2LR8A 3DCFA 3ZOBA 2FX0A 3LSPA 3ZQFA 4IHVA 5EG0A 3UKGA 4A3BJ 1ZTRA 1WGXA 2HOSA 4FISA 2AO9A 1Y1WJ 3QQAA 4CYCA 1ETKA 1B72A 5F0FA 3CMYA 2EZIA 3CCYA 1D5YA 2HOTA 4Y52J 3BR6A 4MFDA 4MO7A 4IHYA 1IV6A 1RETA 4A3LJ 1P7JA 4V2GA 4BY1J 2LFBA 3ZQGA 2NVXJ 2R5YB 3JRBA 3BQYA 2JA8J 2FJ1A 3JRDA 1VFCA 3D1NI 5IPAA 3HOYJ 3HBLA 5M5XJ 2L7ZA 1OFCX 3MKLA 3Q0WA 2CUEA 2JN6A 4M3DA 5EZHA 2M34A 4W97A 5EF6A 1JUMA 2R92J 2E2JJ 5DS9A 5J3LA 2MW8A 1X58A 3M3YJ 2KDZA 5F0CA 3HGYA 1JT6A 1SANA 2JA5J 3BTLA 1XS9A 4IHXA 1G2HA 4RDUA 3JREA 2EZHA 5FKOA 4FCYA 5C44J 1LE8A 2LLKA 1IJWC 2O8KA 2DA4A 3ZQHA 1YRNB 1MBFA 4M3GA 3VPRA 1X2NA 1A5JA 4XRMA 3DEWA 4GFBA 5EG0B 1DU0A 4RBOA 4D5FA 3PM1A 2HI3A 3G1MA 2NVQJ 4QIWN 2O7OA 1JJ8C 4L5EA 4CYCB 1B72B 2L7FP 5J1YA 2YUSA 2HQ5A 1I50J 1RPWA 2CQXA 2I10A 2IBDA 2WV1A 1IDZA 2HXOA 4S0HB 3NAUA 4DYQA 4A3DJ 1AU7A 2MG4A 3BG9A 1FIAA 2LKXA 3JRHA 2M2EA 4X6AJ 3HEFA 3K7AJ 2AHQA 3BG3A 4Y7NJ 3W6VA 4M3BA 3FK7A 4DYRA 4W1UA 1HLVA 2COBA 5GP9A 4ABZA 2DMUA 2O9LA 3FIWA 5EZGA 1QPIA 3O8GA 3B6CA 1GDTA 5F04A 3A03A 4BXXJ 3RKQA 2OPTA 5JLXA 1RKWA 2GBYA 2R5YA 1FEXA 1LE8B 1H89C 1GUUA 2DJNA 3OSGA 4BY7J 3OOUA 3WHBA 2GLOA 2ID3A 1U9OA 5F1JA 1K61A 1TWCJ 1MBKA 2E19A 3WHCA 2D5VA 1Y1VJ 1ETYA 2XB5A 2JA6J 1EF4A 4C3HJ 1W0TA 1POGA 4G12A 1R9TJ 5IP7J 1JUPA 2NVTJ 3S15J 2DA1A 5BNGA 1JTXA 4UUSB 1NK3P 2DA7A 4XRSG 1T56A 3S1MJ 3JRCA 3FK6A 1ETQA 1LFBA 3HKZN 4DYCA 3S1NJ 5J1UA 2L0KA 3BQZA 2Y31A 1JGGA 1IDYA 1MBJA 1JKRC 2CJJA 1ORKA 1MBGA 2RAEA 2DA2A 3BTJA 3HOUJ 5FJ8J 2OF7A 5IYCJ 3GTKJ 1UMQA 2DTZA 1GV2A 5FKLA 4HNVA 3JRAA 4EEFG 2ID6A 3CQZJ 2DN0A 5FLVA 2N8GA 3HGGA 3TP0A 2K9QA 4JP0A 3CDLA 4A3FJ 3H0GJ 3BTIA 3A01A 2JMWA 5IOYA 5FKNA 1RESA 1JTYA 4BBSJ 2XRLA 1ITYA 1LFUP 9ANTA 4C3JJ 1GT0C 2LTPA 3TEDA 1ETWA 1OCPA 4DZJA 3RZOJ 4AUXA 4NDLA 3BR3A 3Q3SA 4B3AA 2K9NA 2FQ4A 1ZQ3P 1TWFJ 4UUTA 4QTRA 1VI0A 3L1PA 3BR2A 5F0HA 2L9RA 4C3IJ 4I6ZA 3GTQJ 1FJLA 1WI3A 3S2HJ 1RR7A 2XPWA 5IP9J 4XIDA 2IEKA 4IHWA 2L7MP 3O8HA 3Q0VA 4C2MJ 4B4CA 1IGNA 2E1OA 1Z77A 2NVYJ 2QCOA 3GTLJ 2Y2ZA 1TWGJ 3LSRA 1WH7A 3BTCA 1FTTA 4UUSA 5F27A 2XSDC 3IH4A 1T33A 2VKVA 2E2IJ 2JJ7A 3LNQA 2GM4A 1JUSA 3GTGJ 1HOMA 3F0CA 2DMPA 4M3EA 2X6OA 1I3QJ 1TC3C 3LSGA 5JLWA 3A01B 2HDDA 3JRGA
chains in the Genus database with same CATH superfamily
4XSZF 5FLXZ 3CUOA 3MVPA 5GADJ 4BHPA 1WQ2A 1V55H 3OIOA 3W3CA 5IOZA 2H1KA 2DMTA 4XLCA 1WJFA 2DFEA 2KISA 1GVDA 2ZMEA 2LMDA 5AIQA 1I5ZA 1T95A 5HLHA 2JA2A 1RNLA 3I3LA 3EUHA 5FGMA 4CZZA 3P9IA 3TOAA 3GW2A 2QKLB 4ZDPA 1Z05A 3V7RA 2FBIA 1J9IA 5DUIA 2BYVE 4OMZA 4MIMA 4RM2A 2CGPA 1PJRA 4H0EA 2KMUA 1JKQC 2QBYA 3MWMA 5A2QK 2VI6A 2MGQA 3EYYA 2R7ZJ 4QPOA 5DUKA 2X9DA 3E6BA 4LIUA 1OLTA 2GA1A 2H6CA 4M6XA 3L2UA 1JJ6C 2Z16A 4BDZA 4B43A 1FPQA 1YO5C 2G0EA 3LSJA 3OL4A 3E6MA 1IRZA 4PJJA 4EJTA 1XMKA 1FSEA 3KIOA 1UELB 3CTAA 1F43A 1W36D 2XF6A 1W5SA 3HRTA 1Z3XA 2Q8KA 3DF8A 1W5CC 2JRTA 3GFMA 3MEXA 1X1AA 4I76A 1MSFC 4L0ZB 2ICWG 2JK3A 3FMSA 2Y0SN 1KONA 5HS9A 1FT9A 2CRGA 2VASA 1U5TA 3C2GA 5GTHC 1S29A 1X3ZB 1G3YA 2F5FA 2OQRA 4BJ5C 1ZR2A 2HS5A 1JI8A 2YR2A 3S1QJ 4OIPF 3ABLH 4BHCA 2M7AA 1P7IA 1D1AA 4BBRJ 4D5CA 1IUFA 5KK1A 1Z91A 3BG6A 4HBLA 2ECBA 4XSXF 1LDDA 2E7XA 3JRFA 1UHMA 4P1WA 1HDDC 2K4JA 4BNCA 2Y48A 2XAGA 5LGNA 1PVEA 1Y8RB 3KX2A 1S7OA 3KP6A 3QOEA 2E5NA 2HVSA 3GFJA 1Z3YA 3SZPA 5K7FA 3MCZA 1HBXG 2LDUA 2FSWA 3K2AA 3RQIA 1HKQA 1QRYA 3ABKH 3V4GA 2IAIA 1BJZA 5M5WJ 2PMHA 2JPCA 3CJRB 2CUFA 4EJOA 2STWA 5IT9K 2IGMA 3U1DA 2KKOA 1YHQI 2LSOA 4D0PA 2QA4I 5HOOA 2OV7A 1R1VA 2CW7A 1NTCA 4IKFA 4YELA 3GCMA 1VQ6I 1BW5A 4HX8A 4XLAA 1R5ID 2HYGD 1WFXA 5IYDJ 5M3MJ 4HF0A 5AIPA 5J40A 4KIFA 5JHUA 3I5UA 1ZAOA 2NXNB 4NC6A 4GXOA 2XV4S 2X1DA 3QP5A 4MFEA 5CJ9A 4EMSA 3H9QA 3W6JB 4UNOA 2ZCWA 5K1YA 2NVUB 4A0YA 1MH3A 2PEXA 2XASA 4C2TA 5HODA 2ZXHA 2HFHA 3JSPA 1E2XA 1N77A 4EM1A 1QVTA 1LKXA 2EH3A 3K10A 3G4SI 2VKDA 3JAMZ 3E6DA 3VFZA 1YS7A 4Z6YA 3MKWB 1IG7A 3BROA 3V8KA 4ETSA 4AIKA 5DD8A 1G3SA 4F93B 2Q1ZB 2HZDA 4EJUA 1H9GA 2WTEA 1SD5A 3RZDJ 1QPMA 3W2WA 3GBGA 3DBHB 4E7SA 4C30A 2PJPA 1TNSA 4U88A 5EGOB 5LBQA 1IXRC 5DTDA 2Y9YA 2Z1DA 3FDYA 2ZJPF 1OR7C 1ZR4A 3EUKL 1B8IB 1W36C 1MGTA 4AC0A 1PDNC 2QLZA 4H4KC 2DT5A 1HDPA 5ICEA 5E3LA 1UHWA 1TQMA 1Z0XA 2M9HA 1CQTA 2JSCA 3G1OA 1OKRA 3FZVA 4G6TB 3RYRA 4OMYA 3REOA 2K9MA 2ME6A 1AA7A 1D3YA 2GOMA 3CMMA 3E5QA 4V2FA 2VKHA 2WAQA 1J2XA 1OCOH 2MSYA 2K40A 4IJAA 3COAC 2R93J 3PQJA 2RGVA 3K4LA 4HDVA 1O57A 1RRJA 4EM0B 4L18B 4KITB 5IP6A 1MSEC 3MZ8A 2I5UA 1B9NA 4BE1A 3PO2J 1WJCA 4JX4A 3UR3C 3GF2A 2EZKA 4G6DA 3J80Z 1Y0NA 2L2OA 4KA4A 2PJRA 2R7VA 2CQQA 2ZC2A 1J59A 3I64A 4UXNA 1X1CA 1QVUA 1LDJA 3ZOBA 5J8FA 1FC3A 2QZ8A 3KP5A 3WGIA 1TP4A 3F8FA 4M72A 2CQ7A 2HOSA 2H09A 2VOOA 4FISA 1XPXA 3A0HC 1R6RA 2F4IA 3QQAA 4CYCA 1FSHA 1B9MA 3CCYA 5GAEJ 2FNPA 2H27A 4XMYA 4IHYA 1P7JA 3TMOA 2VXZA 3L09A 2NVXJ 3IRQA 3J7YJ 3ECOA 1T08B 2Z5UA 2FJ1A 2IS1A 2BE5F 4LK0F 4LITA 3CDHA 4PFPA 3ZR8X 2L7ZA 2DXIA 1BR1A 3ZQQA 3WTZA 2ZJQF 2JN6A 2NYXA 5EF6A 5J3LA 3H5RA 4AWXB 5E1XA 3M3YJ 3D5LA 1EKEA 4IRGA 3ZRGA 4CH7A 5CQEA 3IRRA 4IHXA 4RDUA 2DJIA 2EZHA 4FCYA 2CV0A 2BW3A 3IL2A 4OAYA 2KRHA 2QM3A 1G8XA 2E5ZA 4XNFA 4I02A 2EINH 1ON1A 1SMYF 1X2NA 5IY5H 3DEWA 3I9V2 1U3EM 4AVPA 4BEHA 2HI3A 4E7IA 4CCOA 3LFKA 3BC8A 4ITVA 1XSVA 1JJ8C 1QQIA 3ZPLA 2GXAA 4ZYHA 2JPBA 1Y8QB 1MJ9A 3GLXA 3K6GA 2WV1A 2BV6A 2R7TA 3KP7A 1KZHA 2KLOA 3ZMTA 4DYQA 2ZSHB 4YIRX 5K5OA 3BG9A 4Y17A 5DCMB 1MW7A 2KIUA 4V19K 5CYVA 4BYYA 1EH8A 2AHQA 3M7GA 1IXSB 4M3BA 3L7WA 4KIGA 3OYNA 5IT3A 4IPAA 3S8PA 5GP9A 3I56I 3QODA 4Q47A 2KJBA 3C18A 3D5SC 1QPIA 2BY1A 3B6CA 3SDBA 5ICCA 3A03A 4BXXJ 3I53A 2OCCH 1RKWA 2GBYA 4IQ4A 2R5YA 1FEXA 5A2QZ 1ACIA 4EGYA 5E79C 2VT3A 1WJBA 1YI2I 3OYJA 2DCEA 3GZNB 1H89C 1E17A 2L5QA 1GUUA 3OSGA 4BY7J 3OOUA 4FX4A 5FRNA 5F1JA 1K61A 3EQLF 1MBKA 1R22A 4KT5C 2FOKA 2QGUA 2BZTA 1EH6A 4A0ZA 3HKZA 1HKTA 1KU7A 2XB5A 3ZXSA 2XKOA 2L4AA 2EIMH 4C3HJ 4NUBA 2HVQA 1BI3A 2JVGA 2X85A 4G12A 5IP7J 1JUPA 2F5EA 1S3JA 3VSKA 4WXDA 1D8JA 2CQNA 5ILSA 1FOYA 2LY1A 2P0WA 5D4RA 1T56A 1Z9CA 2GA2A 1KQ8A 4RAGA 3ZN1A 1ETQA 1RR8C 4HPQA 2L0KA 2LBFB 1DPUA 1IDYA 2HQNA 3GFLA 4G7HF 2CJJA 1ORKA 3BTJA 1P4AA 4X0GA 2Q2EB 5FJ8J 3PFYA 1VQ4I 2Z33A 5D8KB 3I59A 2HDCA 3SZGA 1B6AA 3K1NA 2EV0A 4UUVA 2ZKZA 1ULYA 1XGOA 3VYRB 1X19A 1ZHFA 2ACJA 4DIQA 3DWLE 2MLKA 2LC2A 2IS2A 1ZN2A 2K02A 1WJAA 3BP8A 4XLHA 4JP0A 1MZBA 1YLFA 3HSEA 1DGWY 2OZ6A 2YSRA 3PNVA 2AXLA 3HUGA 2CS3A 3B73A 1JTYA 2XRLA 4A2UA 9ANTA 2K3FA 5IT9Z 2Z3YA 2B0LA 2X6YA 4DZJA 1LFPA 3TKYA 2L3DA 2KHMA 2HVRA 3Q3SA 2K9NA 3CCQI 4UV8A 1ZQ3P 3GMEA 3BCBA 2QSHX 4QTRA 1VI0A 2DAOA 5F0HA 1TTYA 2WWYA 3OR2C 1B4AA 2PBIA 4PCQA 4RGRA 3EYIA 1RC9A 2XAFA 3P5JA 1S6LA 1TNTA 1YIOA 3GWZA 4XIDA 5IP9J 2L7KA 2L7MP 3O8HA 5CVIA 3G71I 1VQ8I 2F2EA 2E60A 1IN7A 3RTRA 3MD2A 2NOJB 5J4YA 1Z77A 2NVYJ 2K9LA 3ZP5A 3F9KA 1K6YA 1H0MA 1RZ4A 4HNTA 1YW7A 3TOBA 2XSDC 3K4MA 1T33A 3V8LA 3DTIA 3VOEA 5DM6F 3OYIA 2G7HA 3O2PE 3CUQB 2VB6A 4WK8F 1HOMA 2QENA 4RMNA 3KEQA 2XHKA 3WGHA 1V5GA 3MKZA 2HTSA 3CJQB 1T39A 3NWTA 3JRGA 2EIJH 1WJEA 2GZWA 2CMPA 2PQ8A 1I1GA 4MQVA 3W6KB 3LSTA 1BIAA 4OAZA 5C4XJ 2L4MA 3C2BA 1NG6A 1KU3A 1O3QA 4JK1X 1PP7U 4A12A 2Y30A 4JX6A 4RA2A 2NS7A 2XAUA 4E7HA 2DT6A 1SD6A 4MGRA 2MH9A 4M9SA 2B63J 5FRMA 5BOXA 1TWHJ 2KRFA 3ASOH 1BI1A 2RC4A 2XAHA 3IC7A 4KICA 4A3EJ 2LVSA 3QPTA 4X1EA 2ZMEC 2HU9A 3CP2A 3HOWJ 3HHHA 1SVMA 3F6VA 3EUHC 5B66C 1ZH5A 3DU5A 2RDPA 4NNJA 3KP2A 2CV2A 4I01A 2Y0SA 2QF7A 3T0YA 3IV5A 3IWFA 3M8EA 3WTYC 4I98B 1MDMA 3V7SA 4A3KJ 3J7ZI 5HNHA 2Z99A 2IA1A 4HSTA 1MD0A 2LG4A 1LQ1A 3GFIA 3S1RJ 2JT1A 1NK2P 2M1BA 2DDAA 3OIQA 5CKTA 4D7NA 1O7FA 1J09A 2EB7A 1SFEA 2WA0A 1R23A 1Y6IA 3IKVA 4UB8C 4BAYA 1VNDA 3ISPA 2GIZA 1P9QC 3DU6A 3QWLA 4KN7X 2PG4A 3TQNA 4ESJA 2DW4A 3MMYB 1IV8A 4LG0A 1GLNA 1R71A 2V9KA 1K83J 1IC8A 2BXYA 1OYYA 1HA8A 4ZH4F 5C3EJ 2ZFUA 2M4GA 3AL0C 2CQKA 2VKEA 2OAZA 1N75A 4OU0A 1FOXA 1VQKI 1V5EA 1I39A 1I1SA 5L3DA 1FMWA 2X1CA 1HCRA 4RAFA 1DPRA 5FFXA 3RKXA 5E3MA 1ZELA 2M8GX 2V1XA 4XN3A 4QLCU 1BR2A 4WX9A 3OYMA 3CCEI 3ZQLA 5GPAA 5EGOA 4MQ9F 5EJCA 1F36A 2QUFA 3CO7C 4AYBN 4XRSA 1H9TA 3IH3A 4NC7A 5CPRB 1B8IA 5DV5A 2WB1N 3DTKA 4GGGA 1NG7A 3T8RA 4BKXA 3SZTA 3HOZJ 2PMUA 1AWCA 2DODA 1U78A 4IL6C 5HVQC 2MYSA 2KL4A 1XCVA 1ETVA 3SYTA 2VXDA 1GXQA 2RQQA 5M5YJ 3V42A 2DLLA 1ZLKA 2XF7A 4ZZDA 1L3LA 1FIPA 4BQOA 4CCJA 1VQ7I 1X1BA 2G7UA 5J1RA 4Q48A 2V6EA 3LQQA 3BR0A 1DDNA 4IEJA 1D0XA 1YJWI 4ZZLA 1QNTA 2CH0A 3CZ6A 3EDPA 3R4KA 2HKOA 