2E1EA

Crystal structure of the hrdc domain of human werner syndrome protein, wrn
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
94
structure length
94
Chain Sequence
QPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKRIDGVSEGKAAMLAPLLEVIKHFCQTNSVQTDLFSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the HRDC domain of human Werner syndrome protein, WRN
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Werner syndrome ATP-dependent helicase
total genus 33
structure length 94
sequence length 94
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2e1eA01
1GO3F 2KV2A 2DGZA 1YT3A 3SAHA 2HBJA 4O3MA 4NLCA 4OO1J 3SAGA 2MA1A 2RRDA 4QJFB 4QIWF 3CYMA 2RHFA 2HBKA 4NLBA 4CGZA 4CDGA 1WUDA 2HBMA 1D8BA 2E1EA 2CPRA 2HBLA 3SAFA 5C0YA 2E1FA
chains in the Genus database with same CATH superfamily
3WK9A 1ZQEA 3MR2A 4KLFA 2XY6A 5JRTA 4QZGA 1OXJA 4J9NA 4OJPA 5KFFA 1ZQYA 5J2AA 4O3OA 5KFDA 2G07A 9ICIA 1ED1A 2FDRA 1NK5A 5AI0A 3MGIA 1L3SA 3IHQB 1S8OA 4O5CA 4F4XA 4J9SA 3PR4A 3SEIA 4M9LA 4OD0A 3C2MA 4RQ0A 4DCCA 3C28A 5CRXA 3TFRA 3RH5A 3PW7A 3AUOA 2JZBB 4IRDA 2M9NA 3OJUA 4BGDA 3WU2U 2DPJA 5KFGA 3NRWA 4GC7A 2KIWA 1SV0A 1TAUA 3UMCA 1TE2A 4QWEA 5J29A 1ZETA 2HBLA 4P4MA 2E1FA 5TZVA 1GO3F 2E8NA 1KEJA 5F9NA 1ZQWA 1WWVA 5AI4A 4ECVA 5KAIU 2GLEA 3NVWA 5CEHA 5J2KA 4C4TA 1T8EA 5KT4A 1JXEA 3T5HA 2WHEA 3GV8B 2H3QA 1C7YA 4YMMA 2FLPA 4KN4A 2ZTDA 4DL6A 3HP6A 1QSLA 4DSKA 2IMWP 5AKEA 5L1MA 3MGVA 2PFPA 3WKEA 2KFNA 1QTMA 2P6UA 3SMVA 1U4BA 1SL1A 5KFPA 3QZ7A 4KMUA 4NM1A 2W9BA 3C1ZA 2JH7A 3M9MB 4NWIA 4G9BA 2BKEA 2O6KA 5KFTA 2Y0SC 2ZUBA 5J0WA 3I1YA 2RDJA 3PMNA 3CYMA 5J2IA 5GTIU 2AJQA 5HR6A 3RAQA 3OGUA 2BQ3A 2A3VA 2NO5A 7ICMA 3H0MB 4Y2VA 1DGJA 4O3QA 3SI8A 2FI1A 1F44A 2IOFK 2JEIA 2V4RA 3AU6A 4ED2A 4P0QA 2YMMA 8ICIA 2DKXA 2AHOB 1ZQXA 2AH5A 7ICTA 1L3UA 1ZJMA 1Z1VA 4CE6A 3FM9A 5HP4A 2NRWA 2ZIWB 2DKZA 2LBOA 2LKYA 3QYPA 2J6TA 2DBYA 5JU5A 2RDIA 2IOFA 1SGGA 4UB2A 4DQQA 2F2AB 4RQMA 2ODGA 1NI3A 4JWNA 3THVA 1JROA 3BQTA 1FFVA 2PFQA 3CNHA 1ZQLA 2W9CA 5KFRA 3ZDBA 8ICVA 3B9JA 3HPOA 4DF8A 4Q8EA 3QU5A 4YD2A 7ICEA 1A76A 4QZHA 2Q0ZX 1P7DA 2DUYA 4HAIA 4MF2A 3O0FA 5ALMA 3T5KA 5BPCA 2F8LA 2ZXHA 1S97A 3DV9A 2R8IA 2E8OA 3N7PD 1SWWA 4UAUA 4DL3A 5AM5A 3PSIA 2KG5A 2YMQA 4M0AA 5KFYA 2V9WA 4EEYA 3SAFA 1X66A 1BPYA 4F5RA 2K60A 4C8OA 3PX6A 2QARA 2ZTEA 4QIWF 4KLUA 2W9AA 1ZQTA 1N56A 1N61A 3ONNA 2F76X 3UMGA 1Z4OA 3L3FX 4TQSA 2LM1A 2YTUA 2Q4TA 3J81j 3GDXA 8ICWA 5ALZA 1F0MA 1RYSA 4US8A 3TQ1A 1U47A 4OO1J 2LM4A 1UT5A 5ALXA 4UAVA 2JXJA 4YP3A 3ETRA 5ALNA 4PJ0U 5EE1A 1ZQAA 4B6JA 4KTQA 1A6SA 3T5LA 5IIIA 3TADA 3WKAA 3QXGA 5CR0A 5DGAA 2WF5A 4USAA 5CP2A 4Q44A 4NLCA 1NOMA 1V97A 4IRKA 1T7PA 1KN5A 5ALWA 2WFAA 2HOFA 3SYZA 4RNNA 3PMLA 4J03A 2K4HA 4BJQA 3ISDA 1QQ7A 2H3FA 3ICXA 5ALRA 2QARB 3EW9A 4PHDA 4IQTA 4UB4A 4P2HA 3FC4A 2XC9A 2EQYA 3AQFA 5KG0A 2PI4A 8ICHA 2G0AA 2VKQA 5DBCA 2OWOA 4DL2A 4TUQA 1ZQ1C 4ED0A 4ELVA 4R8UA 5D4BA 2KNJA 3VC8A 5G5GA 4EELA 3PW2A 3D2SA 1JIHA 3F5EA 1TV9A 2UVWA 2R8KA 5J2FA 4US9A 1TVAA 5ALKA 3OJSA 3ZI4A 4FZMA 4J9MA 3H7IA 2WF8A 3RR8A 1IG6A 1YT3A 4NXZA 3SZ2A 5AKLA 1DOQA 4KLLA 3WK6A 5KAFU 1T3NA 3PSTA 5L1KA 2W03A 3ZD8A 3KHHA 3RJEA 1TKDA 3LDAA 5KT7A 2LYBA 4B9TA 2KEYA 2AXTU 2F1IA 1BPEA 5K4LA 1T4GA 4ELTA 2VJ4A 4O3PA 2W04A 5ALPA 4NLZA 5DLFA 4JMUA 2JV3A 1ZQSA 5J2DA 2EDUA 1VDVA 2K4IA 1XC9A 3F2CA 4GC6A 3ZDCA 2C2EA 3FDSA 4KLMA 2ESEA 3RH6A 3BQ7A 3I28A 1TK8A 4ACOA 1RYUA 3OSNA 1QSYA 4DO9A 3D6JA 5AK3A 3E2EA 2KD1A 4Z6FA 2KTQA 1SWVA 3KOOA 4NLBA 4IC9A 1AQ6A 5KFOA 9ICXA 1L5UA 1BPZA 2F3NA 1COOA 4ECQA 2MAXA 2BCQA 2OEHA 3Q8LA 2BR0A 9ICRA 4EX6A 2MUTB 2IA6A 2OM6A 4RNMA 5HNKA 3HT3A 1NKBA 1QSSA 4F5PA 1SIJA 3PY8A 4YXJA 3OHAA 4OJOA 3MR6A 5KFSA 2VJ5A 3OTQA 4NLNA 9ICBA 4IQVA 4M47A 3WK4A 4Y2JA 5B66U 2D6FC 4UAYA 2JH1A 4EEKA 4P0QB 5AKGA 3MFIA 8ICBA 3GIKA 4RUAA 8ICLA 9ICHA 4I2DA 1BVSA 2ZJ5A 4OJ5A 4ED6A 2I5HA 4YCXA 4QW9A 3GU3A 2H3IA 2PFNA 1WCLA 3EUB2 3ZDAA 4QWCA 1RDFA 5AIBA 1ZQGA 2N1RA 2BGWA 2KKPA 3Q8RB 5L1JA 5EWGA 9ICUA 3HJEA 1L7NA 1X9XA 1N5WA 8ICEA 4QNLA 7ICFA 4I2AA 1WCNA 4DQRA 4IR9A 3D2QA 5HMMA 1ZOLA 4UB3A 1UA0A 2KSOA 8ICOA 5ALEA 4M6WB 1L7PA 4HYKA 1V85A 4ECUA 3UXOA 2BZFA 2ZTCA 3TAPA 5ALOA 4BWJA 1SKWA 1PK1A 9ICKA 4RT3A 2MRLA 4CNQA 2ZUDA 2JMGA 8ICAA 5J8YC 3NGDA 3PW5A 