2E1EA

Crystal structure of the hrdc domain of human werner syndrome protein, wrn
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
94
structure length
94
Chain Sequence
QPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKRIDGVSEGKAAMLAPLLEVIKHFCQTNSVQTDLFSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Werner syndrome ATP-dependent helicase
publication title Crystal structure of the HRDC domain of human Werner syndrome protein, WRN
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 33
structure length 94
sequence length 94
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2e1eA01
1D8BA 1WUDA 2KV2A 1GO3F 4QIWF 4CGZA 1YT3A 2RHFA 4NLBA 2E1FA 4OO1J 2E1EA 2HBJA 4CDGA 4NLCA 2RRDA 3SAFA 2HBMA 3SAGA 4O3MA 5C0YA 3SAHA 4QJFB 2HBLA 2CPRA 2HBKA 2MA1A 3CYMA 2DGZA
chains in the Genus database with same CATH superfamily
1ZQRA 1TVAA 1RG6A 3K4GA 4F5RA 4DSIA 1PK3A 2RHFA 4M9HA 2EZZA 2P6RA 2BKEA 2E1EA 2KKVA 1F0MA 1SL1A 2KICA 4FBTA 1BPXA 5ALIA 2UVUA 5KFQA 2XY6A 1XSLA 5ALKA 3DV9A 3ZDEA 3RB0A 4Y2PA 2BQUA 2MRLA 2IOHA 3Q8SB 7ICEA 3D2QA 3IP4B 4KLOA 4DLGA 1L6NA 4C8OA 3V7KA 1Z4OA 2VJ5A 7ICLA 1MQ3A 4J9RA 3SR6A 1SWVA 2Y9TA 4YXJA 4IS7A 1JXLA 4YP3A 2OHFA 3QUCA 4QZFA 3GIMA 2XCAA 1A77A 1TV9A 2QB0A 5ALGA 3T3FA 4XQ8A 2K8BB 2GOLA 1IIPA 4Y2QA 4DSLA 3RH4A 2RDJA 5FP0A 4RT3A 4RNOA 3H8SA 4PZOA 1K1SA 3NVYA 5J2KA 4R66A 4ECTA 2AQ0A 3TACB 3H4DA 4DQRA 2OXOA 4CDGA 2KOBA 1LV5A 2ISPA 1ZETA 2WF9A 5KFWA 1ZQQA 4P0QA 3PSFA 3OSNA 5L1MA 4AYBF 3RBEA 4QZ8A 1PVQA 2I9GA 4M47A 2F1HA 1ZQGA 1MSWD 2E1FA 4KLJA 3GV8B 4MF2A 2G5HB 4NY8A 3LVVA 4I2BA 3RFAA 2QB0B 3PX6A 4LVSA 3AQEA 5AICA 4F91B 2AGPA 2Z7JA 8ICMA 4DOAA 4R63A 7ICQA 4RPYA 1L7NA 4UB5A 2VJ4A 2NO4A 4MEYA 3E2EA 2BPFA 4U6PA 3PW5A 4C4TA 1TFRA 1SZHA 9ICBA 3AL0B 4C8NA 2F1JA 3QU4A 4B9TA 4I2AA 3TKAA 1S8OA 4I2IA 2YN4A 5KAIU 1ZJMA 2P6UA 1ZQXA 4GXJA 4EBDA 5J0UA 4KLQA 4P0QB 2BCRA 7ICKA 3MGHA 4BJQA 4F4KA 1COKA 5KFYA 3KD3A 3V6KA 1TK5A 5AM3A 5HMLA 4GXKA 3RTVA 4NJ8A 3JPQA 1B4FA 4JWNA 3ZDCA 1KSPA 1X9WA 5CWRA 4ED0A 3SAHA 1S0OA 5TZVA 5CHGA 4Z6EA 1RXWA 5AK4A 4F50A 4ED3A 4OJLA 4EBCA 2PFOA 5KFOA 4KLHA 5HNKA 2E8MA 5KFSA 2WB1C 4QZEA 4DFMA 4CNQA 2ZXIA 5AI0A 3PO4A 1JIHA 2C22A 4I2JA 3FYHA 3RJJA 2NRTA 7ICUA 5F9NA 5J0PA 3EPGA 3THVA 5KFKA 2YTUA 4CF4A 5DGBA 1WWUA 2L5YA 3BQ1A 4I2FA 4YMNA 1Q8KA 5DKWA 5AM2A 1Z1VA 1N56A 4NL9C 3DEEA 4F93B 3T5HA 3HRDD 1L3SA 5KG5A 4CGZA 1SL2A 3C29A 4DWIA 9ICOA 2WHEA 5L1LA 4ED7A 5IIOA 1UT8A 3MR3A 4NWIA 1ZQZA 4F71A 3M9NB 1VDVA 4QW8A 5J29A 2BQ3A 1KQQA 5ALHA 5ALSA 2OH2A 5KFAA 1B0XA 4UBCA 4X5VA 4QWCA 2XC9A 5ALYA 1SV4A 4O3NA 4O3MA 3C5GA 3WK6A 2KHVA 2Q0ZX 3SI8A 5CP2A 4M9LA 3F5EA 8ICAA 5KFHA 4M9NA 4Y2XA 5KL8B 5DB8A 1S97A 1L3UA 2F44A 2KE7A 1COOA 5IIKA 3ZDDA 3KBBA 4KTQA 3KHHA 3PR4A 1NZPA 3WU2U 3OJUA 3PZPA 1SXEA 3SENA 1RZTA 2HVIA 3RJFA 2HOFA 3PSPA 4B9LA 4QWBA 4YVZA 2RLTA 2JV3A 1ZQLA 4K4IA 5F3XB 3MBYA 5KFGA 1XNSA 4F2RA 1N5WA 7ICJA 4HYKA 2VKQA 4RNMA 5J0WA 1JN3A 5DBCA 2H3IA 2KN7A 5DB7A 3C28A 4ELVA 4Y2SA 2DL0A 4EBEA 3PVXA 2K4EA 1Y88A 3V7LA 1Z4NA 9ICSA 4NXZA 3RB4A 2ES6A 1ZQIA 3M9OB 2F1IA 4DSFA 1ZQJA 3K1RB 4QZIA 5DDMA 2CXYA 1FO4A 4ED6A 5GTIU 5KG2A 4IR1A 3I76A 3I1YA 3WKBA 7ICVA 3RJKA 3NRZA 4C4SA 2A3VA 1SV0C 9ICIA 4Z6FA 2EZYA 3IG5A 5KFRA 2K4HA 1BNOA 3H0LB 2K89A 4NM2A 5G5HA 3N28A 2R8HA 4DF8A 8ICYA 2QARA 3UM9A 2NRXA 2HHXA 4US8A 1JROA 2DWQA 1O03A 3C21A 5ALXA 5J0RA 2HHTA 5KT4A 2ZJAA 4RQ0A 2BPGA 7ICFA 4RUCA 1QTMA 1S10A 1L5UA 3ALRA 2WTFA 5AKEA 3QNMA 2FMPA 1UCVA 1ZQUA 1KLNA 3QUTA 3IG8A 2ZUBA 3GIJA 1MQ2A 3F2CA 3Q8KA 4LZDA 3KHGA 4C7ZA 3G6VA 1ZQTA 1S0NA 4UATA 9ICAA 3BJYA 3KZXA 4XUSA 3QZ7A 3H40A 3EZ5A 4K4HA 4O9MA 4TUSA 2J6UA 1V97A 2ODGA 3M9MB 2ISOA 5CRXA 2H5XA 3HT3A 8ICEA 2QARB 1UHUA 4TQRA 3EPIA 2UVRA 4P4OA 8ICVA 5DQGA 2DFLA 1WCNA 2FLPA 2K60A 4MHVA 4ECXA 1PVPA 2YY6A 8ICIA 1MA7A 2ZXHA 3C5FA 3M6ZA 5KL1B 3NVVA 2KKPA 4ECZA 3BQTA 8ICTA 4KN4A 1ZQAA 4O5EA 1SKRA 5J2CA 4CF5A 1KN5A 1FFUA 1NJXA 2XY7A 1XWLA 5EE0A 3HPOA 3HKZC 4RQ7A 2BCUA 8ICSA 4DEZA 4FBUA 2AQ4A 2W7PA 5AI6A 5BPCA 2DQNB 1NK9A 3J81j 2FPKA 5DLFA 4ACOA 4LZGA 3WKEA 2XIDA 2KVCA 2K8AA 3PW4A 2YB1A 4BGDA 5AKIA 5AM4A 3AUOA 5C5JA 3H0MB 2AJQA 4F5OA 4YD1A 3M8RA 3GIKA 1NJZA 3FM9A 3NTUA 2KHQA 5KG7A 3IHQB 1OW5A 3U26A 1U49A 