2E1EA

Crystal structure of the hrdc domain of human werner syndrome protein, wrn
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
94
structure length
94
Chain Sequence
QPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKRIDGVSEGKAAMLAPLLEVIKHFCQTNSVQTDLFSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the HRDC domain of human Werner syndrome protein, WRN
pubmed doi rcsb
molecule keywords Werner syndrome ATP-dependent helicase
molecule tags Hydrolase
source organism Homo sapiens
total genus 33
structure length 94
sequence length 94
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2e1eA01
1GO3F 3SAHA 4CGZA 1YT3A 2RHFA 2E1FA 3SAGA 4QIWF 1WUDA 5C0YA 2HBKA 4NLBA 3CYMA 4O3MA 4OO1J 4CDGA 1D8BA 4QJFB 2DGZA 4NLCA 2HBLA 2HBMA 2RRDA 2HBJA 2CPRA 2MA1A 2E1EA 2KV2A 3SAFA
chains in the Genus database with same CATH superfamily
2YMLA 3J81j 3EYZA 3QEBZ 1QTMA 5J0RA 4RUCA 3HJEA 5J8YA 3QEAZ 4ECWA 5J2EA 2YB4A 4PJ0U 8ICWA 4UASA 2ZJ8A 2CN1A 3N7SC 2A19A 1ZQNA 3ORYA 3WKCA 1D8YA 4AP9A 5KG6A 9ICCA 1TV9A 4FZMA 2W7OA 4RZRA 4Y2JA 5AM1A 2MUTB 2C22A 2A1JB 2JEIA 8ICUA 1WYGA 4B9LA 4RUAA 3PSFA 3PSIA 5KFXA 4UAUA 3QU5A 5AKLA 2JMGA 2KVCA 5AKIA 3RH4A 4DL3A 2IMWP 3F2DA 1D9DA 5CP2A 4ECXA 1UHUA 5AHXA 5J2FA 1RQLA 4KLGA 1NKBA 4U7CA 4RU9A 2FLPA 3NVYA 2BDUA 4OJ6A 3B0YA 4B9VA 3PSTA 1ED1A 3D6JA 3ALRA 2EZYA 3K1RB 1ZQXA 4Q43A 4P0PA 7ICGA 2VJ4A 1SL0A 9ICOA 4RPYA 1L3VA 3DV9A 2AGPA 3GILA 2WTFA 5IIMA 2LYBA 5DG7A 3QE9Y 2IOHA 1IIPA 3I76A 1S10A 2DL0A 3GQCA 1ZQRA 1KDHA 7ICHA 2Y1JA 1F44A 3OGUA 7ICKA 1X2IA 5ALSA 1JMSA 2BCRA 3RTVA 3HP6A 8ICTA 1ZQVA 3KHGA 3BQ1A 1RG6A 4C4TA 5AKXA 1FEZA 2YX8A 3RH5A 8ICZA 3MC1A 4EX7A 2LYAA 1A77A 4Y2TA 4RNNA 4UAWA 4YVZA 2W55A 4YMOA 1SV0C 5AI4A 2KJ8A 3WK7A 4KMOB 1YT3A 8ICYA 1UCVA 2W43A 1O03A 1HEKA 4NL9C 3KHRA 3PR4A 1BNPA 2ZG6A 3RR7A 1L8OA 8ICIA 2VA3A 2B21A 5ALKA 7ICQA 2VA2A 1S97A 2VANA 1SZHA 4JB3A 4G3IA 3GDXA 4P0PB 2PI5A 1F5SA 5BPCA 4DQRA 4G9BA 2E5SA 5ALJA 1PVQA 3KKAA 4C0ZA 3HT3A 5KFGA 3PX4A 3QUQA 1COKA 5AI8A 2Q4TA 1CUKA 4F4YA 4F50A 2HI0A 4RQ7A 4QIWC 1S8OA 2KZMA 3T5KA 1XSPA 4I2IA 1BVSA 9ICLA 4RQNA 4JV2A 4Z6FA 9ICKA 3RB3A 3C23A 3ICXA 1N2XA 2E3TA 2ODGA 1TAUA 2NRVA 4MFAA 4QWCA 4TURA 4DFMA 1SV4A 4JWMA 4PHAA 5DQGA 4C80A 1ZQSA 9ICBA 2CPRA 2PFQA 5AI9A 1QQ6A 9ICIA 2AH5A 1ZQZA 5KAFU 3WK5A 3RBDA 3V6HA 1NK9A 4O3RA 4F5NA 5ALYA 4ELUA 4FS2A 2XVTA 2BZFA 4KTQA 1Z4OA 1AQ6A 4YR2A 3UMGA 5EWFA 2Z7JA 4F5QA 2KHQA 1ZQHA 4F5RA 1DOQA 3RR8A 5IIIA 9ICHA 3G6YA 3QX7A 2KJ5A 7ICJA 1C7YA 5KT6A 4P4PA 3GV7B 3AL0B 1NNLA 4O5EA 3WK8A 5EE1A 2KK0A 3RJHA 5BOMA 1ZQJA 3WKAA 8ICPA 4RNOA 5ALVA 4R65A 4J9QA 3UPQA 1N56A 9ICSA 4RQ4A 3WU2U 4F72A 2E1FA 4RPXA 5AKJA 1DGJA 1HJPA 2HOQA 5J2CA 3NVZA 5KFZA 4K4IA 2KP7A 5F9LA 4DL2A 5F9NA 2J6UA 2E8OA 3RRHA 1BPDA 2FDRA 2GH1A 4TQSA 3O0FA 1SL1A 3KTQA 4C8MA 5ALRA 4TQRA 4M2YA 3Q8KA 5DB7A 4DL5A 5KFHA 4PPXA 2WB1F 2HHUA 4F4WA 4EZ6A 5G5GA 1ZD3A 7ICMA 3H7IA 4J9RA 3TAQA 1COOA 4F92B 3H4BA 3QUBA 3ZDDA 3QU2A 2IHMA 1N60A 3F5AA 4DOCA 1QSLA 1S0VA 2WF9A 2DKXA 4YG2A 1C20A 3SQIA 4ED7A 3TAPA 2PFPA 1J2NA 5AKGA 1S5LU 3EZ5A 2IOFA 1U9LA 4DO9A 2VIXA 2XGQA 3GV5B 3C2KA 2OH2A 1WWUA 4I2GA 4B9TA 1HUZA 1KKXA 3R9KA 2G5HB 3THVA 1MQ3A 4J9MA 5KG5A 4JV1A 4PZNA 5KT4A 1X9SA 3RFAA 3AU2A 4F2SA 4O3NA 2YY6A 5GTHU 1N63A 2KKPA 1RM6C 4R8UA 8ICEA 2ESEA 4EEKA 9ICUA 1NK5A 3NVVA 3F53A 3SZ2A 3ISDA 1KLNA 1QQ5A 1SL2A 1ZD2P 3L5KA 4QZAA 5ALWA 3NRWA 3WK4A 4I2BA 4CF3A 3EW9A 4QIWF 1X6JA 2BQUA 5J2DA 2KFZA 4IR1A 3RJGA 4UW9A 5ALZA 4BWMA 2LMRA 3KFUF 3MGIA 1JXEA 1ZRMA 1DK2A 3H8JA 3ZDEA 4M04A 2BKEA 2AU0A 4FFDA 5AKEA 5CJ7A 5KFPA 1N61A 2K4HA 1L7OA 4OJPA 2ISOA 4AYBC 1N5XA 2W9BA 1ZETA 2MRLA 2BQRA 1SIJA 9ICTA 4KLIA 2Y1IA 5J8YC 2H5XA 3T5JA 3RH6A 5J2IA 4FZNA 2KMDA 3LK9A 3RB0A 4P4MA 1ZQCA 1NK0A 4DL7A 2K60A 4CF5A 3UXPA 4RQ6A 2PMZC 4NLKA 4O9MA 4UB1A 2K8AA 4ECUA 4O3PA 1HIWA 2JH1A 3LYSA 3E0FA 2KD1A 2JEFA 3UMBA 3HKZF 2KSOA 4DL4A 2WF8A 3EPGA 3PSPA 3QZ7A 1TK8A 4B9NA 4IR9A 4UAYA 2UVRA 2HW3A 2F44A 2H3VA 5J0WA 4QW9A 4PGXA 3T3FA 3B9JA 5KT5A 2HBLA 3PW2A 4R8UB 5KL8B 4RQ1A 5KNIA 4DS4A 4QZCA 1U48A 5DG9A 2AXTU 5KL1B 3AQEA 3OJUA 2QLTA 3CP8A 3PO4A 3N97B 1RPLA 4IC9A 2HHXA 3QYPA 3PVXA 4NM1A 3BQ7A 4NWIA 4MF8A 1Q3VA 3KHLA 5KFWA 4ED2A 1KFTA 1S0OA 2NRXA 3DDHA 1MC8A 3NRZA 2W8LA 3TFSA 4RNMA 1IXRA 