4M04A 1PVQA 4QZEA 5C5JA 4CDGA 1NKCA 3RJGA 7ICLA 5KG6A 4JWMA 4M9GA 4FZLA 4I2FA 1ZQBA 2K4PA 3Q8SB 4Y2TA 2DPIA 3B0YA 1L6NA 3AU2A 2YY6A 1PVRA 7ICJA 1ZD4A 1Q46A 3RBEA 7ICVA 5AK5A 2GH1A 3F53A 1SL0A 1SV0C 5IIOA 2ASLA 4KLJA 4FS2A 2ZIVA 8ICXA 4B9UA 3N28A 3KHGA 4ELUA 3K4GA 4UB5A 4DSFA 4ED1A 3H4BA 4RQNA 8ICPA 5KFZA 3G6XA 1ZQPA 4KX5A 5DQGA 1L7OA 4YVZA 1VJ5A 2AGQA 4DLEA 3G6YA 1MC8A 2ZJAA 1ZQCA 2FE9A 5J2HA 1SV4A 1IIPA 2VIXA 5J0UA 4F92B 4JK1A 1ZJNA 1ZRNA 1RM6C 2ZJ8A 2XVTA 2VA8A 4PGQA 2HVIA 4RQ5A 3LWLA 4Y2XA 2UVVA 1Z4NA 3RJKA 4NV0A 2F44A 4KLEA 5KL8B 3GILA 3N7RC 3IV6A 3M1YA 3EWAA 1ZQIA 4DF4A 4F4WA 5ALSA 1J97A 2QB0B 4IQUA 2QB1A 2ZIUB 4DSJA 4F5QA 5AKHA 3C23A 2F8KA 4CF5A 2F1HA 5E79U 3PNCA 3QEAZ 1RXWA 4QJFB 3M8SA 3ZDDA 2BPFA 1ZQDA 2D8CA 4YMNA 1UT8A 2JRZA 3ED5A 5ALFA 3Q8QB 4UB6U 2KZMA 4KLHA 4JUZA 2XGPA 3C1YA 4J9QA 8ICZA 2ISOA 8ICUA 1X40A 3TANA 4I2GA 4F5OA 2BDPA 1J2MA 3BS7A 3H8SA 7ICSA 5KG1A 2I1QA 4B9LA 4I29A 1X42A 4ECRA 5D49A 5DLGA 1LKYA 5AKXA 4UB1A 3H8JA 4UASA 5ALHA 2RP5A 2EZXA 2HI0A 3BQ1A 4K4HA 4PZNA 5KFXA 4DOBA 4MHVA 4DWIA 3H0LB 1S77D 3IP4B 5AM3A 1KFTA 7ICHA 3M6ZA 7ICNA 5KT5A 1Z00B 2KIVA 1BPXA 3JPNA 4UBBA 3MGHA 5G5HA 4EENA 1X6JA 4GIBA 2K8AA 4FO6A 2ZIVB 2KHVA 3V72A 5ALQA 4NLGA 2G08A 2HCFA 3FAHA 5ALYA 1Z00A 1U48A 4TUPA 4UATA 3H4DA 4E0DA 1X9WA 1XU4A 3BQ0A 3M6KA 3PO5A 2AQ4A 1ECWA 4DEZA 2IOHA 5AKZA 4YN4A 5DDYA 1BGXT 2HHWA 9ICMA 2C28A 5AK4A 4O0IA 4CGZA 4EYHB 4P0PA 3G6VA 5AKKA 3RFAA 2LYHA 2BCSA 4F91B 1V9PA 1Q3VA 5HHIA 3ALRA 1U45A 1SB3C 5CWRA 4Y2UA 1SZHA 2BDUA 4R66A 5KG4A 5AM1A 4RQ4A 3TAQA 2B0CA 5KT6A 1A0PA 4EBEA 3MC1A 7ICUA 1URJA 5KNIA 2QLTA 1NZBA 2Y9UA 2E5SA 4KMOB 4CF3A 3UXNA 7ICRA 2ASDA 3WK8A 1B22A 1J2NA 1ZQKA 2DF4B 2YX8A 1ZD3A 3KKAC 2DFLA 3PSFA 1PVPA 5KFNA 4PHAA 3BZCA 3JPTA 3NRZA 4LZGA 4QZ9A 3GV5B 5DG7A 2ATLA 1NK0A 2IHNA 4R64A 5T14A 3JPPA 3F2DA 2HVHA 5J0SA 2XCAA 1ZQRA 1L7MA 5ALLA 5KFUA 5IIMA 4C8LA 3NS1A 2J6UA 2B21A 3PV8A 1KBUA 9ICSA 4UARA 3B0XA 5DB6A 3CRXA 1ZQJA 2WTFA 2KV2A 1DK2A 3QUTA 2CN1A 2MA1A 3V7KA 2PKEA 2P35A 2FPLA 2HMXA 2RQ5A 1O03A 5KT2A 5KFMA 4FE3A 2KMDA 4KX3A 1LV5A 4ED8A 2G5IB 4RU9A 4RT2A 5JTIA 2R8HA 2I6XA 5KFVA 4NL9A 2KN7A 2YN4A 3RJJA 3NASA 5AI5A 2EANA 3TADC 2GO7A 1LVHA 3F5AA 3L4PA 2OCEA 4FS1A 1S0NA 2NRXA 5KFJA 2IHMA 5J0RA 1H38A 2CRXA 4MFFA 5KG7A 3HWTA 4Y2QA 1RYRA 4DS4A 5IIKA 2VA3A 1WYGA 3RJHA 2KICA 3QU9A 2HW3A 5A0LA 1IM4A 1KFSA 2FLLA 4K4IA 2RLTA 3RH4A 2LPEA 9ICOA 3OSPA 2LI6A 2PFOA 1WUDA 1JX4A 1X9SA 9ICPA 1TFRA 4K4GA 5KFKA 4KLTA 4YMOA 4J9LA 4KN7A 1Y88A 8ICFA 4GFJA 3H40A 1RG6A 5IILA 3MDCA 3RTVA 2ALZA 5DQIA 2K8BB 3ISCA 3PX0A 3RRHA 5AI9A 2W3SA 2EZYA 1K1QA 2L5YA 4Y2RA 3HKZF 5AM0A 2YQEA 1X9MA 4F4KA 3EPGA 4YR2A 1NJWA 2K8CB 5EWEA 1D8LA 4M9NA 2NV3A 4CRXA 2W9BB 3N7SC 4DL7A 3SV3A 5EWFA 2HSZA 3V6JA 3OHBA 2H3VA 1QQ6A 2W9CB 2GOLA 1ZQUA 3H8WA 1SXDA 2RHFA 2WF6A 2EZZA 1PZNA 3C21A 5BOMA 3KTQA 4XRHA 4DLGA 2A1JB 1MQ3A 4IRCA 2EH9A 1JALA 2WB1C 2HHTA 4J9PA 3I76A 1Z3EB 3QX7A 4BUGA 4KLGA 1F5SA 3SENA 3C2KA 1NK7A 1FFUA 2Z7JA 3A0HU 2XIDA 3LVWA 1ZQMA 3GZFA 1ZQOA 3GQCA 3AQEA 2NRZA 3RB3A 4OCZA 5AK6A 2C2DA 2LYAA 1O08A 5ALUA 1NK4A 1ZQVA 1WWUA 3ETLA 4XUSA 2ZIUA 1D8YA 3HKZC 2WF7A 3SR6A 1PK3A 1FIQA 3TI0A 3EYZA 4F4ZA 1OW5A 3M9OB 2EAOA 2W11A 3RB6A 1ZD2P 4OJ6A 4I2CA 3LK9A 1UCVA 2W54A 5KG2A 3T79A 5J2EA 2G09A 1TAQA 1T94A 1YZ7A 9ICFA 5DBBA 4ICAA 1LKYB 1ZRMA 5J0TA 3L5KA 3MR3A 4XQ8A 1SZPA 3BS5B 1OUQA 2KZ3A 4BXOB 2XY7A 2HBKA 2MUTA 2BQUA 5CHGA 2W3RA 4DS5A 1S9FA 3IRUA 5AHXA 2NYVA 3K1RB 3WK5A 4I27A 4QWDA 2W8LA 5HMLA 1Z19A 5DB9A 2PMZC 1FEZA 2Y9TA 4RQ6A 5AI8A 2HDOA 1JN3A 9ICTA 2ZG6A 4QZBA 5DGBA 4PL2A 5KFHA 4DFMA 3AL0B 1SKSA 4AYBF 5J0YA 4LZDA 2XI9A 4NY8A 1XSNA 1U49A 4J9RA 3GFKB 4JV1A 3SAHA 5KFLA 3KKAA 3UPQA 4EZ9A 1CEZA 1DXSA 4U7CA 2F1JA 3GIJA 1PK1B 4UB8U 1XSPA 1NZPA 2JEJA 1N63A 4PH5A 1KW4A 4M6WA 2H3ZA 1RPLA 5DB7A 2W8KA 5IIJA 2DL0A 3LYSA 5AICA 2RRDA 2BCVA 1KRPA 3CP8A 3NVYA 4NJ8A 4OJLA 5CB1A 4QZDA 4X5VA 1S0MA 5DBAA 2KFZA 5AKJA 1NJYA 1ZQNA 4DFJA 3RB4A 1B43A 3JPSA 2IBKA 4PZOA 5AI6A 4YG2A 1FO4A 3EPIA 5CA7A 1RQNA 4PGXA 3ORYA 4I2JA 2KK0A 1SKRA 2CXYA 8ICMA 4DFKA 1DRGA 1S76D 2MU2A 3AEVA 1D8BA 5AM2A 4Z6EA 3V7JA 3QUCA 3SD7A 7ICGA 2KOBA 2E8MA 1JXLA 3M7DA 2D3DA 1JMSA 2KP7A 3V6HA 3TKAA 1MSWD 1BPBA 2R8GA 1MA7A 3Q8PB 3GIIA 4FBTA 3PVXA 3UQ2A 3UM9A 4DQSA 