2XVTA 1J2MA 5AK5A 2DKXA 2QB1A 5AI4A 2GO7A 4QZ9A 3ICXA 1NI3A 3RJEA 4UB6U 3M7DA 5J2GA 5DQHA 3TAQA 3OGUA 5KG4A 2HHSA 8ICOA 2N1RA 3WK8A 2JEJA 4KMUA 4EELA 9ICKA 3L3FX 8ICJA 3Q8PB 7ICRA 4UAZA 4TUPA 3WKAA 4DL2A 3CNHA 1M6YA 5ALFA 3Q8QB 4QWEA 8ICNA 1F44A 2F77X 2KD1A 3FDSA 1RDFA 2QLTA 1V38A 5AM1A 4WJ3B 2B21A 3BQ0A 2ZTCA 3QUBA 4Z6CA 2XCPA 4BX9C 4F92B 4Z6DA 4J9SA 4B9SA 4USAA 3OJSA 1ZQEA 4DSEA 2OCEA 5K4LA 4FZMA 4CRXA 2MU2A 5KFBA 1BPYA 2Y1IA 2GH1A 1HJPA 2HOQA 3IRUA 2G07A 3I28A 4NV0A 2ZJ5A 4NLKA 2FI1A 4DS5A 2OYYA 2MAXA 2HHVA 1X2IA 5KFNA 2JRZA 5ALDA 1C7YA 1S0MA 4I2EA 3EYZA 2LM4A 4KMOB 2J6TA 2XGQA 3H8MA 3SYZA 3QEAZ 5J2JA 3HWTA 3NS1A 4YR0A 4ED2A 3TADC 1TAUA 1IG6A 2H3FA 1ZQNA 4I28A 4KLDA 2NRVA 5DBBA 2D6FC 2E5SA 2ZIVA 4C7YA 2XY5A 4P2HA 1P7DA 4B9MA 2JGAA 3KKAC 3UXPA 2LYBA 4AP9A 4JB3A 3L4PA 5IIIA 4IR9A 3UMGA 1A76A 1DGSA 1D8LA 2Y0SC 4GIBA 1AROP 4IC9A 3PR5B 5AIBA 1D9DA 1ZQWA 2XICA 5KT3A 3MGIA 2BPCA 2W04A 2W9BA 2HHUA 4B9NA 5AKLA 2HCFA 4PL2A 4BWMA 2HOIA 2D8CA 2C28A 1X66A 2W43A 2H3VA 1NKEA 2F2AB 2CN1A 1ZQCA 1HUOA 5KG0A 4CE6A 3M6KA 2ZIVB 5DG7A 2BQRA 1UT5A 5IILA 1L8LA 1ZRNA 2AGOA 3AMZA 3GU3A 4KLGA 4GC6A 5AK6A 3QZ8A 5KFCA 3V7JA 1QSSA 5KG3A 3RJIA 7ICPA 2AU0A 4P0PA 3PW2A 1K1QA 3N7RC 4QIWF 1RYSA 4U7CA 3PO5A 4F5NA 5J2DA 4DL5A 3HX0A 4NLCA 2W9BB 5JTIA 1LVHA 4NLZA 3MDCA 4DOCA 3IN5A 3C2KA 4ECVA 4JUZA 3M8SA 3PX0A 3RF9A 1KDHA 3HILA 1SKSA 2JH7A 2DF4B 2GWSA 3QYPA 5ALWA 3AM9A 2PMZF 1MN8A 2PI4A 2ZIWA 1KFDA 5KFEA 4EYIB 2R18A 4YCXA 1X9MA 5J0QA 5AKJA 5KTQA 4KX3A 3PY8A 3IM1A 3MFIA 4M04A 2LMRA 3KZIU 3O0FA 3L5KA 5EE3A 4P0PB 3F2BA 7ICGA 4AYBC 5KFZA 2HI0A 1FIQA 4DFPA 1IM4A 1JUDA 2IBKA 2HBMA 1RM6C 4QZBA 5AKGA 3KFUF 2CRXA 2UVVA 2ASDA 1A6SA 5J2AA 1RYRA 4ZH4A 4C4RA 1Z00A 5IIJA 1ZD5A 5EWGA 1UA0A 2IHMA 4J9LA 2ZIWB 2PKEA 3NVZA 3TANA 2YMQA 3UXNA 1X42A 2B6GA 4UASA 4BXOA 3GV5B 2QKQA 5C0YA 4KLEA 2BDUA 4NLNA 1Q46A 5DG8A 5CA7A 5L1KA 1N62A 1NOMA 2MA1A 5H2FU 3B0YA 3RR7A 4BDPA 4ECQA 1ECWA 2PFQA 1L7OA 5DB6A 3NRWA 4FFDA 1FEZA 4PHPA 4ICAA 1LKYA 4KLUA 4NLBA 4RZRA 4DSKA 4PGXA 4GLXA 2DPJA 1PUZA 4A8EA 2DPIA 2PFPA 5DGAA 4KX5A 2EZXA 2KG5A 4ED1A 4DF4A 2IHNA 4OJOA 2HDOA 1PZNA 1PVRA 4BWJA 1NKBA 3JPNA 5AKZA 1Z00B 2W8LA 1T4GA 3LYSA 2W7OA 1WUDA 5J2FA 1AQ6A 1NK7A 2IOFK 3WK4A 2AGQA 4O0IA 1XS9D 9ICQA 4FZLA 3QU7A 4F8RA 1ZD3A 1CI4A 3PSIA 4GC7A 4BXOB 2YMPA 2W55A 9ICCA 3RAXA 3AQFA 5KFTA 2IMWP 4RQ4A 3TFSA 4CCHA 2KK0A 5EOZA 4ECWA 2ALZA 1KTQA 2I1QA 1IV8A 4I29A 1U47A 1LKYB 4PGYA 8ICUA 1QH9A 5AKKA 5HR6A 3D2SA 3PMLA 4F2SA 4UW9A 2VA2A 3V6JA 3SV3A 5IINA 3KHRA 4JK1A 4B9UA 8ICCA 3MR6A 4I2GA 7ICIA 3FC4A 1D8BA 3V72A 3ISBA 1Z3EB 4NLGA 4Q8EA 2DBYA 1TAMA 2VANA 4UAVA 3OHAA 1XU4A 4RQ5A 1DOQA 2RQ5A 1ZQOA 1JXEA 2WAQF 3H0RB 3ISCA 1N48A 1SB3C 3RR8A 2KVSA 2ZUCA 2I5HA 1X40A 5AI5A 2BCVA 1BGXT 3ETLA 3A0HU 5F9LA 2RDIA 5J8YA 3M1YA 1S9FA 4Y2RA 1OXJA 5ALZA 9ICTA 4O5KA 3UMBA 4ECSA 3QU9A 2ZG6A 2KSOA 1WYGA 1NK0A 1JX4A 3RJGA 2KZZA 3SMVA 2ZTEA 2KTQA 2C2DA 1JALA 3H7IA 4XA5A 3WKCA 8ICBA 3F53A 3ZDAA 1L3TA 2LKYA 4TUQA 1KEJA 1U48A 3OSPA 4P4MA 2NRWA 2E3TA 9ICXA 1O08A 1PK1A 2FPMA 2LYAA 2NRZA 2FPLA 1UPHA 4KLTA 4YG2A 4P4PA 4RNNA 5KFUA 4YR2A 1KL9A 4Q44A 4O3SA 5KT5A 5AK3A 5J2BA 5JRTA 4UB4A 5KG1A 4MFAA 5EE1A 2CPRA 2KSOB 9ICEA 3H8JA 4ECUA 2XO7A 2WF5A 1N2XA 3GV7B 4JV0A 2UVWA 4IQVA 3CW2C 4DFDA 1Z1BA 2KIVA 4JMUA 5DLGA 7ICHA 2Y9UA 2YB4A 4ECRA 3CRXA 2HBLA 8ICWA 5AI9A 4PH5A 3K1ZA 4O3PA 4EEKA 2AXTU 1PK1B 1TK8A 3FAHA 2W3RA 3C23A 4R8UA 3PV8A 1GO3F 3AU6A 1NJYA 4UBBA 2W8KA 2NO5A 3LDAA 1SGGA 3QXGA 2IOFA 5B66U 1U9LA 3N7SC 3CP8A 4EENA 5KFMA 5J2HA 1ZQMA 2JH1A 4KLIA 1ZQFA 2A19A 2G0AA 5L9XA 3EW9A 3BQ7A 2EAPA 3JPOA 1ZQYA 1BPZA 3QU5A 4K4GA 3LWMA 2HVHA 5ALVA 5BOLA 2FLLA 4QJFB 3N7PD 1QSYA 1N5XA 5J2IA 1T7PA 4EX6A 3ZD9A 2LI6A 3UPQA 4M9JA 3D2NA 8ICHA 3QUQA 3N4MB 4RQ8A 3OTQA 4O3QA 4R8UB 2C2RA 2ZTDA 1S0VA 3ETRA 3LVWA 5GTHU 1SXDA 1ZYQA 2A1AA 3N97B 7ICNA 4RT2A 3KHLA 4M9GA 2BHNA 3ZI4A 1ZD4A 2F3NA 2R8GA 3PNCA 3G6XA 7ICOA 4DS4A 3RAQA 2HMXA 2JXJA 4OCZA 4KITB 3C2LA 4GFJA 4OJ6A 4F4WA 2JEFA 5HHIA 3EUB2 5DDYA 5DBAA 4J9MA 1EXNA 5AHXA 1NNLA 3MR5A 3JPRA 1NKCA 2FE9A 5AI8A 4EYHB 1DXSA 3BS5A 1SIJA 4E0DA 1L7PA 2W54A 4DFJA 1ED1A 2W9CA 4C8KA 1IXRA 1JRPA 1NJWA 1NZBA 3SQIA 1YZ6A 4HAIA 2BR0A 3C2MA 9ICLA 4DL6A 8ICGA 