2X48A 3CJNA 3M4OJ 2VC0A 1ZYRF 3LAPA 2LP0A 1MNMC 2FMYA 2XPVA 4R8HA 4XM3A 1MNEA 1UB9A 3MKYB 3S17J 2HPIA 2P5VA 2TDXA 2DK8A 2OTLI 3OYKA 1JT0A 2B7EA 2R7UA 5BS6A 3SJMA 2HYJA 3HXLA 5DYMA 3K4KA 2JSPA 2A6EF 4RB2C 1KYWA 1ZK8A 3DTEA 3VB2A 2R5ZA 2FF4A 4CCMA 1FYMA 1K6OA 3TO7A 4RLQA 3BWGA 4P96A 3RIRA 3LAJA 4XK4A 3CCMI 3ECHA 4WXCA 2MABA 4RS8A 2MC4A 3LOCA 3WTUC 1XSDA 4IF4A 3LWFA 3B6AA 1Q1HA 4FETA 3TL4X 5K7ZA 2PI0A 4CDGA 1UJ8A 4M71A 2XIGA 3HTUA 4U87A 3ZQIA 3MZYA 2LD5A 3JR9A 4O3MA 4B3XA 3PO3J 3PUBA 1O4XA 2ZSIB 1R1UA 4HNUA 3BT9A 1OCTC 3C7JA 2JWTA 1WWXA 3QYFA 3RYPA 4G7OF 2QKMB 5D5WB 2UXNA 2K7LA 3ZMVA 3L2RA 3GZ6A 1JKPC 3MN2A 2R7RA 2VUMJ 2KP6A 1JHHA 1Z67A 1J75A 1TT5B 2G9WA 2BVMA 3DEEA 5KHDA 2DMNA 1S9HA 4KIBA 4ZJZA 2VODA 1YS6A 2LKPA 1ENHA 4XLFA 4QPQA 3PIOF 2R0QC 4YFNF 1SFOJ 2M3AA 5HDKA 5BQTA 2IGOA 5E3NA 3DCFA 2B9SA 5D6FA 3LSPA 4HLXA 2EFNA 3ZQFA 1ZG5A 3K2ZA 1R49A 1F4KA 3BJAA 4LG3A 1WGXA 4BL0B 4ZYAA 4A6EA 1ERDA 4L9NA 5F0FA 3CF5F 1IN8A 4JOMA 1D5YA 1Z6RA 1VQ5I 3P9KA 1IV6A 1RETA 3CCVI 4BY1J 1WJ5A 3SEQA 4KMUX 3E5XA 1O3RA 2ZXWH 4N4NB 1OCCH 2WY7Q 4LFUA 4IXAA 1I6XA 2QWWA 1L0OC 3HYIA 3MKLA 4LJZF 3B02A 2M34A 5HLIA 5DD4A 2KPMA 2Y69H 1O7LA 5LEJA 4KFCA 3CLOA 3FKJA 1XCBA 5JR3A 2VBYA 3HHGA 4ENJA 4J00A 2KDZA 1ZG3A 5F0CA 2L02A 3CMEI 2JA5J 3GYHX 1R1TA 1XS9A 1P6RA 2HOEA 3T8TA 3G2BA 3TO9A 5L3GA 5GAGJ 2EFOA 4NQWB 3VYSB 3K4JA 2LLKA 1IJWC 2O8KA 2KIMA 4I0BA 4KUMA 1SEUA 4N9IA 1SFKA 4HF2A 2ISYA 4XLPF 3ZQHA 1MBFA 4M3GA 1STZA 2R7FA 3KFWX 4GFBA 3TBIA 4S04A 5EG0B 4RBOA 3G1MA 3OS0A 1X4PA 5L3FA 4UVCA 3WTVC 4KJZA 1JXSA 2GQQA 1ZGAA 2CUZA 4K2EA 1FYLA 2M0MA 3KP4A 1B72B 1Z21A 3DEUA 2LH9A 2XSJC 1RPWA 2I10A 3BG7A 3L9FA 4IHSA 5FFZA 3WU2C 2F6CA 1MMDA 1AU7A 3JTHA 5H20A 1Z1DA 1FIAA 3KEYA 4LK1F 2LBFA 4P9FA 4F3QA 1S8NA 1RIOH 3K7AJ 2ELHA 3W6VA 4DYRA 3M8FA 3FWEA 4Q4ZF 1LJ9A 4YIIA 2XGXA 1QZYA 4HX7A 2DI3A 2P5KA 3FMRA 1EJ9A 3L2WA 3J7AO 4XLNF 1GDTA 5F04A 2P4WA 1LVAA 5HDGA 5JLXA 1YG2A 4I99C 1M1EB 1ONVA 2FA5A 2DJNA 3VDXA 2BHZA 2QQ8A 2BHYA 1T0FA 5BPIA 3K9TA 2GLOA 2ID3A 3SXYA 3N97A 4DQ2A 2E36A 4XORA 3N05A 2D5VA 2QQBA 2XRNA 2P5LC 4BHBA 1YFHA 4RGSA 5K5RA 4F52A 4II2A 3K4NA 1R4MB 1W0TA 3RKWA 1POGA 5ILVA 3OYBA 1R9TJ 2QVOA 4ZTJA 2C6YA 3S15J 2DA1A 3LQRA 3Q9VA 1NK3P 4XRSG 3JRCA 1WRJA 1U6GA 2XUBA 3FK6A 3A1YA 5J1UA 5D5XB 2W4SA 4WF2A 1FY7A 2GAUA 1EH7A 1KU2A 1MJBA 5CVJA 2RAEA 4PJLA 2CG4A 5E1WA 4I7HA 4EVIA 2OF7A 4U0YA 1UMQA 4RLFA 5GAHJ 5FKLA 3JRAA 1FMVA 4EEFG 1QZEA 2ZJRF 1FOWA 4XKWA 5AONA 2AS5F 3CUQA 3HGGA 3HSFA 4B47A 2K9QA 3WE3A 1YE9A 5L3CA 3H0GJ 4HQMA 3MZHA 5HS7A 4GDFA 1TQPA 2JZYA 4HX4A 5FKNA 2CW8A 3A4CA 3M07A 2QBYB 2BOLA 2IGKA 3EUAA 3TEDA 1ETWA 2K3PA 1WHUA 3GUDA 2IS4A 3ZCOA 1R7JA 3FHNA 1TWFJ 2EFPA 3MFKA 3G73A 1R5GA 3L1PA 3HPHA 1VQLI 1IRXA 3BR2A 1F1ZA 4FX0A 2L9RA 2VQGA 3CESA 3HRMA 4HEA2 3FXKA 2HGCA 1MNDA 1OYIA 2DYRH 3GTQJ 4I09A 5CVVA 2IEKA 4IHWA 1FZPB 2ZXJA 3Q0VA 4LB5A 3BDDA 3KPHA 4B4CA 1IGNA 1HKSA 2FNAA 1FX7A 1U5TB 3PQKA 3SEZA 3HIFA 1WH7A 3VYUB 1FTTA 4UUSA 1HW1A 3IH4A 1SC7A 3ZMUA 4M73A 3DLLF 3H9JA 2V26A 4BXUA 4DBQA 3LNQA 1BIBA 2CW0F 2GM4A 4KDPA 1MMSA 3GTGJ 1XDSA 1HW5A 4RB3C 1SFUA 4M3EA 1VQOI 1QHGA 2OC6A 2CFXA 3ABUA 1TC3C 3H1CA 3A01B 1B1BA 2HDDA 3IHUA 1CGPA 2QEXI 4G94A 5JVTA 2X6WA 2M30A 2X51A 1W7PB 2QQ9A 3LSKA 4AVZA 1ETOA 2YU9J 3KYLA 2IXSA 2NS8A 2E1MB 5ED4A 3OMYA 2OJED 5F6FA 2VC1A 3I54A 2W48A 4PJMA 1GXPA 2DA6A 3HPGA 4KMFA 1MBEA 2H94A 3FM3A 2IP2A 5LFAA 1BL0A 3ZGKA 2GXBA 1OMIA 3DBLB 3TW6A 2VPLA 1YTYA 5LGUA 4BQNA 3F8NA 4XLEA 1HSJA 4IRHA 2A07F 1KU9A 2FEZA 4C9YA 1UCRA 4LIVA 3DKYA 4XL9A 4EJVA 3VWBA 2FE3A 4BXFA 4G9YA 4EATA 5E3OA 3PJRA 1WKMA 3IUOA 2F5CA 2R7QA 3C2HA 1I27A 3R0JA 1ON2A 4HZFA 2DA3A 4PGHA 4E7KA 4XOPA 2ZNZA 4BQAA 4OIOF 2MFZA 2GWRA 4A3MJ 5EEHA 2EJRA 4BS9A 2BXZA 1A36A 3KYCB 1XTAA 4JQFA 2CYYA 3J81K 2DOEA 4Q5SF 1USTA 3DBRB 1QO0D 2DFHA 2HEOA 2LF7A 2OUMA 1GVJA 5J47A 1MBHA 1UAAA 1UHSA 2W00A 4GRIA 4IVNA 1S7EA 2BGCA 1XG1A 4CSWA 3M8JA 1DP3A 4EQQA 3OOPA 5ICGA 3VEPA 1K7AA 1BC8C 5J4VA 3GXOA 1GV5A 2W1OA 3ZN0A 1XMXA 2VQHA 3FM5A 1ZRDA 3ASNH 3D5RC 2VONA 2DQLA 1H88C 2X6XA 4MLOA 2D1VA 1UG2A 3R60A 2OQGA 2TCTA 3M1CA 5M3FJ 1APLC 3HOTA 2EWNA 2VJ5A 3BJOA 3F21A 2LOOA 2ELKA 1Q1VA 4U0WA 4AYBA 3GTPJ 2M8EA 1A35A 2UWMA 2WB1A 3RPQA 5L3EA 3IKTA 1BOAA 1HQCA 1BR4A 2RNJA 5KAFC 2HYFA 3R61A 3QYEA 3G1LA 4OOIA 3GTMJ 2L54A 4NB5A 4AM3A 1A6QA 1KA8A 3NQOA 3CJTB 3W2VA 1WZ2A 1XDUA 2YU3A 4A3GJ 1ZLJA 1SD7A 1ETXA 3RQ4A 3IH2A 5CVRA 3WTWC 3AFHA 1R4NB 4NC8A 4CCKA 1BW6A 3RKYA 2R7XA 3S2DJ 3I4NJ 4DW6A 3Q9SA 1E3OC 3H9GA 1MH4A 2EQRA 3EETA 4CCNA 3QRFF 3LA2A 2H6BA 1JHFA 1JGSA 1P92A 4RM3A 1AKHB 4B1RA 4LLLA 4M9XA 4PUSA 5HDNA 3OSFA 1Z7LA 2EBIA 1W0UA 1K78B 1IZ1A 3RPUD 2MLGA 3K70D 2PJRB 2K9SA 2EZLA 3HZJA 2V9PA 1E3PA 3SFIA 2HZTA 3KE2A 2V6CA 2BY3A 3HTSB 4D7MA 1IAWA 1WPKA 4U7DA 4YG2F 3S14J 4LLGF 2PMZN 1G3TA 3KETA 1SVLA 4A3IJ 2ZB9A 3HRSA 1BI2A 1BOBA 2UZKA 4L5IA 2Y0MA 2XAQA 3CF2A 4M6VA 3F23A 2CV1A 2FXAA 3PSIA 2P6TA 4Y4RA 1VQMI 2A69F 2WADA 4II3A 4PSXA 2Y9ZA 2M0CA 3R6SA 5F08A 1BA5A 3V8JA 4M6YA 1W7PD 1D0YA 2COMA 2VLAA 1FOKA 2DA5A 2NS0A 3SHFA 2A05A 1I6HJ 4D9JA 4QSHA 4XBFA 4A3JJ 5EEGA 2F48A 2IPQX 2L9VA 2ME0A 5FKMA 3F8BA 3HOXJ 1PUFB 2V1UA 2XGDA 5KNLA 3FISA 3D0SA 3BPXA 5B1AH 2E34A 4LB6B 4J19A 3HM5A 3LL7A 3S16J 1HC8A 2O03A 4DZPA 4I2OA 1OYWA 2FBHA 3P9CA 3TW7A 4MTEA 2DYSH 4Y3OA 1K4SA 1ZKGA 2FBKA 2E1NA 4A0XA 1FBUA 2LNBA 2LY9A 1ZGWA 3OYLA 3AKZA 5H2FC 1U9NA 2DTRA 2ZFWA 4P55A 2W7NA 3DKWA 2AQEA 3DLAA 3DKXA 4IHTA 4IX7A 2W82A 3AG2H 1ZG1A 2M7BA 1TW3A 3GX4X 3E3VA 2P6SA 2CU7A 3H0DA 2VPRA 2JTVA 3P7NA 5LLQA 4N9HA 4A69C 3HOVJ 3E7LA 3OYHA 3A02A 3GZ5A 4ZTFA 1RKTA 4DOZA 4LD5A 3CCSI 4CCLA 2VOPA 3OYFA 5KCMA 2KDOA 5EDNA 1TBXA 4CXFA 3JRIA 1T98A 2LR8A 1T38A 3TDUC 5HLTA 3KP3A 2VJJA 5EG0A 3OV8A 4A3BJ 4CGZA 1ZTRA 3ELKA 4LLNA 2AO9A 4ENKA 2ESNA 3DPLC 3DPUA 2DPUA 1Y1WJ 2DPDA 3KLOA 1B72A 2EZIA 3FBNB 1BJAA 4Y52J 2ESHA 3BR6A 5E17F 4MFDA 1IN4A 4MO7A 4F7ZA 4A3LJ 4V2GA 3ZQGA 3JTGA 5LD2C 4KNYA 2R5YB 2V7FA 2JA8J 4GYGA 3T5XA 1VFCA 4PJ0C 4PFOA 4XR6A 2FMLA 3VODA 2IJLA 4F55A 1IW7F 3HBLA 5M5XJ 3CD6I 2CUEA 2DOAA 5FB2A 4W97A 4ZDLA 2O5RA 2R92J 2E2JJ 3T1BA 2MW8A 1YOVB 2IGNA 5ICFA 2BY0A 2ETHA 3X2QH 1U8RA 1R36A 5JVGF 3L2CA 2F5VA 3HGYA 1XGSA 2YPRA 1JT6A 1SANA 3BTLA 2LYCA 5J8CA 3JREA 3AG1H 5FKOA 3ESWB 3I55I 1PUEE 3W2AA 1XGNA 1V54H 1J5YA 3QU6A 1YRNB 1ZARA 3PL8A 4EJWA 1YJ9I 2HR3A 3VPRA 2NRAC 3E6CC 2HQRA 3C1DA 1O3TA 1VQNI 3H3ZA 1DU0A 2JUGA 2IS6A 4D5FA 1D8KA 2VL8A 5B5EC 4GO1A 1TZLA 2D2WA 4HYEA 4B09A 1QA6A 2A61A 3I59B 2YUSA 4IOAF 2HQ5A 3ABTA 2D45A 2HXOA 4S0HB 3QAHA 1Z6TA 4BACA 3NAUA 4FHTA 4M74A 3ROUA 4E7JA 4A3DJ 2MG4A 4N0BA 2M2EA 3IWZA 5CVUA 2A68F 2NNNA 3RI4A 3QU3A 1X3WB 3C3WA 2YX4A 1YIJI 4IQJA 5DM7F 3HUGB 1T2KA 1HLVA 2COBA 2MBFA 4OIQF 3FIWA 5EZGA 1ZRCA 2IVMA 3O8GA 2KZGA 3NRVA 4UHTA 4HV6A 1HW2A 2OPTA 4YFXF 4XONA 2DO7A 1LE8B 2RQPA 1QZZA 2Z2SB 3OYDA 4Z2YA 1TW2A 1X1DA 2VJ4A 3JW4A 4KYWA 2O61A 1U9OA 1TWCJ 1FNNA 3A0BC 1WSUA 3WHCA 2OD5A 1Y1VJ 1LVKA 2P7VB 3GLLA 1ZRFA 2STTA 3RDIA 1MJAA 1VTNC 3QPHA 1EF4A 2XC7A 5F64A 4HDUA 3FBIB 2RKHA 5E8GA 5D8LB 1DP7P 5LHGA 4RB1A 2HKXA 3FXUA 5H6RA 1T0FC 4AU7A 3I4PA 5KAIC 3J81Z 1BM9A 4BH9A 3L2VA 5BNGA 3BLYA 4DBRA 1K4TA 3IAM2 3CCLI 3AG3H 3RCOA 4P5OA 4XN0A 5D5UB 3OYCA 2XDVA 3S1NJ 3BJ6A 4AD9A 3A2KA 1EV7A 3AAFA 2K27A 2Y31A 2HNHA 3FXRA 4R79A 4E6KG 2FOWA 3SFZA 1JGGA 2MD0A 1MBJA 2NAZA 2W85A 1JKRC 2O6GE 2DU9A 3M9AA 1SD4A 1MBGA 2DA2A 3HOUJ 2Y75A 3RPUA 4A6DA 1NH3A 5B3SH 3DFGA 5FD6A 4HNVA 3HOSA 4RB0A 1E0EA 3LSMA 3CQZJ 5FLVA 1JE8A 3WGGA 4HG2A 3N4MA 2BBYA 2CWEA 5DCMA 4PJNA 2D1HA 3OYAA 5BPDA 1S7AA 3CDLA 1X4OA 3BTIA 3A01A 3PSFA 5IOYA 2EFWA 4BBSJ 1ITYA 2EV5A 3KCCA 2FQ3A 1LFUP 4CUGA 3LSHA 3CC4I 3O6BB 1WI9A 4G6QA 4L9JA 3OY9A 2PLYA 3KLNA 1SVOA 1GT0C 4G7ZF 1XN7A 2LTPA 1W7PA 3CUQC 1G3WA 1SAXA 4HAMA 1KGSA 3H3UA 2CO5A 4AUXA 1BC7C 3PUFA 3RZOJ 4B3AA 4MEXF 2FQ4A 4LGWA 4ZC3A 1IN5A 2J5OA 2LF8A 2QSFX 2DDBA 2XAJA 2AQFA 2JVHA 2O0YA 2W57A 5E18F 5DDGA 1MDMB 4YEJA 2DT7B 2NNYA 1FJLA 2MH2A 3PNYA 3U2RA 3S2HJ 1KYZA 2XPWA 3KZIC 2HQAA 3BY6A 4C2MJ 1W5TA 4ZYDA 3G3ZA 2V79A 1XGMA 1J0RA 1V3FA 3ERMA 3SQNA 1C0WA 3BCAA 1V5FA 2IA0A 3GTLJ 2A6HF 2VBWA 2VQLA 1TWGJ 4JBAA 4HOBA 2LY2A 3FMQA 3LSRA 3WU0A 2P8TA 4HQEA 2W24A 2WAFA 3KZZA 2V1NA 2WV0A 4LG0B 4ZDOA 4E7ZA 3H36A 1FBQA 3F0CA 2DMPA 4F91B 2X6OA 4ENNA 2WY8Q 1I3QJ 3LSGA 3NWSA 2HDWA 1XSXA 2XKPA 3H5NA 4RAYA 3BZKA 2Q2EA 4HLYA 1E3HA 2LKSA 2VE8A 2HXIA 