2E1EA

Crystal structure of the hrdc domain of human werner syndrome protein, wrn
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
94
structure length
94
Chain Sequence
b'QPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKRIDGVSEGKAAMLAPLLEVIKHFCQTNSVQTDLFSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Werner syndrome ATP-dependent helicase
publication title Crystal structure of the HRDC domain of human Werner syndrome protein, WRN
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 33
structure length 94
sequence length 94
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2e1eA01
2E1EA 4NLCA 4QIWF 5C0YA 1D8BA 1GO3F 2CPRA 2MA1A 4CDGA 2E1FA 1WUDA 4O3MA 4OO1J 2KV2A 3SAFA 2RRDA 3SAHA 2HBMA 4QJFB 2DGZA 2RHFA 2HBKA 3CYMA 4CGZA 2HBJA 4NLBA 3SAGA 1YT3A 2HBLA
chains in the Genus database with same CATH superfamily
4UARA 5AM2A 4RQ1A 2LHTA 2BCRA 2XY7A 1HUOA 1NKEA 4ECZA 3PV8A 5BPCA 5IINA 1QSYA 5ALUA 5KFYA 3RJEA 3Q8RB 3RJKA 4USAA 3OSPA 2NRWA 4CE6A 5KG2A 2K4EA 2IOHA 4EX7A 4BXOB 3OTQA 1KTQA 4BWJA 2ZIWB 1OXJA 2MUTB 4UBCA 5IIIA 3PMLA 5J0RA 4ZOHC 5E79U 5CEHA 4X5VA 3TFRA 4LZGA 2UVWA 1FFVA 5DG8A 4IR1A 3ZI4A 3PO5A 4QWDA 4EBEA 4M9GA 4NM2A 1U9LA 5GTIU 5KFCA 4YG2A 1S9FA 1K1SA 2F1JA 2E3TA 2R18A 4QZBA 4FBUA 5L1KA 3PSTA 4NM1A 4LJXA 3MDAA 2VA3A 3N28A 2R8KA 5KG5A 2A1JA 1CEZA 5L9XA 3WK7A 1C7YA 4KLLA 5F3XB 2XCAA 2Y9TA 1ZQAA 5J0UA 4M6WA 4CDGA 4OJ5A 1ZQCA 4TQSA 9ICNA 4ECUA 4UQGA 2LYHA 1D8LA 3IM1A 1J97A 3N7RC 2ZIXA 5KFZA 3KZIU 1URJA 1D9FA 2BPGA 5ALZA 1PZNA 1ZQUA 3GU3A 2L5YA 4QZ9A 1Q46A 8ICTA 3C5FA 5KG1A 4RNMA 3A0BU 3C2KA 2P66A 3MABA 1TVAA 1N2XA 1SB3C 4DS5A 5ALWA 1QSSA 5J29A 3HWTA 4EELA 1TE2A 4UAYA 2D3DA 2JGAA 2RDJA 3V7LA 2PFPA 2W11A 5EE9A 2W03A 2Q4TA 3JPOA 2H3ZA 8ICEA 5J2BA 4AP9A 4ELTA 2YQEA 5KFUA 1V38A 7ICQA 5A0LA 2KSOB 2YMMA 1JRPA 3QU5A 1FEZA 3KD3A 4I29A 9ICKA 4KX3A 5KG0A 3ISBA 1RQNA 3SEIA 2HHTA 1F0MA 1MC8A 3OJUA 2ZTCA 5BOMA 1KEJA 4US9A 3IG8A 5KL1B 3IG5A 4IRDA 3EW9A 2BQRA 1LKYA 3GIMA 4F92B 3KHRA 1NNLA 5ALVA 4F4ZA 4KLFA 1ZQRA 3RBDA 3Q8QB 3KHLA 3JPSA 7ICLA 5KFNA 3OHBA 8ICOA 3V72A 2LMRA 5KFVA 9ICLA 5AKGA 2DL0A 5DLGA 3PX4A 4QJFB 4ED6A 2A19A 4C0ZA 3DEEA 4J9KA 2H3VA 2BCSA 1JROA 4F5QA 1TKDA 3C2MA 1SKSA 1JIHA 1Z4OA 1A0PA 2QB1A 3H4DA 5AK6A 4BDPA 4NLGA 8ICRA 3KKAC 5EOZA 1BGXT 2KOBA 5DB8A 3M9NB 3FM9A 4PHAA 4DFDA 3HILA 2WF7A 4RT2A 4QZEA 2NV3A 4Y2SA 3RJGA 4C8NA 3N97B 5L1IA 4UAUA 2WAQC 4NV0A 2M9NA 3UQ2A 3N4MB 1SWVA 1KFSA 2OWOA 3WKAA 3Q8PB 5KFQA 2OHFA 2AH5A 5HHHA 3M6KA 2ZIUB 3HPOA 3RB3A 4DWIA 2W8LA 2KIWA 4Q8EA 3LYSA 1LV5A 4I2HA 2CXYA 4J9OA 4KLJA 1L3SA 5B5EU 3V6KA 9ICBA 1IG6A 1KBUA 3CP8A 4Y2PA 4O3MA 4WJ3B 3V6HA 4UB1A 4CNQA 4QZHA 2JMGA 3KOOA 4YQWA 5J2EA 1KSPA 1ZQQA 2P6UA 3JPPA 4DF8A 5KFAA 2HOQA 4I2BA 1ZQJA 1WG8A 2JH7A 2PI5A 3PX0A 4RQ7A 1BPEA 2JRZA 5ALPA 5KFXA 2ZG6A 2LBOA 3KTQA 2OXOA 3BS7A 4DL7A 4YFKA 4YCXA 5KFGA 2I1QA 2JH1A 3SI8A 1CUKA 3THVA 1N48A 5KT3A 1RPLA 1Q3UA 2AGPA 1JI7A 5KFIA 5KFJA 5JU5A 4M9NA 5IIMA 4QZGA 2EZZA 2HI0A 2KZZA 4P0QA 3PR4A 1Y88A 3IRUA 1F5SA 3BS5A 3H8JA 4JV1A 1N62A 2BCQA 5F9LA 4IL6U 5BOLA 5EWGA 2H3FA 1MSWD 1PK1A 1JN3A 5ALQA 3CNHA 3S6JA 1ED1A 4K4IA 3RR8A 1QTMA 3RBEA 5AI5A 4DL4A 4J9RA 5DB6A 4DLGA 4CCHA 2HOIA 8ICJA 2KTQA 3AL0B 3IDWA 4QW9A 4CF3A 2KZ3A 1ZQZA 3ALRA 2AGQA 2ISPA 3ZDAA 1U45A 1ZQYA 3Q8LA 4BX9C 3C1ZA 4RPXA 9ICFA 1NK9A 1LVHA 1JALA 4I28A 4YMOA 5DLFA 4NLKA 2EANA 2KE7A 2JR5A 4DFPA 4UB2A 2PMZF 5AHXA 4KLEA 3KFUF 3TARA 2W9MA 5ALLA 5KTQA 4FZMA 2KKVA 5ALGA 5AKZA 1SZPA 4TUQA 2W9BB 2YMQA 1TAMA 3WKCA 1X6IA 4UB5A 1VLBA 2MA1A 5IIJA 2DFLA 2DPJA 5KL8B 3AU6A 4DEZA 3PZPA 4BXOA 4KN7A 5AI9A 2ZIWA 4A8EA 4Q45A 4K4GA 1FFUA 2MUTA 4B9LA 2EQYA 2Z7JA 4R65A 5J0OA 2JV3A 2Q0ZX 4QIWF 3AQFA 4XUSA 4IQUA 1O08A 1WUDA 1KKXA 5AKYA 3NRWA 4Y2XA 1RZTA 2GO7A 4QZDA 4Q43A 4LVSA 1QQ7A 4C80A 1S5LU 2FPKA 2PXIA 2W04A 8ICIA 3CRXA 2CRXA 2HMXA 4RQ2A 3BJYA 3MFHA 2YB1A 3OPXA 4P4OA 1PK3A 3T5JA 4DS4A 1QH9A 2ES6A 1P7DA 3M9OB 2PFNA 3ISDA 3PSFA 1ZQIA 1X9XA 3RRGA 2HBMA 2HHUA 5KFHA 1PVQA 3RF9A 4PHEA 7ICKA 3TAQA 2YMPA 2G08A 4UB6U 3GIIA 3MGHA 2ASJA 1UHUA 3I28A 5J2CA 4UB4A 4J9LA 1V85A 2KJ8A 1ZQEA 2DKXA 3KBBA 2EDUA 1WWVA 1S97A 2KFZA 3HKZC 4PZNA 2KK0A 1PVPA 5J0SA 4DQPA 1K5OA 2MSNA 4U6PA 4DFMA 2HHVA 3FC4A 4RU9A 3ZDDA 2XY5A 1UT8A 7ICIA 2JEJA 