4M9GA 2W9BB 1ZQMA 1V9PA 1X66A 3CYMA 4CCHA 4I2FA 2PXIA 2OWOA 4I2CA 1NI3A 2J6SA 1OXJA 4Y2QA 2AHOB 3I1YA 5AI6A 4DSIA 1KSPA 5ALIA 7ICUA 4UAVA 2IHNA 3D2NA 3TARA 2ASDA 5EE3A 1ZOLA 4XUSA 1GO3F 3FDSA 4EEYA 3AU6A 1TE2A 4F2RA 2DQNB 2QB0A 2KIVA 2KSOB 2LPEA 3BZCA 5KFMA 2XGPA 1NK8A 3D2QA 4PL1A 1WCLA 3T5HA 4I2AA 3NVWA 5J29A 1Z19A 1ZJNA 5DLFA 3I28A 4KLMA 5CR0A 5HR7A 5EOZA 2BGWA 3SAHA 4Z6CA 2D3DA 3AMZA 1ZQBA 2ZIUA 1QLNA 7ICVA 1K5OA 4M9NA 3H40A 1KFSA 2G0AA 5G5HA 3BS7A 2G09A 2RDIA 1XSNA 1VLBA 3C2LA 2AQ4A 4NLCA 3WKDA 4QZIA 1DXSA 4J9NA 4IQVA 1L6NA 2V9WA 2VJ5A 2XC9A 3Q8RB 9ICVA 4GC6A 1PK1A 3GIKA 3AUOA 1SKSA 1S9FA 2HVHA 2H3IA 3JPTA 1NK7A 8ICRA 4DF4A 4NM2A 5CHGA 4DF8A 5CWRA 3KKAC 5IIOA 4Z6EA 4A8EA 3KHHA 5HHIA 4DFJA 4PH5A 1JN3A 3RAQA 4YCXA 3N7PD 2EH9A 3IRUA 1ZQQA 4R66A 4KLJA 5KG2A 2QB0B 1N48A 4XRHA 2F1JA 1LV5A 2K4IA 4CNQA 4AYBF 1JRPA 4GXIA 2UVUA 4C4RA 3G6XA 3WKBA 3GZFA 1Z3EB 1X42A 4F91B 2H3ZA 1WCNA 2ZUDA 4O3QA 4EYIB 4F5OA 8ICJA 1Z00A 2PKEA 2ZIUB 9ICJA 1ZQKA 4R64A 3F2CA 1T4GA 4DQIA 3LVVA 5JRTA 1ZQEA 4DWIA 2R8IA 2I6XA 2XY6A 4EX6A 1P7DA 1ZQIA 2HDOA 3C21A 5EWGA 1PK1B 7ICLA 4BJQA 7ICEA 2FMSA 4R63A 1H38A 2EAMA 3PR5B 2BDPA 7ICSA 4OO1J 3PY8A 1ZQDA 4GXJA 2BCSA 4DEZA 4US9A 1NKEA 2H3QA 8ICAA 4YXJA 2YQEA 2F3NA 3QU7A 1JXLA 4ECYA 3RJFA 2ZTEA 4LZGA 1A0PA 4J9OA 2WAQF 4IL6U 1NJZA 1SXDA 4YMMA 1NOMA 4YQWA 3WK6A 3NGDA 5DG8A 4GIBA 4JMUA 2HVIA 2YMMA 5DB8A 3HPOA 3RB6A 2Y0SF 1UT8A 4QZHA 1MN8A 1DK3A 3GFKB 3H8SA 5T14A 4KLOA 2BPCA 1Z00B 1UQVA 2R8GA 2E8NA 3PNCA 5J0XA 1SWWA 3TANA 5DDYA 1O08A 5AI5A 1L7NA 3ZDCA 3EPIA 1L3TA 2I5HA 3M9NB 5AM4A 4O5KA 2KN7A 1J97A 2WFAA 2B0CA 1S0MA 4F93B 3QUCA 1KQQA 3NS1A 3TADA 4ECQA 4CE6A 1N5WA 5F3XB 5KFQA 2YTUA 4DFKA 2ATLA 4NLZA 2DWQA 4QZFA 1ZQTA 3PZPA 5BOLA 2V4QA 4O3OA 1B0XA 4Z6DA 4RPZA 2AQ0A 4C8NA 4DFPA 1NJYA 4FE3A 2KFNA 2NRWA 4ICAA 3GU3A 4DL6A 3K4GA 9ICWA 2GO7A 2KE7A 4DOAA 3ISCA 1X9MA 4F8RA 4ECTA 4M9JA 3CRXA 2D6FC 2F1HA 3IDWA 1JX4A 1ZQPA 3AN1A 2QB1A 3QNMA 2DFLA 5ALNA 2EZXA 3BDPA 3PW5A 3HRDD 1D8BA 4ECSA 3OSNA 1KFDA 1RQNA 4ECZA 8ICLA 2DBYA 4RQMA 3D2SA 1PVRA 1TK5A 1ZQOA 2HHSA 2XO7A 2JRZA 2QKQA 7ICIA 2DKZA 4Y2XA 4ECRA 5J2HA 5ALHA 4DQPA 2HBKA 4MHVA 4M9LA 3IP4B 3RJJA 4I28A 3FAHA 1U49A 3M9OB 2GLEA 2EAPA 4QW8A 3LDAA 2JR5A 1RXVA 1KTQA 1L8LA 5ALDA 8ICVA 4UB6U 1NK4A 4YR3A 3PMLA 1DRGA 8ICOA 4US8A 3IV6A 1ZQAA 2YMPA 1UT5A 3OTQA 5EE9A 4YR0A 4KLSA 4ECVA 2K89A 5DBAA 3IHQB 4KN4A 1V85A 2ZIWA 3M7DA 2RRDA 1BPZA 3OPXA 4DS5A 1BPXA 4E0DA 9ICMA 4IS7A 3PX0A 1Q3UA 2EZZA 3MDCA 4F4XA 3RBEA 4RQ3A 3KD3A 3H8MA 1KEJA 1UA1A 4UB5A 5CEHA 3BZKA 4FO6A 1YZ6A 3SR6A 3GIJA 5EWEA 1K1SA 2E8MA 8ICCA 5AK3A 1A76A 3JPSA 2XY7A 4KX5A 2LBOA 1PK3A 2ZIXA 1A6SA 4C8OA 1LKYA 1J2MA 4M6WA 3JPRA 1D9FA 2H3FA 5C0YA 2PI4A 3JPNA 5IILA 5HNKA 4NJ8A 2ZTCA 1F0MA 5K4LA 3BQ2A 2RQ5A 3C1YA 2ISPA 3TFRA 1V38A 2JEGA 2K4PA 4ED8A 2ZUBA 9ICAA 3MR2A 5J0YA 4OJ5A 4NLNA 5B5EU 4KLFA 5KT3A 4DCCA 3H0MB 3MABA 5ALOA 4TUSA 1XSLA 2PFOA 5KFJA 5KG7A 3H0LB 2GOLA 9ICRA 2XICA 2UVWA 3PW4A 4EELA 4J9SA 4DFDA 2MAXA 2ZIWB 5DGBA 2NV3A 1ZJMA 3MR5A 3PMNA 3EWAA 2AJQA 2OCEA 1JIHA 4MEYA 3C1ZA 4ZH4A 5L1JA 1KW4A 7ICTA 5ALGA 3FM9A 4F5PA 1WG8A 1ZQWA 1V97A 3HWTA 2YMQA 4J9PA 4PZOA 4QWBA 1LVHA 4TUPA 2FE9A 5J0QA 5J0TA 2F76X 2ZIXB 1OW5A 4GXKA 2W9AA 1T3QA 3S6JA 1MA7A 1Y88A 4NV0A 1LKYB 3L4PA 2M0NA 4M6WB 1DGSA 4M47A 2OHFA 2ALZA 2IOFK 3Q8MA 1FFVA 2I1QA 3SYZA 3JPQA 4J9KA 1S77D 1JALA 2F8LA 4JWNA 2NO4A 5J2KA 5GTIU 1ECWA 3MR3A 8ICQA 1XNSA 2E1EA 5ALPA 2FLLA 5HMLA 3Q8LA 2G06A 4NY8A 4BXOA 3QUTA 7ICPA 4EENA 3ETLA 2JV3A 3PX6A 8ICNA 1WWVA 2KJ9A 2HOIA 3M6ZA 4Q45A 5KFVA 3C29A 4Y2VA 4RQ0A 1FIQA 2WHEA 3CNHA 5J0PA 8ICHA 9ICPA 4C7ZA 5KFBA 3Q8SB 5J2JA 1AROP 1NZPA 5D46A 4OJLA 5KFDA 4KLHA 2OYYA 2LYHA 3QU9A 3BQTA 5ALMA 1SXEA 2BCQA 3TKAA 1SZPA 3VCBA 2WF6A 1SWVA 3N7RC 4EBDA 3OSPA 2KHVA 3ZDBA 2WF5A 3BQ0A 2RHFA 5L1IA 5KAIU 4UAZA 4ED0A 1ZQGA 5KFUA 1TFRA 2F1IA 3LWMA 3B0XA 4P2HA 5L1LA 4BGDA 4YN4A 4RT3A 2W9MA 2P66A 3KBBA 1L3UA 2ZXHA 5KFIA 2JZBA 4C8KA 3C5GA 4ZOHC 4BXOB 1KL9A 4F4ZA 1MQ2A 2W9CA 2QARA 4TUQA 2KVSA 4XA5A 1BPEA 3ED5A 2KZ3A 2LI6A 1RDFA 5L1KA 2KTQA 1IG6A 3MGHA 5ALFA 1SB3C 1BNOA 4KLTA 2HHVA 5KFTA 1VDVA 1RYRA 1TAQA 5L1MA 1QH9A 4QJFB 1PVPA 4UB2A 5ALLA 3AQFA 4DOBA 7ICFA 3T79A 1X40A 2FPMA 2RP5A 2ZIVA 4Y2UA 3RJEA 3SV3A 2C28A 8ICBA 3U26A 