4RPZA 1ZOLA 1ZQ1C 3LWLA 1D8YA 2EDUA 2F8LA 5DG9A 2BCSA 5BOMA 1V9PA 4PHDA 4UAUA 3GIIA 5EWFA 3ONNA 2OM6A 4I27A 2OWOA 2J6SA 1NK8A 1KRPA 1ZXIA 4J9KA 4FS2A 4NM1A 2G09A 4F4XA 1ZJNA 4O5CA 3T5LA 1KKXA 2JZBB 1J2NA 3TQ1A 3K75D 3GFKB 5B5EU 1TE2A 2YX8A 4F5QA 9ICVA 3BS5B 3VCBA 4QZCA 1ZD2P 8ICZA 3H4BA 4DQIA 4ECYA 2W9CB 1H38A 3BZCA 1SKWA 1ZQDA 1WCLA 5KFDA 4DOBA 4Y2VA 5CR0A 1YZ7A 3RBDA 9ICJA 4B6JA 4RQ6A 4C8MA 4DO9A 1VLBA 3RH5A 4QZDA 4PGQA 3IV6A 4PHAA 5AKHA 4Y2TA 2Y1JA 4I2CA 5DB9A 1BNPA 1B43A 2LBOA 1L8OA 3SAFA 9ICUA 1Z19A 5KFVA 1Q3UA 2GLEA 4IL6U 4F4YA 1QSLA 4M2YA 1DGJA 3WK7A 3ZDBA 1L7MA 4JWMA 3AEVA 2WF7A 5KT2A 2NYVA 2WB1F 5HR7A 5CEHA 1T3QA 4DQSA 5KG6A 4QZAA 4MFCA 1LB2B 1U45A 5JUMA 4R65A 3VC8A 2M9NA 5D4BA 1MC8A 4J03A 1ZQHA 1KFSA 2XI9A 1X9XA 2G08A 2V9WA 4DQQA 2AH5A 4QZGA 2JMGA 4NL9A 3KOOA 5IIMA 5AKYA 2FDRA 1CEZA 3V6HA 5TISU 5ALNA 8ICLA 1XO1A 1ZRMA 3TI0A 2O6KA 1N63A 4FZNA 3JPSA 2KJ5A 1U4BA 2DUYA 2KMDA 3G6YA 4YD2A 1ZQBA 3C1YA 1S5LU 1DRGA 4DL4A 3SAGA 1XC9A 7ICSA 1UQVA 2ZIUA 2VA3A 1D9FA 3DDHA 3F2DA 5KNIA 2KP7A 4XRHA 9ICMA 5J0TA 2YQEA 1BPDA 4KLFA 4G9BA 1DK3A 3RRGA 4IRKA 3OHBA 2ASLA 9ICPA 3RB3A 4QIWC 2KZ3A 4YMMA 3S6JA 2JEGA 4I2DA 4MF8A 4O3OA 1BPBA 3ISDA 5D49A 1NK6A 1TKDA 2V4RA 4RQNA 5A0LA 4RUAA 2KFNA 2ZIXA 4C8LA 4GXIA 4Q45A 2PMZC 3MABA 5ALUA 3R9KA 4DL7A 4Q43A 1V85A 5E79U 2KJ9A 4IQWA 4UB1A 3BDPA 5ALLA 2ZIUB 2BCQA 2IA6A 2R8KA 8ICQA 2BGWA 2C2EA 1SL0A 4EZ6A 2LPEA 5ALOA 4C0ZA 4QWDA 1VJ5A 1NK5A 4UAYA 2FJ6A 3ORYA 3RRHA 3WK9A 4J9NA 3BS7A 4UQGA 1YT3A 3SD7A 2ZUDA 1RQLA 2MUTA 2RP5A 4UB2A 1T8EA 3NVWA 1BVSA 4KLSA 3E58A 4US9A 9ICRA 2FLNA 3E0FA 8ICRA 2E8OA 5EWEA 1QLNA 1T94A 2P66A 2ZIXB 2JR5A 4RQMA 1RQNA 2W03A 1J97A 2EH9A 2Q4TA 5AIAA 3A0BU 3SZ2A 2P35A 5JU5A 1ZQSA 3TAPA 2JHDA 1X6JA 4JV2A 4PHEA 1SV0A 4Y2YA 3KTQA 4QWAA 3LK9A 3AU2A 2PI5A 4KN7A 4B9VA 3RJHA 5KAFU 1ZQPA 2BDPA 3NASA 3T79A 4OO1J 4MEXA 1UA1A 2ZJ8A 2MUTB 2EAOA 2PFNA 3PX4A 4IQUA 4QZHA 2DKZA 5J0SA 4R64A 2F8KA 3BQ2A 8ICFA 2EAMA 3GILA 3RH6A 1C20A 4RU9A 1B22A 4DL3A 2B0CA 1N61A 2YMLA 2YMMA 4Q8FA 8ICPA 5AM5A 3RB6A 3Q8MA 5KFXA 4J9QA 5ALTA 2FMSA 1L3VA 9ICHA 3MDAA 1S76D 5KFLA 2JEIA 5HHHA 4BUGA 2OEHA 2WF6A 4YR3A 4TQSA 9ICGA 3ED5A 3NGDA 2BZFA 4J9PA 2M0NA 4IRDA 4DQPA 3PW7A 2HBJA 1Q3VA 3PW0A 1SZPA 3T5KA 4IRCA 3IDWA 3WKDA 1T3NA 4ELTA 3JPTA 2KFZA 4F5PA 1KFTA 3HW8A 3QEBZ 2K4IA 4UARA 1KBUA 1WWVA 1F5SA 3H8WA 5KFIA 3WK5A 3PMNA 4EX7A 3UMCA 1A0PA 1ZQVA 4DSJA 4ED8A 5AM0A 5ALRA 4UAWA 4Y2JA 5AKXA 4C80A 4LJXA 1RYUA 1JI7A 1CUKA 2FMQA 3UXOA 2KNJA 2KEYA 3HKZF 1OUQA 4F72A 3MR2A 1SWWA 3SEIA 2WAQC 2A1JA 1QCKA 5T14A 2K4PA 5EE9A 2W9MA 2KV2A 5KFPA 3MGVA 4ELUA 3TFRA 4QW9A 2V4QA 5J2EA 2K8CB 2D3DA 4DLEA 4RPXA 1KW4A 2RRDA 5HP4A 3TARA 3EWAA 5CJ7A 4UB3A 4EEYA 5J8YC 2HW3A 7ICTA 4FE3A 2HSZA 2HHWA 1TAQA 5L1IA 2G5IB 3MFHA 3C1ZA 2EANA 4EZ9A 2R8JA 3D6JA 1HEKA 4I2HA 5KT6A 2KJ8A 4OJPA 2H3ZA 3UQ0A 1QQ5A 2E8PA 3HP6A 5L1JA 2HHQA 3BZKA 3QX7A 3GQCA 4JV1A 2A1JB 1QQ7A 4YMOA 3NUQA 4DFKA 5ALPA 5HMMA 4FO6A 5J0YA 2F76X 3MC1A 4YFKA 4ZOHC 3Q8RB 5ALQA 4UB8U 1RPLA 3F5AA 4M0AA 5D46A 2W9AA 5DQIA 3QE9Y 2ESEA 2KIWA 4OD0A 8ICKA 4O3RA 1FFVA 2I6XA 5KFFA 2EQYA 2ASJA 2WF8A 3UQ2A 1DK2A 4CF3A 2AHOB 1RXVA 9ICFA 7ICMA 5KT7A 9ICNA 4PZNA 3Q8LA 9ICWA 4Y2UA 3TADA 4KLMA 1XSPA 2W3SA 4F3OA 4RQ3A 2VA8A 4KLLA 1WG8A 2LM1A 5G5GA 4TURA 2HBKA 4PJ0U 1NK4A 3KKAA 8ICXA 4M6WA 4J9OA 2LYHA 1HIWA 3QU2A 2PXIA 1X6IA 2E8NA 2JZBA 1TK0A 3B0XA 1CRXA 1XSNA 5J0OA 4IQTA 3OPXA 5ALEA 1QQ6A 4G3IA 2W11A 2NV3A 4DCCA 3HJEA 2Y0SF 4PPXA 5CB1A 4MFFA 1K5OA 1JMSA 3CYMA 1BPEA 2DGZA 2LHTA 4QNLA 4RQ2A 2R8IA 4PL1A 4YN4A 5ALMA 1XO0A 3JPPA 1S77D 2MSNA 2VIXA 2WFAA 3GDXA 4FS1A 1ZQKA 1URJA 4YXMA 3B9JA 2XGPA 4RQ1A 3AN1A 4OJ5A 5J0XA 1N60A 3GZFA 5KFJA 1HUZA 2KZMA 1X9SA 5ALJA 2G06A 4F4ZA 2H3QA 3T5JA 3PSTA 3ZD8A 4YQWA 2ATLA 4M6WB 3SV4A
chains in the Genus database with same CATH topology