1ZQWA 4OO1J 3H0MB 1XSPA 2JXJA 2HDOA 1Q3VA 1S77D 5J8YC 1ZOLA 4RT3A 3QUBA 5ALHA 2XGQA 3C5GA 3QZ7A 9ICQA 5JRTA 4YR3A 1TK0A 3WK6A 2Y1IA 4RQMA 5HR6A 2V4RA 4ED3A 5KFTA 1ZQKA 1QQ5A 1KL9A 4B9NA 4JV0A 2FDRA 1NKCA 2KVCA 2CPRA 1ZQMA 3EPIA 4FS1A 2GWSA 3LDAA 9ICTA 4HYKA 5JTIA 2KICA 4RQNA 4R66A 3H40A 1UPHA 4KLHA 4DSLA 4UW9A 4ECWA 4NXZA 7ICRA 2IBKA 5KAIU 3FYHA 4KMUA 2NYVA 2UVUA 1VJ5A 4ECYA 1ZQDA 2BCUA 1DGJA 5HMMA 4O5CA 5KFBA 4NLNA 4KLMA 4NL9A 3UMBA 4YD2A 5J0QA 4UB8U 1XSNA 2NRZA 1HEKA 1M6YA 3HP6A 9ICIA 1NJYA 1JUDA 1AROP 2H3QA 3RJFA 3G6YA 3D2SA 3IHQB 5DG7A 3V7JA 1HIWA 5EE1A 1JX4A 1V9PA 4O3PA 7ICGA 3BQ1A 4Q8FA 1SV4A 5EE3A 4G3IA 3QU4A 8ICSA 2AQ0A 3HJEA 4PPXA 3NUQA 4F93B 4F5PA 4M9LA 2Y9UA 1KN5A 4MF8A 4UBBA 4J9NA 2R8IA 2KVSA 1RQLA 3WKDA 2KNJA 2JZBB 4IR9A 2F77X 4YXMA 2IHNA 4XQ8A 4I27A 4NJ8A 4YMNA 2Y0SC 5DGBA 4Y2UA 2NO5A 4QZAA 3MC1A 3C2LA 3QUCA 2OH2A 2ZIUA 2IOFK 2R8JA 3OHAA 3T3FA 3LVVA 4OJPA 3SAFA 4QWAA 4EBCA 7ICEA 4I2DA 4FFDA 3ETRA 4RNOA 4I2IA 3ZDCA 2OM6A 4DLEA 2C2RA 5G5HA 1ZQTA 2F3NA 4IQWA 1QSLA 2RDIA 4DL2A 1IM4A 1JMSA 4XA5A 4GIBA 2PFOA 4I2FA 3AQEA 3BZKA 4PH5A 4QWBA 3C1YA 4DL5A 8ICHA 4PHPA 3RJJA 5ALJA 3GZFA 1NJWA 3RRHA 4Y2TA 5AI4A 4BUGA 5J2GA 4HAIA 3CW2C 3NTUA 3C28A 1T3QA 3T5LA 1SGGA 1U49A 5KFEA 1X6JA 4Y2QA 3RB6A 2F2AB 2QB0B 4JMUA 8ICMA 1XWLA 2F1HA 2E8MA 3KZXA 4Y2JA 1Z4NA 2ZIVB 5CHGA 5AK5A 5KFWA 1SV0A 3SENA 3HX0A 3PO4A 2ODGA 2KHQA 5J2JA 4P2HA 4DL3A 3I1YA 5D4BA 4KLOA 2ZUDA 1N63A 1SKWA 1D8BA 1GO3F 2G06A 3F2DA 2XO7A 1ZQVA 3UMGA 4DQIA 1KRPA 2DF4B 1PUZA 7ICMA 4YVZA 4F2SA 3E2EA 4RUAA 3HRDD 3MGIA 4EENA 3M8SA 5DBAA 1H38A 1RM6C 1B22A 3BQ7A 3L4PA 5AM5A 2EAPA 3F5EA 2XI9A 2PKEA 5J2AA 1DGSA 3I76A 4RNNA 1WWUA 4RZRA 5KT6A 5L1MA 2I5HA 3V6JA 5ALKA 3QEBZ 4F4WA 1BPYA 3AEVA 4RUCA 3MR3A 3IV6A 5KFKA 5C5JA 2ZJ8A 5J2KA 3PNCA 3NS1A 3ORYA 4F5OA 3WK4A 1YZ6A 3SZ2A 4Y2RA 4RQ6A 2LM4A 1NK5A 2I9GA 2BGWA 5DDMA 5FP0A 4ECSA 2A3VA 2KKPA 1L7OA 5DQGA 4M9HA 2VIXA 5ALYA 4F8RA 2FE9A 3SMVA 2W9BA 2WTFA 1U4BA 4EEKA 2W8KA 1SL2A 4NWIA 2HHQA 4GFJA 5KFMA 2HBLA 1S0MA 1BPBA 4YR0A 4B6JA 3H0LB 5F9NA 1ZYQA 2IHMA 1XC9A 4P4MA 4I2EA 3K1RB 4KLDA 5DGAA 2KV2A 5KFPA 2WAQF 4US8A 3PSIA 5AK4A 4ED1A 2F76X 4DFJA 1RYRA 1ZD2P 4M04A 2KP7A 5HHIA 2YY6A 1PVRA 2H5XA 9ICRA 3TADA 5B66U 3QEAZ 5ALDA 4RQ8A 2C22A 3GDXA 1Q8KA 4J9QA 4GC7A 2C2EA 1N61A 3RR7A 3PX6A 1KLNA 2YTUA 5AKHA 2FJ6A 1X9MA 3KHGA 3NGDA 4OJ6A 3AU2A 1BPZA 3BQTA 3ETLA 1UA1A 3QNMA 9ICEA 3A0HU 2ZUCA 2F8LA 2FLNA 2FMSA 4F91B 2I6XA 4ED2A 5H2FU 5KFLA 1ZQHA 1HJPA 5GTHU 1ZQBA 4C8KA 2WB1C 3UQ0A 5KFRA 3ZD9A 1U47A 2G09A 1QLNA 2W43A 3NVYA 2EAOA 2KJ9A 1Z19A 2RLTA 1A77A 2RRDA 1BPXA 3G6XA 7ICFA 4BJQA 8ICCA 5CR0A 2DQNB 8ICBA 2HVIA 4C4TA 5AKEA 4CGZA 3SD7A 4RQ4A 2YB4A 1X42A 2E8PA 5KG3A 3H0RB 3ICXA 2EZYA 2ZXIA 3C29A 1TAQA 1F44A 5AKLA 4ED8A 2BDUA 3TFSA 1DK2A 1X2IA 1EXNA 2O6KA 1COOA 4KLIA 4B9UA 1L8LA 1IIPA 9ICPA 3JPQA 1J2MA 4M2YA 4UAVA 4NLBA 5AKXA 1JXLA 1N60A 5J8YA 4CF5A 3E58A 4MFFA 5ALMA 5J2IA 4IRKA 2E1FA 4EZ6A 8ICQA 3J81j 1QCKA 2GLEA 3PW5A 1T94A 2LYBA 2NRVA 3BQ0A 5AIBA 4EEYA 2IMWP 4OJOA 2UVRA 5KFOA 2F8KA 4JB3A 1B4FA 5DG9A 1S0OA 4CF4A 3M1YA 5CP2A 4O3NA 2N1RA 5ALIA 3RJHA 2BPFA 3TKAA 2ALZA 4F4YA 4F4KA 9ICGA 3F5AA 2FLLA 4QW8A 2E8OA 2ZUBA 3GIKA 2W7PA 3UXPA 5AM3A 5DQHA 5EE0A 4I2JA 4AYBC 1MQ3A 4BWMA 1S76D 2A1AA 3JPTA 5AI0A 5DKWA 4RQ3A 5KG6A 2KMDA 1FO4A 7ICSA 2DWQA 2W9CB 5CJ7A 1RYUA 2AXTU 4NY8A 5ALEA 4QIWC 3N7PD 4OCZA 5T14A 4DQSA 3DDHA 2BCVA 1VDVA 1RDFA 3R9KA 3QYPA 2JZBA 4QZFA 1J2NA 1X9WA 3WK8A 2R8GA 4JWNA 2JHDA 4FBTA 3T5KA 2XIDA 3LVWA 3QUTA 3T5HA 5CB1A 4GLXA 2XC9A 2JEIA 4IRCA 2XVTA 4DQQA 4O3QA 1OUQA 1NI3A 3DV9A 5KFSA 1RXVA 1BNPA 2DKZA 1TK8A 3B0YA 2NRTA 5D49A 2ASLA 4Y2YA 1NOMA 1WCNA 1D9DA 5EWFA 2FI1A 4PZOA 1X9SA 2DBYA 1YT3A 4DSIA 2BQ3A 4DSFA 3RH4A 2C2DA 3HKZF 2ASDA 4R8UB 2W3SA 3ONNA 2FMPA 4C8OA 5TZVA 5J2FA 5IILA 1DRGA 2XGPA 4I2AA 1ZQPA 2KG5A 4MHVA 2HOFA 1ZRNA 2EAMA 5J2HA 1SWWA 2JEFA 2W7OA 3F2CA 8ICGA 2QB0A 2QKQA 4C8MA 4QZCA 3MFIA 1NK6A 3H7IA 2ZIVA 2DPIA 4KN4A 2KSOA 2J6UA 3WK9A 4DL6A 4MFCA 3WU2U 5CWRA 1Z00B 5AI6A 2NO4A 1ZRMA 2DGZA 2RHFA 2G5IB 2OEHA 2HBKA 3WKBA 1NKBA 2HHSA 1TK5A 3EZ5A 2EZXA 4PL1A 5KFFA 2ATLA 2ESEA 2K60A 1T8EA 4Z6EA 2WFAA 2HCFA 2C28A 2K4HA 3TI0A 1NK7A 3IP4B 8ICKA 3SV3A 1MA7A 3MGVA 4O0IA 4O9MA 3RTVA 2F44A 4YN4A 3VC8A 5J0TA 