5KFYA 2W03A 2B6GA 2IBKA 1URJA 2OM6A 4I2DA 3TADC 3PW0A 2UVVA 3K1ZA 5E79U 4EYHB 1QCKA 4Q8FA 3A0HU 2OXOA 5IIJA 1Z1BA 5C5JA 5CA7A 2ES6A 4EZ9A 1NJXA 3IG5A 1CEZA 5KFCA 4DSEA 4B9MA 4CF4A 1UPHA 4WJ3B 2JZBB 4I2JA 3PW7A 3RJKA 5KFLA 4KLLA 3MBYA 2KG5A 4NLBA 4PGQA 1ZXIA 2W9CB 2QARB 4ED6A 5KFOA 1NZBA 5AM5A 2NRZA 8ICFA 4DQSA 4C8LA 5EE0A 3IG8A 2F8KA 2W3SA 2PMZF 5KFAA 1IM4A 2MSNA 1SGGA 1RXWA 3SD7A 3KZIU 5IIKA 2J6TA 1M6YA 3F5EA 1ZQ1C 2LM4A 5KG0A 5JUMA 2P35A 5AK4A 2RLTA 2PFNA 4HYKA 2XCPA 1LB2B 4MFCA 3OJSA 2ZIVB 2FLNA 4OJOA 4KX3A 1JROA 3SAGA 4UB3A 2HHTA 4IRKA 4GC7A 4OD0A 3AEVA 4IQUA 3LWLA 1K1QA 2JXJA 5CRXA 2KOBA 5DBBA 5DDMA 1NK6A 2DPJA 5KFNA 2HCFA 3V6JA 3M9MB 1B4FA 1XWLA 3KZXA 2ASJA 1X6IA 4M9HA 5ALUA 3SI8A 3OHBA 4DLGA 1WUDA 2Q0ZX 3GIIA 4KLQA 4QWEA 2DF4B 2FPLA 5KT2A 2BPFA 3TACB 2WB1C 3C28A 2OEHA 1ZQLA 3PV8A 4I29A 4Y2PA 5AICA 3H4DA 5AKKA 5AI0A 1KBUA 1U45A 4EBCA 3GIMA 4KLUA 2W54A 2K8BB 3N4MB 1ZQYA 4KN7A 1XC9A 3E2EA 2AGOA 3Q8QB 5KG1A 5KFFA 1Q8KA 3V6KA 3RB4A 3MFHA 5DGAA 2D8CA 4UB8U 1BPYA 3EUB2 2G5IB 2BCVA 5J0UA 3AM9A 1EXNA 4BWJA 3WK9A 3TQ1A 5L9XA 4DSKA 4PL2A 8ICMA 3HILA 1RYSA 2R8JA 4LJXA 4I2HA 4NXZA 9ICGA 5D49A 5TISU 3SV4A 5AKHA 1U47A 5HR6A 5AM2A 1TVAA 5DQIA 4YMNA 4MEXA 5KG4A 2ASLA 2NRTA 1FFUA 3UM9A 2DGZA 2HBMA 2ZXIA 4UARA 2HBJA 1TAMA 4YP3A 4FS1A 3V72A 4USAA 3MFIA 2KV2A 3UXOA 1N62A 4UBBA 4Y2YA 2W7PA 5TZVA 3RF9A 3H8WA 2ZTDA 4FBUA 4KMUA 2HSZA 3BS5A 3M6KA 1MSWD 3KOOA 2MU2A 1X9XA 1XO0A 2I9GA 4CRXA 2YB1A 2C2RA 3QU4A 2NYVA 3G6VA 9ICQA 2BPGA 5AIBA 4YFKA 2Y9TA 1NKCA 1SKWA 1B43A 4IRCA 1S0NA 3HKZC 1SKRA 4Q8EA 2HMXA 1Z1VA 5DB9A 2XI9A 1ZD4A 4KLEA 3ISBA 2P6UA 2R18A 4ELVA 2R8KA 3JPPA 5IINA 3UQ2A 4I27A 3WKEA 3L3FX 3LVWA 5AK5A 4M0AA 3HW8A 2V4RA 4C4SA 3SMVA 4XQ8A 4FBTA 2XIDA 3ZD9A 4YXMA 2W04A 4QZBA 3ZD8A 4KITB 3M1YA 4ELTA 4K4GA 7ICOA 2P6RA 2K4EA 4P0QA 4IQTA 2ZJAA 5DLGA 5DKWA 3MR6A 5KFSA 5AIAA 3TI0A 3BS5B 2K8CB 4GLXA 1T7PA 5J2GA 5ALTA 4B9UA 4DQQA 1JI7A 2E8PA 2N1RA 5AM0A 5DBCA 1ZYQA 3A0BU 1SV0A 1XO1A 2L5YA 5ALQA 4CGZA 2KZZA 3C2MA 4EBEA 3ETRA 3NASA 4NL9A 4UB4A 2A3VA 3QXGA 2AGQA 5HP4A 4DSJA 1YZ7A 7ICRA 4B9SA 1ZQUA 3VC8A 5A0LA 4QZDA 2Y9UA 7ICNA 2ZUCA 1ZRNA 1CRXA 3UXNA 4F71A 4F4KA 5AKZA 3PO5A 3SAFA 1BPBA 2ZJ5A 3ONNA 4DSFA 9ICXA 2KIWA 3M8SA 3N28A 4NLGA 9ICEA 4U6PA 4PHEA 1TKDA 1Q46A 4IRDA 4KLDA 5KG3A 2CRXA 2IA6A 1KRPA 1B22A 4C7YA 4X5VA 5AM3A 1U4BA 4P0QB 2EAOA 2YN4A 3V7LA 4ACOA 2FI1A 5HMMA 2VA8A 5JU5A 4Y2SA 8ICXA 5DB6A 4PHPA 4ED3A 3SEIA 4QZGA 1ZD5A 4I2EA 2HHQA 2C2DA 2LKYA 5D4BA 3V7JA 2W3RA 3DEEA 4MF2A 1L7PA 3ZI4A 1PZNA 5DQHA 3ZDAA 4JV0A 5KTQA 1X9WA 8ICKA 3CW2C 2NO5A 9ICFA 2VKQA 5J2BA 4RQ5A 1RZTA 4YD2A 3BJYA 1HUOA 2R8HA 1XU4A 3E58A 2M9NA 2EDUA 9ICNA 3C5FA 1L7MA 4BDPA 4P4OA 3JPOA 3H0RB 1RYUA 2DPIA 4O0IA 4RT2A 1FO4A 4Y2RA 3HX0A 1NJWA 2GWSA 1TK0A 3IM1A 3F2BA 1L5UA 1KN5A 2KICA 2KNJA 5J0OA 4RQ2A 3NUQA 4B6JA 2FPKA 2W11A 5J0SA 2JHDA 1T3NA 1OUQA 1D8LA 4JK1A 4LVSA 2A1AA 2EQYA 5KFKA 3NTUA 5CB1A 5KFRA 2HHWA 4QNLA 2JEJA 2BR0A 2LHTA 4BUGA 2G07A 3GV8B 1XS9D 4IQWA 2KKVA 3SENA 5KFEA 2RDJA 2FMPA 1QQ7A 4HAIA 1L3SA 1S76D 4UQGA 3T5LA 1T8EA 5ALXA 2F2AB 4O3SA 1ZQFA 5H2FU 3FYHA 2KEYA 2BQ3A 4F3OA 5B66U 4RQ8A 2XCAA 2W8KA 2WAQC 3IN5A 3V7KA 4PHDA 2FJ6A 2BHNA 8ICGA 2F77X 3QZ8A 5ALEA 5AKYA 4O5CA 2LM1A 2Y0SC 1T94A 3FC4A 4QWAA 5JTIA 2C2EA 2WF7A 4J9LA 2MA1A 4ED1A 1IV8A 3OHAA 2XY5A 4QZ9A 1BGXT 3K75D 3RRGA 1Z4NA 2MUTA 2EANA 4DSLA 4UATA 2A1JA 4Q44A 5J2AA 4UBCA 4CDGA 4PGYA 4QZEA 4BX9C 2HOFA 3MGVA 2FMQA 2CXYA 4JUZA 3MDAA 4YD1A 4FZLA 1QSYA 4GFJA 1CI4A 2G08A 3M8RA 4K4HA 4J03A 1JUDA 4MFFA 5FP0A 5KT7A 3RJIA 2O6KA 3RAXA 5AK6A 3Q8PB 2BCUA 5HHHA 1UA0A 4O3MA 1VJ5A 4OCZA 2DUYA 8ICSA 4LZDA 3UMCA 2JH7A 4QZ8A 4DLEA 2JGAA 1PUZA 1QSSA 4QWDA 3UQ0A
chains in the Genus database with same CATH topology