1D8BA 4BX9C 3M6KA 2ZIVB 2W03A 1PVPA 1DRGA 4U6PA 4CGZA 2ZIWB 3C29A 1MA7A 2Q4TA 2ZXHA 1A0PA 2RHFA 1SZHA 2KIWA 3M6ZA 5KL1B 2E1EA 3AL0B 1Z1BA 2KKVA 4JMUA 2JHDA 1TAMA 2KICA 3SAGA 2KKPA 2YB4A 4FZMA 4CRXA 2HMXA 5C0YA 3F2CA 2ZIUA 3CRXA 2BDUA 2GH1A 2HBLA 3GU3A 4NWIA 3F2DA 2KNJA 3K1ZA 2KEYA 4GFJA 4OJ6A 4P0QB 2HOQA 2WAQF 3HKZF 2MA1A 1OUQA 4BJQA 2MRLA 2WAQC 3H0RB 3HKZC 2G07A 4NV0A 5T14A 1ECWA 4P0PA 2OYYA 3D2QA 3IP4B 2A3VA 3NRWA 3N7RC 1L6NA 2KV2A 1GO3F 3IG5A 4QIWF 3MGVA 2VJ5A 4U7CA 4ICAA 3T79A 2OH2A 4NLBA 4QIWC 2W7PA 4KMOB 4OO1J 2K8CB 2DQNB 2LBOA 2K4HA 4NLCA 2RRDA 4A8EA 3SAFA 4ACOA 3H0LB 1Z19A 2K89A 1Q3UA 4O3MA 3SAHA 3IN5A 4KX5A 2KHVA 2XIDA 2ZG6A 2KVCA 4OJOA 3N7SC 3CP8A 2K8AA 2K8BB 3RF9A 1PVRA 1ED1A 2YB1A 2GOLA 2H3FA 2HBKA 5A0LA 3F5EA 1IIPA 3SMVA 2JH7A 4FE3A 5KL8B 3H0MB 2ZIXA 2DF4B 2D6FC 2JH1A 3F53A 2G5IB 2E5SA 2PMZF 2G0AA 2WB1F 2ZIVA 3LYSA 4OJLA 2W7OA 1WUDA 3SQIA 1NZBA 5HR7A 1HIWA 2ZIWA 2LKYA 2PMZC 2WB1C 2KHQA 2R18A 2ZXIA 1CRXA 1ZQ1C 2OXOA 1P7DA 3PZPA 4FZLA 2F8LA 2JGAA 1HEKA 2KOBA 3OPXA 4CDGA 3ALRA 2KJ8A 2XVTA 2KJ9A 2H3ZA 4OJPA 3PSIA 2HOFA 2LYBA 4QJFB 2ZIUB 2NV3A 3PSPA 3N7PD 3ICXA 3ONNA 2OM6A 3VC8A 4P0QA 4KX3A 3AQFA 2Y0SF 4BUGA 3IG8A 3CYMA 4C0ZA 3M7DA 2DGZA 2LHTA 2LYAA 2Y0SC 3D2NA 3PSFA 4IC9A 3O0FA 4QNLA 1UPHA 2G09A 4PL1A 4AYBF 2N1RA 1XO0A 1PVQA 2XI9A 4P0PB 3F2BA 2G08A 4AYBC 3NUQA 2M0NA 3KZXA 1YT3A 2VIXA 2XICA 2JMGA 3L3FX 2W04A 2E1FA 1XNSA 1URJA 3LVWA 2HBJA 5HR6A 2G5HB 1Q3VA 3D2SA 2HBMA 3LVVA 2F76X 2RP5A 2YX8A 2VKQA 4OJ5A 3VCBA 4PL2A 3RFAA 3KFUF 2CRXA 3GZFA 2HOIA 5CRXA 2H3IA 4FZNA 2CPRA 1A6SA 3E0FA 3AQEA 2KJ5A 2G06A 3C28A 2F77X 1F44A 2H3QA 3DEEA 2KD1A 2Z7JA 2H3VA 3F5AA 3PSTA 4WJ3B 2F2AB 1T94A 2CN1A 2K4IA 2VJ4A 1KBUA 2ZIXB 2K4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D8B A;  1WUD A;  2KV2 A;  1GO3 F;  4QIW F;  4CGZ A;  1YT3 A;  2RHF A;  4NLB A;  2E1F A;  4OO1 J;  2E1E A;  2HBJ A;  4CDG A;  4NLC A;  2RRD A;  3SAF A;  2HBM A;  3SAG A;  4O3M A;  5C0Y A;  3SAH A;  4QJF B;  2HBL A;  2CPR A;  2HBK A;  2MA1 A;  3CYM A;  2DGZ A; 
#chains in the Genus database with same CATH topology
 1ZQR A;  1TVA A;  1RG6 A;  3K4G A;  4F5R A;  4DSI A;  1PK3 A;  2RHF A;  4M9H A;  2EZZ A;  2P6R A;  2BKE A;  2E1E A;  2KKV A;  1F0M A;  1SL1 A;  2KIC A;  4FBT A;  1BPX A;  5ALI A;  2UVU A;  5KFQ A;  2XY6 A;  1XSL A;  5ALK A;  3DV9 A;  3ZDE A;  3RB0 A;  4Y2P A;  2BQU A;  2MRL A;  2IOH A;  3Q8S B;  7ICE A;  3D2Q A;  3IP4 B;  4KLO A;  4DLG A;  1L6N A;  4C8O A;  3V7K A;  1Z4O A;  2VJ5 A;  7ICL A;  1MQ3 A;  4J9R A;  3SR6 A;  1SWV A;  2Y9T A;  4YXJ A;  4IS7 A;  1JXL A;  4YP3 A;  2OHF A;  3QUC A;  4QZF A;  3GIM A;  2XCA A;  1A77 A;  1TV9 A;  2QB0 A;  5ALG A;  3T3F A;  4XQ8 A;  2K8B B;  2GOL A;  1IIP A;  4Y2Q A;  4DSL A;  3RH4 A;  2RDJ A;  5FP0 A;  4RT3 A;  4RNO A;  3H8S A;  4PZO A;  1K1S A;  3NVY A;  5J2K A;  4R66 A;  4ECT A;  2AQ0 A;  3TAC B;  3H4D A;  4DQR A;  2OXO A;  4CDG A;  2KOB A;  1LV5 A;  2ISP A;  1ZET A;  2WF9 A;  5KFW A;  1ZQQ A;  4P0Q A;  3PSF A;  3OSN A;  5L1M A;  4AYB F;  3RBE A;  4QZ8 A;  1PVQ A;  2I9G A;  4M47 A;  2F1H A;  1ZQG A;  1MSW D;  2E1F A;  4KLJ A;  3GV8 B;  4MF2 A;  2G5H B;  4NY8 A;  3LVV A;  4I2B A;  3RFA A;  2QB0 B;  3PX6 A;  4LVS A;  3AQE A;  5AIC A;  4F91 B;  2AGP A;  2Z7J A;  8ICM A;  4DOA A;  4R63 A;  7ICQ A;  4RPY A;  1L7N A;  4UB5 A;  2VJ4 A;  2NO4 A;  4MEY A;  3E2E A;  2BPF A;  4U6P A;  3PW5 A;  4C4T A;  1TFR A;  1SZH A;  9ICB A;  3AL0 B;  4C8N A;  2F1J A;  3QU4 A;  4B9T A;  4I2A A;  3TKA A;  1S8O A;  4I2I A;  2YN4 A;  5KAI U;  1ZJM A;  2P6U A;  1ZQX A;  4GXJ A;  4EBD A;  5J0U A;  4KLQ A;  4P0Q B;  2BCR A;  7ICK A;  3MGH A;  4BJQ A;  4F4K A;  1COK A;  5KFY A;  3KD3 A;  3V6K A;  1TK5 A;  5AM3 A;  5HML A;  4GXK A;  3RTV A;  4NJ8 A;  3JPQ A;  1B4F A;  4JWN A;  3ZDC A;  1KSP A;  1X9W A;  5CWR A;  4ED0 A;  3SAH A;  1S0O A;  5TZV A;  5CHG A;  4Z6E A;  1RXW A;  5AK4 A;  4F50 A;  4ED3 A;  4OJL A;  4EBC A;  2PFO A;  5KFO A;  4KLH A;  5HNK A;  2E8M A;  5KFS A;  2WB1 C;  4QZE A;  4DFM A;  4CNQ A;  2ZXI A;  5AI0 A;  3PO4 A;  1JIH A;  2C22 A;  4I2J A;  3FYH A;  3RJJ A;  2NRT A;  7ICU A;  5F9N A;  5J0P A;  3EPG A;  3THV A;  5KFK A;  2YTU A;  4CF4 A;  5DGB A;  1WWU A;  2L5Y A;  3BQ1 A;  4I2F A;  4YMN A;  1Q8K A;  5DKW A;  5AM2 A;  1Z1V A;  1N56 A;  4NL9 C;  3DEE A;  4F93 B;  3T5H A;  3HRD D;  1L3S A;  5KG5 A;  4CGZ A;  1SL2 A;  3C29 A;  4DWI A;  9ICO A;  2WHE A;  5L1L A;  4ED7 A;  5IIO A;  1UT8 A;  3MR3 A;  4NWI A;  1ZQZ A;  4F71 A;  3M9N B;  1VDV A;  4QW8 A;  5J29 A;  2BQ3 A;  1KQQ A;  5ALH A;  5ALS A;  2OH2 A;  5KFA