4FS2A 1TAUA 7ICHA 4KX5A 3GV5B 3RB0A 3GFKB 3PSPA 1MQ2A 1XSLA 2BPCA 2B21A 1O03A 3RAQA 3GQCA 3ISCA 1RXWA 3RAXA 8ICFA 1ZQFA 3CYMA 2XCPA 3D6JA 3QXGA 1ZD4A 8ICVA 3ZD8A 2GH1A 2FMQA 3V7KA 2KD1A 4C7YA 1L6NA 5J0PA 5J0XA 4C8LA 3UM9A 2XY6A 1FIQA 3AMZA 4M0AA 9ICJA 2P6RA 1KQQA 5DDYA 4O3RA 4UAZA 3T79A 2G0AA 4U7CA 1WCLA 1ZD5A 9ICWA 1HUZA 4TUPA 2LM1A 5ALNA 4ECXA 4XRHA 4QWEA 4LZDA 2G5HB 3KKAA 3JPRA 3NVWA 4ZH4A 2Y0SF 4DOCA 2KFNA 3ZDEA 1L3UA 1BVSA 1L3TA 1OW5A 2QLTA 2M0NA 4F2RA 3NVZA 3PW4A 3HW8A 3PMNA 8ICNA 4DOBA 4DOAA 3TQ1A 8ICAA 2OCEA 2J6TA 1B0XA 2CN1A 5AKIA 2PFQA 4J9MA 5C0YA 8ICPA 3SV4A 1S10A 3NASA 3EUB2 5K4LA 3UPQA 5KT5A 9ICUA 4PGQA 1N5XA 1BNOA 9ICHA 1SIJA 4RQ0A 3D2QA 4YD1A 4JV2A 4PL2A 4IQVA 4KITB 5CRXA 1ZQNA 8ICWA 1RYSA 4QWCA 4KLUA 4CRXA 1XS9D 5DBCA 4FZNA 2E5SA 4O5EA 4KMOB 4DCCA 5ALSA 1CI4A 3RJIA 4PJ0U 4ECQA 1QQ6A 4PGYA 2WF6A 2Y1JA 5IIKA 4NLCA 1LB2B 3VCBA 9ICCA 4MEXA 1ZQGA 4DSKA 2QARB 2VANA 5DQIA 3UXNA 2K8CB 9ICMA 1B43A 1L7NA 5KT2A 2HVHA 2BR0A 3H8MA 2W9AA 4P0PB 4MFAA 4NLZA 2KHVA 1TV9A 4ECTA 4DSEA 5KT7A 2OYYA 5HMLA 4ELUA 4C4SA 1XO0A 1IXRA 4NL9C 1SXEA 3EPGA 7ICOA 1AQ6A 3IN5A 2E1EA 4M47A 1NK0A 1N5WA 3LK9A 1DOQA 3WK5A 3PY8A 3QE9Y 2YMLA 1X66A 4ELVA 4JK1A 1NJZA 4Z6DA 7ICVA 1SKRA 3MDCA 1DK3A 3L3FX 3BQ2A 2MAXA 2HHWA 5DBBA 5KG4A 2B0CA 4J9SA 2WHEA 1UA0A 2VKQA 4YP3A 4PHDA 4EBDA 4F50A 3FAHA 2ZJ5A 2ZTEA 4IQTA 1ZD3A 1KFDA 4K4HA 2K4PA 2GOLA 3PW2A 5HNKA 1NK8A 5ALRA 3F53A 2HHXA 2YX8A 2D8CA 1ZQOA 3Q8SB 4MF2A 5EWEA 5HP4A 4ECVA 3SAGA 2AJQA 2W9CA 3K4GA 2RP5A 1ZJMA 3RFAA 1T4GA 1V97A 3FDSA 5HR7A 2A1JB 2LPEA 1XU4A 4EX6A 1KFTA 4R63A 3M8RA 3SQIA 4C4RA 3JPNA 5AM1A 2V9WA 3PR5B 4M6WB 3M9MB 1COKA 2WF5A 2KZMA 4C7ZA 3E0FA 4KLQA 3F2BA 3H8WA 1A6SA 4UASA 1NJXA 3QX7A 3EWAA 1NZPA 1WYGA 1UCVA 5KAFU 2KIVA 2ZIXB 1D8YA 2W55A 5ALXA 2MRLA 3U26A 2K89A 4B9SA 5ALOA 2G07A 1N56A 4ACOA 1T7PA 4I2GA 2WF9A 4EYHB 1SXDA 1DXSA 2FPMA 1SZHA 7ICNA 5L1LA 2BQUA 4ED7A 3NVVA 1NZBA 1SV0C 2WB1F 5KFDA 4FZLA 3K1ZA 4F5RA 4B9TA 2LYAA 2XICA 1A76A 1S0NA 2KN7A 9ICVA 4P4PA 2NRXA 3NRZA 1U48A 3UXOA 4JWMA 2WF8A 2AQ4A 4R8UA 2BZFA 4J03A 9ICXA 5KNIA 3GIJA 4YMMA 1NK4A 2E8NA 1L3VA 3MBYA 2H3IA 4PGXA 3EYZA 3BZCA 4B9MA 4E0DA 4TURA 5KT4A 4EZ9A 3OJSA 1S0VA 1IV8A 9ICOA 4TUSA 1Z1VA 5AKJA 3WKEA 4UB3A 3SR6A 3QU7A 4UAWA 4OD0A 4GXIA 1Z00A 3LWLA 3KHHA 1LKYB 3PVXA 4GXKA 3AN1A 2VJ4A 3K75D 1UT5A 3QZ8A 3M7DA 1XNSA 2AHOB 4F4XA 5AK3A 3GV8B 3AM9A 4F5NA 2BKEA 4Z6FA 1KW4A 1ZQSA 2V4QA 1T3NA 4OJLA 2FPLA 4RPYA 2EH9A 4DQRA 2R8HA 2PMZC 2HW3A 2W54A 2HBJA 4GC6A 4TQRA 5KG7A 1JXEA 9ICAA 2FLPA 2UVVA 3MR5A 7ICJA 3ZDBA 2BHNA 1Z3EB 3AUOA 2D6FC 2W3RA 5TISU 5L1JA 3BDPA 2ZTDA 1SL0A 1XO1A 1UQVA 2BDPA 1ZQXA 8ICXA 5J0WA 3GV7B 3H8SA 3PW0A 5JUMA 2IA6A 2PI4A 3N7SC 5ALFA 3Q8KA 2KJ5A 3UMCA 5D46A 2K8BB 1BPDA 4Y2VA 1RG6A 5AKKA 4AYBF 3HT3A 1KDHA 4QZ8A 4DSJA 4ED0A 3RB4A 3TADC 1SL1A 4YR2A 3GILA 2J6SA 4Q44A 7ICPA 3SYZA 2DUYA 4F71A 1L7MA 4BGDA 3RH6A 1ZQLA 4EYIB 2JEGA 3QU9A 4JUZA 4KTQA 8ICYA 1ZJNA 4IC9A 5J2DA 4O5KA 1S8OA 4IS7A 3M6ZA 3MR2A 3B9JA 4RQ5A 2YN4A 5DB7A 4DFKA 2VA2A 2F1IA 3B0XA 5AI8A 3Q8MA 3OSNA 1K1QA 1MN8A 2ISOA 3SAHA 3D2NA 3LWMA 4QZIA 4M9JA 4KLSA 1L7PA 2ZXHA 4DO9A 4FO6A 4ECRA 4MEYA 5CA7A 3RH5A 5IIOA 2AU0A 4Z6CA 4FE3A 1ZETA 4UATA 2K8AA 2IOFA 2RQ5A 1L5UA 9ICSA 1CRXA 5AM4A 4P0QB 1Z1BA 4O3SA 1TFRA 7ICTA 4G9BA 3BS5B 4R64A 2VA8A 1YZ7A 1C20A 5ALTA 1L8OA 1X40A 4I2CA 3OGUA 1PK1B 4DF4A 2KEYA 3G6VA 3MR6A 2ZJAA 4RPZA 4F3OA 3PW7A 3C21A 3H4BA 2LKYA 5DB9A 4KLTA 4ICAA 3QUQA 2P35A 3L5KA 5J0YA 2QARA 4YXJA 4B9VA 7ICUA 5AM0A 4O3OA 3TANA 4P0PA 4KLGA 1ZQ1C 4J9PA 1ZXIA 2VJ5A 3ED5A 3TAPA 2MU2A 4QNLA 2K4IA 1ECWA 2HSZA 4F72A 8ICUA 8ICLA 2AGOA 3C23A 2B6GA 3QU2A 5AIAA 3O0FA 8ICZA 5AICA 2LI6A 3TACB 5G5GA 4GXJA
chains in the Genus database with same CATH topology