5DKWA 4UQGA 4F2RA 4YR0A 2KVSA 3DDHA 3HW8A 4PGYA 3N4MB 1SXEA 2HHXA 9ICAA 4C4RA 7ICPA 3IG8A 4ECSA 5J2CA 2B6GA 2ZIWA 2AGPA 4RPZA 9ICWA 2WB1F 3RBDA 2BHNA 4JV2A 4EBCA 1CUKA 2V4QA 4YQWA 4MEYA 1QQ5A 3PZPA 2QKQA 2OHFA 4C7ZA 2A1AA 4YD1A 1RZTA 8ICNA 2JZBA 4FFDA 5HHHA 1XWLA 3QEBZ 3C5FA 3AN1A 4QWBA 1TAMA 2MSNA 5KFAA 7ICQA 5L1IA 4DQIA 4R65A 1XO0A 1VLBA 5DG8A 2W7OA 1COKA 4DOCA 4QZ8A 3MFHA 4F71A 1JUDA 2DWQA 2XICA 8ICTA 1Q8KA 3JPRA 3BZKA 3NVZA 4Y2SA 3ZD9A 4O5KA 4O5EA 3RR7A 1CRXA 1L8OA 4DSIA 2G5HB 3FYHA 4F5NA 3T3FA 3GIMA 1B4FA 1JRPA 4RQ7A 2BPGA 2AU0A 4QZFA 5F3XB 1M6YA 5ALIA 1L8LA 4PHPA 4ED7A 4FBUA 1IXRA 2R8JA 2GWSA 2KKVA 1HUZA 5KG3A 1D9DA 5DB8A 5J0OA 3RRGA 3TFSA 4ED3A 4C0ZA 4C7YA 8ICSA 1ZQFA 5EE0A 3KD3A 3IM1A 2WF9A 4DOAA 4CCHA 8ICYA 2XGQA 4MF8A 2K4EA 1BNPA 1KKXA 3D2NA 4RZRA 4DL5A 2NRVA 1XS9D 9ICCA 1HJPA 3JPQA 3MR5A 2R18A 3U26A 4DL4A 4ECYA 1KFDA 2P66A 1N5XA 4B9SA 4KLSA 2KJ8A 3NTUA 1ZQQA 1NK9A 4KITB 3PSPA 3QU2A 2CPRA 5TISU 4R63A 1AROP 2Y0SF 4YXMA 4RUCA 8ICGA 5BOLA 5ALDA 4KLQA 2JHDA 2UVUA 3R9KA 4ZH4A 2BCUA 2W55A 4UBCA 2LMRA 1UPHA 2PMZF 4A8EA 4GXJA 4GXKA 4C8KA 4M9JA 9ICGA 2HBMA 1XO1A 3HX0A 4NM2A 4J9KA 2JEFA 4QIWC 1Q3UA 8ICCA 5KTQA 3PW0A 4NL9C 2P6RA 5EOZA 4F72A 2ASJA 2E8PA 8ICKA 2YMLA 2Y1JA 3TARA 3K1ZA 3AM9A 5J2GA 3WKBA 8ICJA 2KSOB 4KLOA 3BJYA 4M2YA 3HILA 1PUZA 1RXVA 3TACB 3UQ0A 1NK8A 4I28A 3KZIU 2HHSA 4O3RA 3OPXA 1ZYQA 2KZZA 3MBYA 3RB0A 2ZXIA 2QB0A 2WAQC 3LVVA 3MABA 4DFDA 1ZQHA 2HOQA 2KVCA 4Q43A 1X2IA 4ECWA 2FJ6A 5J2BA 3F2BA 5KFBA 1KDHA 4YR3A 3GV7B 2NO4A 1KSPA 4I2EA 5KT3A 4JV0A 4F3OA 2F77X 7ICKA 4I2BA 3WKDA 5EE3A 5KFCA 4ECTA 2ZIXA 3IG5A 1UHUA 5L9XA 2HHUA 4QZIA 3LWMA 4G3IA 3UMBA 3SAGA 3QNMA 4BX9C 2I9GA 5HR7A 2BQRA 4QZAA 1L3TA 1TK0A 4TURA 2JEGA 3BQ2A 5KFQA 2EAMA 5H2FU 4MFCA 2ISPA 2OYYA 2DGZA 3BS5A 4O3NA 4Q8FA 1MN8A 5DG9A 4C4SA 1S5LU 1BPDA 4QWAA 1C20A 4B9MA 2JR5A 3HRDD 2H5XA 4DSEA 1HIWA 4UAWA 3EZ5A 4GLXA 5AKIA 4ECZA 5J0QA 3PX4A 1XSLA 2FLNA 4B9VA 3SV4A 2HBJA 3ISBA 4LVSA 4BWMA 1N60A 2HHQA 7ICOA 1UA1A 2JGAA 3T5JA 5J0PA 3H8MA 2DQNB 1NJZA 4IQWA 3H0RB 4TQRA 4I2HA 3SQIA 3NUQA 3PO4A 3M8RA 2ZIXB 4JB3A 1N62A 4BXOA 1UQVA 2YMPA 7ICIA 5EE9A 1CI4A 1V38A 1XNSA 4M9HA 1BNOA 1DGSA 4CF4A 3RF9A 1QH9A 2VA2A 4FZNA 1ZQZA 2LHTA 3E0FA 4Z6DA 1DK3A 5DQHA 2FMPA 4U6PA 3V7LA 2A1JA 1NJXA 1ZD5A 2C2RA 3C29A 3E58A 5D46A 1S0VA 4UAZA 5IINA 3BDPA 2NRTA 2WAQF 1NNLA 1X6IA 3RAXA 1RQLA 9ICLA 4O9MA 4PL1A 1D9FA 1K1SA 3Q8KA 4F93B 3KZXA 4GXIA 3NVVA 3IN5A 4F50A 3A0BU 2FMQA 3Q8MA 4P4PA 4TUSA 5B5EU 1TK5A 3DEEA 3PR5B 2W7PA 4QW8A 1U9LA 2YB1A 4QZCA 2C22A 3C2LA 1QLNA 3K75D 2A19A 3S6JA 3N97B 4ZOHC 5GTHU 2YB4A 1Z1BA 3IDWA 4EZ6A 3QUQA 4AP9A 1L3VA 3KHLA 4DQPA 8ICRA 4IR1A 3QU4A 2Y1IA 2BCRA 2ES6A 4KLIA 4AYBC 1QCKA 1LB2B 4PPXA 3KHRA 2FPKA 2KHQA 2FPMA 4RQ1A 4I2IA 2W43A 4EYIB 9ICQA 5J0XA 2OXOA 1HEKA 5F9LA 4DSLA 2FMSA 4Z6CA 3JPOA 4WJ3B 4P0PB 3QE9Y 9ICEA 5ALGA 5C0YA 4UW9A 5KFIA 5L1LA 1YZ6A 2KJ9A 4B9NA 4BDPA 2OH2A 5JUMA 5AIAA 4C8NA 4O3MA 5J2JA 4F8RA 1EXNA 9ICVA 4RPXA 1N48A 5KG5A 3ZDEA 2KE7A 9ICJA 4EX7A 4Q45A 3V6KA 2BPCA 1T3QA 3AMZA 4KLDA 4XA5A 4O3SA 3C5GA 5AM4A 1B0XA 2AGOA 1SL2A 2HHVA 5ALJA 8ICQA 2KJ5A 4IL6U 5KFWA 4EBDA 1IV8A 3KBBA 4NLKA 1NKEA 5CJ7A 5KFEA 2HOIA 4C8MA 2XO7A 3QZ8A 3UXPA 1WG8A 4Y2PA 4R8UB 5DDMA 3QU7A 4PHEA 3KFUF 4RQ3A 5J8YA 2XCPA 3PW4A 3M9NB 3QUBA 4MFAA 4RNOA 1NK6A 2PI5A 2E3TA 4RPYA 5AKYA 1N2XA 1A77A 1KLNA 2M0NA 3MDAA 3RJIA 4LJXA 3WK7A 2ZUCA 4DFPA 1HUOA 1S10A 1K5OA 4RQ8A 2PXIA 1KQQA 3VCBA 2W9MA 3CW2C 1MQ2A 2E1EA 4F2SA 4IS7A 2J6SA 1KL9A 4F4YA 1S0OA 5ALTA 1ZXIA 2EAPA 4C80A 2UVRA 5FP0A 4YFKA 4J9OA 2AQ0A 4Y2YA 4MEXA 9ICNA 1JI7A 5ALVA 5KL1B 3RJFA 4P4OA 2K89A 3WKCA 1KTQA 2G06A 4RQ2A 4ECXA 2VANA 2XY5A
chains in the Genus database with same CATH topology