2KD1A 2ZXHA 3SAHA 4FE3A 1MA7A 4P0QB 3HKZF 4NV0A 4ACOA 2ZIUA 2M0NA 3GU3A 2PMZF 4ICAA 3SQIA 4BJQA 2G0AA 3L3FX 3PSPA 3LVWA 2F2AB 2G5IB 2G09A 2VIXA 2XVTA 2YB4A 4OO1J 2H3VA 2YX8A 3F5EA 2F8LA 1ZQ1C 2KEYA 2CN1A 3SMVA 3N7SC 4NLCA 2OH2A 2HBLA 2H3QA 2LKYA 2XIDA 4KX5A 2W04A 2LBOA 3CRXA 2D6FC 2LYAA 2WAQC 1ECWA 2ZIXA 5KL8B 3IN5A 1L6NA 1A6SA 4PL2A 2G5HB 2Z7JA 2KHQA 2VJ5A 2E1EA 1XNSA 3DEEA 2K4EA 4P0QA 2ZIVB 2KJ8A 4KMOB 1YT3A 5KL1B 1A0PA 3AQEA 4OJOA 2G06A 2KJ5A 4KX3A 2F77X 2WAQF 1HEKA 4FZMA 2H3IA 2H3FA 3SAGA 2W7OA 2ZG6A 3AL0B 2VKQA 3CP8A 5C0YA 4IC9A 5HR6A 2Y0SC 3RFAA 2K8CB 4NWIA 1Q3VA 1D8BA 1T94A 4QJFB 3PSFA 3PSIA 2DGZA 5CRXA 4JMUA 1PVPA 2KKPA 2KOBA 2N1RA 4A8EA 2KJ9A 2HBMA 2JMGA 2ZXIA 2HOIA 2HBJA 1TAMA 2KVCA 2Y0SF 1SZHA 3AQFA 2MA1A 3M6ZA 3T79A 3C29A 3D2SA 2RP5A 2ZIVA 3F53A 4OJ5A 1PVRA 4P0PB 2KV2A 3N7PD 3F2DA 3KZXA 5T14A 4CGZA 2W7PA 3H0MB 2A3VA 3RF9A 2W03A 3NRWA 2E1FA 1URJA 1HIWA 2OM6A 4QIWF 1WUDA 3H0RB 2E5SA 3E0FA 2HBKA 3M6KA 2K4IA 4C0ZA 3IP4B 3H0LB 4U7CA 1PVQA 4AYBF 2GOLA 2BDUA 3CYMA 3K1ZA 4OJLA 3KFUF 5A0LA 2XICA 2HOQA 3VC8A 4OJ6A 4CDGA 2OYYA 2DF4B 2Q4TA 1ED1A 3PSTA 3F2BA 1XO0A 2KNJA 2KICA 2OXOA 2ZIWB 4BX9C 3ALRA 3GZFA 2HOFA 2NV3A 3MGVA 4CRXA 1Z1BA 1Q3UA 2WB1C 2GH1A 3D2NA 3NUQA 1CRXA 2YB1A 4P0PA 4QIWC 3C28A 3O0FA 2VJ4A 3IG5A 3VCBA 4FZLA 1DRGA 3SAFA 2JHDA 2K4HA 1GO3F 2H3ZA 3N7RC 4OJPA 1OUQA 4AYBC 4GFJA 2KHVA 1UPHA 2G08A 2DQNB 2MRLA 2RHFA 3ONNA 2ZIUB 4WJ3B 2WB1F 1KBUA 3D2QA 3F2CA 4NLBA 4QNLA 2KIWA 2LYBA 2LHTA 4FZNA 3LVVA 2K89A 4PL1A 3ICXA 4O3MA 1IIPA 4U6PA 4BUGA 2G07A 2ZIWA 3PZPA 1Z19A 1NZBA 3M7DA 2JH7A 2KKVA 3HKZC 2K8BB 2RRDA 1F44A 2HMXA 2CRXA 1P7DA 2JGAA 2CPRA 2PMZC 2F76X 3OPXA 2XI9A 2ZIXB 2K8AA 5HR7A 3F5AA 3IG8A 2JH1A 3LYSA 2R18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GO3 F;  3SAH A;  4CGZ A;  1YT3 A;  2RHF A;  2E1F A;  3SAG A;  4QIW F;  1WUD A;  5C0Y A;  2HBK A;  4NLB A;  3CYM A;  4O3M A;  4OO1 J;  4CDG A;  1D8B A;  4QJF B;  2DGZ A;  4NLC A;  2HBL A;  2HBM A;  2RRD A;  2HBJ A;  2CPR A;  2MA1 A;  2E1E A;  2KV2 A;  3SAF A; 
#chains in the Genus database with same CATH topology
 2YML A;  3J81 j;  3EYZ A;  3QEB Z;  1QTM A;  5J0R A;  4RUC A;  3HJE A;  5J8Y A;  3QEA Z;  4ECW A;  5J2E A;  2YB4 A;  4PJ0 U;  8ICW A;  4UAS A;  2ZJ8 A;  2CN1 A;  3N7S C;  2A19 A;  1ZQN A;  3ORY A;  3WKC A;  1D8Y A;  4AP9 A;  5KG6 A;  9ICC A;  1TV9 A;  4FZM A;  2W7O A;  4RZR A;  4Y2J A;  5AM1 A;  2MUT B;  2C22 A;  2A1J B;  2JEI A;  8ICU A;  1WYG A;  4B9L A;  4RUA A;  3PSF A;  3PSI A;  5KFX A;  4UAU A;  3QU5 A;  5AKL A;  2JMG A;  2KVC A;  5AKI A;  3RH4 A;  4DL3 A;  2IMW P;  3F2D A;  1D9D A;  5CP2 A;  4ECX A;  1UHU A;  5AHX A;  5J2F A;  1RQL A;  4KLG A;  1NKB A;  4U7C A;  4RU9 A;  2FLP A;  3NVY A;  2BDU A;  4OJ6 A;  3B0Y A;  4B9V A;  3PST A;  1ED1 A;  3D6J A;  3ALR A;  2EZY A;  3K1R B;  1ZQX A;  4Q43 A;  4P0P A;  7ICG A;  2VJ4 A;  1SL0 A;  9ICO A;  4RPY A;  1L3V A;  3DV9 A;  2AGP A;  3GIL A;  2WTF A;  5IIM A;  2LYB A;  5DG7 A;  3QE9 Y;  2IOH A;  1IIP A;  3I76 A;  1S10 A;  2DL0 A;  3GQC A;  1ZQR A;  1KDH A;  7ICH A;  2Y1J A;  1F44 A;  3OGU A;  7ICK A;  1X2I A;  5ALS A;  1JMS A;  2BCR A;  3RTV A;  3HP6 A;  8ICT A;  1ZQV A;  3KHG A;  3BQ1 A;  1RG6 A;  4C4T A;  5AKX A;  1FEZ A;  2YX8 A;  3RH5 A;  8ICZ A;  3MC1 A;  4EX7 A;  2LYA A;  1A77 A;  4Y2T A;  4RNN A;  4UAW A;  4YVZ A;  2W55 A;  4YMO A;  1SV0 C;  5AI4 A;  2KJ8 A;  3WK7 A;  4KMO B;  1YT3 A;  8ICY A;  1UCV A;  2W43 A;  1O03 A;  1HEK A;  4NL9 C;  3KHR A;  3PR4 A;  1BNP A;  2ZG6 A;  3RR7 A;  1L8O A;  8ICI A;  2VA3 A;  2B21 A;  5ALK A;  7ICQ A;  2VA2 A;  1S97 A;  2VAN A;  1SZH A;  4JB3 A;  4G3I A;  3GDX A;  4P0P B;  2PI5 A;  1F5S A;  5BPC A;  4DQR A;  4G9B A;  2E5S A;  5ALJ A;  1PVQ A;  3KKA A;  4C0Z A;  3HT3 A;  5KFG A;  3PX4 A;  3QUQ A;  1COK A;  5AI8 A;  2Q4T A;  1CUK A;  4F4Y A;  4F50 A;  2HI0 A;  4RQ7 A;  4QIW C;  1S8O A;  2KZM A;  3T5K A;  1XSP A;  4I2I A;  1BVS A;  9ICL A;  4RQN A;  4JV2 A;  4Z6F A;  9ICK A;  3RB3 A;  3C23 A;  3ICX A;  1N2X A;  2E3T A;  2ODG A;  1TAU A;  2NRV A;  4MFA A;  4QWC A;  4TUR A;  4DFM A;  1SV4 A;  4JWM A;  4PHA A;  5DQG A;  4C80 A;  1ZQS A;  9ICB A;  2CPR A;  2PFQ A;  5AI9 A;  1QQ6 A;  9ICI A;  2AH5 A;  1ZQZ A;  5KAF U;  3WK5 A;  3RBD A;  3V6H A;  1NK9 A;  4O3R A;  4F5N A;  5ALY A;  4ELU A;  4FS2 A;  2XVT A;  2BZF A;  4KTQ A;  1Z4O A;  1AQ6 A;  4YR2 A;  3UMG A;  5EWF A;  2Z7J A;  4F5Q A;  2KHQ A;  1ZQH A;  4F5R A;  1DOQ A;  3RR8 A;  5III A;  9ICH A;  3G6Y A;  3QX7 A;  2KJ5 A;  7ICJ A;  1C7Y A;  5KT6 A;  4P4P A;  3GV7 B;  3AL0 B;  1NNL A;  4O5E A;  3WK8 A;  5EE1 A;  2KK0 A;  3RJH A;  5BOM A;  1ZQJ A;  3WKA A;  8ICP A;  4RNO A;  5ALV A;  4R65 A;  4J9Q A;  3UPQ A;  1N56 A;  9ICS A;  4RQ4 A;  3WU2 U;  4F72 