2F8LA 1A0PA 3RFAA 2LHTA 3HKZF 4NLCA 4QIWF 5HR7A 2GH1A 3F5EA 3AQFA 2XI9A 2VJ4A 3GU3A 2ZIUA 2KVCA 2KD1A 2CPRA 2N1RA 1L6NA 3M7DA 1XNSA 3SQIA 1WUDA 3ONNA 3NRWA 2K8CB 2Z7JA 3LVVA 3F5AA 1DRGA 4OJPA 3SAFA 3SAHA 2WB1C 2H3FA 2W04A 3D2NA 2KOBA 2HOFA 2KICA 4P0PB 2W7PA 1UPHA 2KHVA 3T79A 2G0AA 1ED1A 2NV3A 2ZXHA 3E0FA 4U7CA 3F2BA 2CRXA 3CRXA 2HMXA 2OYYA 2W7OA 3F2CA 1A6SA 4OJLA 4AYBC 2YB1A 2PMZC 2G09A 1XO0A 2HBJA 3OPXA 2G5HB 2OM6A 2WAQC 2JGAA 2HOIA 2ZIVA 3IN5A 2K4EA 2E1EA 4FE3A 4NV0A 2ZIXB 3AL0B 2K8AA 2MRLA 2Q4TA 2W03A 2Y0SF 2ZIWB 2K89A 1P7DA 2D6FC 3ALRA 2H3ZA 2G07A 2KKPA 1CRXA 2KJ9A 4ACOA 2A3VA 3AQEA 1Z19A 3PSFA 4BX9C 4P0QB 2M0NA 2RRDA 1Z1BA 2HBMA 5A0LA 2VIXA 4BJQA 4QIWC 2DGZA 3M6KA 3N7PD 1SZHA 3SMVA 2RHFA 2G5IB 2DQNB 5T14A 2ZIUB 1PVQA 3GZFA 2HBKA 3N7SC 1HEKA 3RF9A 2KIWA 4BUGA 4CGZA 3LYSA 4NWIA 1NZBA 3L3FX 4GFJA 4PL1A 3C28A 2YB4A 2H3QA 4KX3A 2KJ5A 2HBLA 2G08A 3H0RB 3ICXA 2CN1A 2WB1F 3H0LB 2K8BB 4FZLA 2KEYA 3D2SA 5C0YA 3K1ZA 2ZXIA 2JHDA 1HIWA 2F2AB 3VCBA 4JMUA 2KJ8A 2LYAA 3C29A 2XICA 2R18A 1KBUA 2K4HA 3CP8A 4O3MA 4AYBF 4WJ3B 3PSTA 1F44A 2PMZF 2KV2A 3IP4B 3KZXA 2BDUA 2XIDA 3LVWA 2JMGA 2ZIVB 2WAQF 3MGVA 2VKQA 3IG8A 1MA7A 3HKZC 5KL1B 3IG5A 3KFUF 3PSIA 2KHQA 2LKYA 2HOQA 2F76X 1PVPA 4ICAA 2XVTA 2JH7A 1IIPA 4FZMA 3NUQA 1OUQA 3VC8A 4U6PA 3D2QA 4NLBA 4PL2A 4KX5A 2KKVA 1PVRA 2ZG6A 5CRXA 2LBOA 1TAMA 3PSPA 4P0PA 1D8BA 1GO3F 2OXOA 2MA1A 2G06A 2GOLA 1ZQ1C 2JH1A 2E1FA 4OJ5A 4CDGA 2KNJA 2VJ5A 3F2DA 4CRXA 4OO1J 3H0MB 2H3IA 4FZNA 2E5SA 4QNLA 4KMOB 3F53A 2DF4B 5KL8B 1Q3UA 1Q3VA 1ECWA 2F77X 2K4IA 2OH2A 4IC9A 4QJFB 3PZPA 2YX8A 4C0ZA 3DEEA 1T94A 2H3VA 2LYBA 2Y0SC 2ZIXA 3N7RC 3CYMA 4OJ6A 2ZIWA 4A8EA 3O0FA 1URJA 3M6ZA 3SAGA 4OJOA 1YT3A 2RP5A 5HR6A 4P0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1E A;  4NLC A;  4QIW F;  5C0Y A;  1D8B A;  1GO3 F;  2CPR A;  2MA1 A;  4CDG A;  2E1F A;  1WUD A;  4O3M A;  4OO1 J;  2KV2 A;  3SAF A;  2RRD A;  3SAH A;  2HBM A;  4QJF B;  2DGZ A;  2RHF A;  2HBK A;  3CYM A;  4CGZ A;  2HBJ A;  4NLB A;  3SAG A;  1YT3 A;  2HBL A; 
#chains in the Genus database with same CATH topology
 4UAR A;  5AM2 A;  4RQ1 A;  2LHT A;  2BCR A;  2XY7 A;  1HUO A;  1NKE A;  4ECZ A;  3PV8 A;  5BPC A;  5IIN A;  1QSY A;  5ALU A;  5KFY A;  3RJE A;  3Q8R B;  3RJK A;  4USA A;  3OSP A;  2NRW A;  4CE6 A;  5KG2 A;  2K4E A;  2IOH A;  4EX7 A;  4BXO B;  3OTQ A;  1KTQ A;  4BWJ A;  2ZIW B;  1OXJ A;  2MUT B;  4UBC A;  5III A;  3PML A;  5J0R A;  4ZOH C;  5E79 U;  5CEH A;  4X5V A;  3TFR A;  4LZG A;  2UVW A;  1FFV A;  5DG8 A;  4IR1 A;  3ZI4 A;  3PO5 A;  4QWD A;  4EBE A;  4M9G A;  4NM2 A;  1U9L A;  5GTI U;  5KFC A;  4YG2 A;  1S9F A;  1K1S A;  2F1J A;  2E3T A;  2R18 A;  4QZB A;  4FBU A;  5L1K A;  3PST A;  4NM1 A;  4LJX A;  3MDA A;  2VA3 A;  3N28 A;  2R8K A;  5KG5 A;  2A1J A;  1CEZ A;  5L9X A;  3WK7 A;  1C7Y A;  4KLL A;  5F3X B;  2XCA A;  2Y9T A;  1ZQA A;  5J0U A;  4M6W A;  4CDG A;  4OJ5 A;  1ZQC A;  4TQS A;  9ICN A;  4ECU A;  4UQG A;  2LYH A;  1D8L A;  3IM1 A;  1J97 A;  3N7R C;  2ZIX A;  5KFZ A;  3KZI U;  1URJ A;  1D9F A;  2BPG A;  5ALZ A;  1PZN A;  1ZQU A;  3GU3 A;  2L5Y A;  4QZ9 A;  1Q46 A;  8ICT A;  3C5F A;  5KG1 A;  4RNM A;  3A0B U;  3C2K A;  2P66 A;  3MAB A;  1TVA A;  1N2X A;  1SB3 C;  4DS5 A;  5ALW A;  1QSS A;  5J29 A;  3HWT A;  4EEL A;  1TE2 A;  4UAY A;  2D3D A;  2JGA A;  2RDJ A;  3V7L A;  2PFP A;  2W11 A;  5EE9 A;  2W03 A;  2Q4T A;  3JPO A;  2H3Z A;  8ICE A;  5J2B A;  4AP9 A;  4ELT A;  2YQE A;  5KFU A;  1V38 A;  7ICQ A;  5A0L A;  2KSO B;  2YMM A;  1JRP A;  3QU5 A;  1FEZ A;  3KD3 A;  4I29 A;  9ICK A;  4KX3 A;  5KG0 A;  3ISB A;  1RQN A;  3SEI A;  2HHT A;  1F0M A;  1MC8 A;  3OJU A;  2ZTC A;  5BOM A;  1KEJ A;  4US9 A;  3IG8 A;  5KL1 B;  3IG5 A;  4IRD A;  3EW9 A;  2BQR A;  1LKY A;  3GIM A;  4F92 B;  3KHR A;  1NNL A;  5ALV A;  4F4Z A;  4KLF A;  1ZQR A;  3RBD A;  3Q8Q B;  3KHL A;  3JPS A;  7ICL A;  5KFN A;  3OHB A;  8ICO A;  3V72 A;  2LMR A;  5KFV A;  9ICL A;  5AKG A;  2DL0 A;  5DLG A;  3PX4 A;  4QJF B;  4ED6 A;  2A19 A;  4C0Z A;  3DEE A;  4J9K A;  2H3V A;  2BCS A;  1JRO A;  4F5Q A;  1TKD A;  3C2M A;  1SKS A;  1JIH A;  1Z4O A;  1A0P A;  2QB1 A;  3H4D A;  5AK6 A;  4BDP A;  4NLG A;  8ICR A;  3KKA C;  5EOZ A;  1BGX T;  2KOB A;  5DB8 A;  3M9N B;  3FM9 A;  4PHA A;  4DFD A;  3HIL A;  2WF7 A;  4RT2 A;  4QZE A;  2NV3 A;  4Y2S A;  3RJG A;  4C8N A;  3N97 B;  5L1I A;  4UAU A;  2WAQ C;  4NV0 A;  2M9N A;  3UQ2 A;  3N4M B;  1SWV A;  1KFS A;  2OWO A;  3WKA A;  3Q8P B;  5KFQ A;  2OHF A;  2AH5 A;  5HHH A;  3M6K A;  2ZIU B;  3HPO A;  3RB3 A;  4DWI A;  2W8L A;  2KIW A;  4Q8E A;  3LYS A;  1LV5 A;  4I2H A;  2CXY A;  4J9O A;  4KLJ A;  1L3S A;  5B5E U;  3V6K A;  9ICB A;  1IG6 A;  1KBU A;  3CP8 A;  4Y2P A;  4O3M A;  4WJ3 B;  