3HKZC 2H3ZA 2Y0SF 2E5SA 2JH7A 4KMOB 4NWIA 2KJ9A 3C29A 2ZIXA 1ZQ1C 2KICA 2OM6A 3IG5A 2OH2A 3LYSA 2JHDA 1PVRA 2Y0SC 4O3MA 2WAQF 2KNJA 3SAGA 2GH1A 2RRDA 3F53A 4QIWF 3CP8A 3VC8A 4BX9C 5A0LA 4OJPA 5HR7A 4PL1A 2DF4B 3D2SA 2YX8A 3CYMA 4OJOA 3F5EA 2ZIVA 2G07A 2VJ5A 1ED1A 3KZXA 3ONNA 4OJLA 5HR6A 1UPHA 1TAMA 2F76X 3IN5A 4OJ6A 3PSFA 4FZMA 2A3VA 2PMZF 3L3FX 4A8EA 1WUDA 3T79A 2RP5A 1PVPA 2HBMA 2G09A 1XO0A 2Q4TA 2W7OA 3H0MB 2D6FC 1T94A 3H0LB 2JH1A 4KX5A 2OYYA 4QIWC 1Q3UA 1F44A 4P0QB 2DGZA 3IP4B 4ICAA 1YT3A 2XICA 2KJ5A 3DEEA 3M6ZA 4GFJA 4OO1J 4P0QA 4OJ5A 2W7PA 5T14A 3F2DA 3K1ZA 4U6PA 2K8BB 2YB1A 3GU3A 2H3IA 3PSTA 1OUQA 1IIPA 2VIXA 2W03A 2HBKA 2HOIA 2N1RA 1CRXA 1DRGA 1HIWA 2G5HB 2KKPA 2K8AA 2XVTA 3HKZF 1KBUA 2ZIWB 1A6SA 2ZIVB 2KHVA 2LYBA 3C28A 2KEYA 5CRXA 1D8BA 2LBOA 2LKYA 2K8CB 2G08A 3KFUF 2YB4A 4WJ3B 3CRXA 2KOBA 1Z19A 1Z1BA 2KV2A 2NV3A 2PMZC 3M7DA 4QNLA 4CRXA 2HBJA 2KKVA 3OPXA 4NV0A 2ZG6A 3N7SC 3M6KA 2CN1A 2VJ4A 4NLCA 2MA1A 4PL2A 5KL8B 3D2QA 1MA7A 3N7RC 2F2AB 1ECWA 2H3VA 2W04A 3AL0B 2M0NA 2ZXIA 2GOLA 4AYBF 4JMUA 2HMXA 2RHFA 4C0ZA 2WAQC 3NRWA 2JGAA 2HOFA 3LVVA 2KIWA 2XI9A 2K4IA 4AYBC 3F2CA 4CGZA 3VCBA 4P0PA 2DQNB 2K4HA 2ZIUB 2K4EA 2WB1C 4BJQA 4FE3A 3RFAA 2E1EA 2HBLA 4KX3A 3H0RB 2HOQA 2KHQA 2KVCA 2G5IB 3D2NA 4ACOA 1Q3VA 2E1FA 1GO3F 2H3FA 3ICXA 3IG8A 3ALRA 4BUGA 3SQIA 3NUQA 3SAHA 2R18A 1SZHA 2MRLA 2Z7JA 2KD1A 2ZIXB 2BDUA 1P7DA 4QJFB 2H3QA 2OXOA 2XIDA 3LVWA 3F2BA 3GZFA 2ZIWA 3O0FA 1HEKA 3AQFA 4U7CA 2JMGA 2F8LA 2ZXHA 1XNSA 5KL1B 3AQEA 3F5AA 3N7PD 1A0PA 2WB1F 2KJ8A 4P0PB 2K89A 4NLBA 4IC9A 3RF9A 2LYAA 3PSIA 2G0AA 1PVQA 3MGVA 4CDGA 2VKQA 1URJA 2G06A 4FZNA 3PSPA 2F77X 2CRXA 2CPRA 2LHTA 3E0FA 3SMVA 3SAFA 3PZPA 4FZLA 2ZIUA 5C0YA 1NZBA 1L6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GO3 F;  2KV2 A;  2DGZ A;  1YT3 A;  3SAH A;  2HBJ A;  4O3M A;  4NLC A;  4OO1 J;  3SAG A;  2MA1 A;  2RRD A;  4QJF B;  4QIW F;  3CYM A;  2RHF A;  2HBK A;  4NLB A;  4CGZ A;  4CDG A;  1WUD A;  2HBM A;  1D8B A;  2E1E A;  2CPR A;  2HBL A;  3SAF A;  5C0Y A;  2E1F A; 
#chains in the Genus database with same CATH topology
 3WK9 A;  1ZQE A;  3MR2 A;  4KLF A;  2XY6 A;  5JRT A;  4QZG A;  1OXJ A;  4J9N A;  4OJP A;  5KFF A;  1ZQY A;  5J2A A;  4O3O A;  5KFD A;  2G07 A;  9ICI A;  1ED1 A;  2FDR A;  1NK5 A;  5AI0 A;  3MGI A;  1L3S A;  3IHQ B;  1S8O A;  4O5C A;  4F4X A;  4J9S A;  3PR4 A;  3SEI A;  4M9L A;  4OD0 A;  3C2M A;  4RQ0 A;  4DCC A;  3C28 A;  5CRX A;  3TFR A;  3RH5 A;  3PW7 A;  3AUO A;  2JZB B;  4IRD A;  2M9N A;  3OJU A;  4BGD A;  3WU2 U;  2DPJ A;  5KFG A;  3NRW A;  4GC7 A;  2KIW A;  1SV0 A;  1TAU A;  3UMC A;  1TE2 A;  4QWE A;  5J29 A;  1ZET A;  2HBL A;  4P4M A;  2E1F A;  5TZV A;  1GO3 F;  2E8N A;  1KEJ A;  5F9N A;  1ZQW A;  1WWV A;  5AI4 A;  4ECV A;  5KAI U;  2GLE A;  3NVW A;  5CEH A;  5J2K A;  4C4T A;  1T8E A;  5KT4 A;  1JXE A;  3T5H A;  2WHE A;  3GV8 B;  2H3Q A;  1C7Y A;  4YMM A;  2FLP A;  4KN4 A;  2ZTD A;  4DL6 A;  3HP6 A;  1QSL A;  4DSK A;  2IMW P;  5AKE A;  5L1M A;  3MGV A;  2PFP A;  3WKE A;  2KFN A;  1QTM A;  2P6U A;  3SMV A;  1U4B A;  1SL1 A;  5KFP A;  3QZ7 A;  4KMU A;  4NM1 A;  2W9B A;  3C1Z A;  2JH7 A;  3M9M B;  4NWI A;  4G9B A;  2BKE A;  2O6K A;  5KFT A;  2Y0S C;  2ZUB A;  5J0W A;  3I1Y A;  2RDJ A;  3PMN A;  3CYM A;  5J2I A;  5GTI U;  2AJQ A;  5HR6 A;  3RAQ A;  3OGU A;  2BQ3 A;  2A3V A;  2NO5 A;  7ICM A;  3H0M B;  4Y2V A;  1DGJ A;  4O3Q A;  3SI8 A;  2FI1 A;  1F44 A;  2IOF K;  2JEI A;  2V4R A;  3AU6 A;  4ED2 A;  4P0Q A;  2YMM A;  8ICI A;  2DKX A;  2AHO B;  1ZQX A;  2AH5 A;  7ICT A;  1L3U A;  1ZJM A;  1Z1V A;  4CE6 A;  3FM9 A;  5HP4 A;  2NRW A;  2ZIW B;  2DKZ A;  2LBO A;  2LKY A;  3QYP A;  2J6T A;  2DBY A;  5JU5 A;  2RDI A;  2IOF A;  1SGG A;  4UB2 A;  4DQQ A;  2F2A B;  4RQM A;  2ODG A;  1NI3 A;  4JWN A;  3THV A;  1JRO A;  3BQT A;  1FFV A;  2PFQ A;  3CNH A;  1ZQL A;  2W9C A;  5KFR A;  3ZDB A;  8ICV A;  3B9J A;  3HPO A;  4DF8 A;  4Q8E A;  3QU5 A;  4YD2 A;  7ICE A;  1A76 A;  4QZH A;  2Q0Z X;  1P7D A;  2DUY A;  4HAI A;  4MF2 A;  3O0F A;  5ALM A;  3T5K A;  5BPC A;  2F8L A;  2ZXH A;  1S97 A;  3DV9 A;  2R8I A;  2E8O A;  3N7P D;  1SWW A;  4UAU A;  4DL3 A;  5AM5 A;  3PSI A;  2KG5 A;  2YMQ A;  4M0A A;  5KFY A;  2V9W A;  4EEY A;  3SAF A;  1X66 A;  1BPY A;  4F5R A;  2K60 A;  4C8O A;  3PX6 A;  2QAR A;  2ZTE A;  4QIW F;  4KLU A;  2W9A A;  1ZQT A;  1N56 A;  1N61 A;  3ONN A;  2F76 X;  3UMG A;  1Z4O A;  3L3F X;  4TQS A;  2LM1 A;  2YTU A;  2Q4T A;  3J81 j;  3GDX A;  8ICW A;  5ALZ A;  1F0M A;  1RYS A;  4US8 A;  3TQ1 A;  1U47 A;  4OO1 J;  2LM4 A;  1UT5 A;  5ALX A;  4UAV A;  2JXJ A;  4YP3 A;  3ETR A;  5ALN A;  4PJ0 U;  5EE1 A;  1ZQA A;  4B6J A;  4KTQ A;  1A6S A;  3T5L A;  5III A;  3TAD A;  3WKA A;  3QXG A;  5CR0 A;  5DGA A;  2WF5 