A;  1B0X A;  4UBC A;  4X5V A;  4QWC A;  2XC9 A;  5ALY A;  1SV4 A;  4O3N A;  4O3M A;  3C5G A;  3WK6 A;  2KHV A;  2Q0Z X;  3SI8 A;  5CP2 A;  4M9L A;  3F5E A;  8ICA A;  5KFH A;  4M9N A;  4Y2X A;  5KL8 B;  5DB8 A;  1S97 A;  1L3U A;  2F44 A;  2KE7 A;  1COO A;  5IIK A;  3ZDD A;  3KBB A;  4KTQ A;  3KHH A;  3PR4 A;  1NZP A;  3WU2 U;  3OJU A;  3PZP A;  1SXE A;  3SEN A;  1RZT A;  2HVI A;  3RJF A;  2HOF A;  3PSP A;  4B9L A;  4QWB A;  4YVZ A;  2RLT A;  2JV3 A;  1ZQL A;  4K4I A;  5F3X B;  3MBY A;  5KFG A;  1XNS A;  4F2R A;  1N5W A;  7ICJ A;  4HYK A;  2VKQ A;  4RNM A;  5J0W A;  1JN3 A;  5DBC A;  2H3I A;  2KN7 A;  5DB7 A;  3C28 A;  4ELV A;  4Y2S A;  2DL0 A;  4EBE A;  3PVX A;  2K4E A;  1Y88 A;  3V7L A;  1Z4N A;  9ICS A;  4NXZ A;  3RB4 A;  2ES6 A;  1ZQI A;  3M9O B;  2F1I A;  4DSF A;  1ZQJ A;  3K1R B;  4QZI A;  5DDM A;  2CXY A;  1FO4 A;  4ED6 A;  5GTI U;  5KG2 A;  4IR1 A;  3I76 A;  3I1Y A;  3WKB A;  7ICV A;  3RJK A;  3NRZ A;  4C4S A;  2A3V A;  1SV0 C;  9ICI A;  4Z6F A;  2EZY A;  3IG5 A;  5KFR A;  2K4H A;  1BNO A;  3H0L B;  2K89 A;  4NM2 A;  5G5H A;  3N28 A;  2R8H A;  4DF8 A;  8ICY A;  2QAR A;  3UM9 A;  2NRX A;  2HHX A;  4US8 A;  1JRO A;  2DWQ A;  1O03 A;  3C21 A;  5ALX A;  5J0R A;  2HHT A;  5KT4 A;  2ZJA A;  4RQ0 A;  2BPG A;  7ICF A;  4RUC A;  1QTM A;  1S10 A;  1L5U A;  3ALR A;  2WTF A;  5AKE A;  3QNM A;  2FMP A;  1UCV A;  1ZQU A;  1KLN A;  3QUT A;  3IG8 A;  2ZUB A;  3GIJ A;  1MQ2 A;  3F2C A;  3Q8K A;  4LZD A;  3KHG A;  4C7Z A;  3G6V A;  1ZQT A;  1S0N A;  4UAT A;  9ICA A;  3BJY A;  3KZX A;  4XUS A;  3QZ7 A;  3H40 A;  3EZ5 A;  4K4H A;  4O9M A;  4TUS A;  2J6U A;  1V97 A;  2ODG A;  3M9M B;  2ISO A;  5CRX A;  2H5X A;  3HT3 A;  8ICE A;  2QAR B;  1UHU A;  4TQR A;  3EPI A;  2UVR A;  4P4O A;  8ICV A;  5DQG A;  2DFL A;  1WCN A;  2FLP A;  2K60 A;  4MHV A;  4ECX A;  1PVP A;  2YY6 A;  8ICI A;  1MA7 A;  2ZXH A;  3C5F A;  3M6Z A;  5KL1 B;  3NVV A;  2KKP A;  4ECZ A;  3BQT A;  8ICT A;  4KN4 A;  1ZQA A;  4O5E A;  1SKR A;  5J2C A;  4CF5 A;  1KN5 A;  1FFU A;  1NJX A;  2XY7 A;  1XWL A;  5EE0 A;  3HPO A;  3HKZ C;  4RQ7 A;  2BCU A;  8ICS A;  4DEZ A;  4FBU A;  2AQ4 A;  2W7P A;  5AI6 A;  5BPC A;  2DQN B;  1NK9 A;  3J81 j;  2FPK A;  5DLF A;  4ACO A;  4LZG A;  3WKE A;  2XID A;  2KVC A;  2K8A A;  3PW4 A;  2YB1 A;  4BGD A;  5AKI A;  5AM4 A;  3AUO A;  5C5J A;  3H0M B;  2AJQ A;  4F5O A;  4YD1 A;  3M8R A;  3GIK A;  1NJZ A;  3FM9 A;  3NTU A;  2KHQ A;  5KG7 A;  3IHQ B;  1OW5 A;  3U26 A;  1U49 A;  2XVT A;  1J2M A;  5AK5 A;  2DKX A;  2QB1 A;  5AI4 A;  2GO7 A;  4QZ9 A;  3ICX A;  1NI3 A;  3RJE A;  4UB6 U;  3M7D A;  5J2G A;  5DQH A;  3TAQ A;  3OGU A;  5KG4 A;  2HHS A;  8ICO A;  2N1R A;  3WK8 A;  2JEJ A;  4KMU A;  4EEL A;  9ICK A;  3L3F X;  8ICJ A;  3Q8P B;  7ICR A;  4UAZ A;  4TUP A;  3WKA A;  4DL2 A;  3CNH A;  1M6Y A;  5ALF A;  3Q8Q B;  4QWE A;  8ICN A;  1F44 A;  2F77 X;  2KD1 A;  3FDS A;  1RDF A;  2QLT A;  1V38 A;  5AM1 A;  4WJ3 B;  2B21 A;  3BQ0 A;  2ZTC A;  3QUB A;  4Z6C A;  2XCP A;  4BX9 C;  4F92 B;  4Z6D A;  4J9S A;  4B9S A;  4USA A;  3OJS A;  1ZQE A;  4DSE A;  2OCE A;  5K4L A;  4FZM A;  4CRX A;  2MU2 A;  5KFB A;  1BPY A;  2Y1I A;  2GH1 A;  1HJP A;  2HOQ A;  3IRU A;  2G07 A;  3I28 A;  4NV0 A;  2ZJ5 A;  4NLK A;  2FI1 A;  4DS5 A;  2OYY A;  2MAX A;  2HHV A;  1X2I A;  5KFN A;  2JRZ A;  5ALD A;  1C7Y A;  1S0M A;  4I2E A;  3EYZ A;  2LM4 A;  4KMO B;  2J6T A;  2XGQ A;  3H8M A;  3SYZ A;  3QEA Z;  5J2J A;  3HWT A;  3NS1 A;  4YR0 A;  4ED2 A;  3TAD C;  1TAU A;  1IG6 A;  2H3F A;  1ZQN A;  4I28 A;  4KLD A;  2NRV A;  5DBB A;  2D6F C;  2E5S A;  2ZIV A;  4C7Y A;  2XY5 A;  4P2H A;  1P7D A;  4B9M A;  2JGA A;  3KKA C;  3UXP A;  2LYB A;  4AP9 A;  4JB3 A;  3L4P A;  5III A;  4IR9 A;  3UMG A;  1A76 A;  1DGS A;  1D8L A;  2Y0S C;  4GIB A;  1ARO P;  4IC9 A;  3PR5 B;  5AIB A;  1D9D A;  1ZQW A;  2XIC A;  5KT3 A;  3MGI A;  2BPC A;  2W04 A;  2W9B A;  2HHU A;  4B9N A;  5AKL A;  2HCF A;  4PL2 A;  4BWM A;  2HOI A;  2D8C A;  2C28 A;  1X66 A;  2W43 A;  2H3V A;  1NKE A;  2F2A B;  2CN1 A;  1ZQC A;  1HUO A;  5KG0 A;  4CE6 A;  3M6K A;  2ZIV B;  5DG7 A;  2BQR A;  1UT5 A;  5IIL A;  1L8L A;  1ZRN A;  2AGO A;  3AMZ A;  3GU3 A;  