3V6H A;  4UB1 A;  4CNQ A;  4QZH A;  2JMG A;  3KOO A;  4YQW A;  5J2E A;  1KSP A;  1ZQQ A;  2P6U A;  3JPP A;  4DF8 A;  5KFA A;  2HOQ A;  4I2B A;  1ZQJ A;  1WG8 A;  2JH7 A;  2PI5 A;  3PX0 A;  4RQ7 A;  1BPE A;  2JRZ A;  5ALP A;  5KFX A;  2ZG6 A;  2LBO A;  3KTQ A;  2OXO A;  3BS7 A;  4DL7 A;  4YFK A;  4YCX A;  5KFG A;  2I1Q A;  2JH1 A;  3SI8 A;  1CUK A;  3THV A;  1N48 A;  5KT3 A;  1RPL A;  1Q3U A;  2AGP A;  1JI7 A;  5KFI A;  5KFJ A;  5JU5 A;  4M9N A;  5IIM A;  4QZG A;  2EZZ A;  2HI0 A;  2KZZ A;  4P0Q A;  3PR4 A;  1Y88 A;  3IRU A;  1F5S A;  3BS5 A;  3H8J A;  4JV1 A;  1N62 A;  2BCQ A;  5F9L A;  4IL6 U;  5BOL A;  5EWG A;  2H3F A;  1MSW D;  1PK1 A;  1JN3 A;  5ALQ A;  3CNH A;  3S6J A;  1ED1 A;  4K4I A;  3RR8 A;  1QTM A;  3RBE A;  5AI5 A;  4DL4 A;  4J9R A;  5DB6 A;  4DLG A;  4CCH A;  2HOI A;  8ICJ A;  2KTQ A;  3AL0 B;  3IDW A;  4QW9 A;  4CF3 A;  2KZ3 A;  1ZQZ A;  3ALR A;  2AGQ A;  2ISP A;  3ZDA A;  1U45 A;  1ZQY A;  3Q8L A;  4BX9 C;  3C1Z A;  4RPX A;  9ICF A;  1NK9 A;  1LVH A;  1JAL A;  4I28 A;  4YMO A;  5DLF A;  4NLK A;  2EAN A;  2KE7 A;  2JR5 A;  4DFP A;  4UB2 A;  2PMZ F;  5AHX A;  4KLE A;  3KFU F;  3TAR A;  2W9M A;  5ALL A;  5KTQ A;  4FZM A;  2KKV A;  5ALG A;  5AKZ A;  1SZP A;  4TUQ A;  2W9B B;  2YMQ A;  1TAM A;  3WKC A;  1X6I A;  4UB5 A;  1VLB A;  2MA1 A;  5IIJ A;  2DFL A;  2DPJ A;  5KL8 B;  3AU6 A;  4DEZ A;  3PZP A;  4BXO A;  4KN7 A;  5AI9 A;  2ZIW A;  4A8E A;  4Q45 A;  4K4G A;  1FFU A;  2MUT A;  4B9L A;  2EQY A;  2Z7J A;  4R65 A;  5J0O A;  2JV3 A;  2Q0Z X;  4QIW F;  3AQF A;  4XUS A;  4IQU A;  1O08 A;  1WUD A;  1KKX A;  5AKY A;  3NRW A;  4Y2X A;  1RZT A;  2GO7 A;  4QZD A;  4Q43 A;  4LVS A;  1QQ7 A;  4C80 A;  1S5L U;  2FPK A;  2PXI A;  2W04 A;  8ICI A;  3CRX A;  2CRX A;  2HMX A;  4RQ2 A;  3BJY A;  3MFH A;  2YB1 A;  3OPX A;  4P4O A;  1PK3 A;  3T5J A;  4DS4 A;  1QH9 A;  2ES6 A;  1P7D A;  3M9O B;  2PFN A;  3ISD A;  3PSF A;  1ZQI A;  1X9X A;  3RRG A;  2HBM A;  2HHU A;  5KFH A;  1PVQ A;  3RF9 A;  4PHE A;  7ICK A;  3TAQ A;  2YMP A;  2G08 A;  4UB6 U;  3GII A;  3MGH A;  2ASJ A;  1UHU A;  3I28 A;  5J2C A;  4UB4 A;  4J9L A;  1V85 A;  2KJ8 A;  1ZQE A;  2DKX A;  3KBB A;  2EDU A;  1WWV A;  1S97 A;  2KFZ A;  3HKZ C;  4PZN A;  2KK0 A;  1PVP A;  5J0S A;  4DQP A;  1K5O A;  2MSN A;  4U6P A;  4DFM A;  2HHV A;  3FC4 A;  4RU9 A;  3ZDD A;  2XY5 A;  1UT8 A;  7ICI A;  2JEJ A;  1ZQW A;  4OO1 J;  3H0M B;  1XSP A;  2JXJ A;  2HDO A;  1Q3V A;  1S77 D;  5J8Y C;  1ZOL A;  4RT3 A;  3QUB A;  5ALH A;  2XGQ A;  3C5G A;  3QZ7 A;  9ICQ A;  5JRT A;  4YR3 A;  1TK0 A;  3WK6 A;  2Y1I A;  4RQM A;  5HR6 A;  2V4R A;  4ED3 A;  5KFT A;  1ZQK A;  1QQ5 A;  1KL9 A;  4B9N A;  4JV0 A;  2FDR A;  1NKC A;  2KVC A;  2CPR A;  1ZQM A;  3EPI A;  4FS1 A;  2GWS A;  3LDA A;  9ICT A;  4HYK A;  5JTI A;  2KIC A;  4RQN A;  4R66 A;  3H40 A;  1UPH A;  4KLH A;  4DSL A;  4UW9 A;  4ECW A;  4NXZ A;  7ICR A;  2IBK A;  5KAI U;  3FYH A;  4KMU A;  2NYV A;  2UVU A;  1VJ5 A;  4ECY A;  1ZQD A;  2BCU A;  1DGJ A;  5HMM A;  4O5C A;  5KFB A;  4NLN A;  4KLM A;  4NL9 A;  3UMB A;  4YD2 A;  5J0Q A;  4UB8 U;  1XSN A;  2NRZ A;  1HEK A;  1M6Y A;  3HP6 A;  9ICI A;  1NJY A;  1JUD A;  1ARO P;  2H3Q A;  3RJF A;  3G6Y A;  3D2S A;  3IHQ B;  5DG7 A;  3V7J A;  1HIW A;  5EE1 A;  1JX4 A;  1V9P A;  4O3P A;  7ICG A;  3BQ1 A;  4Q8F A;  1SV4 A;  5EE3 A;  4G3I A;  3QU4 A;  8ICS A;  2AQ0 A;  3HJE A;  4PPX A;  3NUQ A;  4F93 B;  4F5P A;  4M9L A;  2Y9U A;  1KN5 A;  4MF8 A;  4UBB A;  4J9N A;  2R8I A;  2KVS A;  1RQL A;  3WKD A;  2KNJ A;  2JZB B;  4IR9 A;  2F77 X;  4YXM A;  2IHN A;  4XQ8 A;  4I27 A;  4NJ8 A;  4YMN A;  2Y0S C;  5DGB A;  4Y2U A;  2NO5 A;  4QZA A;  3MC1 A;  3C2L A;  3QUC A;  2OH2 A;  2ZIU A;  2IOF K;  2R8J A;  3OHA A;  3T3F A;  3LVV A;  4OJP A;  3SAF A;  4QWA A;  4EBC A;  7ICE A;  4I2D A;  4FFD A;  3ETR A;  4RNO A;  4I2I A;  3ZDC A;  2OM6 A;  4DLE A;  2C2R A;  5G5H A;  1ZQT A;  2F3N A;  4IQW A;  1QSL A;  2RDI A;  4DL2 A;  1IM4 A;  1JMS A;  4XA5 A;  4GIB A;  2PFO A;  4I2F A;  3AQE A;  3BZK A;  4PH5 A;  4QWB A;  3C1Y A;  4DL5 A;  8ICH A;  4PHP A;  3RJJ A;  5ALJ A;  3GZF A;  1NJW A;  3RRH A;  4Y2T A;  5AI4 A;  4BUG A;  5J2G A;  4HAI A;  3CW2 C;  3NTU A;  3C28 A;  1T3Q A;  3T5L A;  