A;  4USA A;  5CP2 A;  4Q44 A;  4NLC A;  1NOM A;  1V97 A;  4IRK A;  1T7P A;  1KN5 A;  5ALW A;  2WFA A;  2HOF A;  3SYZ A;  4RNN A;  3PML A;  4J03 A;  2K4H A;  4BJQ A;  3ISD A;  1QQ7 A;  2H3F A;  3ICX A;  5ALR A;  2QAR B;  3EW9 A;  4PHD A;  4IQT A;  4UB4 A;  4P2H A;  3FC4 A;  2XC9 A;  2EQY A;  3AQF A;  5KG0 A;  2PI4 A;  8ICH A;  2G0A A;  2VKQ A;  5DBC A;  2OWO A;  4DL2 A;  4TUQ A;  1ZQ1 C;  4ED0 A;  4ELV A;  4R8U A;  5D4B A;  2KNJ A;  3VC8 A;  5G5G A;  4EEL A;  3PW2 A;  3D2S A;  1JIH A;  3F5E A;  1TV9 A;  2UVW A;  2R8K A;  5J2F A;  4US9 A;  1TVA A;  5ALK A;  3OJS A;  3ZI4 A;  4FZM A;  4J9M A;  3H7I A;  2WF8 A;  3RR8 A;  1IG6 A;  1YT3 A;  4NXZ A;  3SZ2 A;  5AKL A;  1DOQ A;  4KLL A;  3WK6 A;  5KAF U;  1T3N A;  3PST A;  5L1K A;  2W03 A;  3ZD8 A;  3KHH A;  3RJE A;  1TKD A;  3LDA A;  5KT7 A;  2LYB A;  4B9T A;  2KEY A;  2AXT U;  2F1I A;  1BPE A;  5K4L A;  1T4G A;  4ELT A;  2VJ4 A;  4O3P A;  2W04 A;  5ALP A;  4NLZ A;  5DLF A;  4JMU A;  2JV3 A;  1ZQS A;  5J2D A;  2EDU A;  1VDV A;  2K4I A;  1XC9 A;  3F2C A;  4GC6 A;  3ZDC A;  2C2E A;  3FDS A;  4KLM A;  2ESE A;  3RH6 A;  3BQ7 A;  3I28 A;  1TK8 A;  4ACO A;  1RYU A;  3OSN A;  1QSY A;  4DO9 A;  3D6J A;  5AK3 A;  3E2E A;  2KD1 A;  4Z6F A;  2KTQ A;  1SWV A;  3KOO A;  4NLB A;  4IC9 A;  1AQ6 A;  5KFO A;  9ICX A;  1L5U A;  1BPZ A;  2F3N A;  1COO A;  4ECQ A;  2MAX A;  2BCQ A;  2OEH A;  3Q8L A;  2BR0 A;  9ICR A;  4EX6 A;  2MUT B;  2IA6 A;  2OM6 A;  4RNM A;  5HNK A;  3HT3 A;  1NKB A;  1QSS A;  4F5P A;  1SIJ A;  3PY8 A;  4YXJ A;  3OHA A;  4OJO A;  3MR6 A;  5KFS A;  2VJ5 A;  3OTQ A;  4NLN A;  9ICB A;  4IQV A;  4M47 A;  3WK4 A;  4Y2J A;  5B66 U;  2D6F C;  4UAY A;  2JH1 A;  4EEK A;  4P0Q B;  5AKG A;  3MFI A;  8ICB A;  3GIK A;  4RUA A;  8ICL A;  9ICH A;  4I2D A;  1BVS A;  2ZJ5 A;  4OJ5 A;  4ED6 A;  2I5H A;  4YCX A;  4QW9 A;  3GU3 A;  2H3I A;  2PFN A;  1WCL A;  3EUB 2;  3ZDA A;  4QWC A;  1RDF A;  5AIB A;  1ZQG A;  2N1R A;  2BGW A;  2KKP A;  3Q8R B;  5L1J A;  5EWG A;  9ICU A;  3HJE A;  1L7N A;  1X9X A;  1N5W A;  8ICE A;  4QNL A;  7ICF A;  4I2A A;  1WCN A;  4DQR A;  4IR9 A;  3D2Q A;  5HMM A;  1ZOL A;  4UB3 A;  1UA0 A;  2KSO A;  8ICO A;  5ALE A;  4M6W B;  1L7P A;  4HYK A;  1V85 A;  4ECU A;  3UXO A;  2BZF A;  2ZTC A;  3TAP A;  5ALO A;  4BWJ A;  1SKW A;  1PK1 A;  9ICK A;  4RT3 A;  2MRL A;  4CNQ A;  2ZUD A;  2JMG A;  8ICA A;  5J8Y C;  3NGD A;  3PW5 A;  4M04 A;  1PVQ A;  4QZE A;  5C5J A;  4CDG A;  1NKC A;  3RJG A;  7ICL A;  5KG6 A;  4JWM A;  4M9G A;  4FZL A;  4I2F A;  1ZQB A;  2K4P A;  3Q8S B;  4Y2T A;  2DPI A;  3B0Y A;  1L6N A;  3AU2 A;  2YY6 A;  1PVR A;  7ICJ A;  1ZD4 A;  1Q46 A;  3RBE A;  7ICV A;  5AK5 A;  2GH1 A;  3F53 A;  1SL0 A;  1SV0 C;  5IIO A;  2ASL A;  4KLJ A;  4FS2 A;  2ZIV A;  8ICX A;  4B9U A;  3N28 A;  3KHG A;  4ELU A;  3K4G A;  4UB5 A;  4DSF A;  4ED1 A;  3H4B A;  4RQN A;  8ICP A;  5KFZ A;  3G6X A;  1ZQP A;  4KX5 A;  5DQG A;  1L7O A;  4YVZ A;  1VJ5 A;  2AGQ A;  4DLE A;  3G6Y A;  1MC8 A;  2ZJA A;  1ZQC A;  2FE9 A;  5J2H A;  1SV4 A;  1IIP A;  2VIX A;  5J0U A;  4F92 B;  4JK1 A;  1ZJN A;  1ZRN A;  1RM6 C;  2ZJ8 A;  2XVT A;  2VA8 A;  4PGQ A;  2HVI A;  4RQ5 A;  3LWL A;  4Y2X A;  2UVV A;  1Z4N A;  3RJK A;  4NV0 A;  2F44 A;  4KLE A;  5KL8 B;  3GIL A;  3N7R C;  3IV6 A;  3M1Y A;  3EWA A;  1ZQI A;  4DF4 A;  4F4W A;  5ALS A;  1J97 A;  2QB0 B;  4IQU A;  2QB1 A;  2ZIU B;  4DSJ A;  4F5Q A;  5AKH A;  3C23 A;  2F8K A;  4CF5 A;  2F1H A;  5E79 U;  3PNC A;  3QEA Z;  1RXW A;  4QJF B;  3M8S A;  3ZDD A;  2BPF A;  1ZQD A;  2D8C A;  4YMN A;  1UT8 A;  2JRZ A;  3ED5 A;  5ALF A;  3Q8Q B;  4UB6 U;  2KZM A;  4KLH A;  4JUZ A;  2XGP A;  3C1Y A;  4J9Q A;  8ICZ A;  2ISO A;  8ICU A;  1X40 A;  3TAN A;  4I2G A;  4F5O A;  2BDP A;  1J2M A;  3BS7 A;  3H8S A;  7ICS A;  5KG1 A;  2I1Q A;  4B9L A;  4I29 A;  1X42 A;  4ECR A;  5D49 A;  5DLG A;  1LKY A;  5AKX A;  4UB1 A;  3H8J A;  4UAS A;  5ALH A;  2RP5 A;  2EZX A;  2HI0 A;  3BQ1 A;  4K4H A;  4PZN A;  5KFX A;  4DOB A;  4MHV A;  4DWI A;  3H0L B;  1S77 D;  3IP4 B;  5AM3 A;  1KFT A;  7ICH A;  3M6Z A;  7ICN A;  5KT5 A;  1Z00 B;  2KIV A;  1BPX A;  3JPN A;  4UBB A;  3MGH A;  5G5H A;  4EEN A;  1X6J A;  4GIB A;  2K8A A;  4FO6 A;  2ZIV B;  2KHV A;  3V72 A;  5ALQ A;  4NLG A;  2G08 A;  2HCF A;  3FAH A;  5ALY A;  1Z00 A;  1U48 A;  4TUP A;  4UAT A;  3H4D A;  4E0D A;  1X9W A;  1XU4 A;  3BQ0 A;  3M6K A;  3PO5 A;  2AQ4 A;  1ECW A;  4DEZ A;  2IOH A;  5AKZ A;  4YN4 A;  5DDY A;  1BGX T;  2HHW A;  9ICM A;  2C28 A;  5AK4 A;  4O0I A;  4CGZ A;  4EYH B;  4P0P A;  3G6V A;  5AKK A;  3RFA A;  2LYH A;  2BCS A;  4F91 B;  1V9P A;  1Q3V A;  5HHI A;  3ALR A;  1U45 A;  1SB3 C;  5CWR A;  4Y2U A;  1SZH A;  2BDU A;  4R66 A;  5KG4 A;  5AM1 A;  4RQ4 A;  3TAQ A;  2B0C A;  5KT6 A;  1A0P A;  4EBE A;  3MC1 A;  7ICU A;  1URJ A;  5KNI A;  2QLT A;  1NZB A;  2Y9U A;  2E5S A;  4KMO B;  4CF3 A;  3UXN A;  7ICR A;  2ASD A;  3WK8 A;  1B22 A;  1J2N A;  1ZQK A;  2DF4 B;  2YX8 A;  1ZD3 A;  3KKA C;  2DFL A;  3PSF A;  1PVP A;  5KFN A;  4PHA A;  3BZC A;  3JPT A;  3NRZ A;  4LZG A;  4QZ9 A;  3GV5 B;  5DG7 A;  2ATL A;  1NK0 A;  2IHN A;  4R64 A;  5T14 A;  3JPP A;  3F2D A;  2HVH A;  5J0S A;  2XCA A;  1ZQR A;  1L7M A;  5ALL A;  5KFU A;  5IIM A;  4C8L A;  3NS1 A;  2J6U A;  2B21 A;  3PV8 A;  1KBU A;  9ICS A;  4UAR A;  3B0X A;  5DB6 A;  3CRX A;  1ZQJ A;  2WTF A;  2KV2 A;  1DK2 A;  3QUT A;  2CN1 A;  2MA1 A;  3V7K A;  2PKE A;  2P35 A;  2FPL A;  2HMX A;  2RQ5 A;  1O03 A;  5KT2 A;  5KFM A;  4FE3 A;  2KMD A;  4KX3 A;  1LV5 A;  4ED8 A;  2G5I B;  4RU9 A;  4RT2 A;  5JTI A;  2R8H A;  2I6X A;  5KFV A;  4NL9 A;  2KN7 A;  2YN4 A;  3RJJ A;  3NAS A;  5AI5 A;  2EAN A;  3TAD C;  2GO7 A;  1LVH A;  3F5A A;  3L4P A;  2OCE A;  4FS1 A;  1S0N A;  2NRX A;  5KFJ A;  2IHM A;  5J0R A;  1H38 A;  2CRX A;  4MFF A;  5KG7 A;  3HWT A;  4Y2Q A;  1RYR A;  4DS4 A;  5IIK A;  2VA3 A;  1WYG A;  3RJH A;  2KIC A;  3QU9 A;  2HW3 A;  5A0L A;  1IM4 A;  1KFS A;  2FLL A;  4K4I A;  2RLT A;  3RH4 A;  2LPE A;  9ICO A;  3OSP A;  2LI6 A;  2PFO A;  1WUD A;  1JX4 A;  1X9S A;  9ICP A;  1TFR A;  4K4G A;  5KFK A;  4KLT A;  4YMO A;  4J9L A;  4KN7 A;  1Y88 A;  8ICF A;  4GFJ A;  3H40 A;  1RG6 A;  5IIL A;  3MDC A;  3RTV A;  2ALZ A;  5DQI A;  2K8B B;  3ISC A;  3PX0 A;  3RRH A;  5AI9 A;  2W3S A;  2EZY A;  1K1Q A;  2L5Y A;  4Y2R A;  3HKZ F;  5AM0 A;  2YQE A;  1X9M A;  4F4K A;  3EPG A;  4YR2 A;  1NJW A;  2K8C B;  5EWE A;  1D8L A;  4M9N A;  2NV3 A;  4CRX A;  2W9B B;  3N7S C;  4DL7 A;  3SV3 A;  5EWF A;  2HSZ A;  3V6J A;  3OHB A;  2H3V A;  1QQ6 A;  2W9C B;  2GOL A;  1ZQU A;  3H8W A;  1SXD A;  2RHF A;  2WF6 A;  2EZZ A;  1PZN A;  3C21 A;  5BOM A;  3KTQ A;  4XRH A;  4DLG A;  2A1J B;  1MQ3 A;  4IRC A;  2EH9 A;  1JAL A;  2WB1 C;  2HHT A;  4J9P A;  3I76 A;  1Z3E B;  3QX7 A;  4BUG A;  4KLG A;  1F5S A;  3SEN A;  3C2K A;  1NK7 A;  1FFU A;  2Z7J A;  3A0H U;  2XID A;  3LVW A;  1ZQM A;  3GZF A;  1ZQO A;  3GQC A;  3AQE A;  2NRZ A;  3RB3 A;  4OCZ A;  5AK6 A;  2C2D A;  2LYA A;  1O08 A;  5ALU A;  1NK4 A;  1ZQV A;  1WWU A;  3ETL A;  4XUS A;  2ZIU A;  1D8Y A;  3HKZ C;  2WF7 A;  3SR6 A;  1PK3 A;  1FIQ A;  3TI0 A;  3EYZ A;  4F4Z A;  1OW5 A;  3M9O B;  2EAO A;  2W11 A;  3RB6 A;  1ZD2 P;  4OJ6 A;  4I2C A;  3LK9 A;  1UCV A;  2W54 A;  5KG2 A;  3T79 A;  5J2E A;  2G09 A;  1TAQ A;  1T94 A;  1YZ7 A;  9ICF A;  5DBB A;  4ICA A;  1LKY B;  1ZRM A;  5J0T A;  3L5K A;  3MR3 A;  4XQ8 A;  1SZP A;  3BS5 B;  1OUQ A;  2KZ3 A;  4BXO B;  2XY7 A;  2HBK A;  2MUT A;  2BQU A;  5CHG A;  2W3R A;  4DS5 A;  1S9F A;  3IRU A;  5AHX A;  2NYV A;  3K1R B;  3WK5 A;  4I27 A;  4QWD A;  2W8L A;  5HML A;  1Z19 A;  5DB9 A;  2PMZ C;  1FEZ A;  2Y9T A;  4RQ6 A;  5AI8 A;  2HDO A;  1JN3 A;  9ICT A;  2ZG6 A;  4QZB A;  5DGB A;  4PL2 A;  5KFH A;  4DFM A;  3AL0 B;  1SKS A;  4AYB F;  5J0Y A;  4LZD A;  2XI9 A;  4NY8 A;  1XSN A;  1U49 A;  4J9R A;  3GFK B;  4JV1 A;  3SAH A;  5KFL A;  3KKA A;  3UPQ A;  4EZ9 A;  1CEZ A;  1DXS A;  4U7C A;  2F1J A;  3GIJ A;  1PK1 B;  4UB8 U;  1XSP A;  1NZP A;  2JEJ A;  1N63 A;  4PH5 A;  1KW4 A;  4M6W A;  2H3Z A;  1RPL A;  5DB7 A;  2W8K A;  5IIJ A;  2DL0 A;  3LYS A;  5AIC A;  2RRD A;  2BCV A;  1KRP A;  3CP8 A;  3NVY A;  4NJ8 A;  4OJL A;  5CB1 A;  4QZD A;  4X5V A;  1S0M A;  5DBA A;  2KFZ A;  5AKJ A;  1NJY A;  1ZQN A;  4DFJ A;  3RB4 A;  1B43 A;  3JPS A;  2IBK A;  4PZO A;  5AI6 A;  4YG2 A;  1FO4 A;  3EPI A;  5CA7 A;  1RQN A;  4PGX A;  3ORY A;  4I2J A;  2KK0 A;  1SKR A;  2CXY A;  8ICM