A;  2E1F A;  4RPX A;  5AKJ A;  1DGJ A;  1HJP A;  2HOQ A;  5J2C A;  3NVZ A;  5KFZ A;  4K4I A;  2KP7 A;  5F9L A;  4DL2 A;  5F9N A;  2J6U A;  2E8O A;  3RRH A;  1BPD A;  2FDR A;  2GH1 A;  4TQS A;  3O0F A;  1SL1 A;  3KTQ A;  4C8M A;  5ALR A;  4TQR A;  4M2Y A;  3Q8K A;  5DB7 A;  4DL5 A;  5KFH A;  4PPX A;  2WB1 F;  2HHU A;  4F4W A;  4EZ6 A;  5G5G A;  1ZD3 A;  7ICM A;  3H7I A;  4J9R A;  3TAQ A;  1COO A;  4F92 B;  3H4B A;  3QUB A;  3ZDD A;  3QU2 A;  2IHM A;  1N60 A;  3F5A A;  4DOC A;  1QSL A;  1S0V A;  2WF9 A;  2DKX A;  4YG2 A;  1C20 A;  3SQI A;  4ED7 A;  3TAP A;  2PFP A;  1J2N A;  5AKG A;  1S5L U;  3EZ5 A;  2IOF A;  1U9L A;  4DO9 A;  2VIX A;  2XGQ A;  3GV5 B;  3C2K A;  2OH2 A;  1WWU A;  4I2G A;  4B9T A;  1HUZ A;  1KKX A;  3R9K A;  2G5H B;  3THV A;  1MQ3 A;  4J9M A;  5KG5 A;  4JV1 A;  4PZN A;  5KT4 A;  1X9S A;  3RFA A;  3AU2 A;  4F2S A;  4O3N A;  2YY6 A;  5GTH U;  1N63 A;  2KKP A;  1RM6 C;  4R8U A;  8ICE A;  2ESE A;  4EEK A;  9ICU A;  1NK5 A;  3NVV A;  3F53 A;  3SZ2 A;  3ISD A;  1KLN A;  1QQ5 A;  1SL2 A;  1ZD2 P;  3L5K A;  4QZA A;  5ALW A;  3NRW A;  3WK4 A;  4I2B A;  4CF3 A;  3EW9 A;  4QIW F;  1X6J A;  2BQU A;  5J2D A;  2KFZ A;  4IR1 A;  3RJG A;  4UW9 A;  5ALZ A;  4BWM A;  2LMR A;  3KFU F;  3MGI A;  1JXE A;  1ZRM A;  1DK2 A;  3H8J A;  3ZDE A;  4M04 A;  2BKE A;  2AU0 A;  4FFD A;  5AKE A;  5CJ7 A;  5KFP A;  1N61 A;  2K4H A;  1L7O A;  4OJP A;  2ISO A;  4AYB C;  1N5X A;  2W9B A;  1ZET A;  2MRL A;  2BQR A;  1SIJ A;  9ICT A;  4KLI A;  2Y1I A;  5J8Y C;  2H5X A;  3T5J A;  3RH6 A;  5J2I A;  4FZN A;  2KMD A;  3LK9 A;  3RB0 A;  4P4M A;  1ZQC A;  1NK0 A;  4DL7 A;  2K60 A;  4CF5 A;  3UXP A;  4RQ6 A;  2PMZ C;  4NLK A;  4O9M A;  4UB1 A;  2K8A A;  4ECU A;  4O3P A;  1HIW A;  2JH1 A;  3LYS A;  3E0F A;  2KD1 A;  2JEF A;  3UMB A;  3HKZ F;  2KSO A;  4DL4 A;  2WF8 A;  3EPG A;  3PSP A;  3QZ7 A;  1TK8 A;  4B9N A;  4IR9 A;  4UAY A;  2UVR A;  2HW3 A;  2F44 A;  2H3V A;  5J0W A;  4QW9 A;  4PGX A;  3T3F A;  3B9J A;  5KT5 A;  2HBL A;  3PW2 A;  4R8U B;  5KL8 B;  4RQ1 A;  5KNI A;  4DS4 A;  4QZC A;  1U48 A;  5DG9 A;  2AXT U;  5KL1 B;  3AQE A;  3OJU A;  2QLT A;  3CP8 A;  3PO4 A;  3N97 B;  1RPL A;  4IC9 A;  2HHX A;  3QYP A;  3PVX A;  4NM1 A;  3BQ7 A;  4NWI A;  4MF8 A;  1Q3V A;  3KHL A;  5KFW A;  4ED2 A;  1KFT A;  1S0O A;  2NRX A;  3DDH A;  1MC8 A;  3NRZ A;  2W8L A;  3TFS A;  4RNM A;  1IXR A;  4M9G A;  2W9B B;  1ZQM A;  1V9P A;  1X66 A;  3CYM A;  4CCH A;  4I2F A;  2PXI A;  2OWO A;  4I2C A;  1NI3 A;  2J6S A;  1OXJ A;  4Y2Q A;  2AHO B;  3I1Y A;  5AI6 A;  4DSI A;  1KSP A;  5ALI A;  7ICU A;  4UAV A;  2IHN A;  3D2N A;  3TAR A;  2ASD A;  5EE3 A;  1ZOL A;  4XUS A;  1GO3 F;  3FDS A;  4EEY A;  3AU6 A;  1TE2 A;  4F2R A;  2DQN B;  2QB0 A;  2KIV A;  2KSO B;  2LPE A;  3BZC A;  5KFM A;  2XGP A;  1NK8 A;  3D2Q A;  4PL1 A;  1WCL A;  3T5H A;  4I2A A;  3NVW A;  5J29 A;  1Z19 A;  1ZJN A;  5DLF A;  3I28 A;  4KLM A;  5CR0 A;  5HR7 A;  5EOZ A;  2BGW A;  3SAH A;  4Z6C A;  2D3D A;  3AMZ A;  1ZQB A;  2ZIU A;  1QLN A;  7ICV A;  1K5O A;  4M9N A;  3H40 A;  1KFS A;  2G0A A;  5G5H A;  3BS7 A;  2G09 A;  2RDI A;  1XSN A;  1VLB A;  3C2L A;  2AQ4 A;  4NLC A;  3WKD A;  4QZI A;  1DXS A;  4J9N A;  4IQV A;  1L6N A;  2V9W A;  2VJ5 A;  2XC9 A;  3Q8R B;  9ICV A;  4GC6 A;  1PK1 A;  3GIK A;  3AUO A;  1SKS A;  1S9F A;  2HVH A;  2H3I A;  3JPT A;  1NK7 A;  8ICR A;  4DF4 A;  4NM2 A;  5CHG A;  4DF8 A;  5CWR A;  3KKA C;  5IIO A;  4Z6E A;  4A8E A;  3KHH A;  5HHI A;  4DFJ A;  4PH5 A;  1JN3 A;  3RAQ A;  4YCX A;  3N7P D;  2EH9 A;  3IRU A;  1ZQQ A;  4R66 A;  4KLJ A;  5KG2 A;  2QB0 B;  1N48 A;  4XRH A;  2F1J A;  1LV5 A;  2K4I A;  4CNQ A;  4AYB F;  1JRP A;  4GXI A;  2UVU A;  4C4R A;  3G6X A;  3WKB A;  3GZF A;  1Z3E B;  1X42 A;  4F91 B;  2H3Z A;  1WCN A;  2ZUD A;  4O3Q A;  4EYI B;  4F5O A;  8ICJ A;  1Z00 A;  2PKE A;  2ZIU B;  9ICJ A;  1ZQK A;  4R64 A;  3F2C A;  1T4G A;  4DQI A;  3LVV A;  5JRT A;  1ZQE A;  4DWI A;  2R8I A;  2I6X A;  2XY6 A;  4EX6 A;  1P7D A;  1ZQI A;  2HDO A;  3C21 A;  5EWG A;  1PK1 B;  7ICL A;  4BJQ A;  7ICE A;  2FMS A;  4R63 A;  1H38 A;  2EAM A;  3PR5 B;  2BDP A;  7ICS A;  4OO1 J;  3PY8 A;  1ZQD A;  4GXJ A;  2BCS A;  4DEZ A;  4US9 A;  1NKE A;  2H3Q A;  8ICA