5K7HA 3PNTA 3F8CA 4ZYGA 1R58A 2VBZA 3HG9A 3DPTA 3GTJJ 3WTXC 5GTIC 1OPCA 2OBPA 3DP7A 4PK4A 4L9VA 4B44A 1IO2A 2VIXA 4Y33A 5LHHA 2KQRA 2X4HA 3TGNA 5DCFA 1IUYA 5KVRA 2QQAA 2R7OA 1S5LC 3TP3A 1RUNA 1HXDA 3ULQB 3U1KA 1R00A 2BEOA 3S3NA 1X1PA 2ZXIA 3HRUA 2DFIA 3G6EI 5D5VB 2F5DA 3PFIA 1YYVA 2X1EA 5TGTA 4FT8A 2EFQA 1HSTA 3DXJF 2LRDA 4B48A 1VF9A 4GCVA 3K0LA 4EGZA 1O3SA 1IN6A 2DMQA 2L9SA 4YIFA 4FTHA 5LGTA 2PFBA 1IXCA 2A5YB 1B59A 3VYTB 3F8MA 1X2MA 2ZO4A 4UVAA 2DOFA 3NARA 4IO9F 1CF7B 3S32A 2P7CB 3U9GA 5C4JJ 2HTJA 3BOQA 4L5JA 2VN2A 2EK5A 2ELJA 4FE7A 3WG9A 2XB0X 2XVCA 2KIQA 5GPCA 1SFXA 4E70A 4ESFA 2J5PA 1P4XA 3QPSA 2H8WA 3HDDA 1JKOC 1J7KA 3F3XA 1OQYA 2CUJA 1OJLA 3BR5A 1AKHA 2MD5A 3Q5FA 1K78A 5HS8A 3TDZC 3IAS2 2ZMEB 1H8AC 2MA3A 3ABMH 3FX3A 1A6IA 2YS9A 2VQCA 3FHZA 4A5NA 4OIRF 1LEBA 3L2QA 2R5ZB 3LFUA 1ODDA 2DK5A 2EA4A 1TWAJ 3QPLA 4FE4A 4CZCA 1NHAA 4L9TA 3OWTA 2I8DA 2FD5A 3OYEA 2JRMA 1LDKB 5E1ZB 3U21A 2EA2A 1UFMA 4OINF 2UUZA 2XPUA 2GIVA 1HF0A 1MIJA 1D1BA 4OWRB 2A6TA 1WCMJ 2KZVA 1FWZA 3BR1A 3MAJA 4PZJA 1I3AA 1PUFA 4N4OB 2ZJ2A 2BY2A 2JA7J 4UVBA 2W25A 5JI6A 1WH5A 1W1WE 5EEAA 1ZREA 1G4DA 3CC2I 1S72I 2E35A 2M87A 5IYBJ 4YRVA 3GTOJ 2ZNYA 1FTZA 3SDGA 3S3MA 1TLHB 4BE2A 1VQPI 4DGWB 1DU6A 5LEKA 2PMZA 3K4CA 3KEOA 4RGXA 3PIPF 5F1RA 4XICA 3K69A 3AL0B 1GHCA 2K5CA 2X0LA 3WU1B 1U0JA 2CFOA 3H5AA 5H6QA 3CP8A 5ILUA 1LPQA 2IRFG 4M3FA 3H3VK 1KQ9A 4CO8A 2E2HJ 3LA7A 3Q0UA 1AHDP 4BQQA 4LOCA 4HA8A 4Y13A 3OYGA 2XGCA 3GEZA 2Q0OA 2WBMA 2V1DA 5BMZA 1XC5A 3S3OA 1OR7A 1LEAA 3S2WA 2DQRA 4I0AA 3J7AY 3HB9A 4EM2A 1XMAA 3VSLA 5TJJA 4BDYA 4A5MA 1FLIA 4JX5A 4UY8I 3BG5A 4Y15A 2E71A 2OU2A 5TRDA 2R3SA 3FKIJ 3FXMA 4A3CJ 5FLXK 3BZ6A 3EPZA 3WTTC 5FLMJ 3OS2A 4M9ZA 4HRIA 1TT0A 2HOAA 1A31A 4E7LA 2OA4A 4HV5A 2JUCA 2LK2A 1BI0A 2A5WA 5FKKA 2KT0A 2XF5A 2LREA 3I4MJ 1MMGA 4O6JA 3I0TA 2GXGA 2KJCA 2ECCA 2XGEA 2H8RA 3I71A 1V4RA 2MC3A 4UV9A 4MTDA 1N25A 1R5HA 4BJTA 4A93J 4KISA 4XOTA 3V7CA 3I58A 4QWQA 1U8BA 2K85A 3HC7A 2F4MB 2KRCA 2P81A 3LSIA 5D6EA 2VJIA 5FO5A 1F5TA 3E97A 4ASNA 3OS1A 2H1LA 1D5VA 2M5WA 3ZQCA 1QBJA 3CDIA 1DGRM 4F92B 2WAQN 4S05A 1YW8A 2NOGA 2TRTA 3QP6A 4JYKA 1FP1D 2W84A 2QYOA 5EYRA 3CCJI 1YRNA 5ERIA 1PP8F 4NBQA 2KIFA 3ERED 2FX0A 1WVRA 4IHVA 2RV8A 3UKGA 5CQGA 4WXHA 4KN4X 1EA3A 3LMMA 4MHGA 2BVLA 3R0AA 1ETKA 2IA2A 2ZBKA 3CMYA 1REPC 2RN7A 2HOTA 5K5QA 2EIKH 1FYKA 2LFBA 2V4JC 4ZYEA 3JRBA 3BQYA 3JRDA 4AIDA 2RNGA 2CSOA 4XQFA 3D1NI 4PSWA 3K1MA 2R7WA 5IPAA 3HOYJ 1OFCX 3Q0WA 3KZYA 5EZHA 4M3DA 1JUMA 2RREA 4RAZA 3E1SA 4ON0A 4ESBA 2O3FA 5DS9A 1X58A 4U0VA 1D1CA 3GO5A 1FP2A 1IF1A 1TL8A 3WG7H 6PAXA 2HWVA 3FXOA 1DUXC 1FBSA 1G2HA 1OCZH 2EV6A 2L9NA 5C44J 1LE8A 5E20A 3ONQA 3F22A 2DA4A 3K4BA 2DFFA 4XKVA 1BBYA 2DBBA 1G6NA 5JFRA 1A5JA 4XRMA 1Y0UA 2VE9A 4XKBA 4KT6A 4O5VA 3ZMDA 2VBXA 4MEYF 3PM1A 4E4HA 4RGUA 5E8IA 4P9UA 2NVQJ 4QIWN 2O7OA 1X3UA 2E7WA 3AG4H 4L5EA 4CYCB 2A3SA 4AIJA 2L7FP 5J1YA 3DV8A 1I50J 2CQXA 2FUG2 2EILH 3RSNA 2IBDA 1IDZA 1XX5A 5HLGA 2QSGX 3QYBA 3JAMK 4BE0A 3NEUA 2LKXA 4XRFA 4BU2A 3JRHA 4X6AJ 4BJ6C 5TISC 3HEFA 4WWCA 4BUPA 3BG3A 3CC7I 4Y7NJ 2ISZA 5FROA 1MMAA 2EPFA 3FK7A 2V9VA 2AXTC 3FF5A 4W1UA 2L01A 3BZCA 3S93A 3ZQ7A 4ABZA 5J6XA 4U7BA 2PX9A 2DMUA 2O9LA 1T8IA 4CICA 2OCEA 3RKQA 5B1BH 3HJEA 4NHJA 3JCUC 2OZUA 5LHIA 1QHHD 2BW3B 4BGDA 2FU4A 1N78A 1PYVA 1LB2A 2F4OB 3WHBA 1IRFA 4AIHA 2E19A 1USSA 2GOXB 2R4GA 1ETYA 1YQAA 4BEHB 2YX7A 2JA6J 3UNGC 1RI7A 2O8XA 3L00A 4R1HA 5FD5A 2NVTJ 2VT2A 1LUJB 1VQ9I 1JTXA 4UUSB 2M4KA 4NQWA 2DA7A 1YX5A 3CMAI 3S1MJ 1LFBA 3HKZN 4DYCA 4YFKF 5HNFA 1UG0A 3BQZA 3QOPA 1QU3A 1BN5A 2K4BA 4HW0A 3H92A 2HPMA 3F6OA 2IT0A 3IP4B 3J80K 4PDKA 2JQ7A 1Y39A 4WCGA 1UZCA 4PGGA 5IYCJ 3OL3A 1ZGJA 3GTKJ 4G8XA 4FQGA 4CYDA 2DTZA 1GV2A 4HF1A 2ID6A 1W4MA 1YITI 2DN0A 2FRHA 3DQVC 1TQIA 2R7SA 4CHUA 2N8GA 3O3KA 5CLSA 2KFDA 2K86A 3TP0A 3TO6A 4DJAA 1OCRH 3M1EA 3FXQA 1U5TC 2UXXA 5LRSA 3K70C 4A3FJ 3HSRA 1SMTA 4ENMA 4EV0A 3OR1C 2JMWA 1YW9A 1SAUA 1RESA 4TV7A 1DQUA 2IW5A 4C3JJ 1XD7A 4CA0A 2E1CA 1QGPA 3CCUI 2PN6A 3E5UA 1OCPA 4J01A 1OISA 1T6SA 4ANJA 1KQ0A 4XKCA 2Z9OA 3WODF 4NDLA 3BR3A 4HSRA 4LMYA 4GYIA 3JSOA 2UV1A 3K1PA 4UUTA 3FXJA 2ADUA 1A04A 3LA3A 1P2FA 2R7DA 2WAEA 3GVAA 4C3IJ 4DNCA 5DEQA 3CO6C 4I6ZA 1AOYA 1WI3A 3BPVA 1RR7A 3F72A 5JHFA 1U2WA 2XROA 2E1MC 1G59A 1MKMA 1P4WA 1WJDA 2E1OA 4UB6C 1LNWA 3WE2A 3CCRI 2QCOA 4D1QA 3FXLA 5LRRA 2M45A 5D4SA 2Y2ZA 4L0YB 1IRGA 3BTCA 5F27A 2OTJI 3ZMSA 3CLQA 2VKVA 2RVCA 4MNUA 1Y56A 2E2IJ 3OIPA 4FASD 3WTSC 2JJ7A 1CF7A 4IZZA 1JUSA 3KYDB 3E0JB 3RJPA 4C2UA 3ML6A 1MMNA 4IOCF 1XB4A 3H35A 5JLWA 1Z7UA 1RUOA 1YX3A 3MQ0A 1VZ0A 1K79A 1F9NA 3HL2A 4IRIA 2WC2A 4B8XA 1YJNI 5L3BA 3ZMZA 1D0ZA
chains in the Genus database with same CATH topology
5C4XJ 3C2BA 3MVPA 2HXIA 5K7HA 5IOZA 3OIOA 1ETOA 2YU9J 2H1KA 2DMTA 2Y30A 4JX6A 2NS7A 3GTJJ 2NS8A 1GVDA 2B63J 2W48A 2DA6A 1MBEA 1BL0A 4MIMA 3TP3A 1TWHJ 3TW6A 4A3EJ 1JKQC 2LVSA 4X1EA 3HOWJ 2VI6A 2MGQA 2R7ZJ 1VF9A 2X9DA 2DMQA 1JJ6C 5E3OA 4FTHA 2G0EA 3LSJA 2QF7A 1X2MA 1IRZA 3NARA 2DA3A 3IV5A 5C4JJ 1F43A 4A3MJ 4FE7A 4A3KJ 2XB0X 4I76A 1MSFC 5GPCA 2JK3A 2Y0SN 3S1RJ 3QPSA 1NK2P 1JKOC 3HDDA 1MBHA 1UHSA 2CRGA 4D7NA 1S7EA 1OJLA 3BR5A 1XG1A 1AKHA 1VNDA 1ZR2A 3S1QJ 1H8AC 1P7IA 1A6IA 1GV5A 2YS9A 4BBRJ 4D5CA 1IUFA 1K83J 1IC8A 1H88C 2ECBA 4MLOA 2R5ZB 3JRFA 1UG2A 5M3FJ 2TCTA 1TWAJ 3QPLA 1APLC 1HDDC 4FE4A 5C3EJ 2ELKA 1Q1VA 2VKEA 3GTPJ 2FD5A 5K7FA 1HCRA 3K2AA 3G1LA 3RQIA 5E3MA 2M8GX 2XPUA 3GTMJ 1QRYA 1HF0A 2IAIA 1BJZA 5M5WJ 3ZQLA 5GPAA 5EGOA 2CUFA 1WCMJ 1F36A 3BR1A 4AYBN 4XRSA 4A3GJ 1PUFA 3IH3A 1ETXA 2JA7J 3IH2A 1B8IA 1BW5A 1NTCA 2WB1N 1WH5A 1BW6A 4BKXA 5EEAA 3S2DJ 3HOZJ 3I4NJ 4DW6A 5IYDJ 1U78A 1E3OC 5M3MJ 1MH4A 1FTZA 5IYBJ 3GTOJ 1ETVA 3SDGA 2EQRA 1DU6A 5M5YJ 4MFEA 1AKHB 4B1RA 1FIPA 3OSFA 2EBIA 1W0UA 4XICA 2K9SA 1MH3A 5J1RA 2EZLA 3SFIA 3BR0A 5HODA 4IEJA 1QVTA 4D7MA 1WPKA 4M3FA 3H3VK 3S14J 2X48A 2EH3A 2PMZN 3M4OJ 1IG7A 2E2HJ 3Q0UA 4A3IJ 2ZB9A 1AHDP 4LOCA 2XGCA 4M6VA 2LP0A 1MNMC 2XPVA 1XC5A 3S17J 2Y9ZA 2M0CA 3HB9A 5F08A 1BA5A 1JT0A 3RZDJ 3SJMA 3GBGA 2DA5A 2HYJA 4JX5A 3BG5A 5EGOB 1ZK8A 1I6HJ 3FKIJ 2Y9YA 4QSHA 5DTDA 4A3CJ 4A3JJ 2ME0A 1PUFB 3HOXJ 5FKMA 2R5ZA 1ZR4A 2XGDA 1B8IB 5FLMJ 3FISA 4AC0A 1HDPA 2HOAA 5E3LA 3HM5A 4J19A 4XK4A 3S16J 1Z0XA 2LK2A 2M9HA 5FKKA 4DZPA 2KT0A 1CQTA 3I4MJ 3G1OA 3TW7A 3LOCA 3B6AA 2ECCA 1ZKGA 5K7ZA 2XGEA 2H8RA 3ZQIA 2LY9A 1ZGWA 2ME6A 2LD5A 4A93J 3JR9A 3PO3J 4V2FA 1U8BA 1U9NA 1O4XA 3BT9A 1OCTC 2MSYA 2JWTA 2K40A 2P81A 2R93J 1JKPC 5IP6A 1MSEC 2CU7A 3MN2A 3ZQCA 2VPRA 2VUMJ 4A69C 3HOVJ 3E7LA 2WAQN 3PO2J 3A02A 4JX4A 1RKTA 2DMNA 2NOGA 2EZKA 2TRTA 4JYKA 1ENHA 2R0QC 5EYRA 2CQQA 5EDNA 1YRNA 3JRIA 1SFOJ 5E3NA 1QVUA 2LR8A 3DCFA 3ZOBA 2FX0A 3LSPA 3ZQFA 4IHVA 5EG0A 3UKGA 4A3BJ 1ZTRA 1WGXA 2HOSA 4FISA 2AO9A 1Y1WJ 3QQAA 4CYCA 1ETKA 1B72A 5F0FA 3CMYA 2EZIA 3CCYA 1D5YA 2HOTA 4Y52J 3BR6A 4MFDA 4MO7A 4IHYA 1IV6A 1RETA 4A3LJ 1P7JA 4V2GA 4BY1J 2LFBA 3ZQGA 2NVXJ 2R5YB 3JRBA 3BQYA 2JA8J 2FJ1A 3JRDA 1VFCA 3D1NI 5IPAA 3HOYJ 3HBLA 5M5XJ 2L7ZA 1OFCX 3MKLA 3Q0WA 2CUEA 2JN6A 4M3DA 5EZHA 2M34A 4W97A 5EF6A 1JUMA 2R92J 2E2JJ 5DS9A 5J3LA 2MW8A 1X58A 3M3YJ 2KDZA 5F0CA 3HGYA 1JT6A 1SANA 2JA5J 3BTLA 1XS9A 4IHXA 1G2HA 4RDUA 3JREA 2EZHA 5FKOA 4FCYA 5C44J 1LE8A 2LLKA 1IJWC 2O8KA 2DA4A 3ZQHA 1YRNB 1MBFA 4M3GA 3VPRA 1X2NA 1A5JA 4XRMA 3DEWA 4GFBA 5EG0B 1DU0A 4RBOA 4D5FA 3PM1A 2HI3A 3G1MA 2NVQJ 4QIWN 2O7OA 1JJ8C 4L5EA 4CYCB 1B72B 2L7FP 5J1YA 2YUSA 2HQ5A 1I50J 1RPWA 2CQXA 2I10A 2IBDA 2WV1A 1IDZA 2HXOA 4S0HB 3NAUA 4DYQA 4A3DJ 1AU7A 2MG4A 3BG9A 1FIAA 2LKXA 3JRHA 2M2EA 4X6AJ 3HEFA 3K7AJ 2AHQA 3BG3A 4Y7NJ 3W6VA 4M3BA 3FK7A 4DYRA 4W1UA 1HLVA 2COBA 5GP9A 4ABZA 2DMUA 2O9LA 3FIWA 5EZGA 1QPIA 3O8GA 3B6CA 1GDTA 5F04A 3A03A 4BXXJ 3RKQA 2OPTA 5JLXA 1RKWA 2GBYA 2R5YA 1FEXA 1LE8B 1H89C 1GUUA 2DJNA 3OSGA 4BY7J 3OOUA 3WHBA 2GLOA 2ID3A 1U9OA 5F1JA 1K61A 1TWCJ 1MBKA 2E19A 3WHCA 2D5VA 1Y1VJ 1ETYA 2XB5A 2JA6J 1EF4A 4C3HJ 1W0TA 1POGA 4G12A 1R9TJ 5IP7J 1JUPA 2NVTJ 3S15J 2DA1A 5BNGA 1JTXA 4UUSB 1NK3P 2DA7A 4XRSG 1T56A 3S1MJ 3JRCA 3FK6A 1ETQA 1LFBA 3HKZN 4DYCA 3S1NJ 5J1UA 2L0KA 3BQZA 2Y31A 1JGGA 1IDYA 1MBJA 1JKRC 2CJJA 1ORKA 1MBGA 2RAEA 2DA2A 3BTJA 3HOUJ 5FJ8J 2OF7A 5IYCJ 3GTKJ 1UMQA 2DTZA 1GV2A 5FKLA 4HNVA 3JRAA 4EEFG 2ID6A 3CQZJ 2DN0A 5FLVA 2N8GA 3HGGA 3TP0A 2K9QA 4JP0A 3CDLA 4A3FJ 3H0GJ 3BTIA 3A01A 2JMWA 5IOYA 5FKNA 1RESA 1JTYA 4BBSJ 2XRLA 1ITYA 1LFUP 9ANTA 