1SGG A;  1U49 A;  5KFE A;  1X6J A;  4Y2Q A;  3RB6 A;  2F2A B;  2QB0 B;  4JMU A;  8ICM A;  1XWL A;  2F1H A;  2E8M A;  3KZX A;  4Y2J A;  1Z4N A;  2ZIV B;  5CHG A;  5AK5 A;  5KFW A;  1SV0 A;  3SEN A;  3HX0 A;  3PO4 A;  2ODG A;  2KHQ A;  5J2J A;  4P2H A;  4DL3 A;  3I1Y A;  5D4B A;  4KLO A;  2ZUD A;  1N63 A;  1SKW A;  1D8B A;  1GO3 F;  2G06 A;  3F2D A;  2XO7 A;  1ZQV A;  3UMG A;  4DQI A;  1KRP A;  2DF4 B;  1PUZ A;  7ICM A;  4YVZ A;  4F2S A;  3E2E A;  4RUA A;  3HRD D;  3MGI A;  4EEN A;  3M8S A;  5DBA A;  1H38 A;  1RM6 C;  1B22 A;  3BQ7 A;  3L4P A;  5AM5 A;  2EAP A;  3F5E A;  2XI9 A;  2PKE A;  5J2A A;  1DGS A;  3I76 A;  4RNN A;  1WWU A;  4RZR A;  5KT6 A;  5L1M A;  2I5H A;  3V6J A;  5ALK A;  3QEB Z;  4F4W A;  1BPY A;  3AEV A;  4RUC A;  3MR3 A;  3IV6 A;  5KFK A;  5C5J A;  2ZJ8 A;  5J2K A;  3PNC A;  3NS1 A;  3ORY A;  4F5O A;  3WK4 A;  1YZ6 A;  3SZ2 A;  4Y2R A;  4RQ6 A;  2LM4 A;  1NK5 A;  2I9G A;  2BGW A;  5DDM A;  5FP0 A;  4ECS A;  2A3V A;  2KKP A;  1L7O A;  5DQG A;  4M9H A;  2VIX A;  5ALY A;  4F8R A;  2FE9 A;  3SMV A;  2W9B A;  2WTF A;  1U4B A;  4EEK A;  2W8K A;  1SL2 A;  4NWI A;  2HHQ A;  4GFJ A;  5KFM A;  2HBL A;  1S0M A;  1BPB A;  4YR0 A;  4B6J A;  3H0L B;  5F9N A;  1ZYQ A;  2IHM A;  1XC9 A;  4P4M A;  4I2E A;  3K1R B;  4KLD A;  5DGA A;  2KV2 A;  5KFP A;  2WAQ F;  4US8 A;  3PSI A;  5AK4 A;  4ED1 A;  2F76 X;  4DFJ A;  1RYR A;  1ZD2 P;  4M04 A;  2KP7 A;  5HHI A;  2YY6 A;  1PVR A;  2H5X A;  9ICR A;  3TAD A;  5B66 U;  3QEA Z;  5ALD A;  4RQ8 A;  2C22 A;  3GDX A;  1Q8K A;  4J9Q A;  4GC7 A;  2C2E A;  1N61 A;  3RR7 A;  3PX6 A;  1KLN A;  2YTU A;  5AKH A;  2FJ6 A;  1X9M A;  3KHG A;  3NGD A;  4OJ6 A;  3AU2 A;  1BPZ A;  3BQT A;  3ETL A;  1UA1 A;  3QNM A;  9ICE A;  3A0H U;  2ZUC A;  2F8L A;  2FLN A;  2FMS A;  4F91 B;  2I6X A;  4ED2 A;  5H2F U;  5KFL A;  1ZQH A;  1HJP A;  5GTH U;  1ZQB A;  4C8K A;  2WB1 C;  3UQ0 A;  5KFR A;  3ZD9 A;  1U47 A;  2G09 A;  1QLN A;  2W43 A;  3NVY A;  2EAO A;  2KJ9 A;  1Z19 A;  2RLT A;  1A77 A;  2RRD A;  1BPX A;  3G6X A;  7ICF A;  4BJQ A;  8ICC A;  5CR0 A;  2DQN B;  8ICB A;  2HVI A;  4C4T A;  5AKE A;  4CGZ A;  3SD7 A;  4RQ4 A;  2YB4 A;  1X42 A;  2E8P A;  5KG3 A;  3H0R B;  3ICX A;  2EZY A;  2ZXI A;  3C29 A;  1TAQ A;  1F44 A;  5AKL A;  4ED8 A;  2BDU A;  3TFS A;  1DK2 A;  1X2I A;  1EXN A;  2O6K A;  1COO A;  4KLI A;  4B9U A;  1L8L A;  1IIP A;  9ICP A;  3JPQ A;  1J2M A;  4M2Y A;  4UAV A;  4NLB A;  5AKX A;  1JXL A;  1N60 A;  5J8Y A;  4CF5 A;  3E58 A;  4MFF A;  5ALM A;  5J2I A;  4IRK A;  2E1F A;  4EZ6 A;  8ICQ A;  3J81 j;  1QCK A;  2GLE A;  3PW5 A;  1T94 A;  2LYB A;  2NRV A;  3BQ0 A;  5AIB A;  4EEY A;  2IMW P;  4OJO A;  2UVR A;  5KFO A;  2F8K A;  4JB3 A;  1B4F A;  5DG9 A;  1S0O A;  4CF4 A;  3M1Y A;  5CP2 A;  4O3N A;  2N1R A;  5ALI A;  3RJH A;  2BPF A;  3TKA A;  2ALZ A;  4F4Y A;  4F4K A;  9ICG A;  3F5A A;  2FLL A;  4QW8 A;  2E8O A;  2ZUB A;  3GIK A;  2W7P A;  3UXP A;  5AM3 A;  5DQH A;  5EE0 A;  4I2J A;  4AYB C;  1MQ3 A;  4BWM A;  1S76 D;  2A1A A;  3JPT A;  5AI0 A;  5DKW A;  4RQ3 A;  5KG6 A;  2KMD A;  1FO4 A;  7ICS A;  2DWQ A;  2W9C B;  5CJ7 A;  1RYU A;  2AXT U;  4NY8 A;  5ALE A;  4QIW C;  3N7P D;  4OCZ A;  5T14 A;  4DQS A;  3DDH A;  2BCV A;  1VDV A;  1RDF A;  3R9K A;  3QYP A;  2JZB A;  4QZF A;  1J2N A;  1X9W A;  3WK8 A;  2R8G A;  4JWN A;  2JHD A;  4FBT A;  3T5K A;  2XID A;  3LVW A;  3QUT A;  3T5H A;  5CB1 A;  4GLX A;  2XC9 A;  2JEI A;  4IRC A;  2XVT A;  4DQQ A;  4O3Q A;  1OUQ A;  1NI3 A;  3DV9 A;  5KFS A;  1RXV A;  1BNP A;  2DKZ A;  1TK8 A;  3B0Y A;  2NRT A;  5D49 A;  2ASL A;  4Y2Y A;  1NOM A;  1WCN A;  1D9D A;  5EWF A;  2FI1 A;  4PZO A;  1X9S A;  2DBY A;  1YT3 A;  4DSI A;  2BQ3 A;  4DSF A;  3RH4 A;  2C2D A;  3HKZ F;  2ASD A;  4R8U B;  2W3S A;  3ONN A;  2FMP A;  4C8O A;  5TZV A;  5J2F A;  5IIL A;  1DRG A;  2XGP A;  4I2A A;  1ZQP A;  2KG5 A;  4MHV A;  2HOF A;  1ZRN A;  2EAM A;  5J2H A;  1SWW A;  2JEF A;  2W7O A;  3F2C A;  8ICG A;  2QB0 A;  2QKQ A;  4C8M A;  4QZC A;  3MFI A;  1NK6 A;  3H7I A;  2ZIV A;  2DPI A;  4KN4 A;  2KSO A;  2J6U A;  3WK9 A;  4DL6 A;  4MFC A;  3WU2 U;  5CWR A;  1Z00 B;  5AI6 A;  2NO4 A;  1ZRM A;  2DGZ A;  2RHF A;  2G5I B;  2OEH A;  2HBK A;  3WKB A;  1NKB