A;  4YXJ A;  2YQE A;  2F3N A;  3QU7 A;  1JXL A;  4ECY A;  3RJF A;  2ZTE A;  4LZG A;  1A0P A;  4J9O A;  2WAQ F;  4IL6 U;  1NJZ A;  1SXD A;  4YMM A;  1NOM A;  4YQW A;  3WK6 A;  3NGD A;  5DG8 A;  4GIB A;  4JMU A;  2HVI A;  2YMM A;  5DB8 A;  3HPO A;  3RB6 A;  2Y0S F;  1UT8 A;  4QZH A;  1MN8 A;  1DK3 A;  3GFK B;  3H8S A;  5T14 A;  4KLO A;  2BPC A;  1Z00 B;  1UQV A;  2R8G A;  2E8N A;  3PNC A;  5J0X A;  1SWW A;  3TAN A;  5DDY A;  1O08 A;  5AI5 A;  1L7N A;  3ZDC A;  3EPI A;  1L3T A;  2I5H A;  3M9N B;  5AM4 A;  4O5K A;  2KN7 A;  1J97 A;  2WFA A;  2B0C A;  1S0M A;  4F93 B;  3QUC A;  1KQQ A;  3NS1 A;  3TAD A;  4ECQ A;  4CE6 A;  1N5W A;  5F3X B;  5KFQ A;  2YTU A;  4DFK A;  2ATL A;  4NLZ A;  2DWQ A;  4QZF A;  1ZQT A;  3PZP A;  5BOL A;  2V4Q A;  4O3O A;  1B0X A;  4Z6D A;  4RPZ A;  2AQ0 A;  4C8N A;  4DFP A;  1NJY A;  4FE3 A;  2KFN A;  2NRW A;  4ICA A;  3GU3 A;  4DL6 A;  3K4G A;  9ICW A;  2GO7 A;  2KE7 A;  4DOA A;  3ISC A;  1X9M A;  4F8R A;  4ECT A;  4M9J A;  3CRX A;  2D6F C;  2F1H A;  3IDW A;  1JX4 A;  1ZQP A;  3AN1 A;  2QB1 A;  3QNM A;  2DFL A;  5ALN A;  2EZX A;  3BDP A;  3PW5 A;  3HRD D;  1D8B A;  4ECS A;  3OSN A;  1KFD A;  1RQN A;  4ECZ A;  8ICL A;  2DBY A;  4RQM A;  3D2S A;  1PVR A;  1TK5 A;  1ZQO A;  2HHS A;  2XO7 A;  2JRZ A;  2QKQ A;  7ICI A;  2DKZ A;  4Y2X A;  4ECR A;  5J2H A;  5ALH A;  4DQP A;  2HBK A;  4MHV A;  4M9L A;  3IP4 B;  3RJJ A;  4I28 A;  3FAH A;  1U49 A;  3M9O B;  2GLE A;  2EAP A;  4QW8 A;  3LDA A;  2JR5 A;  1RXV A;  1KTQ A;  1L8L A;  5ALD A;  8ICV A;  4UB6 U;  1NK4 A;  4YR3 A;  3PML A;  1DRG A;  8ICO A;  4US8 A;  3IV6 A;  1ZQA A;  2YMP A;  1UT5 A;  3OTQ A;  5EE9 A;  4YR0 A;  4KLS A;  4ECV A;  2K89 A;  5DBA A;  3IHQ B;  4KN4 A;  1V85 A;  2ZIW A;  3M7D A;  2RRD A;  1BPZ A;  3OPX A;  4DS5 A;  1BPX A;  4E0D A;  9ICM A;  4IS7 A;  3PX0 A;  1Q3U A;  2EZZ A;  3MDC A;  4F4X A;  3RBE A;  4RQ3 A;  3KD3 A;  3H8M A;  1KEJ A;  1UA1 A;  4UB5 A;  5CEH A;  3BZK A;  4FO6 A;  1YZ6 A;  3SR6 A;  3GIJ A;  5EWE A;  1K1S A;  2E8M A;  8ICC A;  5AK3 A;  1A76 A;  3JPS A;  2XY7 A;  4KX5 A;  2LBO A;  1PK3 A;  2ZIX A;  1A6S A;  4C8O A;  1LKY A;  1J2M A;  4M6W A;  3JPR A;  1D9F A;  2H3F A;  5C0Y A;  2PI4 A;  3JPN A;  5IIL A;  5HNK A;  4NJ8 A;  2ZTC A;  1F0M A;  5K4L A;  3BQ2 A;  2RQ5 A;  3C1Y A;  2ISP A;  3TFR A;  1V38 A;  2JEG A;  2K4P A;  4ED8 A;  2ZUB A;  9ICA A;  3MR2 A;  5J0Y A;  4OJ5 A;  4NLN A;  5B5E U;  4KLF A;  5KT3 A;  4DCC A;  3H0M B;  3MAB A;  5ALO A;  4TUS A;  1XSL A;  2PFO A;  5KFJ A;  5KG7 A;  3H0L B;  2GOL A;  9ICR A;  2XIC A;  2UVW A;  3PW4 A;  4EEL A;  4J9S A;  4DFD A;  2MAX A;  2ZIW B;  5DGB A;  2NV3 A;  1ZJM A;  3MR5 A;  3PMN A;  3EWA A;  2AJQ A;  2OCE A;  1JIH A;  4MEY A;  3C1Z A;  4ZH4 A;  5L1J A;  1KW4 A;  7ICT A;  5ALG A;  3FM9 A;  4F5P A;  1WG8 A;  1ZQW A;  1V97 A;  3HWT A;  2YMQ A;  4J9P A;  4PZO A;  4QWB A;  1LVH A;  4TUP A;  2FE9 A;  5J0Q A;  5J0T A;  2F76 X;  2ZIX B;  1OW5 A;  4GXK A;  2W9A A;  1T3Q A;  3S6J A;  1MA7 A;  1Y88 A;  4NV0 A;  1LKY B;  3L4P A;  2M0N A;  4M6W B;  1DGS A;  4M47 A;  2OHF A;  2ALZ A;  2IOF K;  3Q8M A;  1FFV A;  2I1Q A;  3SYZ A;  3JPQ A;  4J9K A;  1S77 D;  1JAL A;  2F8L A;  4JWN A;  2NO4 A;  5J2K A;  5GTI U;  1ECW A;  3MR3 A;  8ICQ A;  1XNS A;  2E1E A;  5ALP A;  2FLL A;  5HML A;  3Q8L A;  2G06 A;  4NY8 A;  4BXO A;  3QUT A;  7ICP A;  4EEN A;  3ETL A;  2JV3 A;  3PX6 A;  8ICN A;  1WWV A;  2KJ9 A;  2HOI A;  3M6Z A;  4Q45 A;  5KFV A;  3C29 A;  4Y2V A;  4RQ0 A;  1FIQ A;  2WHE A;  3CNH A;  5J0P A;  8ICH A;  9ICP A;  4C7Z A;  5KFB A;  3Q8S B;  5J2J A;  1ARO P;  1NZP A;  5D46 A;  4OJL A;  5KFD A;  4KLH A;  2OYY A;  2LYH A;  3QU9 A;  3BQT A;  5ALM A;  1SXE A;  2BCQ A;  3TKA A;  1SZP A;  3VCB A;  2WF6 A;  1SWV A;  3N7R C;  4EBD A;  3OSP A;  2KHV A;  3ZDB A;  2WF5 A;  3BQ0 A;  2RHF A;  5L1I A;  5KAI U;  4UAZ A;  4ED0 A;  1ZQG A;  5KFU A;  1TFR A;  2F1I A;  3LWM A;  3B0X A;  4P2H A;  5L1L A;  4BGD A;  4YN4 A;  4RT3 A;  2W9M A;  2P66 A;  3KBB A;  1L3U A;  2ZXH A;  5KFI A;  2JZB A;  4C8K A;  3C5G A;  4ZOH C;  4BXO B;  1KL9 A;  4F4Z A;  1MQ2 A;  2W9C A;  2QAR A;  4TUQ A;  2KVS A;  4XA5 A;  1BPE A;  3ED5 A;  2KZ3 A;  2LI6 A;  1RDF A;  5L1K A;  2KTQ A;  1IG6 A;  3MGH