A;  4DFK A;  1DRG A;  1S76 D;  2MU2 A;  3AEV A;  1D8B A;  5AM2 A;  4Z6E A;  3V7J A;  3QUC A;  3SD7 A;  7ICG A;  2KOB A;  2E8M A;  1JXL A;  3M7D A;  2D3D A;  1JMS A;  2KP7 A;  3V6H A;  3TKA A;  1MSW D;  1BPB A;  2R8G A;  1MA7 A;  3Q8P B;  3GII A;  4FBT A;  3PVX A;  3UQ2 A;  3UM9 A;  4DQS A;  5DKW A;  4UQG A;  4F2R A;  4YR0 A;  2KVS A;  3DDH A;  3HW8 A;  4PGY A;  3N4M B;  1SXE A;  2HHX A;  9ICA A;  4C4R A;  7ICP A;  3IG8 A;  4ECS A;  5J2C A;  2B6G A;  2ZIW A;  2AGP A;  4RPZ A;  9ICW A;  2WB1 F;  3RBD A;  2BHN A;  4JV2 A;  4EBC A;  1CUK A;  2V4Q A;  4YQW A;  4MEY A;  1QQ5 A;  3PZP A;  2QKQ A;  2OHF A;  4C7Z A;  2A1A A;  4YD1 A;  1RZT A;  8ICN A;  2JZB A;  4FFD A;  5HHH A;  1XWL A;  3QEB Z;  3C5F A;  3AN1 A;  4QWB A;  1TAM A;  2MSN A;  5KFA A;  7ICQ A;  5L1I A;  4DQI A;  4R65 A;  1XO0 A;  1VLB A;  5DG8 A;  2W7O A;  1COK A;  4DOC A;  4QZ8 A;  3MFH A;  4F71 A;  1JUD A;  2DWQ A;  2XIC A;  8ICT A;  1Q8K A;  3JPR A;  3BZK A;  3NVZ A;  4Y2S A;  3ZD9 A;  4O5K A;  4O5E A;  3RR7 A;  1CRX A;  1L8O A;  4DSI A;  2G5H B;  3FYH A;  4F5N A;  3T3F A;  3GIM A;  1B4F A;  1JRP A;  4RQ7 A;  2BPG A;  2AU0 A;  4QZF A;  5F3X B;  1M6Y A;  5ALI A;  1L8L A;  4PHP A;  4ED7 A;  4FBU A;  1IXR A;  2R8J A;  2GWS A;  2KKV A;  1HUZ A;  5KG3 A;  1D9D A;  5DB8 A;  5J0O A;  3RRG A;  3TFS A;  4ED3 A;  4C0Z A;  4C7Y A;  8ICS A;  1ZQF A;  5EE0 A;  3KD3 A;  3IM1 A;  2WF9 A;  4DOA A;  4CCH A;  8ICY A;  2XGQ A;  4MF8 A;  2K4E A;  1BNP A;  1KKX A;  3D2N A;  4RZR A;  4DL5 A;  2NRV A;  1XS9 D;  9ICC A;  1HJP A;  3JPQ A;  3MR5 A;  2R18 A;  3U26 A;  4DL4 A;  4ECY A;  1KFD A;  2P66 A;  1N5X A;  4B9S A;  4KLS A;  2KJ8 A;  3NTU A;  1ZQQ A;  1NK9 A;  4KIT B;  3PSP A;  3QU2 A;  2CPR A;  5TIS U;  4R63 A;  1ARO P;  2Y0S F;  4YXM A;  4RUC A;  8ICG A;  5BOL A;  5ALD A;  4KLQ A;  2JHD A;  2UVU A;  3R9K A;  4ZH4 A;  2BCU A;  2W55 A;  4UBC A;  2LMR A;  1UPH A;  2PMZ F;  4A8E A;  4GXJ A;  4GXK A;  4C8K A;  4M9J A;  9ICG A;  2HBM A;  1XO1 A;  3HX0 A;  4NM2 A;  4J9K A;  2JEF A;  4QIW C;  1Q3U A;  8ICC A;  5KTQ A;  3PW0 A;  4NL9 C;  2P6R A;  5EOZ A;  4F72 A;  2ASJ A;  2E8P A;  8ICK A;  2YML A;  2Y1J A;  3TAR A;  3K1Z A;  3AM9 A;  5J2G A;  3WKB A;  8ICJ A;  2KSO B;  4KLO A;  3BJY A;  4M2Y A;  3HIL A;  1PUZ A;  1RXV A;  3TAC B;  3UQ0 A;  1NK8 A;  4I28 A;  3KZI U;  2HHS A;  4O3R A;  3OPX A;  1ZYQ A;  2KZZ A;  3MBY A;  3RB0 A;  2ZXI A;  2QB0 A;  2WAQ C;  3LVV A;  3MAB A;  4DFD A;  1ZQH A;  2HOQ A;  2KVC A;  4Q43 A;  1X2I A;  4ECW A;  2FJ6 A;  5J2B A;  3F2B A;  5KFB A;  1KDH A;  4YR3 A;  3GV7 B;  2NO4 A;  1KSP A;  4I2E A;  5KT3 A;  4JV0 A;  4F3O A;  2F77 X;  7ICK A;  4I2B A;  3WKD A;  5EE3 A;  5KFC A;  4ECT A;  2ZIX A;  3IG5 A;  1UHU A;  5L9X A;  2HHU A;  4QZI A;  3LWM A;  4G3I A;  3UMB A;  3SAG A;  3QNM A;  4BX9 C;  2I9G A;  5HR7 A;  2BQR A;  4QZA A;  1L3T A;  1TK0 A;  4TUR A;  2JEG A;  3BQ2 A;  5KFQ A;  2EAM A;  5H2F U;  4MFC A;  2ISP A;  2OYY A;  2DGZ A;  3BS5 A;  4O3N A;  4Q8F A;  1MN8 A;  5DG9 A;  4C4S A;  1S5L U;  1BPD A;  4QWA A;  1C20 A;  4B9M A;  2JR5 A;  3HRD D;  2H5X A;  4DSE A;  1HIW A;  4UAW A;  3EZ5 A;  4GLX A;  5AKI A;  4ECZ A;  5J0Q A;  3PX4 A;  1XSL A;  2FLN A;  4B9V A;  3SV4 A;  2HBJ A;  3ISB A;  4LVS A;  4BWM A;  1N60 A;  2HHQ A;  7ICO A;  1UA1 A;  2JGA A;  3T5J A;  5J0P A;  3H8M A;  2DQN B;  1NJZ A;  4IQW A;  3H0R B;  4TQR A;  4I2H A;  3SQI A;  3NUQ A;  3PO4 A;  3M8R A;  2ZIX B;  4JB3 A;  1N62 A;  4BXO A;  1UQV A;  2YMP A;  7ICI A;  5EE9 A;  1CI4 A;  1V38 A;  1XNS A;  4M9H A;  1BNO A;  1DGS A;  4CF4 A;  3RF9 A;  1QH9 A;  2VA2 A;  4FZN A;  1ZQZ A;  2LHT A;  3E0F A;  4Z6D A;  1DK3 A;  5DQH A;  2FMP A;  4U6P A;  3V7L A;  2A1J A;  1NJX A;  1ZD5 A;  2C2R A;  3C29 A;  3E58 A;  5D46 A;  1S0V A;  4UAZ A;  5IIN A;  3BDP A;  2NRT A;  2WAQ F;  1NNL A;  1X6I A;  3RAX A;  1RQL A;  9ICL A;  4O9M A;  4PL1 A;  1D9F A;  1K1S A;  3Q8K A;  4F93 B;  3KZX A;  4GXI A;  3NVV A;  3IN5 A;  4F50 A;  3A0B U;  2FMQ A;  3Q8M A;  4P4P A;  4TUS A;  5B5E U;  1TK5 A;  3DEE A;  3PR5 B;  2W7P A;  4QW8 A;  1U9L A;  2YB1 A;  4QZC A;  2C22 A;  3C2L A;  1QLN A;  3K75 D;  2A19 A;  3S6J A;  3N97 B;  4ZOH C;  5GTH U;  2YB4 A;  1Z1B A;  3IDW A;  4EZ6 A;  3QUQ A;  