A;  2HHS A;  1TK5 A;  3EZ5 A;  2EZX A;  4PL1 A;  5KFF A;  2ATL A;  2ESE A;  2K60 A;  1T8E A;  4Z6E A;  2WFA A;  2HCF A;  2C28 A;  2K4H A;  3TI0 A;  1NK7 A;  3IP4 B;  8ICK A;  3SV3 A;  1MA7 A;  3MGV A;  4O0I A;  4O9M A;  3RTV A;  2F44 A;  4YN4 A;  3VC8 A;  5J0T A;  4FS2 A;  1TAU A;  7ICH A;  4KX5 A;  3GV5 B;  3RB0 A;  3GFK B;  3PSP A;  1MQ2 A;  1XSL A;  2BPC A;  2B21 A;  1O03 A;  3RAQ A;  3GQC A;  3ISC A;  1RXW A;  3RAX A;  8ICF A;  1ZQF A;  3CYM A;  2XCP A;  3D6J A;  3QXG A;  1ZD4 A;  8ICV A;  3ZD8 A;  2GH1 A;  2FMQ A;  3V7K A;  2KD1 A;  4C7Y A;  1L6N A;  5J0P A;  5J0X A;  4C8L A;  3UM9 A;  2XY6 A;  1FIQ A;  3AMZ A;  4M0A A;  9ICJ A;  2P6R A;  1KQQ A;  5DDY A;  4O3R A;  4UAZ A;  3T79 A;  2G0A A;  4U7C A;  1WCL A;  1ZD5 A;  9ICW A;  1HUZ A;  4TUP A;  2LM1 A;  5ALN A;  4ECX A;  4XRH A;  4QWE A;  4LZD A;  2G5H B;  3KKA A;  3JPR A;  3NVW A;  4ZH4 A;  2Y0S F;  4DOC A;  2KFN A;  3ZDE A;  1L3U A;  1BVS A;  1L3T A;  1OW5 A;  2QLT A;  2M0N A;  4F2R A;  3NVZ A;  3PW4 A;  3HW8 A;  3PMN A;  8ICN A;  4DOB A;  4DOA A;  3TQ1 A;  8ICA A;  2OCE A;  2J6T A;  1B0X A;  2CN1 A;  5AKI A;  2PFQ A;  4J9M A;  5C0Y A;  8ICP A;  3SV4 A;  1S10 A;  3NAS A;  3EUB 2;  5K4L A;  3UPQ A;  5KT5 A;  9ICU A;  4PGQ A;  1N5X A;  1BNO A;  9ICH A;  1SIJ A;  4RQ0 A;  3D2Q A;  4YD1 A;  4JV2 A;  4PL2 A;  4IQV A;  4KIT B;  5CRX A;  1ZQN A;  8ICW A;  1RYS A;  4QWC A;  4KLU A;  4CRX A;  1XS9 D;  5DBC A;  4FZN A;  2E5S A;  4O5E A;  4KMO B;  4DCC A;  5ALS A;  1CI4 A;  3RJI A;  4PJ0 U;  4ECQ A;  1QQ6 A;  4PGY A;  2WF6 A;  2Y1J A;  5IIK A;  4NLC A;  1LB2 B;  3VCB A;  9ICC A;  4MEX A;  1ZQG A;  4DSK A;  2QAR B;  2VAN A;  5DQI A;  3UXN A;  2K8C B;  9ICM A;  1B43 A;  1L7N A;  5KT2 A;  2HVH A;  2BR0 A;  3H8M A;  2W9A A;  4P0P B;  4MFA A;  4NLZ A;  2KHV A;  1TV9 A;  4ECT A;  4DSE A;  5KT7 A;  2OYY A;  5HML A;  4ELU A;  4C4S A;  1XO0 A;  1IXR A;  4NL9 C;  1SXE A;  3EPG A;  7ICO A;  1AQ6 A;  3IN5 A;  2E1E A;  4M47 A;  1NK0 A;  1N5W A;  3LK9 A;  1DOQ A;  3WK5 A;  3PY8 A;  3QE9 Y;  2YML A;  1X66 A;  4ELV A;  4JK1 A;  1NJZ A;  4Z6D A;  7ICV A;  1SKR A;  3MDC A;  1DK3 A;  3L3F X;  3BQ2 A;  2MAX A;  2HHW A;  5DBB A;  5KG4 A;  2B0C A;  4J9S A;  2WHE A;  1UA0 A;  2VKQ A;  4YP3 A;  4PHD A;  4EBD A;  4F50 A;  3FAH A;  2ZJ5 A;  2ZTE A;  4IQT A;  1ZD3 A;  1KFD A;  4K4H A;  2K4P A;  2GOL A;  3PW2 A;  5HNK A;  1NK8 A;  5ALR A;  3F53 A;  2HHX A;  2YX8 A;  2D8C A;  1ZQO A;  3Q8S B;  4MF2 A;  5EWE A;  5HP4 A;  4ECV A;  3SAG A;  2AJQ A;  2W9C A;  3K4G A;  2RP5 A;  1ZJM A;  3RFA A;  1T4G A;  1V97 A;  3FDS A;  5HR7 A;  2A1J B;  2LPE A;  1XU4 A;  4EX6 A;  1KFT A;  4R63 A;  3M8R A;  3SQI A;  4C4R A;  3JPN A;  5AM1 A;  2V9W A;  3PR5 B;  4M6W B;  3M9M B;  1COK A;  2WF5 A;  2KZM A;  4C7Z A;  3E0F A;  4KLQ A;  3F2B A;  3H8W A;  1A6S A;  4UAS A;  1NJX A;  3QX7 A;  3EWA A;  1NZP A;  1WYG A;  1UCV A;  5KAF U;  2KIV A;  2ZIX B;  1D8Y A;  2W55 A;  5ALX A;  2MRL A;  3U26 A;  2K89 A;  4B9S A;  5ALO A;  2G07 A;  1N56 A;  4ACO A;  1T7P A;  4I2G A;  2WF9 A;  4EYH B;  1SXD A;  1DXS A;  2FPM A;  1SZH A;  7ICN A;  5L1L A;  2BQU A;  4ED7 A;  3NVV A;  1NZB A;  1SV0 C;  2WB1 F;  5KFD A;  4FZL A;  3K1Z A;  4F5R A;  4B9T A;  2LYA A;  2XIC A;  1A76 A;  1S0N A;  2KN7 A;  9ICV A;  4P4P A;  2NRX A;  3NRZ A;  1U48 A;  3UXO A;  4JWM A;  2WF8 A;  2AQ4 A;  4R8U A;  2BZF A;  4J03 A;  9ICX A;  5KNI A;  3GIJ A;  4YMM A;  1NK4 A;  2E8N A;  1L3V A;  3MBY A;  2H3I A;  4PGX A;  3EYZ A;  3BZC A;  4B9M A;  4E0D A;  4TUR A;  5KT4 A;  4EZ9 A;  3OJS A;  1S0V A;  1IV8 A;  9ICO A;  4TUS A;  1Z1V A;  5AKJ A;  3WKE A;  4UB3 A;  3SR6 A;  3QU7 A;  4UAW A;  4OD0 A;  4GXI A;  1Z00 A;  3LWL A;  3KHH A;  1LKY B;  3PVX A;  4GXK A;  3AN1 A;  2VJ4 A;  3K75 D;  1UT5 A;  3QZ8 A;  3M7D A;  1XNS A;  2AHO B;  4F4X A;  5AK3 A;  3GV8 B;  3AM9 A;  4F5N A;  2BKE A;  4Z6F A;  1KW4 A;  1ZQS A;  2V4Q A;  1T3N A;  4OJL A;  2FPL A;  4RPY A;  2EH9 A;  4DQR A;  2R8H A;  2PMZ C;  2HW3 A;  2W54 A;  2HBJ A;  4GC6 A;  4TQR A;  5KG7 A;  1JXE A;  9ICA A;  2FLP A;  2UVV A;  3MR5 A;  7ICJ A;  3ZDB A;  2BHN A;  1Z3E B;  3AUO A;  2D6F C;  2W3R A;  5TIS U;  5L1J A;  3BDP A;  2ZTD A;  1SL0 A;  1XO1 A;  1UQV A;  2BDP A;  1ZQX A;  8ICX