A;  5ALF A;  1SB3 C;  1BNO A;  4KLT A;  2HHV A;  5KFT A;  1VDV A;  1RYR A;  1TAQ A;  5L1M A;  1QH9 A;  4QJF B;  1PVP A;  4UB2 A;  5ALL A;  3AQF A;  4DOB A;  7ICF A;  3T79 A;  1X40 A;  2FPM A;  2RP5 A;  2ZIV A;  4Y2U A;  3RJE A;  3SV3 A;  2C28 A;  8ICB A;  3U26 A;  5KFY A;  2W03 A;  2B6G A;  2IBK A;  1URJ A;  2OM6 A;  4I2D A;  3TAD C;  3PW0 A;  2UVV A;  3K1Z A;  5E79 U;  4EYH B;  1QCK A;  4Q8F A;  3A0H U;  2OXO A;  5IIJ A;  1Z1B A;  5C5J A;  5CA7 A;  2ES6 A;  4EZ9 A;  1NJX A;  3IG5 A;  1CEZ A;  5KFC A;  4DSE A;  4B9M A;  4CF4 A;  1UPH A;  4WJ3 B;  2JZB B;  4I2J A;  3PW7 A;  3RJK A;  5KFL A;  4KLL A;  3MBY A;  2KG5 A;  4NLB A;  4PGQ A;  1ZXI A;  2W9C B;  2QAR B;  4ED6 A;  5KFO A;  1NZB A;  5AM5 A;  2NRZ A;  8ICF A;  4DQS A;  4C8L A;  5EE0 A;  3IG8 A;  2F8K A;  2W3S A;  2PMZ F;  5KFA A;  1IM4 A;  2MSN A;  1SGG A;  1RXW A;  3SD7 A;  3KZI U;  5IIK A;  2J6T A;  1M6Y A;  3F5E A;  1ZQ1 C;  2LM4 A;  5KG0 A;  5JUM A;  2P35 A;  5AK4 A;  2RLT A;  2PFN A;  4HYK A;  2XCP A;  1LB2 B;  4MFC A;  3OJS A;  2ZIV B;  2FLN A;  4OJO A;  4KX3 A;  1JRO A;  3SAG A;  4UB3 A;  2HHT A;  4IRK A;  4GC7 A;  4OD0 A;  3AEV A;  4IQU A;  3LWL A;  1K1Q A;  2JXJ A;  5CRX A;  2KOB A;  5DBB A;  5DDM A;  1NK6 A;  2DPJ A;  5KFN A;  2HCF A;  3V6J A;  3M9M B;  1B4F A;  1XWL A;  3KZX A;  2ASJ A;  1X6I A;  4M9H A;  5ALU A;  3SI8 A;  3OHB A;  4DLG A;  1WUD A;  2Q0Z X;  3GII A;  4KLQ A;  4QWE A;  2DF4 B;  2FPL A;  5KT2 A;  2BPF A;  3TAC B;  2WB1 C;  3C28 A;  2OEH A;  1ZQL A;  3PV8 A;  4I29 A;  4Y2P A;  5AIC A;  3H4D A;  5AKK A;  5AI0 A;  1KBU A;  1U45 A;  4EBC A;  3GIM A;  4KLU A;  2W54 A;  2K8B B;  3N4M B;  1ZQY A;  4KN7 A;  1XC9 A;  3E2E A;  2AGO A;  3Q8Q B;  5KG1 A;  5KFF A;  1Q8K A;  3V6K A;  3RB4 A;  3MFH A;  5DGA A;  2D8C A;  4UB8 U;  1BPY A;  3EUB 2;  2G5I B;  2BCV A;  5J0U A;  3AM9 A;  1EXN A;  4BWJ A;  3WK9 A;  3TQ1 A;  5L9X A;  4DSK A;  4PL2 A;  8ICM A;  3HIL A;  1RYS A;  2R8J A;  4LJX A;  4I2H A;  4NXZ A;  9ICG A;  5D49 A;  5TIS U;  3SV4 A;  5AKH A;  1U47 A;  5HR6 A;  5AM2 A;  1TVA A;  5DQI A;  4YMN A;  4MEX A;  5KG4 A;  2ASL A;  2NRT A;  1FFU A;  3UM9 A;  2DGZ A;  2HBM A;  2ZXI A;  4UAR A;  2HBJ A;  1TAM A;  4YP3 A;  4FS1 A;  3V72 A;  4USA A;  3MFI A;  2KV2 A;  3UXO A;  1N62 A;  4UBB A;  4Y2Y A;  2W7P A;  5TZV A;  3RF9 A;  3H8W A;  2ZTD A;  4FBU A;  4KMU A;  2HSZ A;  3BS5 A;  3M6K A;  1MSW D;  3KOO A;  2MU2 A;  1X9X A;  1XO0 A;  2I9G A;  4CRX A;  2YB1 A;  2C2R A;  3QU4 A;  2NYV A;  3G6V A;  9ICQ A;  2BPG A;  5AIB A;  4YFK A;  2Y9T A;  1NKC A;  1SKW A;  1B43 A;  4IRC A;  1S0N A;  3HKZ C;  1SKR A;  4Q8E A;  2HMX A;  1Z1V A;  5DB9 A;  2XI9 A;  1ZD4 A;  4KLE A;  3ISB A;  2P6U A;  2R18 A;  4ELV A;  2R8K A;  3JPP A;  5IIN A;  3UQ2 A;  4I27 A;  3WKE A;  3L3F X;  3LVW A;  5AK5 A;  4M0A A;  3HW8 A;  2V4R A;  4C4S A;  3SMV A;  4XQ8 A;  4FBT A;  2XID A;  3ZD9 A;  4YXM A;  2W04 A;  4QZB A;  3ZD8 A;  4KIT B;  3M1Y A;  4ELT A;  4K4G A;  7ICO A;  2P6R A;  2K4E A;  4P0Q A;  4IQT A;  2ZJA A;  5DLG A;  5DKW A;  3MR6 A;  5KFS A;  5AIA A;  3TI0 A;  3BS5 B;  2K8C B;  4GLX A;  1T7P A;  5J2G A;  5ALT A;  4B9U A;  4DQQ A;  1JI7 A;  2E8P A;  2N1R A;  5AM0 A;  5DBC A;  1ZYQ A;  3A0B U;  1SV0 A;  1XO1 A;  2L5Y A;  5ALQ A;  4CGZ A;  2KZZ A;  3C2M A;  4EBE A;  3ETR A;  3NAS A;  4NL9 A;  4UB4 A;  2A3V A;  3QXG A;  2AGQ A;  5HP4 A;  4DSJ A;  1YZ7 A;  7ICR A;  4B9S A;  1ZQU A;  3VC8 A;  5A0L A;  4QZD A;  2Y9U A;  7ICN A;  2ZUC A;  1ZRN A;  1CRX A;  3UXN A;  4F71 A;  4F4K A;  5AKZ A;  3PO5 A;  3SAF A;  1BPB A;  2ZJ5 A;  3ONN A;  4DSF A;  9ICX A;  2KIW A;  3M8S A;  3N28 A;  4NLG A;  9ICE A;  4U6P A;  4PHE A;  1TKD A;  1Q46 A;  4IRD A;  4KLD A;  5KG3 A;  2CRX A;  2IA6 A;  1KRP A;  1B22 A;  4C7Y A;  4X5V A;  5AM3 A;  1U4B A;  4P0Q B;  2EAO A;  2YN4 A;  3V7L A;  4ACO A;  2FI1 A;  5HMM A;  2VA8 A;  5JU5 A;  4Y2S A;  8ICX A;  5DB6 A;  4PHP A;  4ED3 A;  3SEI A;  4QZG A;  1ZD5 A;  4I2E A;  2HHQ A;  2C2D A;  2LKY A;  5D4B A;  3V7J A;  2W3R A;  3DEE A;  4MF2 A;  1L7P A;  3ZI4 A;  1PZN A;  5DQH A;  3ZDA A;  4JV0 A;  5KTQ A;  1X9W A;  8ICK A;  3CW2 C;  2NO5 A;  9ICF A;  2VKQ A;  5J2B A;  4RQ5 A;  1RZT A;  4YD2 A;  3BJY A;  1HUO A;  2R8H A;  1XU4 A;  3E58 