4AP9 A;  1L3V A;  3KHL A;  4DQP A;  8ICR A;  4IR1 A;  3QU4 A;  2Y1I A;  2BCR A;  2ES6 A;  4KLI A;  4AYB C;  1QCK A;  1LB2 B;  4PPX A;  3KHR A;  2FPK A;  2KHQ A;  2FPM A;  4RQ1 A;  4I2I A;  2W43 A;  4EYI B;  9ICQ A;  5J0X A;  2OXO A;  1HEK A;  5F9L A;  4DSL A;  2FMS A;  4Z6C A;  3JPO A;  4WJ3 B;  4P0P B;  3QE9 Y;  9ICE A;  5ALG A;  5C0Y A;  4UW9 A;  5KFI A;  5L1L A;  1YZ6 A;  2KJ9 A;  4B9N A;  4BDP A;  2OH2 A;  5JUM A;  5AIA A;  4C8N A;  4O3M A;  5J2J A;  4F8R A;  1EXN A;  9ICV A;  4RPX A;  1N48 A;  5KG5 A;  3ZDE A;  2KE7 A;  9ICJ A;  4EX7 A;  4Q45 A;  3V6K A;  2BPC A;  1T3Q A;  3AMZ A;  4KLD A;  4XA5 A;  4O3S A;  3C5G A;  5AM4 A;  1B0X A;  2AGO A;  1SL2 A;  2HHV A;  5ALJ A;  8ICQ A;  2KJ5 A;  4IL6 U;  5KFW A;  4EBD A;  1IV8 A;  3KBB A;  4NLK A;  1NKE A;  5CJ7 A;  5KFE A;  2HOI A;  4C8M A;  2XO7 A;  3QZ8 A;  3UXP A;  1WG8 A;  4Y2P A;  4R8U B;  5DDM A;  3QU7 A;  4PHE A;  3KFU F;  4RQ3 A;  5J8Y A;  2XCP A;  3PW4 A;  3M9N B;  3QUB A;  4MFA A;  4RNO A;  1NK6 A;  2PI5 A;  2E3T A;  4RPY A;  5AKY A;  1N2X A;  1A77 A;  1KLN A;  2M0N A;  3MDA A;  3RJI A;  4LJX A;  3WK7 A;  2ZUC A;  4DFP A;  1HUO A;  1S10 A;  1K5O A;  4RQ8 A;  2PXI A;  1KQQ A;  3VCB A;  2W9M A;  3CW2 C;  1MQ2 A;  2E1E A;  4F2S A;  4IS7 A;  2J6S A;  1KL9 A;  4F4Y A;  1S0O A;  5ALT A;  1ZXI A;  2EAP A;  4C80 A;  2UVR A;  5FP0 A;  4YFK A;  4J9O A;  2AQ0 A;  4Y2Y A;  4MEX A;  9ICN A;  1JI7 A;  5ALV A;  5KL1 B;  3RJF A;  4P4O A;  2K89 A;  3WKC A;  1KTQ A;  2G06 A;  4RQ2 A;  4ECX A;  2VAN A;  2XY5 A; 
#chains in the Genus database with same CATH homology
 3HKZ C;  2H3Z A;  2Y0S F;  2E5S A;  2JH7 A;  4KMO B;  4NWI A;  2KJ9 A;  3C29 A;  2ZIX A;  1ZQ1 C;  2KIC A;  2OM6 A;  3IG5 A;  2OH2 A;  3LYS A;  2JHD A;  1PVR A;  2Y0S C;  4O3M A;  2WAQ F;  2KNJ A;  3SAG A;  2GH1 A;  2RRD A;  3F53 A;  4QIW F;  3CP8 A;  3VC8 A;  4BX9 C;  5A0L A;  4OJP A;  5HR7 A;  4PL1 A;  2DF4 B;  3D2S A;  2YX8 A;  3CYM A;  4OJO A;  3F5E A;  2ZIV A;  2G07 A;  2VJ5 A;  1ED1 A;  3KZX A;  3ONN A;  4OJL A;  5HR6 A;  1UPH A;  1TAM A;  2F76 X;  3IN5 A;  4OJ6 A;  3PSF A;  4FZM A;  2A3V A;  2PMZ F;  3L3F X;  4A8E A;  1WUD A;  3T79 A;  2RP5 A;  1PVP A;  2HBM A;  2G09 A;  1XO0 A;  2Q4T A;  2W7O A;  3H0M B;  2D6F C;  1T94 A;  3H0L B;  2JH1 A;  4KX5 A;  2OYY A;  4QIW C;  1Q3U A;  1F44 A;  4P0Q B;  2DGZ A;  3IP4 B;  4ICA A;  1YT3 A;  2XIC A;  2KJ5 A;  3DEE A;  3M6Z A;  4GFJ A;  4OO1 J;  4P0Q A;  4OJ5 A;  2W7P A;  5T14 A;  3F2D A;  3K1Z A;  4U6P A;  2K8B B;  2YB1 A;  3GU3 A;  2H3I A;  3PST A;  1OUQ A;  1IIP A;  2VIX A;  2W03 A;  2HBK A;  2HOI A;  2N1R A;  1CRX A;  1DRG A;  1HIW A;  2G5H B;  2KKP A;  2K8A A;  2XVT A;  3HKZ F;  1KBU A;  2ZIW B;  1A6S A;  2ZIV B;  2KHV A;  2LYB A;  3C28 A;  2KEY A;  5CRX A;  1D8B A;  2LBO A;  2LKY A;  2K8C B;  2G08 A;  3KFU F;  2YB4 A;  4WJ3 B;  3CRX A;  2KOB A;  1Z19 A;  1Z1B A;  2KV2 A;  2NV3 A;  2PMZ C;  3M7D A;  4QNL A;  4CRX A;  2HBJ A;  2KKV A;  3OPX A;  4NV0 A;  2ZG6 A;  3N7S C;  3M6K A;  2CN1 A;  2VJ4 A;  4NLC A;  2MA1 A;  4PL2 A;  5KL8 B;  3D2Q A;  1MA7 A;  3N7R C;  2F2A B;  1ECW A;  2H3V A;  2W04 A;  3AL0 B;  2M0N A;  2ZXI A;  2GOL A;  4AYB F;  4JMU A;  2HMX A;  2RHF A;  4C0Z A;  2WAQ C;  3NRW A;  2JGA A;  2HOF A;  3LVV A;  2KIW A;  2XI9 A;  2K4I A;  4AYB C;  3F2C A;  4CGZ A;  3VCB A;  4P0P A;  2DQN B;  2K4H A;  2ZIU B;  2K4E A;  2WB1 C;  4BJQ A;  4FE3 A;  3RFA A;  2E1E A;  2HBL A;  4KX3 A;  3H0R B;  2HOQ A;  2KHQ A;  2KVC A;  2G5I B;  3D2N A;  4ACO A;  1Q3V A;  2E1F A;  1GO3 F;  2H3F A;  3ICX A;  3IG8 A;  3ALR A;  4BUG A;  3SQI A;  3NUQ A;  3SAH A;  2R18 A;  1SZH A;  2MRL A;  2Z7J A;  2KD1 A;  2ZIX B;  2BDU A;  1P7D A;  4QJF B;  2H3Q A;  2OXO A;  2XID A;  3LVW A;  3F2B A;  3GZF A;  2ZIW A;  3O0F A;  1HEK A;  3AQF A;  4U7C A;  2JMG A;  2F8L A;  2ZXH A;  1XNS A;  5KL1 B;  3AQE A;  3F5A A;  3N7P D;  1A0P A;  2WB1 F;  2KJ8 A;  4P0P B;  2K89 A;  4NLB A;  4IC9 A;  3RF9 A;  2LYA A;  3PSI A;  2G0A A;  1PVQ A;  3MGV A;  4CDG A;  2VKQ A;  1URJ A;  2G06 A;  4FZN A;  3PSP A;  2F77 X;  2CRX A;  2CPR A;  2LHT A;  3E0F A;  3SMV A;  3SAF A;  3PZP A;  4FZL A;  2ZIU A;  5C0Y A;  1NZB A;  1L6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...