A;  5J0W A;  3GV7 B;  3H8S A;  3PW0 A;  5JUM A;  2IA6 A;  2PI4 A;  3N7S C;  5ALF A;  3Q8K A;  2KJ5 A;  3UMC A;  5D46 A;  2K8B B;  1BPD A;  4Y2V A;  1RG6 A;  5AKK A;  4AYB F;  3HT3 A;  1KDH A;  4QZ8 A;  4DSJ A;  4ED0 A;  3RB4 A;  3TAD C;  1SL1 A;  4YR2 A;  3GIL A;  2J6S A;  4Q44 A;  7ICP A;  3SYZ A;  2DUY A;  4F71 A;  1L7M A;  4BGD A;  3RH6 A;  1ZQL A;  4EYI B;  2JEG A;  3QU9 A;  4JUZ A;  4KTQ A;  8ICY A;  1ZJN A;  4IC9 A;  5J2D A;  4O5K A;  1S8O A;  4IS7 A;  3M6Z A;  3MR2 A;  3B9J A;  4RQ5 A;  2YN4 A;  5DB7 A;  4DFK A;  2VA2 A;  2F1I A;  3B0X A;  5AI8 A;  3Q8M A;  3OSN A;  1K1Q A;  1MN8 A;  2ISO A;  3SAH A;  3D2N A;  3LWM A;  4QZI A;  4M9J A;  4KLS A;  1L7P A;  2ZXH A;  4DO9 A;  4FO6 A;  4ECR A;  4MEY A;  5CA7 A;  3RH5 A;  5IIO A;  2AU0 A;  4Z6C A;  4FE3 A;  1ZET A;  4UAT A;  2K8A A;  2IOF A;  2RQ5 A;  1L5U A;  9ICS A;  1CRX A;  5AM4 A;  4P0Q B;  1Z1B A;  4O3S A;  1TFR A;  7ICT A;  4G9B A;  3BS5 B;  4R64 A;  2VA8 A;  1YZ7 A;  1C20 A;  5ALT A;  1L8O A;  1X40 A;  4I2C A;  3OGU A;  1PK1 B;  4DF4 A;  2KEY A;  3G6V A;  3MR6 A;  2ZJA A;  4RPZ A;  4F3O A;  3PW7 A;  3C21 A;  3H4B A;  2LKY A;  5DB9 A;  4KLT A;  4ICA A;  3QUQ A;  2P35 A;  3L5K A;  5J0Y A;  2QAR A;  4YXJ A;  4B9V A;  7ICU A;  5AM0 A;  4O3O A;  3TAN A;  4P0P A;  4KLG A;  1ZQ1 C;  4J9P A;  1ZXI A;  2VJ5 A;  3ED5 A;  3TAP A;  2MU2 A;  4QNL A;  2K4I A;  1ECW A;  2HSZ A;  4F72 A;  8ICU A;  8ICL A;  2AGO A;  3C23 A;  2B6G A;  3QU2 A;  5AIA A;  3O0F A;  8ICZ A;  5AIC A;  2LI6 A;  3TAC B;  5G5G A;  4GXJ A; 
#chains in the Genus database with same CATH homology
 2F8L A;  1A0P A;  3RFA A;  2LHT A;  3HKZ F;  4NLC A;  4QIW F;  5HR7 A;  2GH1 A;  3F5E A;  3AQF A;  2XI9 A;  2VJ4 A;  3GU3 A;  2ZIU A;  2KVC A;  2KD1 A;  2CPR A;  2N1R A;  1L6N A;  3M7D A;  1XNS A;  3SQI A;  1WUD A;  3ONN A;  3NRW A;  2K8C B;  2Z7J A;  3LVV A;  3F5A A;  1DRG A;  4OJP A;  3SAF A;  3SAH A;  2WB1 C;  2H3F A;  2W04 A;  3D2N A;  2KOB A;  2HOF A;  2KIC A;  4P0P B;  2W7P A;  1UPH A;  2KHV A;  3T79 A;  2G0A A;  1ED1 A;  2NV3 A;  2ZXH A;  3E0F A;  4U7C A;  3F2B A;  2CRX A;  3CRX A;  2HMX A;  2OYY A;  2W7O A;  3F2C A;  1A6S A;  4OJL A;  4AYB C;  2YB1 A;  2PMZ C;  2G09 A;  1XO0 A;  2HBJ A;  3OPX A;  2G5H B;  2OM6 A;  2WAQ C;  2JGA A;  2HOI A;  2ZIV A;  3IN5 A;  2K4E A;  2E1E A;  4FE3 A;  4NV0 A;  2ZIX B;  3AL0 B;  2K8A A;  2MRL A;  2Q4T A;  2W03 A;  2Y0S F;  2ZIW B;  2K89 A;  1P7D A;  2D6F C;  3ALR A;  2H3Z A;  2G07 A;  2KKP A;  1CRX A;  2KJ9 A;  4ACO A;  2A3V A;  3AQE A;  1Z19 A;  3PSF A;  4BX9 C;  4P0Q B;  2M0N A;  2RRD A;  1Z1B A;  2HBM A;  5A0L A;  2VIX A;  4BJQ A;  4QIW C;  2DGZ A;  3M6K A;  3N7P D;  1SZH A;  3SMV A;  2RHF A;  2G5I B;  2DQN B;  5T14 A;  2ZIU B;  1PVQ A;  3GZF A;  2HBK A;  3N7S C;  1HEK A;  3RF9 A;  2KIW A;  4BUG A;  4CGZ A;  3LYS A;  4NWI A;  1NZB A;  3L3F X;  4GFJ A;  4PL1 A;  3C28 A;  2YB4 A;  2H3Q A;  4KX3 A;  2KJ5 A;  2HBL A;  2G08 A;  3H0R B;  3ICX A;  2CN1 A;  2WB1 F;  3H0L B;  2K8B B;  4FZL A;  2KEY A;  3D2S A;  5C0Y A;  3K1Z A;  2ZXI A;  2JHD A;  1HIW A;  2F2A B;  3VCB A;  4JMU A;  2KJ8 A;  2LYA A;  3C29 A;  2XIC A;  2R18 A;  1KBU A;  2K4H A;  3CP8 A;  4O3M A;  4AYB F;  4WJ3 B;  3PST A;  1F44 A;  2PMZ F;  2KV2 A;  3IP4 B;  3KZX A;  2BDU A;  2XID A;  3LVW A;  2JMG A;  2ZIV B;  2WAQ F;  3MGV A;  2VKQ A;  3IG8 A;  1MA7 A;  3HKZ C;  5KL1 B;  3IG5 A;  3KFU F;  3PSI A;  2KHQ A;  2LKY A;  2HOQ A;  2F76 X;  1PVP A;  4ICA A;  2XVT A;  2JH7 A;  1IIP A;  4FZM A;  3NUQ A;  1OUQ A;  3VC8 A;  4U6P A;  3D2Q A;  4NLB A;  4PL2 A;  4KX5 A;  2KKV A;  1PVR A;  2ZG6 A;  5CRX A;  2LBO A;  1TAM A;  3PSP A;  4P0P A;  1D8B A;  1GO3 F;  2OXO A;  2MA1 A;  2G06 A;  2GOL A;  1ZQ1 C;  2JH1 A;  2E1F A;  4OJ5 A;  4CDG A;  2KNJ A;  2VJ5 A;  3F2D A;  4CRX A;  4OO1 J;  3H0M B;  2H3I A;  4FZN A;  2E5S A;  4QNL A;  4KMO B;  3F53 A;  2DF4 B;  5KL8 B;  1Q3U A;  1Q3V A;  1ECW A;  2F77 X;  2K4I A;  2OH2 A;  4IC9 A;  4QJF B;  3PZP A;  2YX8 A;  4C0Z A;  3DEE A;  1T94 A;  2H3V A;  2LYB A;  2Y0S C;  2ZIX A;  3N7R C;  3CYM A;  4OJ6 A;  2ZIW A;  4A8E A;  3O0F A;  1URJ A;  3M6Z A;  3SAG A;  4OJO A;  1YT3 A;  2RP5 A;  5HR6 A;  4P0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...