4C3JJ 1GT0C 2LTPA 3TEDA 1ETWA 1OCPA 4DZJA 3RZOJ 4AUXA 4NDLA 3BR3A 3Q3SA 4B3AA 2K9NA 2FQ4A 1ZQ3P 1TWFJ 4UUTA 4QTRA 1VI0A 3L1PA 3BR2A 5F0HA 2L9RA 4C3IJ 4I6ZA 3GTQJ 1FJLA 1WI3A 3S2HJ 1RR7A 2XPWA 5IP9J 4XIDA 2IEKA 4IHWA 2L7MP 3O8HA 3Q0VA 4C2MJ 4B4CA 1IGNA 2E1OA 1Z77A 2NVYJ 2QCOA 3GTLJ 2Y2ZA 1TWGJ 3LSRA 1WH7A 3BTCA 1FTTA 4UUSA 5F27A 2XSDC 3IH4A 1T33A 2VKVA 2E2IJ 2JJ7A 3LNQA 2GM4A 1JUSA 3GTGJ 1HOMA 3F0CA 2DMPA 4M3EA 2X6OA 1I3QJ 1TC3C 3LSGA 5JLWA 3A01B 2HDDA 3JRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4X J;  3C2B A;  3MVP A;  2HXI A;  5K7H A;  5IOZ A;  3OIO A;  1ETO A;  2YU9 J;  2H1K A;  2DMT A;  2Y30 A;  4JX6 A;  2NS7 A;  3GTJ J;  2NS8 A;  1GVD A;  2B63 J;  2W48 A;  2DA6 A;  1MBE A;  1BL0 A;  4MIM A;  3TP3 A;  1TWH J;  3TW6 A;  4A3E J;  1JKQ C;  2LVS A;  4X1E A;  3HOW J;  2VI6 A;  2MGQ A;  2R7Z J;  1VF9 A;  2X9D A;  2DMQ A;  1JJ6 C;  5E3O A;  4FTH A;  2G0E A;  3LSJ A;  2QF7 A;  1X2M A;  1IRZ A;  3NAR A;  2DA3 A;  3IV5 A;  5C4J J;  1F43 A;  4A3M J;  4FE7 A;  4A3K J;  2XB0 X;  4I76 A;  1MSF C;  5GPC A;  2JK3 A;  2Y0S N;  3S1R J;  3QPS A;  1NK2 P;  1JKO C;  3HDD A;  1MBH A;  1UHS A;  2CRG A;  4D7N A;  1S7E A;  1OJL A;  3BR5 A;  1XG1 A;  1AKH A;  1VND A;  1ZR2 A;  3S1Q J;  1H8A C;  1P7I A;  1A6I A;  1GV5 A;  2YS9 A;  4BBR J;  4D5C A;  1IUF A;  1K83 J;  1IC8 A;  1H88 C;  2ECB A;  4MLO A;  2R5Z B;  3JRF A;  1UG2 A;  5M3F J;  2TCT A;  1TWA J;  3QPL A;  1APL C;  1HDD C;  4FE4 A;  5C3E J;  2ELK A;  1Q1V A;  2VKE A;  3GTP J;  2FD5 A;  5K7F A;  1HCR A;  3K2A A;  3G1L A;  3RQI A;  5E3M A;  2M8G X;  2XPU A;  3GTM J;  1QRY A;  1HF0 A;  2IAI A;  1BJZ A;  5M5W J;  3ZQL A;  5GPA A;  5EGO A;  2CUF A;  1WCM J;  1F36 A;  3BR1 A;  4AYB N;  4XRS A;  4A3G J;  1PUF A;  3IH3 A;  1ETX A;  2JA7 J;  3IH2 A;  1B8I A;  1BW5 A;  1NTC A;  2WB1 N;  1WH5 A;  1BW6 A;  4BKX A;  5EEA A;  3S2D J;  3HOZ J;  3I4N J;  4DW6 A;  5IYD J;  1U78 A;  1E3O C;  5M3M J;  1MH4 A;  1FTZ A;  5IYB J;  3GTO J;  1ETV A;  3SDG A;  2EQR A;  1DU6 A;  5M5Y J;  4MFE A;  1AKH B;  4B1R A;  1FIP A;  3OSF A;  2EBI A;  1W0U A;  4XIC A;  2K9S A;  1MH3 A;  5J1R A;  2EZL A;  3SFI A;  3BR0 A;  5HOD A;  4IEJ A;  1QVT A;  4D7M A;  1WPK A;  4M3F A;  3H3V K;  3S14 J;  2X48 A;  2EH3 A;  2PMZ N;  3M4O J;  1IG7 A;  2E2H J;  3Q0U A;  4A3I J;  2ZB9 A;  1AHD P;  4LOC A;  2XGC A;  4M6V A;  2LP0 A;  1MNM C;  2XPV A;  1XC5 A;  3S17 J;  2Y9Z A;  2M0C A;  3HB9 A;  5F08 A;  1BA5 A;  1JT0 A;  3RZD J;  3SJM A;  3GBG A;  2DA5 A;  2HYJ A;  4JX5 A;  3BG5 A;  5EGO B;  1ZK8 A;  1I6H J;  3FKI J;  2Y9Y A;  4QSH A;  5DTD A;  4A3C J;  4A3J J;  2ME0 A;  1PUF B;  3HOX J;  5FKM A;  2R5Z A;  1ZR4 A;  2XGD A;  1B8I B;  5FLM J;  3FIS A;  4AC0 A;  1HDP A;  2HOA A;  5E3L A;  3HM5 A;  4J19 A;  4XK4 A;  3S16 J;  1Z0X A;  2LK2 A;  2M9H A;  5FKK A;  4DZP A;  2KT0 A;  1CQT A;  3I4M J;  3G1O A;  3TW7 A;  3LOC A;  3B6A A;  2ECC A;  1ZKG A;  5K7Z A;  2XGE A;  2H8R A;  3ZQI A;  2LY9 A;  1ZGW A;  2ME6 A;  2LD5 A;  4A93 J;  3JR9 A;  3PO3 J;  4V2F A;  1U8B A;  1U9N A;  1O4X A;  3BT9 A;  1OCT C;  2MSY A;  2JWT A;  2K40 A;  2P81 A;  2R93 J;  1JKP C;  5IP6 A;  1MSE C;  2CU7 A;  3MN2 A;  3ZQC A;  2VPR A;  2VUM J;  4A69 C;  3HOV J;  3E7L A;  2WAQ N;  3PO2 J;  3A02 A;  4JX4 A;  1RKT A;  2DMN A;  2NOG A;  2EZK A;  2TRT A;  4JYK A;  1ENH A;  2R0Q C;  5EYR A;  2CQQ A;  5EDN A;  1YRN A;  3JRI A;  1SFO J;  5E3N A;  1QVU A;  2LR8 A;  3DCF A;  3ZOB A;  2FX0 A;  3LSP A;  3ZQF A;  4IHV A;  5EG0 A;  3UKG A;  4A3B J;  1ZTR A;  1WGX A;  2HOS A;  4FIS A;  2AO9 A;  1Y1W J;  3QQA A;  4CYC A;  1ETK A;  1B72 A;  5F0F A;  3CMY A;  2EZI A;  3CCY A;  1D5Y A;  2HOT A;  4Y52 J;  3BR6 A;  4MFD A;  4MO7 A;  4IHY A;  1IV6 A;  1RET A;  4A3L J;  1P7J A;  4V2G A;  4BY1 J;  2LFB A;  3ZQG A;  2NVX J;  2R5Y B;  3JRB A;  3BQY A;  2JA8 J;  2FJ1 A;  3JRD A;  1VFC A;  3D1N I;  5IPA A;  3HOY J;  3HBL A;  5M5X J;  2L7Z A;  1OFC X;  3MKL A;  3Q0W A;  2CUE A;  2JN6 A;  4M3D A;  5EZH A;  2M34 A;  4W97 A;  5EF6 A;  1JUM A;  2R92 J;  2E2J J;  5DS9 A;  5J3L A;  2MW8 A;  1X58 A;  3M3Y J;  2KDZ A;  5F0C A;  3HGY A;  1JT6 A;  1SAN A;  2JA5 J;  3BTL A;  1XS9 A;  4IHX A;  1G2H A;  4RDU A;  3JRE A;  2EZH A;  5FKO A;  4FCY A;  5C44 J;  1LE8 A;  2LLK A;  1IJW C;  2O8K A;  2DA4 A;  3ZQH A;  1YRN B;  1MBF A;  4M3G A;  3VPR A;  1X2N A;  1A5J A;  4XRM A;  3DEW A;  4GFB A;  5EG0 B;  1DU0 A;  4RBO A;  4D5F A;  3PM1 A;  2HI3 A;  3G1M A;  2NVQ J;  4QIW N;  2O7O A;  1JJ8 C;  4L5E A;  4CYC B;  1B72 B;  2L7F P;  5J1Y A;  2YUS A;  2HQ5 A;  1I50 J;  1RPW A;  2CQX A;  2I10 A;  2IBD A;  2WV1 A;  1IDZ A;  2HXO A;  4S0H B;  3NAU A;  4DYQ A;  4A3D J;  1AU7 A;  2MG4 A;  3BG9 A;  1FIA A;  2LKX A;  3JRH A;  2M2E A;  4X6A J;  3HEF A;  3K7A J;  2AHQ A;  3BG3 A;  4Y7N J;  3W6V A;  4M3B A;  3FK7 A;  4DYR A;  4W1U A;  1HLV A;  2COB A;  5GP9 A;  4ABZ A;  2DMU A;  2O9L A;  3FIW A;  5EZG A;  1QPI A;  3O8G A;  3B6C A;  1GDT A;  5F04 A;  3A03 A;  4BXX J;  3RKQ A;  2OPT A;  5JLX A;  1RKW A;  2GBY A;  2R5Y A;  1FEX A;  1LE8 B;  1H89 C;  1GUU A;  2DJN A;  3OSG A;  4BY7 J;  3OOU A;  3WHB A;  2GLO A;  2ID3 A;  1U9O A;  5F1J A;  1K61 A;  1TWC J;  1MBK A;  2E19 A;  3WHC A;  2D5V A;  1Y1V J;  1ETY A;  2XB5 A;  2JA6 J;  1EF4 A;  4C3H J;  1W0T A;  1POG A;  4G12 A;  1R9T J;  5IP7 J;  1JUP A;  2NVT J;  3S15 J;  2DA1 A;  5BNG A;  1JTX A;  4UUS B;  1NK3 P;  2DA7 A;  4XRS G;  1T56 A;  3S1M J;  3JRC A;  3FK6 A;  1ETQ A;  1LFB A;  3HKZ N;  4DYC A;  3S1N J;  5J1U A;  2L0K A;  3BQZ A;  2Y31 A;  1JGG A;  1IDY A;  1MBJ A;  1JKR C;  2CJJ A;  1ORK A;  1MBG A;  2RAE A;  2DA2 A;  3BTJ A;  3HOU J;  5FJ8 J;  2OF7 A;  5IYC J;  3GTK J;  1UMQ A;  2DTZ A;  1GV2 A;  5FKL A;  4HNV A;  3JRA A;  4EEF G;  2ID6 A;  3CQZ J;  2DN0 A;  5FLV A;  2N8G A;  3HGG A;  3TP0 A;  2K9Q A;  4JP0 A;  3CDL A;  4A3F J;  3H0G J;  3BTI A;  3A01 A;  2JMW A;  5IOY A;  5FKN A;  1RES A;  1JTY A;  4BBS J;  2XRL A;  1ITY A;  1LFU P;  9ANT A;  4C3J J;  1GT0 C;  2LTP A;  3TED A;  1ETW A;  1OCP A;  4DZJ A;  3RZO J;  4AUX A;  4NDL A;  3BR3 A;  3Q3S A;  4B3A A;  2K9N A;  2FQ4 A;  1ZQ3 P;  1TWF J;  4UUT A;  4QTR A;  1VI0 A;  3L1P A;  3BR2 A;  5F0H A;  2L9R A;  4C3I J;  4I6Z A;  3GTQ J;  1FJL A;  1WI3 A;  3S2H J;  1RR7 A;  2XPW A;  5IP9 J;  4XID A;  2IEK A;  4IHW A;  2L7M P;  3O8H A;  3Q0V A;  4C2M J;  4B4C A;  1IGN A;  2E1O A;  1Z77 A;  2NVY J;  2QCO A;  3GTL J;  2Y2Z A;  1TWG J;  3LSR A;  1WH7 A;  3BTC A;  1FTT A;  4UUS A;  5F27 A;  2XSD C;  3IH4 A;  1T33 A;  2VKV A;  2E2I J;  2JJ7 A;  3LNQ A;  2GM4 A;  1JUS A;  3GTG J;  1HOM A;  3F0C A;  2DMP A;  4M3E A;  2X6O A;  1I3Q J;  1TC3 C;  3LSG A;  5JLW A;  3A01 B;  2HDD A;  3JRG A; 
#chains in the Genus database with same CATH topology
 4XSZ F;  5FLX Z;  3CUO A;  3MVP A;  5GAD J;  4BHP A;  1WQ2 A;  1V55 H;  3OIO A;  3W3C A;  5IOZ A;  2H1K A;  2DMT A;  4XLC A;  1WJF A;  2DFE A;  2KIS A;  1GVD A;  2ZME A;  2LMD A;  5AIQ A;  1I5Z A;  1T95 A;  5HLH A;  2JA2 A;  1RNL A;  3I3L A;  3EUH A;  5FGM A;  4CZZ A;  3P9I A;  3TOA A;  3GW2 A;  2QKL B;  4ZDP A;  1Z05 A;  3V7R A;  2FBI A;  1J9I A;  5DUI A;  2BYV E;  4OMZ A;  4MIM A;  4RM2 A;  2CGP A;  1PJR A;  4H0E A;  2KMU A;  1JKQ C;  2QBY A;  3MWM A;  5A2Q K;  2VI6 A;  2MGQ A;  3EYY A;  2R7Z J;  4QPO A;  5DUK A;  2X9D A;  3E6B A;  4LIU A;  1OLT A;  2GA1 A;  2H6C A;  4M6X A;  3L2U A;  1JJ6 C;  2Z16 A;  4BDZ A;  4B43 A;  1FPQ A;  1YO5 C;  2G0E A;  3LSJ A;  3OL4 A;  3E6M A;  1IRZ A;  4PJJ A;  4EJT A;  1XMK A;  1FSE A;  3KIO A;  1UEL B;  3CTA A;  1F43 A;  1W36 D;  2XF6 A;  1W5S A;  3HRT A;  1Z3X A;  2Q8K A;  3DF8 A;  1W5C C;  2JRT A;  3GFM A;  3MEX A;  1X1A A;  4I76 A;  1MSF C;  4L0Z B;  2ICW G;  2JK3 A;  3FMS A;  2Y0S N;  1KON A;  5HS9 A;  1FT9 A;  2CRG A;  2VAS A;  1U5T A;  3C2G A;  5GTH C;  1S29 A;  1X3Z B;  1G3Y A;  2F5F A;  2OQR A;  4BJ5 C;  1ZR2 A;  2HS5 A;  1JI8 A;  2YR2 A;  3S1Q J;  4OIP F;  3ABL H;  4BHC A;  2M7A A;  1P7I A;  1D1A A;  4BBR J;  4D5C A;  1IUF A;  5KK1 A;  1Z91 A;  3BG6 A;  4HBL A;  2ECB A;  4XSX F;  1LDD A;  2E7X A;  3JRF A;  1UHM A;  4P1W A;  1HDD C;  2K4J A;  4BNC A;  2Y48 A;  2XAG A;  5LGN A;  1PVE A;  1Y8R B;  3KX2 A;  1S7O A;  3KP6 A;  3QOE A;  2E5N A;  2HVS A;  3GFJ A;  1Z3Y A;  3SZP A;  5K7F A;  3MCZ A;  1HBX G;  2LDU A;  2FSW A;  3K2A A;  3RQI A;  1HKQ A;  1QRY A;  3ABK H;  3V4G A;  2IAI A;  1BJZ A;  5M5W J;  2PMH A;  2JPC A;  3CJR B;  2CUF A;  4EJO A;  2STW A;  5IT9 K;  2IGM A;  3U1D A;  2KKO A;  1YHQ I;  2LSO A;  4D0P A;  2QA4 I;  5HOO A;  2OV7 A;  1R1V A;  2CW7 A;  1NTC A;  4IKF A;  4YEL A;  3GCM A;  1VQ6 I;  1BW5 A;  4HX8 A;  4XLA A;  1R5I D;  2HYG D;  1WFX A;  5IYD J;  5M3M J;  4HF0 A;  5AIP A;  5J40 A;  4KIF A;  5JHU A;  3I5U A;  1ZAO A;  2NXN B;  4NC6 A;  4GXO A;  2XV4 S;  2X1D A;  3QP5 A;  4MFE A;  5CJ9 A;  4EMS A;  3H9Q A;  3W6J B;  4UNO A;  2ZCW A;  5K1Y A;  2NVU B;  4A0Y A;  1MH3 A;  2PEX A;  2XAS A;  4C2T A;  5HOD A;  2ZXH A;  2HFH A;  3JSP A;  1E2X A;  1N77 A;  4EM1 A;  1QVT A;  1LKX A;  2EH3 A;  3K10 A;  3G4S I;  2VKD A;  3JAM Z;  3E6D A;  3VFZ A;  1YS7 A;  4Z6Y A;  3MKW B;  1IG7 A;  3BRO A;  3V8K A;  4ETS A;  4AIK A;  5DD8 A;  1G3S A;  4F93 B;  2Q1Z B;  2HZD A;  4EJU A;  1H9G A;  2WTE A;  1SD5 A;  3RZD J;  1QPM A;  3W2W A;  3GBG A;  3DBH B;  4E7S A;  4C30 A;  2PJP A;  1TNS A;  4U88 A;  5EGO B;  5LBQ A;  1IXR C;  5DTD A;  2Y9Y A;  2Z1D A;  3FDY A;  2ZJP F;  1OR7 C;  1ZR4 A;  3EUK L;  1B8I B;  1W36 C;  1MGT A;  4AC0 A;  1PDN C;  2QLZ A;  4H4K C;  2DT5 A;  1HDP A;  5ICE A;  5E3L A;  1UHW A;  1TQM A;  1Z0X A;  2M9H A;  1CQT A;  2JSC A;  3G1O A;  1OKR A;  3FZV A;  4G6T B;  3RYR A;  4OMY A;  3REO A;  2K9M A;  2ME6 A;  1AA7 A;  1D3Y A;  2GOM A;  3CMM A;  3E5Q A;  4V2F A;  2VKH A;  2WAQ A;  1J2X A;  1OCO H;  2MSY A;  2K40 A;  4IJA A;  3COA C;  2R93 J;  3PQJ A;  2RGV A;  3K4L A;  4HDV A;  1O57 A;  1RRJ A;  4EM0 B;  4L18 B;  4KIT B;  5IP6 A;  1MSE C;  3MZ8 A;  2I5U A;  1B9N A;  4BE1 A;  3PO2 J;  1WJC A;  4JX4 A;  3UR3 C;  3GF2 A;  2EZK A;  4G6D A;  3J80 Z;  1Y0N A;  2L2O A;  4KA4 A;  2PJR A;  2R7V A;  2CQQ A;  2ZC2 A;  1J59 A;  3I64 A;  4UXN A;  1X1C A;  1QVU A;  1LDJ A;  3ZOB A;  5J8F A;  1FC3 A;  2QZ8 A;  3KP5 A;  3WGI A;  1TP4 A;  3F8F A;  4M72 A;  2CQ7 A;  2HOS A;  2H09 A;  2VOO A;  4FIS A;  1XPX A;  3A0H C;  1R6R A;  2F4I A;  3QQA A;  4CYC A;  1FSH A;  1B9M A;  3CCY A;  5GAE J;  2FNP A;  2H27 A;  4XMY A;  4IHY A;  1P7J A;  3TMO A;  2VXZ A;  3L09 A;  2NVX J;  3IRQ A;  3J7Y J;  3ECO A;  1T08 B;  2Z5U A;  2FJ1 A;  2IS1 A;  2BE5 F;  4LK0 F;  4LIT A;  3CDH A;  4PFP A;  3ZR8 X;  2L7Z A;  2DXI A;  1BR1 A;  3ZQQ A;  3WTZ A;  2ZJQ F;  2JN6 A;  2NYX A;  5EF6 A;  5J3L A;  3H5R A;  4AWX B;  5E1X A;  3M3Y J;  3D5L A;  1EKE A;  4IRG A;  3ZRG A;  4CH7 A;  5CQE A;  3IRR A;  4IHX A;  4RDU A;  2DJI A;  2EZH A;  4FCY A;  2CV0 A;  2BW3 A;  3IL2 A;  4OAY A;  2KRH A;  2QM3 A;  1G8X A;  2E5Z A;  4XNF A;  4I02 A;  2EIN H;  1ON1 A;  1SMY F;  1X2N A;  5IY5 H;  3DEW A;  3I9V 2;  1U3E M;  4AVP A;  4BEH A;  2HI3 A;  4E7I A;  4CCO A;  3LFK A;  3BC8 A;  4ITV A;  1XSV A;  1JJ8 C;  1QQI A;  3ZPL A;  2GXA A;  4ZYH A;  2JPB A;  1Y8Q B;  1MJ9 A;  3GLX A;  3K6G A;  2WV1 A;  2BV6 A;  2R7T A;  3KP7 A;  1KZH A;  2KLO A;  3ZMT A;  4DYQ A;  2ZSH B;  4YIR X;  5K5O A;  3BG9 A;  4Y17 A;  5DCM B;  1MW7 A;  2KIU A;  4V19 K;  5CYV A;  4BYY A;  1EH8 A;  2AHQ A;  3M7G A;  1IXS B;  4M3B A;  3L7W A;  4KIG A;  3OYN A;  5IT3 A;  4IPA A;  3S8P A;  5GP9 A;  3I56 I;  3QOD A;  4Q47 A;  2KJB A;  3C18 A;  3D5S C;  1QPI A;  2BY1 A;  3B6C A;  3SDB A;  5ICC A;  3A03 A;  4BXX J;  3I53 A;  2OCC H;  1RKW A;  2GBY A;  4IQ4 A;  2R5Y A;  1FEX A;  5A2Q Z;  1ACI A;  4EGY A;  5E79 C;  2VT3 A;  1WJB A;  1YI2 I;  3OYJ A;  2DCE A;  3GZN B;  1H89 C;  1E17 A;  2L5Q A;  1GUU A;  3OSG A;  4BY7 J;  3OOU A;  4FX4 A;  5FRN A;  5F1J A;  1K61 A;  3EQL F;  1MBK A;  1R22 A;  4KT5 C;  2FOK A;  2QGU A;  2BZT A;  1EH6 A;  4A0Z A;  3HKZ A;  1HKT A;  1KU7 A;  2XB5 A;  3ZXS A;  2XKO A;  2L4A A;  2EIM H;  4C3H J;  4NUB A;  2HVQ A;  1BI3 A;  2JVG A;  2X85 A;  4G12 A;  5IP7 J;  1JUP A;  2F5E A;  1S3J A;  3VSK A;  4WXD A;  1D8J A;  2CQN A;  5ILS A;  1FOY A;  2LY1 A;  2P0W A;  5D4R A;  1T56 A;  1Z9C A;  2GA2 A;  1KQ8 A;  4RAG A;  3ZN1 A;  1ETQ A;  1RR8 C;  4HPQ A;  2L0K A;  2LBF B;  1DPU A;  1IDY A;  2HQN A;  3GFL A;  4G7H F;  2CJJ A;  1ORK A;  3BTJ A;  1P4A A;  4X0G A;  2Q2E B;  5FJ8 J;  3PFY A;  1VQ4 I;  2Z33 A;  5D8K B;  3I59 A;  2HDC A;  3SZG A;  1B6A A;  3K1N A;  2EV0 A;  4UUV A;  2ZKZ A;  1ULY A;  1XGO A;  3VYR B;  1X19 A;  1ZHF A;  2ACJ A;  4DIQ A;  3DWL E;  2MLK A;  2LC2 A;  2IS2 A;  1ZN2 A;  2K02 A;  1WJA A;  3BP8 A;  4XLH A;  4JP0 A;  1MZB A;  1YLF A;  3HSE A;  1DGW Y;  2OZ6 A;  2YSR A;  3PNV A;  2AXL A;  3HUG A;  2CS3 A;  3B73 A;  1JTY A;  2XRL A;  4A2U A;  9ANT A;  2K3F A;  5IT9 Z;  2Z3Y A;  2B0L A;  2X6Y A;  4DZJ A;  1LFP A;  3TKY A;  2L3D A;  2KHM A;  2HVR A;  3Q3S A;  2K9N A;  3CCQ I;  4UV8 A;  1ZQ3 P;  3GME A;  3BCB A;  2QSH X;  4QTR A;  1VI0 A;  2DAO A;  5F0H A;  1TTY A;  2WWY A;  3OR2 C;  1B4A A;  2PBI A;  4PCQ A;  4RGR A;  3EYI A;  1RC9 A;  2XAF A;  3P5J A;  1S6L A;  1TNT A;  1YIO A;  3GWZ A;  4XID A;  5IP9 J;  2L7K A;  2L7M P;  3O8H A;  5CVI A;  3G71 I;  1VQ8 I;  2F2E A;  2E60 A;  1IN7 A;  3RTR A;  3MD2 A;  2NOJ B;  5J4Y A;  1Z77 A;  2NVY J;  2K9L A;  3ZP5 A;  3F9K A;  1K6Y A;  1H0M A;  1RZ4 A;  4HNT A;  1YW7 A;  3TOB A;  2XSD C;  3K4M A;  1T33 A;  3V8L A;  3DTI A;  3VOE A;  5DM6 F;  3OYI A;  2G7H A;  3O2P E;  3CUQ B;  2VB6 A;  4WK8 F;  1HOM A;  2QEN A;  4RMN A;  3KEQ A;  2XHK A;  3WGH A;  1V5G A;  3MKZ A;  2HTS A;  3CJQ B;  1T39 A;  3NWT A;  3JRG A;  2EIJ H;  1WJE A;  2GZW A;  2CMP A;  2PQ8 A;  1I1G A;  4MQV A;  3W6K B;  3LST A;  1BIA A;  4OAZ A;  5C4X J;  2L4M A;  3C2B A;  1NG6 A;  1KU3 A;  1O3Q A;  4JK1 X;  1PP7 U;  4A12 A;  2Y30 A;  4JX6 A;  4RA2 A;  2NS7 A;  2XAU A;  4E7H A;  2DT6 A;  1SD6 A;  4MGR A;  2MH9 A;  4M9S A;  2B63 J;  5FRM A;  5BOX A;  1TWH J;  2KRF A;  3ASO H;  1BI1 A;  2RC4 A;  2XAH A;  3IC7 A;  4KIC A;  4A3E J;  2LVS A;  3QPT A;  4X1E A;  2ZME C;  2HU9 A;  3CP2 A;  3HOW J;  3HHH A;  1SVM A;  3F6V A;  3EUH C;  5B66 C;  1ZH5 A;  3DU5 A;  2RDP A;  4NNJ A;  3KP2 A;  2CV2 A;  4I01 A;  2Y0S A;  2QF7 A;  3T0Y A;  3IV5 A;  3IWF A;  3M8E A;  3WTY C;  4I98 B;  1MDM A;  3V7S A;  4A3K J;  3J7Z I;  5HNH A;  2Z99 A;  2IA1 A;  4HST A;  1MD0 A;  2LG4 A;  1LQ1 A;  3GFI A;  3S1R J;  2JT1 A;  1NK2 P;  2M1B A;  2DDA A;  3OIQ A;  5CKT A;  4D7N A;  1O7F A;  1J09 A;  2EB7 A;  1SFE A;  2WA0 A;  1R23 A;  1Y6I A;  3IKV A;  4UB8 C;  4BAY A;  1VND A;  3ISP A;  2GIZ A;  1P9Q C;  3DU6 A;  3QWL A;  4KN7 X;  2PG4 A;  3TQN A;  4ESJ A;  2DW4 A;  3MMY B;  1IV8 A;  4LG0 A;  1GLN A;  1R71 A;  2V9K A;  1K83 J;  1IC8 A;  2BXY A;  1OYY A;  1HA8 A;  4ZH4 F;  5C3E J;  2ZFU A;  2M4G A;  3AL0 C;  2CQK A;  2VKE A;  2OAZ A;  1N75 A;  4OU0 A;  1FOX A;  1VQK I;  1V5E A;  1I39 A;  1I1S A;  5L3D A;  1FMW A;  2X1C A;  1HCR A;  4RAF A;  1DPR A;  5FFX A;  3RKX A;  5E3M A;  1ZEL A;  2M8G X;  2V1X A;  4XN3 A;  4QLC U;  1BR2 A;  4WX9 A;  3OYM A;  3CCE I;  3ZQL A;  5GPA A;  5EGO A;  4MQ9 F;  5EJC A;  1F36 A;  2QUF A;  3CO7 C;  4AYB N;  4XRS A;  1H9T A;  3IH3 A;  4NC7 A;  5CPR B;  1B8I A;  5DV5 A;  2WB1 N;  3DTK A;  4GGG A;  1NG7 A;  3T8R A;  4BKX A;  3SZT A;  3HOZ J;  2PMU A;  1AWC A;  2DOD A;  1U78 A;  4IL6 C;  5HVQ C;  2MYS A;  2KL4 A;  1XCV A;  1ETV A;  3SYT A;  2VXD A;  1GXQ A;  2RQQ A;  5M5Y J;  3V42 A;  2DLL A;  1ZLK A;  2XF7 A;  4ZZD A;  1L3L A;  1FIP A;  4BQO A;  4CCJ A;  1VQ7 I;  1X1B A;  2G7U A;  5J1R A;  4Q48 A;  2V6E A;  3LQQ A;  3BR0 A;  1DDN A;  4IEJ A;  1D0X A;  1YJW I;  4ZZL A;  1QNT A;  2CH0 A;  3CZ6 A;  3EDP A;  3R4K A;  2HKO A;  2X48 A;  3CJN A;  3M4O J;  2VC0 A;  1ZYR F;  3LAP A;  2LP0 A;  1MNM C;  2FMY A;  2XPV A;  4R8H A;  4XM3 A;  1MNE A;  1UB9 A;  3MKY B;  3S17 J;  2HPI A;  2P5V A;  2TDX A;  2DK8 A;  2OTL I;  3OYK A;  1JT0 A;  2B7E A;  2R7U A;  5BS6 A;  3SJM A;  2HYJ A;  3HXL A;  5DYM A;  3K4K A;  2JSP A;  2A6E F;  4RB2 C;  1KYW A;  1ZK8 A;  3DTE A;  3VB2 A;  2R5Z A;  2FF4 A;  4CCM A;  1FYM A;  1K6O A;  3TO7 A;  4RLQ A;  3BWG A;  4P96 A;  3RIR A;  3LAJ A;  4XK4 A;  3CCM I;  3ECH A;  4WXC A;  2MAB A;  4RS8 A;  2MC4 A;  3LOC A;  3WTU C;  1XSD A;  4IF4 A;  3LWF A;  3B6A A;  1Q1H A;  4FET A;  3TL4 X;  5K7Z A;  2PI0 A;  4CDG A;  1UJ8 A;  4M71 A;  2XIG A;  3HTU A;  4U87 A;  3ZQI A;  3MZY A;  2LD5 A;  3JR9 A;  4O3M A;  4B3X A;  3PO3 J;  