A;  2M9N A;  2EDU A;  9ICN A;  3C5F A;  1L7M A;  4BDP A;  4P4O A;  3JPO A;  3H0R B;  1RYU A;  2DPI A;  4O0I A;  4RT2 A;  1FO4 A;  4Y2R A;  3HX0 A;  1NJW A;  2GWS A;  1TK0 A;  3IM1 A;  3F2B A;  1L5U A;  1KN5 A;  2KIC A;  2KNJ A;  5J0O A;  4RQ2 A;  3NUQ A;  4B6J A;  2FPK A;  2W11 A;  5J0S A;  2JHD A;  1T3N A;  1OUQ A;  1D8L A;  4JK1 A;  4LVS A;  2A1A A;  2EQY A;  5KFK A;  3NTU A;  5CB1 A;  5KFR A;  2HHW A;  4QNL A;  2JEJ A;  2BR0 A;  2LHT A;  4BUG A;  2G07 A;  3GV8 B;  1XS9 D;  4IQW A;  2KKV A;  3SEN A;  5KFE A;  2RDJ A;  2FMP A;  1QQ7 A;  4HAI A;  1L3S A;  1S76 D;  4UQG A;  3T5L A;  1T8E A;  5ALX A;  2F2A B;  4O3S A;  1ZQF A;  5H2F U;  3FYH A;  2KEY A;  2BQ3 A;  4F3O A;  5B66 U;  4RQ8 A;  2XCA A;  2W8K A;  2WAQ C;  3IN5 A;  3V7K A;  4PHD A;  2FJ6 A;  2BHN A;  8ICG A;  2F77 X;  3QZ8 A;  5ALE A;  5AKY A;  4O5C A;  2LM1 A;  2Y0S C;  1T94 A;  3FC4 A;  4QWA A;  5JTI A;  2C2E A;  2WF7 A;  4J9L A;  2MA1 A;  4ED1 A;  1IV8 A;  3OHA A;  2XY5 A;  4QZ9 A;  1BGX T;  3K75 D;  3RRG A;  1Z4N A;  2MUT A;  2EAN A;  4DSL A;  4UAT A;  2A1J A;  4Q44 A;  5J2A A;  4UBC A;  4CDG A;  4PGY A;  4QZE A;  4BX9 C;  2HOF A;  3MGV A;  2FMQ A;  2CXY A;  4JUZ A;  3MDA A;  4YD1 A;  4FZL A;  1QSY A;  4GFJ A;  1CI4 A;  2G08 A;  3M8R A;  4K4H A;  4J03 A;  1JUD A;  4MFF A;  5FP0 A;  5KT7 A;  3RJI A;  2O6K A;  3RAX A;  5AK6 A;  3Q8P B;  2BCU A;  5HHH A;  1UA0 A;  4O3M A;  1VJ5 A;  4OCZ A;  2DUY A;  8ICS A;  4LZD A;  3UMC A;  2JH7 A;  4QZ8 A;  4DLE A;  2JGA A;  1PUZ A;  1QSS A;  4QWD A;  3UQ0 A; 
#chains in the Genus database with same CATH homology
 2KD1 A;  2ZXH A;  3SAH A;  4FE3 A;  1MA7 A;  4P0Q B;  3HKZ F;  4NV0 A;  4ACO A;  2ZIU A;  2M0N A;  3GU3 A;  2PMZ F;  4ICA A;  3SQI A;  4BJQ A;  2G0A A;  3L3F X;  3PSP A;  3LVW A;  2F2A B;  2G5I B;  2G09 A;  2VIX A;  2XVT A;  2YB4 A;  4OO1 J;  2H3V A;  2YX8 A;  3F5E A;  2F8L A;  1ZQ1 C;  2KEY A;  2CN1 A;  3SMV A;  3N7S C;  4NLC A;  2OH2 A;  2HBL A;  2H3Q A;  2LKY A;  2XID A;  4KX5 A;  2W04 A;  2LBO A;  3CRX A;  2D6F C;  2LYA A;  2WAQ C;  1ECW A;  2ZIX A;  5KL8 B;  3IN5 A;  1L6N A;  1A6S A;  4PL2 A;  2G5H B;  2Z7J A;  2KHQ A;  2VJ5 A;  2E1E A;  1XNS A;  3DEE A;  2K4E A;  4P0Q A;  2ZIV B;  2KJ8 A;  4KMO B;  1YT3 A;  5KL1 B;  1A0P A;  3AQE A;  4OJO A;  2G06 A;  2KJ5 A;  4KX3 A;  2F77 X;  2WAQ F;  1HEK A;  4FZM A;  2H3I A;  2H3F A;  3SAG A;  2W7O A;  2ZG6 A;  3AL0 B;  2VKQ A;  3CP8 A;  5C0Y A;  4IC9 A;  5HR6 A;  2Y0S C;  3RFA A;  2K8C B;  4NWI A;  1Q3V A;  1D8B A;  1T94 A;  4QJF B;  3PSF A;  3PSI A;  2DGZ A;  5CRX A;  4JMU A;  1PVP A;  2KKP A;  2KOB A;  2N1R A;  4A8E A;  2KJ9 A;  2HBM A;  2JMG A;  2ZXI A;  2HOI A;  2HBJ A;  1TAM A;  2KVC A;  2Y0S F;  1SZH A;  3AQF A;  2MA1 A;  3M6Z A;  3T79 A;  3C29 A;  3D2S A;  2RP5 A;  2ZIV A;  3F53 A;  4OJ5 A;  1PVR A;  4P0P B;  2KV2 A;  3N7P D;  3F2D A;  3KZX A;  5T14 A;  4CGZ A;  2W7P A;  3H0M B;  2A3V A;  3RF9 A;  2W03 A;  3NRW A;  2E1F A;  1URJ A;  1HIW A;  2OM6 A;  4QIW F;  1WUD A;  3H0R B;  2E5S A;  3E0F A;  2HBK A;  3M6K A;  2K4I A;  4C0Z A;  3IP4 B;  3H0L B;  4U7C A;  1PVQ A;  4AYB F;  2GOL A;  2BDU A;  3CYM A;  3K1Z A;  4OJL A;  3KFU F;  5A0L A;  2XIC A;  2HOQ A;  3VC8 A;  4OJ6 A;  4CDG A;  2OYY A;  2DF4 B;  2Q4T A;  1ED1 A;  3PST A;  3F2B A;  1XO0 A;  2KNJ A;  2KIC A;  2OXO A;  2ZIW B;  4BX9 C;  3ALR A;  3GZF A;  2HOF A;  2NV3 A;  3MGV A;  4CRX A;  1Z1B A;  1Q3U A;  2WB1 C;  2GH1 A;  3D2N A;  3NUQ A;  1CRX A;  2YB1 A;  4P0P A;  4QIW C;  3C28 A;  3O0F A;  2VJ4 A;  3IG5 A;  3VCB A;  4FZL A;  1DRG A;  3SAF A;  2JHD A;  2K4H A;  1GO3 F;  2H3Z A;  3N7R C;  4OJP A;  1OUQ A;  4AYB C;  4GFJ A;  2KHV A;  1UPH A;  2G08 A;  2DQN B;  2MRL A;  2RHF A;  3ONN A;  2ZIU B;  4WJ3 B;  2WB1 F;  1KBU A;  3D2Q A;  3F2C A;  4NLB A;  4QNL A;  2KIW A;  2LYB A;  2LHT A;  4FZN A;  3LVV A;  2K89 A;  4PL1 A;  3ICX A;  4O3M A;  1IIP A;  4U6P A;  4BUG A;  2G07 A;  2ZIW A;  3PZP A;  1Z19 A;  1NZB A;  3M7D A;  2JH7 A;  2KKV A;  3HKZ C;  2K8B B;  2RRD A;  1F44 A;  2HMX A;  2CRX A;  1P7D A;  2JGA A;  2CPR A;  2PMZ C;  2F76 X;  3OPX A;  2XI9 A;  2ZIX B;  2K8A A;  5HR7 A;  3F5A A;  3IG8 A;  2JH1 A;  3LYS A;  2R18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...