3PUB A;  1O4X A;  2ZSI B;  1R1U A;  4HNU A;  3BT9 A;  1OCT C;  3C7J A;  2JWT A;  1WWX A;  3QYF A;  3RYP A;  4G7O F;  2QKM B;  5D5W B;  2UXN A;  2K7L A;  3ZMV A;  3L2R A;  3GZ6 A;  1JKP C;  3MN2 A;  2R7R A;  2VUM J;  2KP6 A;  1JHH A;  1Z67 A;  1J75 A;  1TT5 B;  2G9W A;  2BVM A;  3DEE A;  5KHD A;  2DMN A;  1S9H A;  4KIB A;  4ZJZ A;  2VOD A;  1YS6 A;  2LKP A;  1ENH A;  4XLF A;  4QPQ A;  3PIO F;  2R0Q C;  4YFN F;  1SFO J;  2M3A A;  5HDK A;  5BQT A;  2IGO A;  5E3N A;  3DCF A;  2B9S A;  5D6F A;  3LSP A;  4HLX A;  2EFN A;  3ZQF A;  1ZG5 A;  3K2Z A;  1R49 A;  1F4K A;  3BJA A;  4LG3 A;  1WGX A;  4BL0 B;  4ZYA A;  4A6E A;  1ERD A;  4L9N A;  5F0F A;  3CF5 F;  1IN8 A;  4JOM A;  1D5Y A;  1Z6R A;  1VQ5 I;  3P9K A;  1IV6 A;  1RET A;  3CCV I;  4BY1 J;  1WJ5 A;  3SEQ A;  4KMU X;  3E5X A;  1O3R A;  2ZXW H;  4N4N B;  1OCC H;  2WY7 Q;  4LFU A;  4IXA A;  1I6X A;  2QWW A;  1L0O C;  3HYI A;  3MKL A;  4LJZ F;  3B02 A;  2M34 A;  5HLI A;  5DD4 A;  2KPM A;  2Y69 H;  1O7L A;  5LEJ A;  4KFC A;  3CLO A;  3FKJ A;  1XCB A;  5JR3 A;  2VBY A;  3HHG A;  4ENJ A;  4J00 A;  2KDZ A;  1ZG3 A;  5F0C A;  2L02 A;  3CME I;  2JA5 J;  3GYH X;  1R1T A;  1XS9 A;  1P6R A;  2HOE A;  3T8T A;  3G2B A;  3TO9 A;  5L3G A;  5GAG J;  2EFO A;  4NQW B;  3VYS B;  3K4J A;  2LLK A;  1IJW C;  2O8K A;  2KIM A;  4I0B A;  4KUM A;  1SEU A;  4N9I A;  1SFK A;  4HF2 A;  2ISY A;  4XLP F;  3ZQH A;  1MBF A;  4M3G A;  1STZ A;  2R7F A;  3KFW X;  4GFB A;  3TBI A;  4S04 A;  5EG0 B;  4RBO A;  3G1M A;  3OS0 A;  1X4P A;  5L3F A;  4UVC A;  3WTV C;  4KJZ A;  1JXS A;  2GQQ A;  1ZGA A;  2CUZ A;  4K2E A;  1FYL A;  2M0M A;  3KP4 A;  1B72 B;  1Z21 A;  3DEU A;  2LH9 A;  2XSJ C;  1RPW A;  2I10 A;  3BG7 A;  3L9F A;  4IHS A;  5FFZ A;  3WU2 C;  2F6C A;  1MMD A;  1AU7 A;  3JTH A;  5H20 A;  1Z1D A;  1FIA A;  3KEY A;  4LK1 F;  2LBF A;  4P9F A;  4F3Q A;  1S8N A;  1RIO H;  3K7A J;  2ELH A;  3W6V A;  4DYR A;  3M8F A;  3FWE A;  4Q4Z F;  1LJ9 A;  4YII A;  2XGX A;  1QZY A;  4HX7 A;  2DI3 A;  2P5K A;  3FMR A;  1EJ9 A;  3L2W A;  3J7A O;  4XLN F;  1GDT A;  5F04 A;  2P4W A;  1LVA A;  5HDG A;  5JLX A;  1YG2 A;  4I99 C;  1M1E B;  1ONV A;  2FA5 A;  2DJN A;  3VDX A;  2BHZ A;  2QQ8 A;  2BHY A;  1T0F A;  5BPI A;  3K9T A;  2GLO A;  2ID3 A;  3SXY A;  3N97 A;  4DQ2 A;  2E36 A;  4XOR A;  3N05 A;  2D5V A;  2QQB A;  2XRN A;  2P5L C;  4BHB A;  1YFH A;  4RGS A;  5K5R A;  4F52 A;  4II2 A;  3K4N A;  1R4M B;  1W0T A;  3RKW A;  1POG A;  5ILV A;  3OYB A;  1R9T J;  2QVO A;  4ZTJ A;  2C6Y A;  3S15 J;  2DA1 A;  3LQR A;  3Q9V A;  1NK3 P;  4XRS G;  3JRC A;  1WRJ A;  1U6G A;  2XUB A;  3FK6 A;  3A1Y A;  5J1U A;  5D5X B;  2W4S A;  4WF2 A;  1FY7 A;  2GAU A;  1EH7 A;  1KU2 A;  1MJB A;  5CVJ A;  2RAE A;  4PJL A;  2CG4 A;  5E1W A;  4I7H A;  4EVI A;  2OF7 A;  4U0Y A;  1UMQ A;  4RLF A;  5GAH J;  5FKL A;  3JRA A;  1FMV A;  4EEF G;  1QZE A;  2ZJR F;  1FOW A;  4XKW A;  5AON A;  2AS5 F;  3CUQ A;  3HGG A;  3HSF A;  4B47 A;  2K9Q A;  3WE3 A;  1YE9 A;  5L3C A;  3H0G J;  4HQM A;  3MZH A;  5HS7 A;  4GDF A;  1TQP A;  2JZY A;  4HX4 A;  5FKN A;  2CW8 A;  3A4C A;  3M07 A;  2QBY B;  2BOL A;  2IGK A;  3EUA A;  3TED A;  1ETW A;  2K3P A;  1WHU A;  3GUD A;  2IS4 A;  3ZCO A;  1R7J A;  3FHN A;  1TWF J;  2EFP A;  3MFK A;  3G73 A;  1R5G A;  3L1P A;  3HPH A;  1VQL I;  1IRX A;  3BR2 A;  1F1Z A;  4FX0 A;  2L9R A;  2VQG A;  3CES A;  3HRM A;  4HEA 2;  3FXK A;  2HGC A;  1MND A;  1OYI A;  2DYR H;  3GTQ J;  4I09 A;  5CVV A;  2IEK A;  4IHW A;  1FZP B;  2ZXJ A;  3Q0V A;  4LB5 A;  3BDD A;  3KPH A;  4B4C A;  1IGN A;  1HKS A;  2FNA A;  1FX7 A;  1U5T B;  3PQK A;  3SEZ A;  3HIF A;  1WH7 A;  3VYU B;  1FTT A;  4UUS A;  1HW1 A;  3IH4 A;  1SC7 A;  3ZMU A;  4M73 A;  3DLL F;  3H9J A;  2V26 A;  4BXU A;  4DBQ A;  3LNQ A;  1BIB A;  2CW0 F;  2GM4 A;  4KDP A;  1MMS A;  3GTG J;  1XDS A;  1HW5 A;  4RB3 C;  1SFU A;  4M3E A;  1VQO I;  1QHG A;  2OC6 A;  2CFX A;  3ABU A;  1TC3 C;  3H1C A;  3A01 B;  1B1B A;  2HDD A;  3IHU A;  1CGP A;  2QEX I;  4G94 A;  5JVT A;  2X6W A;  2M30 A;  2X51 A;  1W7P B;  2QQ9 A;  3LSK A;  4AVZ A;  1ETO A;  2YU9 J;  3KYL A;  2IXS A;  2NS8 A;  2E1M B;  5ED4 A;  3OMY A;  2OJE D;  5F6F A;  2VC1 A;  3I54 A;  2W48 A;  4PJM A;  1GXP A;  2DA6 A;  3HPG A;  4KMF A;  1MBE A;  2H94 A;  3FM3 A;  2IP2 A;  5LFA A;  1BL0 A;  3ZGK A;  2GXB A;  1OMI A;  3DBL B;  3TW6 A;  2VPL A;  1YTY A;  5LGU A;  4BQN A;  3F8N A;  4XLE A;  1HSJ A;  4IRH A;  2A07 F;  1KU9 A;  2FEZ A;  4C9Y A;  1UCR A;  4LIV A;  3DKY A;  4XL9 A;  4EJV A;  3VWB A;  2FE3 A;  4BXF A;  4G9Y A;  4EAT A;  5E3O A;  3PJR A;  1WKM A;  3IUO A;  2F5C A;  2R7Q A;  3C2H A;  1I27 A;  3R0J A;  1ON2 A;  4HZF A;  2DA3 A;  4PGH A;  4E7K A;  4XOP A;  2ZNZ A;  4BQA A;  4OIO F;  2MFZ A;  2GWR A;  4A3M J;  5EEH A;  2EJR A;  4BS9 A;  2BXZ A;  1A36 A;  3KYC B;  1XTA A;  4JQF A;  2CYY A;  3J81 K;  2DOE A;  4Q5S F;  1UST A;  3DBR B;  1QO0 D;  2DFH A;  2HEO A;  2LF7 A;  2OUM A;  1GVJ A;  5J47 A;  1MBH A;  1UAA A;  1UHS A;  2W00 A;  4GRI A;  4IVN A;  1S7E A;  2BGC A;  1XG1 A;  4CSW A;  3M8J A;  1DP3 A;  4EQQ A;  3OOP A;  5ICG A;  3VEP A;  1K7A A;  1BC8 C;  5J4V A;  3GXO A;  1GV5 A;  2W1O A;  3ZN0 A;  1XMX A;  2VQH A;  3FM5 A;  1ZRD A;  3ASN H;  3D5R C;  2VON A;  2DQL A;  1H88 C;  2X6X A;  4MLO A;  2D1V A;  1UG2 A;  3R60 A;  2OQG A;  2TCT A;  3M1C A;  5M3F J;  1APL C;  3HOT A;  2EWN A;  2VJ5 A;  3BJO A;  3F21 A;  2LOO A;  2ELK A;  1Q1V A;  4U0W A;  4AYB A;  3GTP J;  2M8E A;  1A35 A;  2UWM A;  2WB1 A;  3RPQ A;  5L3E A;  3IKT A;  1BOA A;  1HQC A;  1BR4 A;  2RNJ A;  5KAF C;  2HYF A;  3R61 A;  3QYE A;  3G1L A;  4OOI A;  3GTM J;  2L54 A;  4NB5 A;  4AM3 A;  1A6Q A;  1KA8 A;  3NQO A;  3CJT B;  3W2V A;  1WZ2 A;  1XDU A;  2YU3 A;  4A3G J;  1ZLJ A;  1SD7 A;  1ETX A;  3RQ4 A;  3IH2 A;  5CVR A;  3WTW C;  3AFH A;  1R4N B;  4NC8 A;  4CCK A;  1BW6 A;  3RKY A;  2R7X A;  3S2D J;  3I4N J;  4DW6 A;  3Q9S A;  1E3O C;  3H9G A;  1MH4 A;  2EQR A;  3EET A;  4CCN A;  3QRF F;  3LA2 A;  2H6B A;  1JHF A;  1JGS A;  1P92 A;  4RM3 A;  1AKH B;  4B1R A;  4LLL A;  4M9X A;  4PUS A;  5HDN A;  3OSF A;  1Z7L A;  2EBI A;  1W0U A;  1K78 B;  1IZ1 A;  3RPU D;  2MLG A;  3K70 D;  2PJR B;  2K9S A;  2EZL A;  3HZJ A;  2V9P A;  1E3P A;  3SFI A;  2HZT A;  3KE2 A;  2V6C A;  2BY3 A;  3HTS B;  4D7M A;  1IAW A;  1WPK A;  4U7D A;  4YG2 F;  3S14 J;  4LLG F;  2PMZ N;  1G3T A;  3KET A;  1SVL A;  4A3I J;  2ZB9 A;  3HRS A;  1BI2 A;  1BOB A;  2UZK A;  4L5I A;  2Y0M A;  2XAQ A;  3CF2 A;  4M6V A;  3F23 A;  2CV1 A;  2FXA A;  3PSI A;  2P6T A;  4Y4R A;  1VQM I;  2A69 F;  2WAD A;  4II3 A;  4PSX A;  2Y9Z A;  2M0C A;  3R6S A;  5F08 A;  1BA5 A;  3V8J A;  4M6Y A;  1W7P D;  1D0Y A;  2COM A;  2VLA A;  1FOK A;  2DA5 A;  2NS0 A;  3SHF A;  2A05 A;  1I6H J;  4D9J A;  4QSH A;  4XBF A;  4A3J J;  5EEG A;  2F48 A;  2IPQ X;  2L9V A;  2ME0 A;  5FKM A;  3F8B A;  3HOX J;  1PUF B;  2V1U A;  2XGD A;  5KNL A;  3FIS A;  3D0S A;  3BPX A;  5B1A H;  2E34 A;  4LB6 B;  4J19 A;  3HM5 A;  3LL7 A;  3S16 J;  1HC8 A;  2O03 A;  4DZP A;  4I2O A;  1OYW A;  2FBH A;  3P9C A;  3TW7 A;  4MTE A;  2DYS H;  4Y3O A;  1K4S A;  1ZKG A;  2FBK A;  2E1N A;  4A0X A;  1FBU A;  2LNB A;  2LY9 A;  1ZGW A;  3OYL A;  3AKZ A;  5H2F C;  1U9N A;  2DTR A;  2ZFW A;  4P55 A;  2W7N A;  3DKW A;  2AQE A;  3DLA A;  3DKX A;  4IHT A;  4IX7 A;  2W82 A;  3AG2 H;  1ZG1 A;  2M7B A;  1TW3 A;  3GX4 X;  3E3V A;  2P6S A;  2CU7 A;  3H0D A;  2VPR A;  2JTV A;  3P7N A;  5LLQ A;  4N9H A;  4A69 C;  3HOV J;  3E7L A;  3OYH A;  3A02 A;  3GZ5 A;  4ZTF A;  1RKT A;  4DOZ A;  4LD5 A;  3CCS I;  4CCL A;  2VOP A;  3OYF A;  5KCM A;  2KDO A;  5EDN A;  1TBX A;  4CXF A;  3JRI A;  1T98 A;  2LR8 A;  1T38 A;  3TDU C;  5HLT A;  3KP3 A;  2VJJ A;  5EG0 A;  3OV8 A;  4A3B J;  4CGZ A;  1ZTR A;  3ELK A;  4LLN A;  2AO9 A;  4ENK A;  2ESN A;  3DPL C;  3DPU A;  2DPU A;  1Y1W J;  2DPD A;  3KLO A;  1B72 A;  2EZI A;  3FBN B;  1BJA A;  4Y52 J;  2ESH A;  3BR6 A;  5E17 F;  4MFD A;  1IN4 A;  4MO7 A;  4F7Z A;  4A3L J;  4V2G A;  3ZQG A;  3JTG A;  5LD2 C;  4KNY A;  2R5Y B;  2V7F A;  2JA8 J;  4GYG A;  3T5X A;  1VFC A;  4PJ0 C;  4PFO A;  4XR6 A;  2FML A;  3VOD A;  2IJL A;  4F55 A;  1IW7 F;  3HBL A;  5M5X J;  3CD6 I;  2CUE A;  2DOA A;  5FB2 A;  4W97 A;  4ZDL A;  2O5R A;  2R92 J;  2E2J J;  3T1B A;  2MW8 A;  1YOV B;  2IGN A;  5ICF A;  2BY0 A;  2ETH A;  3X2Q H;  1U8R A;  1R36 A;  5JVG F;  3L2C A;  2F5V A;  3HGY A;  1XGS A;  2YPR A;  1JT6 A;  1SAN A;  3BTL A;  2LYC A;  5J8C A;  3JRE A;  3AG1 H;  5FKO A;  3ESW B;  3I55 I;  1PUE E;  3W2A A;  1XGN A;  1V54 H;  1J5Y A;  3QU6 A;  1YRN B;  1ZAR A;  3PL8 A;  4EJW A;  1YJ9 I;  2HR3 A;  3VPR A;  2NRA C;  3E6C C;  2HQR A;  3C1D A;  1O3T A;  1VQN I;  3H3Z A;  1DU0 A;  2JUG A;  2IS6 A;  4D5F A;  1D8K A;  2VL8 A;  5B5E C;  4GO1 A;  1TZL A;  2D2W A;  4HYE A;  4B09 A;  1QA6 A;  2A61 A;  3I59 B;  2YUS A;  4IOA F;  2HQ5 A;  3ABT A;  2D45 A;  2HXO A;  4S0H B;  3QAH A;  1Z6T A;  4BAC A;  3NAU A;  4FHT A;  4M74 A;  3ROU A;  4E7J A;  4A3D J;  2MG4 A;  4N0B A;  2M2E A;  3IWZ A;  5CVU A;  2A68 F;  2NNN A;  3RI4 A;  3QU3 A;  1X3W B;  3C3W A;  2YX4 A;  1YIJ I;  4IQJ A;  5DM7 F;  3HUG B;  1T2K A;  1HLV A;  2COB A;  2MBF A;  4OIQ F;  3FIW A;  5EZG A;  1ZRC A;  2IVM A;  3O8G A;  2KZG A;  3NRV A;  4UHT A;  4HV6 A;  1HW2 A;  2OPT A;  4YFX F;  4XON A;  2DO7 A;  1LE8 B;  2RQP A;  1QZZ A;  2Z2S B;  3OYD A;  4Z2Y A;  1TW2 A;  1X1D A;  2VJ4 A;  3JW4 A;  4KYW A;  2O61 A;  1U9O A;  1TWC J;  1FNN A;  3A0B C;  1WSU A;  3WHC A;  2OD5 A;  1Y1V J;  1LVK A;  2P7V B;  3GLL A;  1ZRF A;  2STT A;  3RDI A;  1MJA A;  1VTN C;  3QPH A;  1EF4 A;  2XC7 A;  5F64 A;  4HDU A;  3FBI B;  2RKH A;  5E8G A;  5D8L B;  1DP7 P;  5LHG A;  4RB1 A;  2HKX A;  3FXU A;  5H6R A;  1T0F C;  4AU7 A;  3I4P A;  5KAI C;  3J81 Z;  1BM9 A;  4BH9 A;  3L2V A;  5BNG A;  3BLY A;  4DBR A;  1K4T A;  3IAM 2;  3CCL I;  3AG3 H;  3RCO A;  4P5O A;  4XN0 A;  5D5U B;  3OYC A;  2XDV A;  3S1N J;  3BJ6 A;  4AD9 A;  3A2K A;  1EV7 A;  3AAF A;  2K27 A;  2Y31 A;  2HNH A;  3FXR A;  4R79 A;  4E6K G;  2FOW A;  3SFZ A;  1JGG A;  2MD0 A;  1MBJ A;  2NAZ A;  2W85 A;  1JKR C;  2O6G E;  2DU9 A;  3M9A A;  1SD4 A;  1MBG A;  2DA2 A;  3HOU J;  2Y75 A;  3RPU A;  4A6D A;  1NH3 A;  5B3S H;  3DFG A;  5FD6 A;  4HNV A;  3HOS A;  4RB0 A;  1E0E A;  3LSM A;  3CQZ J;  5FLV A;  1JE8 A;  3WGG A;  4HG2 A;  3N4M A;  2BBY A;  2CWE A;  5DCM A;  4PJN A;  2D1H A;  3OYA A;  5BPD A;  1S7A A;  3CDL A;  1X4O A;  3BTI A;  3A01 A;  3PSF A;  5IOY A;  2EFW A;  4BBS J;  1ITY A;  2EV5 A;  3KCC A;  2FQ3 A;  1LFU P;  4CUG A;  3LSH A;  3CC4 I;  3O6B B;  1WI9 A;  4G6Q A;  4L9J A;  3OY9 A;  2PLY A;  3KLN A;  1SVO A;  1GT0 C;  4G7Z F;  1XN7 A;  2LTP A;  1W7P A;  3CUQ C;  1G3W A;  1SAX A;  4HAM A;  1KGS A;  3H3U A;  2CO5 A;  4AUX A;  1BC7 C;  3PUF A;  3RZO J;  4B3A A;  4MEX F;  2FQ4 A;  4LGW A;  4ZC3 A;  1IN5 A;  2J5O A;  2LF8 A;  2QSF X;  2DDB A;  2XAJ A;  2AQF A;  2JVH A;  2O0Y A;  2W57 A;  5E18 F;  5DDG A;  1MDM B;  4YEJ A;  2DT7 B;  2NNY A;  1FJL A;  2MH2 A;  3PNY A;  3U2R A;  3S2H J;  1KYZ A;  2XPW A;  3KZI C;  2HQA A;  3BY6 A;  4C2M J;  1W5T A;  4ZYD A;  3G3Z A;  2V79 A;  1XGM A;  1J0R A;  1V3F A;  3ERM A;  3SQN A;  1C0W A;  3BCA A;  1V5F A;  2IA0 A;  3GTL J;  2A6H F;  2VBW A;  2VQL A;  1TWG J;  4JBA A;  4HOB A;  2LY2 A;  3FMQ A;  3LSR A;  3WU0 A;  2P8T A;  4HQE A;  2W24 A;  2WAF A;  3KZZ A;  2V1N A;  2WV0 A;  4LG0 B;  4ZDO A;  4E7Z A;  3H36 A;  1FBQ A;  3F0C A;  2DMP A;  4F91 B;  2X6O A;  4ENN A;  2WY8 Q;  1I3Q J;  3LSG A;  3NWS A;  2HDW A;  1XSX A;  2XKP A;  3H5N A;  4RAY A;  3BZK A;  2Q2E A;  4HLY A;  1E3H A;  2LKS A;  2VE8 A;  2HXI A;  5K7H A;  3PNT A;  3F8C A;  4ZYG A;  1R58 A;  2VBZ A;  3HG9 A;  3DPT A;  3GTJ J;  3WTX C;  5GTI C;  1OPC A;  2OBP A;  3DP7 A;  4PK4 A;  4L9V A;  4B44 A;  1IO2 A;  2VIX A;  4Y33 A;  5LHH A;  2KQR A;  2X4H A;  3TGN A;  5DCF A;  1IUY A;  5KVR A;  2QQA A;  2R7O A;  1S5L C;  3TP3 A;  1RUN A;  1HXD A;  3ULQ B;  3U1K A;  1R00 A;  2BEO A;  3S3N A;  1X1P A;  2ZXI A;  3HRU A;  2DFI A;  3G6E I;  5D5V B;  2F5D A;  3PFI A;  1YYV A;  2X1E A;  5TGT A;  4FT8 A;  2EFQ A;  1HST A;  3DXJ F;  2LRD A;  4B48 A;  1VF9 A;  4GCV A;  3K0L A;  4EGZ A;  1O3S A;  1IN6 A;  2DMQ A;  2L9S A;  4YIF A;  4FTH A;  5LGT A;  2PFB A;  1IXC A;  2A5Y B;  1B59 A;  3VYT B;  3F8M A;  1X2M A;  2ZO4 A;  4UVA A;  2DOF A;  3NAR A;  4IO9 F;  1CF7 B;  3S32 A;  2P7C B;  3U9G A;  5C4J J;  2HTJ A;  3BOQ A;  4L5J A;  2VN2 A;  2EK5 A;  2ELJ A;  4FE7 A;  3WG9 A;  2XB0 X;  2XVC A;  2KIQ A;  5GPC A;  1SFX A;  4E70 A;  4ESF A;  2J5P A;  1P4X A;  3QPS A;  2H8W A;  3HDD A;  1JKO C;  1J7K A;  3F3X A;  1OQY A;  2CUJ A;  1OJL A;  3BR5 A;  1AKH A;  2MD5 A;  3Q5F A;  1K78 A;  5HS8 A;  3TDZ C;  3IAS 2;  2ZME B;  1H8A C;  2MA3 A;  3ABM H;  3FX3 A;  1A6I A;  2YS9 A;  2VQC A;  3FHZ A;  4A5N A;  4OIR F;  1LEB A;  3L2Q A;  2R5Z B;  3LFU A;  1ODD A;  2DK5 A;  2EA4 A;  1TWA J;  3QPL A;  4FE4 A;  4CZC A;  1NHA A;  4L9T A;  3OWT A;  2I8D A;  2FD5 A;  3OYE A;  2JRM A;  1LDK B;  5E1Z B;  3U21 A;  2EA2 A;  1UFM A;  4OIN F;  2UUZ A;  2XPU A;  2GIV A;  1HF0 A;  1MIJ A;  1D1B A;  4OWR B;  2A6T A;  1WCM J;  2KZV A;  1FWZ A;  3BR1 A;  3MAJ A;  4PZJ A;  1I3A A;  1PUF A;  4N4O B;  2ZJ2 A;  2BY2 A;  2JA7 J;  4UVB A;  2W25 A;  5JI6 A;  1WH5 A;  1W1W E;  5EEA A;  1ZRE A;  1G4D A;  3CC2 I;  1S72 I;  2E35 A;  2M87 A;  5IYB J;  4YRV A;  3GTO J;  2ZNY A;  1FTZ A;  3SDG A;  3S3M A;  1TLH B;  4BE2 A;  1VQP I;  4DGW B;  1DU6 A;  5LEK A;  2PMZ A;  3K4C A;  3KEO A;  4RGX A;  3PIP F;  5F1R A;  4XIC A;  3K69 A;  3AL0 B;  1GHC A;  2K5C A;  2X0L A;  3WU1 B;  1U0J A;  2CFO A;  3H5A A;  5H6Q A;  3CP8 A;  5ILU A;  1LPQ A;  2IRF G;  4M3F A;  3H3V K;  1KQ9 A;  4CO8 A;  2E2H J;  3LA7 A;  3Q0U A;  1AHD P;  4BQQ A;  4LOC A;  4HA8 A;  4Y13 A;  3OYG A;  2XGC A;  3GEZ A;  2Q0O A;  2WBM A;  2V1D A;  5BMZ A;  1XC5 A;  3S3O A;  1OR7 A;  1LEA A;  3S2W A;  2DQR A;  4I0A A;  3J7A Y;  3HB9 A;  4EM2 A;  1XMA A;  3VSL A;  5TJJ A;  4BDY A;  4A5M A;  1FLI A;  4JX5 A;  4UY8 I;  3BG5 A;  4Y15 A;  2E71 A;  2OU2 A;  5TRD A;  2R3S A;  3FKI J;  3FXM A;  4A3C J;  5FLX K;  3BZ6 A;  3EPZ A;  3WTT C;  5FLM J;  3OS2 A;  4M9Z A;  4HRI A;  1TT0 A;  2HOA A;  1A31 A;  4E7L A;  2OA4 A;  4HV5 A;  2JUC A;  2LK2 A;  1BI0 A;  2A5W A;  5FKK A;  2KT0 A;  2XF5 A;  2LRE A;  3I4M J;  1MMG A;  4O6J A;  3I0T A;  2GXG A;  2KJC A;  2ECC A;  2XGE A;  2H8R A;  3I71 A;  1V4R A;  2MC3 A;  4UV9 A;  4MTD A;  1N25 A;  1R5H A;  4BJT A;  4A93 J;  4KIS A;  4XOT A;  3V7C A;  3I58 A;  4QWQ A;  1U8B A;  2K85 A;  3HC7 A;  2F4M B;  2KRC A;  2P81 A;  3LSI A;  5D6E A;  2VJI A;  5FO5 A;  1F5T A;  3E97 A;  4ASN A;  3OS1 A;  2H1L A;  1D5V A;  2M5W A;  3ZQC A;  1QBJ A;  3CDI A;  1DGR M;  4F92 B;  2WAQ N;  4S05 A;  1YW8 A;  2NOG A;  2TRT A;  3QP6 A;  4JYK A;  1FP1 D;  2W84 A;  2QYO A;  5EYR A;  3CCJ I;  1YRN A;  5ERI A;  1PP8 F;  4NBQ A;  2KIF A;  3ERE D;  2FX0 A;  1WVR A;  4IHV A;  2RV8 A;  3UKG A;  5CQG A;  4WXH A;  4KN4 X;  1EA3 A;  3LMM A;  4MHG A;  2BVL A;  3R0A A;  1ETK A;  2IA2 A;  2ZBK A;  3CMY A;  1REP C;  2RN7 A;  2HOT A;  5K5Q A;  2EIK H;  1FYK A;  2LFB A;  2V4J C;  4ZYE A;  3JRB A;  3BQY A;  3JRD A;  4AID A;  2RNG A;  2CSO A;  4XQF A;  3D1N I;  4PSW A;  3K1M A;  2R7W A;  5IPA A;  3HOY J;  1OFC X;  3Q0W A;  3KZY A;  5EZH A;  4M3D A;  1JUM A;  2RRE A;  4RAZ A;  3E1S A;  4ON0 A;  4ESB A;  2O3F A;  5DS9 A;  1X58 A;  4U0V A;  1D1C A;  3GO5 A;  1FP2 A;  1IF1 A;  1TL8 A;  3WG7 H;  6PAX A;  2HWV A;  3FXO A;  1DUX C;  1FBS A;  1G2H A;  1OCZ H;  2EV6 A;  2L9N A;  5C44 J;  1LE8 A;  5E20 A;  3ONQ A;  3F22 A;  2DA4 A;  3K4B A;  2DFF A;  4XKV A;  1BBY A;  2DBB A;  1G6N A;  5JFR A;  1A5J A;  4XRM A;  1Y0U A;  2VE9 A;  4XKB A;  4KT6 A;  4O5V A;  3ZMD A;  2VBX A;  4MEY F;  3PM1 A;  4E4H A;  4RGU A;  5E8I A;  4P9U A;  2NVQ J;  4QIW N;  2O7O A;  1X3U A;  2E7W A;  3AG4 H;  4L5E A;  4CYC B;  2A3S A;  4AIJ A;  2L7F P;  5J1Y A;  3DV8 A;  1I50 J;  2CQX A;  2FUG 2;  2EIL H;  3RSN A;  2IBD A;  1IDZ A;  1XX5 A;  5HLG A;  2QSG X;  3QYB A;  3JAM K;  4BE0 A;  3NEU A;  2LKX A;  4XRF A;  4BU2 A;  3JRH A;  4X6A J;  4BJ6 C;  5TIS C;  3HEF A;  4WWC A;  4BUP A;  3BG3 A;  3CC7 I;  4Y7N J;  2ISZ A;  5FRO A;  1MMA A;  2EPF A;  3FK7 A;  2V9V A;  2AXT C;  3FF5 A;  4W1U A;  2L01 A;  3BZC A;  3S93 A;  3ZQ7 A;  4ABZ A;  5J6X A;  4U7B A;  2PX9 A;  2DMU A;  2O9L A;  1T8I A;  4CIC A;  2OCE A;  3RKQ A;  5B1B H;  3HJE A;  4NHJ A;  3JCU C;  2OZU A;  5LHI A;  1QHH D;  2BW3 B;  4BGD A;  2FU4 A;  1N78 A;  1PYV A;  1LB2 A;  2F4O B;  3WHB A;  1IRF A;  4AIH A;  2E19 A;  1USS A;  2GOX B;  2R4G A;  1ETY A;  1YQA A;  4BEH B;  2YX7 A;  2JA6 J;  3UNG C;  1RI7 A;  2O8X A;  3L00 A;  4R1H A;  5FD5 A;  2NVT J;  2VT2 A;  1LUJ B;  1VQ9 I;  1JTX A;  4UUS B;  2M4K A;  4NQW A;  2DA7 A;  1YX5 A;  3CMA I;  3S1M J;  1LFB A;  3HKZ N;  4DYC A;  4YFK F;  5HNF A;  1UG0 A;  3BQZ A;  3QOP A;  1QU3 A;  1BN5 A;  2K4B A;  4HW0 A;  3H92 A;  2HPM A;  3F6O A;  2IT0 A;  3IP4 B;  3J80 K;  4PDK A;  2JQ7 A;  1Y39 A;  4WCG A;  1UZC A;  4PGG A;  5IYC J;  3OL3 A;  1ZGJ A;  3GTK J;  4G8X A;  4FQG A;  4CYD A;  2DTZ A;  1GV2 A;  4HF1 A;  2ID6 A;  1W4M A;  1YIT I;  2DN0 A;  2FRH A;  3DQV C;  1TQI A;  2R7S A;  4CHU A;  2N8G A;  3O3K A;  5CLS A;  2KFD A;  2K86 A;  3TP0 A;  3TO6 A;  4DJA A;  1OCR H;  3M1E A;  3FXQ A;  1U5T C;  2UXX A;  5LRS A;  3K70 C;  4A3F J;  3HSR A;  1SMT A;  4ENM A;  4EV0 A;  3OR1 C;  2JMW A;  1YW9 A;  1SAU A;  1RES A;  4TV7 A;  1DQU A;  2IW5 A;  4C3J J;  1XD7 A;  4CA0 A;  2E1C A;  1QGP A;  3CCU I;  2PN6 A;  3E5U A;  1OCP A;  4J01 A;  1OIS A;  1T6S A;  4ANJ A;  1KQ0 A;  4XKC A;  2Z9O A;  3WOD F;  4NDL A;  3BR3 A;  4HSR A;  4LMY A;  4GYI A;  3JSO A;  2UV1 A;  3K1P A;  4UUT A;  3FXJ A;  2ADU A;  1A04 A;  3LA3 A;  1P2F A;  2R7D A;  2WAE A;  3GVA A;  4C3I J;  4DNC A;  5DEQ A;  3CO6 C;  4I6Z A;  1AOY A;  1WI3 A;  3BPV A;  1RR7 A;  3F72 A;  5JHF A;  1U2W A;  2XRO A;  2E1M C;  1G59 A;  1MKM A;  1P4W A;  1WJD A;  2E1O A;  4UB6 C;  1LNW A;  3WE2 A;  3CCR I;  2QCO A;  4D1Q A;  3FXL A;  5LRR A;  2M45 A;  5D4S A;  2Y2Z A;  4L0Y B;  1IRG A;  3BTC A;  5F27 A;  2OTJ I;  3ZMS A;  3CLQ A;  2VKV A;  2RVC A;  4MNU A;  1Y56 A;  2E2I J;  3OIP A;  4FAS D;  3WTS C;  2JJ7 A;  1CF7 A;  4IZZ A;  1JUS A;  3KYD B;  3E0J B;  3RJP A;  4C2U A;  3ML6 A;  1MMN A;  4IOC F;  1XB4 A;  3H35 A;  5JLW A;  1Z7U A;  1RUO A;  1YX3 A;  3MQ0 A;  1VZ0 A;  1K79 A;  1F9N A;  3HL2 A;  4IRI A;  2WC2 A;  4B8X A;  1YJN I;  5L3B A;  3ZMZ A;  1D0Z A; 
#chains in the Genus database with same CATH homology
 5C4X J;  3C2B A;  3MVP A;  2HXI A;  5K7H A;  5IOZ A;  3OIO A;  1ETO A;  2YU9 J;  2H1K A;  2DMT A;  2Y30 A;  4JX6 A;  2NS7 A;  3GTJ J;  2NS8 A;  1GVD A;  2B63 J;  2W48 A;  2DA6 A;  1MBE A;  1BL0 A;  4MIM A;  3TP3 A;  1TWH J;  3TW6 A;  4A3E J;  1JKQ C;  2LVS A;  4X1E A;  3HOW J;  2VI6 A;  2MGQ A;  2R7Z J;  1VF9 A;  2X9D A;  2DMQ A;  1JJ6 C;  5E3O A;  4FTH A;  2G0E A;  3LSJ A;  2QF7 A;  1X2M A;  1IRZ A;  3NAR A;  2DA3 A;  3IV5 A;  5C4J J;  1F43 A;  4A3M J;  4FE7 A;  4A3K J;  2XB0 X;  4I76 A;  1MSF C;  5GPC A;  2JK3 A;  2Y0S N;  3S1R J;  3QPS A;  1NK2 P;  1JKO C;  3HDD A;  1MBH A;  1UHS A;  2CRG A;  4D7N A;  1S7E A;  1OJL A;  3BR5 A;  1XG1 A;  1AKH A;  1VND A;  1ZR2 A;  3S1Q J;  1H8A C;  1P7I A;  1A6I A;  1GV5 A;  2YS9 A;  4BBR J;  4D5C A;  1IUF A;  1K83 J;  1IC8 A;  1H88 C;  2ECB A;  4MLO A;  2R5Z B;  3JRF A;  1UG2 A;  5M3F J;  2TCT A;  1TWA J;  3QPL A;  1APL C;  1HDD C;  4FE4 A;  5C3E J;  2ELK A;  1Q1V A;  2VKE A;  3GTP J;  2FD5 A;  5K7F A;  1HCR A;  3K2A A;  3G1L A;  3RQI A;  5E3M A;  2M8G X;  2XPU A;  3GTM J;  1QRY A;  1HF0 A;  2IAI A;  1BJZ A;  5M5W J;  3ZQL A;  5GPA A;  5EGO A;  2CUF A;  1WCM J;  1F36 A;  3BR1 A;  4AYB N;  4XRS A;  4A3G J;  1PUF A;  3IH3 A;  1ETX A;  2JA7 J;  3IH2 A;  1B8I A;  1BW5 A;  1NTC A;  2WB1 N;  1WH5 A;  1BW6 A;  4BKX A;  5EEA A;  3S2D J;  3HOZ J;  3I4N J;  4DW6 A;  5IYD J;  1U78 A;  1E3O C;  5M3M J;  1MH4 A;  1FTZ A;  5IYB J;  3GTO J;  1ETV A;  3SDG A;  2EQR A;  1DU6 A;  5M5Y J;  4MFE A;  1AKH B;  4B1R A;  1FIP A;  3OSF A;  2EBI A;  1W0U A;  4XIC A;  2K9S A;  1MH3 A;  5J1R A;  2EZL A;  3SFI A;  3BR0 A;  5HOD A;  4IEJ A;  1QVT A;  4D7M A;  1WPK A;  4M3F A;  3H3V K;  3S14 J;  2X48 A;  2EH3 A;  2PMZ N;  3M4O J;  1IG7 A;  2E2H J;  3Q0U A;  4A3I J;  2ZB9 A;  1AHD P;  4LOC A;  2XGC A;  4M6V A;  2LP0 A;  1MNM C;  2XPV A;  1XC5 A;  3S17 J;  2Y9Z A;  2M0C A;  3HB9 A;  5F08 A;  1BA5 A;  1JT0 A;  3RZD J;  3SJM A;  3GBG A;  2DA5 A;  2HYJ A;  4JX5 A;  3BG5 A;  5EGO B;  1ZK8 A;  1I6H J;  3FKI J;  2Y9Y A;  4QSH A;  5DTD A;  4A3C J;  4A3J J;  2ME0 A;  1PUF B;  3HOX J;  5FKM A;  2R5Z A;  1ZR4 A;  2XGD A;  1B8I B;  5FLM J;  3FIS A;  4AC0 A;  1HDP A;  2HOA A;  5E3L A;  3HM5 A;  4J19 A;  4XK4 A;  3S16 J;  1Z0X A;  2LK2 A;  2M9H A;  5FKK A;  4DZP A;  2KT0 A;  1CQT A;  3I4M J;  3G1O A;  3TW7 A;  3LOC A;  3B6A A;  2ECC A;  1ZKG A;  5K7Z A;  2XGE A;  2H8R A;  3ZQI A;  2LY9 A;  1ZGW A;  2ME6 A;  2LD5 A;  4A93 J;  3JR9 A;  3PO3 J;  4V2F A;  1U8B A;  1U9N A;  1O4X A;  3BT9 A;  1OCT C;  2MSY A;  2JWT A;  2K40 A;  2P81 A;  2R93 J;  1JKP C;  5IP6 A;  1MSE C;  2CU7 A;  3MN2 A;  3ZQC A;  2VPR A;  2VUM J;  4A69 C;  3HOV J;  3E7L A;  2WAQ N;  3PO2 J;  3A02 A;  4JX4 A;  1RKT A;  2DMN A;  2NOG A;  2EZK A;  2TRT A;  4JYK A;  1ENH A;  2R0Q C;  5EYR A;  2CQQ A;  5EDN A;  1YRN A;  3JRI A;  1SFO J;  5E3N A;  1QVU A;  2LR8 A;  3DCF A;  3ZOB A;  2FX0 A;  3LSP A;  3ZQF A;  4IHV A;  5EG0 A;  3UKG A;  4A3B J;  1ZTR A;  1WGX A;  2HOS A;  4FIS A;  2AO9 A;  1Y1W J;  3QQA A;  4CYC A;  1ETK A;  1B72 A;  5F0F A;  3CMY A;  2EZI A;  3CCY A;  1D5Y A;  2HOT A;  4Y52 J;  3BR6 A;  4MFD A;  4MO7 A;  4IHY A;  1IV6 A;  1RET A;  4A3L J;  1P7J A;  4V2G A;  4BY1 J;  2LFB A;  3ZQG A;  2NVX J;  2R5Y B;  3JRB A;  3BQY A;  2JA8 J;  2FJ1 A;  3JRD A;  1VFC A;  3D1N I;  5IPA A;  3HOY J;  3HBL A;  5M5X J;  2L7Z A;  1OFC X;  3MKL A;  3Q0W A;  2CUE A;  2JN6 A;  4M3D A;  5EZH A;  2M34 A;  4W97 A;  5EF6 A;  1JUM A;  2R92 J;  2E2J J;  5DS9 A;  5J3L A;  2MW8 A;  1X58 A;  3M3Y J;  2KDZ A;  5F0C A;  3HGY A;  1JT6 A;  1SAN A;  2JA5 J;  3BTL A;  1XS9 A;  4IHX A;  1G2H A;  4RDU A;  3JRE A;  2EZH A;  5FKO A;  4FCY A;  5C44 J;  1LE8 A;  2LLK A;  1IJW C;  2O8K A;  2DA4 A;  3ZQH A;  1YRN B;  1MBF A;  4M3G A;  3VPR A;  1X2N A;  1A5J A;  4XRM A;  3DEW A;  4GFB A;  5EG0 B;  1DU0 A;  4RBO A;  4D5F A;  3PM1 A;  2HI3 A;  3G1M A;  2NVQ J;  4QIW N;  2O7O A;  1JJ8 C;  4L5E A;  4CYC B;  1B72 B;  2L7F P;  5J1Y A;  2YUS A;  2HQ5 A;  1I50 J;  1RPW A;  2CQX A;  2I10 A;  2IBD A;  2WV1 A;  1IDZ A;  2HXO A;  4S0H B;  3NAU A;  4DYQ A;  4A3D J;  1AU7 A;  2MG4 A;  3BG9 A;  1FIA A;  2LKX A;  3JRH A;  2M2E A;  4X6A J;  3HEF A;  3K7A J;  2AHQ A;  3BG3 A;  4Y7N J;  3W6V A;  4M3B A;  3FK7 A;  4DYR A;  4W1U A;  1HLV A;  2COB A;  5GP9 A;  4ABZ A;  2DMU A;  2O9L A;  3FIW A;  5EZG A;  1QPI A;  3O8G A;  3B6C A;  1GDT A;  5F04 A;  3A03 A;  4BXX J;  3RKQ A;  2OPT A;  5JLX A;  1RKW A;  2GBY A;  2R5Y A;  1FEX A;  1LE8 B;  1H89 C;  1GUU A;  2DJN A;  3OSG A;  4BY7 J;  3OOU A;  3WHB A;  2GLO A;  2ID3 A;  1U9O A;  5F1J A;  1K61 A;  1TWC J;  1MBK A;  2E19 A;  3WHC A;  2D5V A;  1Y1V J;  1ETY A;  2XB5 A;  2JA6 J;  1EF4 A;  4C3H J;  1W0T A;  1POG A;  4G12 A;  1R9T J;  5IP7 J;  1JUP A;  2NVT J;  3S15 J;  2DA1 A;  5BNG A;  1JTX A;  4UUS B;  1NK3 P;  2DA7 A;  4XRS G;  1T56 A;  3S1M J;  3JRC A;  3FK6 A;  1ETQ A;  1LFB A;  3HKZ N;  4DYC A;  3S1N J;  5J1U A;  2L0K A;  3BQZ A;  2Y31 A;  1JGG A;  1IDY A;  1MBJ A;  1JKR C;  2CJJ A;  1ORK A;  1MBG A;  2RAE A;  2DA2 A;  3BTJ A;  3HOU J;  5FJ8 J;  2OF7 A;  5IYC J;  3GTK J;  1UMQ A;  2DTZ A;  1GV2 A;  5FKL A;  4HNV A;  3JRA A;  4EEF G;  2ID6 A;  3CQZ J;  2DN0 A;  5FLV A;  2N8G A;  3HGG A;  3TP0 A;  2K9Q A;  4JP0 A;  3CDL A;  4A3F J;  3H0G J;  3BTI A;  3A01 A;  2JMW A;  5IOY A;  5FKN A;  1RES A;  1JTY A;  4BBS J;  2XRL A;  1ITY A;  1LFU P;  9ANT A;  4C3J J;  1GT0 C;  2LTP A;  3TED A;  1ETW A;  1OCP A;  4DZJ A;  3RZO J;  4AUX A;  4NDL A;  3BR3 A;  3Q3S A;  4B3A A;  2K9N A;  2FQ4 A;  1ZQ3 P;  1TWF J;  4UUT A;  4QTR A;  1VI0 A;  3L1P A;  3BR2 A;  5F0H A;  2L9R A;  4C3I J;  4I6Z A;  3GTQ J;  1FJL A;  1WI3 A;  3S2H J;  1RR7 A;  2XPW A;  5IP9 J;  4XID A;  2IEK A;  4IHW A;  2L7M P;  3O8H A;  3Q0V A;  4C2M J;  4B4C A;  1IGN A;  2E1O A;  1Z77 A;  2NVY J;  2QCO A;  3GTL J;  2Y2Z A;  1TWG J;  3LSR A;  1WH7 A;  3BTC A;  1FTT A;  4UUS A;  5F27 A;  2XSD C;  3IH4 A;  1T33 A;  2VKV A;  2E2I J;  2JJ7 A;  3LNQ A;  2GM4 A;  1JUS A;  3GTG J;  1HOM A;  3F0C A;  2DMP A;  4M3E A;  2X6O A;  1I3Q J;  1TC3 C;  3LSG A;  5JLW A;  3A01 B;  2HDD A;  3JRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...