4KLG A;  4GC6 A;  5AK6 A;  3QZ8 A;  5KFC A;  3V7J A;  1QSS A;  5KG3 A;  3RJI A;  7ICP A;  2AU0 A;  4P0P A;  3PW2 A;  1K1Q A;  3N7R C;  4QIW F;  1RYS A;  4U7C A;  3PO5 A;  4F5N A;  5J2D A;  4DL5 A;  3HX0 A;  4NLC A;  2W9B B;  5JTI A;  1LVH A;  4NLZ A;  3MDC A;  4DOC A;  3IN5 A;  3C2K A;  4ECV A;  4JUZ A;  3M8S A;  3PX0 A;  3RF9 A;  1KDH A;  3HIL A;  1SKS A;  2JH7 A;  2DF4 B;  2GWS A;  3QYP A;  5ALW A;  3AM9 A;  2PMZ F;  1MN8 A;  2PI4 A;  2ZIW A;  1KFD A;  5KFE A;  4EYI B;  2R18 A;  4YCX A;  1X9M A;  5J0Q A;  5AKJ A;  5KTQ A;  4KX3 A;  3PY8 A;  3IM1 A;  3MFI A;  4M04 A;  2LMR A;  3KZI U;  3O0F A;  3L5K A;  5EE3 A;  4P0P B;  3F2B A;  7ICG A;  4AYB C;  5KFZ A;  2HI0 A;  1FIQ A;  4DFP A;  1IM4 A;  1JUD A;  2IBK A;  2HBM A;  1RM6 C;  4QZB A;  5AKG A;  3KFU F;  2CRX A;  2UVV A;  2ASD A;  1A6S A;  5J2A A;  1RYR A;  4ZH4 A;  4C4R A;  1Z00 A;  5IIJ A;  1ZD5 A;  5EWG A;  1UA0 A;  2IHM A;  4J9L A;  2ZIW B;  2PKE A;  3NVZ A;  3TAN A;  2YMQ A;  3UXN A;  1X42 A;  2B6G A;  4UAS A;  4BXO A;  3GV5 B;  2QKQ A;  5C0Y A;  4KLE A;  2BDU A;  4NLN A;  1Q46 A;  5DG8 A;  5CA7 A;  5L1K A;  1N62 A;  1NOM A;  2MA1 A;  5H2F U;  3B0Y A;  3RR7 A;  4BDP A;  4ECQ A;  1ECW A;  2PFQ A;  1L7O A;  5DB6 A;  3NRW A;  4FFD A;  1FEZ A;  4PHP A;  4ICA A;  1LKY A;  4KLU A;  4NLB A;  4RZR A;  4DSK A;  4PGX A;  4GLX A;  2DPJ A;  1PUZ A;  4A8E A;  2DPI A;  2PFP A;  5DGA A;  4KX5 A;  2EZX A;  2KG5 A;  4ED1 A;  4DF4 A;  2IHN A;  4OJO A;  2HDO A;  1PZN A;  1PVR A;  4BWJ A;  1NKB A;  3JPN A;  5AKZ A;  1Z00 B;  2W8L A;  1T4G A;  3LYS A;  2W7O A;  1WUD A;  5J2F A;  1AQ6 A;  1NK7 A;  2IOF K;  3WK4 A;  2AGQ A;  4O0I A;  1XS9 D;  9ICQ A;  4FZL A;  3QU7 A;  4F8R A;  1ZD3 A;  1CI4 A;  3PSI A;  4GC7 A;  4BXO B;  2YMP A;  2W55 A;  9ICC A;  3RAX A;  3AQF A;  5KFT A;  2IMW P;  4RQ4 A;  3TFS A;  4CCH A;  2KK0 A;  5EOZ A;  4ECW A;  2ALZ A;  1KTQ A;  2I1Q A;  1IV8 A;  4I29 A;  1U47 A;  1LKY B;  4PGY A;  8ICU A;  1QH9 A;  5AKK A;  5HR6 A;  3D2S A;  3PML A;  4F2S A;  4UW9 A;  2VA2 A;  3V6J A;  3SV3 A;  5IIN A;  3KHR A;  4JK1 A;  4B9U A;  8ICC A;  3MR6 A;  4I2G A;  7ICI A;  3FC4 A;  1D8B A;  3V72 A;  3ISB A;  1Z3E B;  4NLG A;  4Q8E A;  2DBY A;  1TAM A;  2VAN A;  4UAV A;  3OHA A;  1XU4 A;  4RQ5 A;  1DOQ A;  2RQ5 A;  1ZQO A;  1JXE A;  2WAQ F;  3H0R B;  3ISC A;  1N48 A;  1SB3 C;  3RR8 A;  2KVS A;  2ZUC A;  2I5H A;  1X40 A;  5AI5 A;  2BCV A;  1BGX T;  3ETL A;  3A0H U;  5F9L A;  2RDI A;  5J8Y A;  3M1Y A;  1S9F A;  4Y2R A;  1OXJ A;  5ALZ A;  9ICT A;  4O5K A;  3UMB A;  4ECS A;  3QU9 A;  2ZG6 A;  2KSO A;  1WYG A;  1NK0 A;  1JX4 A;  3RJG A;  2KZZ A;  3SMV A;  2ZTE A;  2KTQ A;  2C2D A;  1JAL A;  3H7I A;  4XA5 A;  3WKC A;  8ICB A;  3F53 A;  3ZDA A;  1L3T A;  2LKY A;  4TUQ A;  1KEJ A;  1U48 A;  3OSP A;  4P4M A;  2NRW A;  2E3T A;  9ICX A;  1O08 A;  1PK1 A;  2FPM A;  2LYA A;  2NRZ A;  2FPL A;  1UPH A;  4KLT A;  4YG2 A;  4P4P A;  4RNN A;  5KFU A;  4YR2 A;  1KL9 A;  4Q44 A;  4O3S A;  5KT5 A;  5AK3 A;  5J2B A;  5JRT A;  4UB4 A;  5KG1 A;  4MFA A;  5EE1 A;  2CPR A;  2KSO B;  9ICE A;  3H8J A;  4ECU A;  2XO7 A;  2WF5 A;  1N2X A;  3GV7 B;  4JV0 A;  2UVW A;  4IQV A;  3CW2 C;  4DFD A;  1Z1B A;  2KIV A;  4JMU A;  5DLG A;  7ICH A;  2Y9U A;  2YB4 A;  4ECR A;  3CRX A;  2HBL A;  8ICW A;  5AI9 A;  4PH5 A;  3K1Z A;  4O3P A;  4EEK A;  2AXT U;  1PK1 B;  1TK8 A;  3FAH A;  2W3R A;  3C23 A;  4R8U A;  3PV8 A;  1GO3 F;  3AU6 A;  1NJY A;  4UBB A;  2W8K A;  2NO5 A;  3LDA A;  1SGG A;  3QXG A;  2IOF A;  5B66 U;  1U9L A;  3N7S C;  3CP8 A;  4EEN A;  5KFM A;  5J2H A;  1ZQM A;  2JH1 A;  4KLI A;  1ZQF A;  2A19 A;  2G0A A;  5L9X A;  3EW9 A;  3BQ7 A;  2EAP A;  3JPO A;  1ZQY A;  1BPZ A;  3QU5 A;  4K4G A;  3LWM A;  2HVH A;  5ALV A;  5BOL A;  2FLL A;  4QJF B;  3N7P D;  1QSY A;  1N5X A;  5J2I A;  1T7P A;  4EX6 A;  3ZD9 A;  2LI6 A;  3UPQ A;  4M9J A;  3D2N A;  8ICH A;  3QUQ A;  3N4M B;  4RQ8 A;  3OTQ A;  4O3Q A;  4R8U B;  2C2R A;  2ZTD A;  1S0V A;  3ETR A;  3LVW A;  5GTH U;  1SXD A;  1ZYQ A;  2A1A A;  3N97 B;  7ICN A;  4RT2 A;  3KHL A;  4M9G A;  2BHN A;  3ZI4 A;  1ZD4 A;  2F3N A;  2R8G A;  3PNC A;  3G6X A;  7ICO A;  4DS4 A;  3RAQ A;  2HMX A;  2JXJ A;  4OCZ A;  4KIT B;  3C2L A;  4GFJ A;  4OJ6 A;  4F4W A;  2JEF A;  5HHI A;  3EUB 2;  5DDY A;  5DBA A;  4J9M A;  1EXN A;  5AHX A;  1NNL A;  3MR5 A;  3JPR A;  1NKC A;  2FE9 A;  5AI8 A;  4EYH B;  1DXS A;  3BS5 A;  1SIJ A;  4E0D A;  1L7P A;  2W54 A;  4DFJ A;  1ED1 A;  2W9C A;  4C8K A;  1IXR A;  1JRP A;  1NJW A;  1NZB A;  3SQI A;  1YZ6 A;  4HAI A;  2BR0 A;  3C2M A;  9ICL A;  4DL6 A;  8ICG A;  4RPZ A;  1ZOL A;  1ZQ1 C;  3LWL A;  1D8Y A;  2EDU A;  2F8L A;  5DG9 A;  2BCS A;  5BOM A;  1V9P A;  4PHD A;  4UAU A;  3GII A;  5EWF A;  3ONN A;  2OM6 A;  4I27 A;  2OWO A;  2J6S A;  1NK8 A;  1KRP A;  1ZXI A;  4J9K A;  4FS2 A;  4NM1 A;  2G09 A;  4F4X A;  1ZJN A;  4O5C A;  3T5L A;  1KKX A;  2JZB B;  1J2N A;  3TQ1 A;  3K75 D;  3GFK B;  5B5E U;  1TE2 A;  2YX8 A;  4F5Q A;  9ICV A;  3BS5 B;  3VCB A;  4QZC A;  1ZD2 P;  8ICZ A;  3H4B A;  4DQI A;  4ECY A;  2W9C B;  1H38 A;  3BZC A;  1SKW A;  1ZQD A;  1WCL A;  5KFD A;  4DOB A;  4Y2V A;  5CR0 A;  1YZ7 A;  3RBD A;  9ICJ A;  4B6J A;  4RQ6 A;  4C8M A;  4DO9 A;  1VLB A;  3RH5 A;  4QZD A;  4PGQ A;  3IV6 A;  4PHA A;  5AKH A;  4Y2T A;  2Y1J A;  4I2C A;  5DB9 A;  1BNP A;  1B43 A;  2LBO A;  1L8O A;  3SAF A;  9ICU A;  1Z19 A;  5KFV A;  1Q3U A;  2GLE A;  4IL6 U;  4F4Y A;  1QSL A;  4M2Y A;  1DGJ A;  3WK7 A;  3ZDB A;  1L7M A;  4JWM A;  3AEV A;  2WF7 A;  5KT2 A;  2NYV A;  2WB1 F;  5HR7 A;  5CEH A;  1T3Q A;  4DQS A;  5KG6 A;  4QZA A;  4MFC A;  1LB2 B;  1U45 A;  5JUM A;  4R65 A;  3VC8 A;  2M9N A;  5D4B A;  1MC8 A;  4J03 A;  1ZQH A;  1KFS A;  2XI9 A;  1X9X A;  2G08 A;  2V9W A;  4DQQ A;  2AH5 A;  4QZG A;  2JMG A;  4NL9 A;  3KOO A;  5IIM A;  5AKY A;  2FDR A;  1CEZ A;  3V6H A;  5TIS U;  5ALN A;  8ICL A;  1XO1 A;  1ZRM A;  3TI0 A;  2O6K A;  1N63 A;  4FZN A;  3JPS A;  2KJ5 A;  1U4B A;  2DUY A;  2KMD A;  3G6Y A;  4YD2 A;  1ZQB A;  3C1Y A;  1S5L U;  1DRG A;  4DL4 A;  3SAG A;  1XC9 A;  7ICS A;  1UQV A;  2ZIU A;  2VA3 A;  1D9F A;  3DDH A;  3F2D A;  5KNI A;  2KP7 A;  4XRH A;  9ICM A;  5J0T A;  2YQE A;  1BPD A;  4KLF A;  4G9B A;  1DK3 A;  3RRG A;  4IRK A;  3OHB A;  2ASL A;  9ICP A;  3RB3 A;  4QIW C;  2KZ3 A;  4YMM A;  3S6J A;  2JEG A;  4I2D A;  4MF8 A;  4O3O A;  1BPB A;  3ISD A;  5D49 A;  1NK6 A;  1TKD A;  2V4R A;  4RQN A;  5A0L A;  4RUA A;  2KFN A;  2ZIX A;  4C8L A;  4GXI A;  4Q45 A;  2PMZ C;  3MAB A;  5ALU A;  3R9K A;  4DL7 A;  4Q43 A;  1V85 A;  5E79 U;  2KJ9 A;  4IQW A;  4UB1 A;  3BDP A;  5ALL A;  2ZIU B;  2BCQ A;  2IA6 A;  2R8K A;  8ICQ A;  2BGW A;  2C2E A;  1SL0 A;  4EZ6 A;  2LPE A;  5ALO A;  4C0Z A;  4QWD A;  1VJ5 A;  1NK5 A;  4UAY A;  2FJ6 A;  3ORY A;  3RRH A;  3WK9 A;  4J9N A;  3BS7 A;  4UQG A;  1YT3 A;  3SD7 A;  2ZUD A;  1RQL A;  2MUT A;  2RP5 A;  4UB2 A;  1T8E A;  3NVW A;  1BVS A;  4KLS A;  3E58 A;  4US9 A;  9ICR A;  2FLN A;  3E0F A;  8ICR A;  2E8O A;  5EWE A;  1QLN A;  1T94 A;  2P66 A;  2ZIX B;  2JR5 A;  4RQM A;  1RQN A;  2W03 A;  1J97 A;  2EH9 A;  2Q4T A;  5AIA A;  3A0B U;  3SZ2 A;  2P35 A;  5JU5 A;  1ZQS A;  3TAP A;  2JHD A;  1X6J A;  4JV2 A;  4PHE A;  1SV0 A;  4Y2Y A;  3KTQ A;  4QWA A;  3LK9 A;  3AU2 A;  2PI5 A;  4KN7 A;  4B9V A;  3RJH A;  5KAF U;  1ZQP A;  2BDP A;  3NAS A;  3T79 A;  4OO1 J;  4MEX A;  1UA1 A;  2ZJ8 A;  2MUT B;  2EAO A;  2PFN A;  3PX4 A;  4IQU A;  4QZH A;  2DKZ A;  5J0S A;  4R64 A;  2F8K A;  3BQ2 A;  8ICF A;  2EAM A;  3GIL A;  3RH6 A;  1C20 A;  4RU9 A;  1B22 A;  4DL3 A;  2B0C A;  1N61 A;  2YML A;  2YMM A;  4Q8F A;  8ICP A;  5AM5 A;  3RB6 A;  3Q8M A;  5KFX A;  4J9Q A;  5ALT A;  2FMS A;  1L3V A;  9ICH A;  3MDA A;  1S76 D;  5KFL A;  2JEI A;  5HHH A;  4BUG A;  2OEH A;  2WF6 A;  4YR3 A;  4TQS A;  9ICG A;  3ED5 A;  3NGD A;  2BZF A;  4J9P A;  2M0N A;  4IRD A;  4DQP A;  3PW7 A;  2HBJ A;  1Q3V A;  3PW0 A;  1SZP A;  3T5K A;  4IRC A;  3IDW A;  3WKD A;  1T3N A;  4ELT A;  3JPT A;  2KFZ A;  4F5P A;  1KFT A;  3HW8 A;  3QEB Z;  2K4I A;  4UAR A;  1KBU A;  1WWV A;  1F5S A;  3H8W A;  5KFI A;  3WK5 A;  3PMN A;  4EX7 A;  3UMC A;  1A0P A;  1ZQV A;  4DSJ A;  4ED8 A;  5AM0 A;  5ALR A;  4UAW A;  4Y2J A;  5AKX A;  4C80 A;  4LJX A;  1RYU A;  1JI7 A;  1CUK A;  2FMQ A;  3UXO A;  2KNJ A;  2KEY A;  3HKZ F;  1OUQ A;  4F72 A;  3MR2 A;  1SWW A;  3SEI A;  2WAQ C;  2A1J A;  1QCK A;  5T14 A;  2K4P A;  5EE9 A;  2W9M A;  2KV2 A;  5KFP A;  3MGV A;  4ELU A;  3TFR A;  4QW9 A;  2V4Q A;  5J2E A;  2K8C B;  2D3D A;  4DLE A;  4RPX A;  1KW4 A;  2RRD A;  5HP4 A;  3TAR A;  3EWA A;  5CJ7 A;  4UB3 A;  4EEY A;  5J8Y C;  2HW3 A;  7ICT A;  4FE3 A;  2HSZ A;  2HHW A;  1TAQ A;  5L1I A;  2G5I B;  3MFH A;  3C1Z A;  2EAN A;  4EZ9 A;  2R8J A;  3D6J A;  1HEK A;  4I2H A;  5KT6 A;  2KJ8 A;  4OJP A;  2H3Z A;  3UQ0 A;  1QQ5 A;  2E8P A;  3HP6 A;  5L1J A;  2HHQ A;  3BZK A;  3QX7 A;  3GQC A;  4JV1 A;  2A1J B;  1QQ7 A;  4YMO A;  3NUQ A;  4DFK A;  5ALP A;  5HMM A;  4FO6 A;  5J0Y A;  2F76 X;  3MC1 A;  4YFK A;  4ZOH C;  3Q8R B;  5ALQ A;  4UB8 U;  1RPL A;  3F5A A;  4M0A A;  5D46 A;  2W9A A;  5DQI A;  3QE9 Y;  2ESE A;  2KIW A;  4OD0 A;  8ICK A;  4O3R A;  1FFV A;  2I6X A;  5KFF A;  2EQY A;  2ASJ A;  2WF8 A;  3UQ2 A;  1DK2 A;  4CF3 A;  2AHO B;  1RXV A;  9ICF A;  7ICM A;  5KT7 A;  9ICN A;  4PZN A;  3Q8L A;  9ICW A;  4Y2U A;  3TAD A;  4KLM A;  1XSP A;  2W3S A;  4F3O A;  4RQ3 A;  2VA8 A;  4KLL A;  1WG8 A;  2LM1 A;  5G5G A;  4TUR A;  2HBK A;  4PJ0 U;  1NK4 A;  3KKA A;  8ICX A;  4M6W A;  4J9O A;  2LYH A;  1HIW A;  3QU2 A;  2PXI A;  1X6I A;  2E8N A;  2JZB A;  1TK0 A;  3B0X A;  1CRX A;  1XSN A;  5J0O A;  4IQT A;  3OPX A;  5ALE A;  1QQ6 A;  4G3I A;  2W11 A;  2NV3 A;  4DCC A;  3HJE A;  2Y0S F;  4PPX A;  5CB1 A;  4MFF A;  1K5O A;  1JMS A;  3CYM A;  1BPE A;  2DGZ A;  2LHT A;  4QNL A;  4RQ2 A;  2R8I A;  4PL1 A;  4YN4 A;  5ALM A;  1XO0 A;  3JPP A;  1S77 D;  2MSN A;  2VIX A;  2WFA A;  3GDX A;  4FS1 A;  1ZQK A;  1URJ A;  4YXM A;  3B9J A;  2XGP A;  4RQ1 A;  3AN1 A;  4OJ5 A;  5J0X A;  1N60 A;  3GZF A;  5KFJ A;  1HUZ A;  2KZM A;  1X9S A;  5ALJ A;  2G06 A;  4F4Z A;  2H3Q A;  3T5J A;  3PST A;  3ZD8 A;  4YQW A;  2ATL A;  4M6W B;  3SV4 A; 
#chains in the Genus database with same CATH homology
 1D8B A;  4BX9 C;  3M6K A;  2ZIV B;  2W03 A;  1PVP A;  1DRG A;  4U6P A;  4CGZ A;  2ZIW B;  3C29 A;  1MA7 A;  2Q4T A;  2ZXH A;  1A0P A;  2RHF A;  1SZH A;  2KIW A;  3M6Z A;  5KL1 B;  2E1E A;  3AL0 B;  1Z1B A;  2KKV A;  4JMU A;  2JHD A;  1TAM A;  2KIC A;  3SAG A;  2KKP A;  2YB4 A;  4FZM A;  4CRX A;  2HMX A;  5C0Y A;  3F2C A;  2ZIU A;  3CRX A;  2BDU A;  2GH1 A;  2HBL A;  3GU3 A;  4NWI A;  3F2D A;  2KNJ A;  3K1Z A;  2KEY A;  4GFJ A;  4OJ6 A;  4P0Q B;  2HOQ A;  2WAQ F;  3HKZ F;  2MA1 A;  1OUQ A;  4BJQ A;  2MRL A;  2WAQ C;  3H0R B;  3HKZ C;  2G07 A;  4NV0 A;  5T14 A;  1ECW A;  4P0P A;  2OYY A;  3D2Q A;  3IP4 B;  2A3V A;  3NRW A;  3N7R C;  1L6N A;  2KV2 A;  1GO3 F;  3IG5 A;  4QIW F;  3MGV A;  2VJ5 A;  4U7C A;  4ICA A;  3T79 A;  2OH2 A;  4NLB A;  4QIW C;  2W7P A;  4KMO B;  4OO1 J;  2K8C B;  2DQN B;  2LBO A;  2K4H A;  4NLC A;  2RRD A;  4A8E A;  3SAF A;  4ACO A;  3H0L B;  1Z19 A;  2K89 A;  1Q3U A;  4O3M A;  3SAH A;  3IN5 A;  4KX5 A;  2KHV A;  2XID A;  2ZG6 A;  2KVC A;  4OJO A;  3N7S C;  3CP8 A;  2K8A A;  2K8B B;  3RF9 A;  1PVR A;  1ED1 A;  2YB1 A;  2GOL A;  2H3F A;  2HBK A;  5A0L A;  3F5E A;  1IIP A;  3SMV A;  2JH7 A;  4FE3 A;  5KL8 B;  3H0M B;  2ZIX A;  2DF4 B;  2D6F C;  2JH1 A;  3F53 A;  2G5I B;  2E5S A;  2PMZ F;  2G0A A;  2WB1 F;  2ZIV A;  3LYS A;  4OJL A;  2W7O A;  1WUD A;  3SQI A;  1NZB A;  5HR7 A;  1HIW A;  2ZIW A;  2LKY A;  2PMZ C;  2WB1 C;  2KHQ A;  2R18 A;  2ZXI A;  1CRX A;  1ZQ1 C;  2OXO A;  1P7D A;  3PZP A;  4FZL A;  2F8L A;  2JGA A;  1HEK A;  2KOB A;  3OPX A;  4CDG A;  3ALR A;  2KJ8 A;  2XVT A;  2KJ9 A;  2H3Z A;  4OJP A;  3PSI A;  2HOF A;  2LYB A;  4QJF B;  2ZIU B;  2NV3 A;  3PSP A;  3N7P D;  3ICX A;  3ONN A;  2OM6 A;  3VC8 A;  4P0Q A;  4KX3 A;  3AQF A;  2Y0S F;  4BUG A;  3IG8 A;  3CYM A;  4C0Z A;  3M7D A;  2DGZ A;  2LHT A;  2LYA A;  2Y0S C;  3D2N A;  3PSF A;  4IC9 A;  3O0F A;  4QNL A;  1UPH A;  2G09 A;  4PL1 A;  4AYB F;  2N1R A;  1XO0 A;  1PVQ A;  2XI9 A;  4P0P B;  3F2B A;  2G08 A;  4AYB C;  3NUQ A;  2M0N A;  3KZX A;  1YT3 A;  2VIX A;  2XIC A;  2JMG A;  3L3F X;  2W04 A;  2E1F A;  1XNS A;  1URJ A;  3LVW A;  2HBJ A;  5HR6 A;  2G5H B;  1Q3V A;  3D2S A;  2HBM A;  3LVV A;  2F76 X;  2RP5 A;  2YX8 A;  2VKQ A;  4OJ5 A;  3VCB A;  4PL2 A;  3RFA A;  3KFU F;  2CRX A;  3GZF A;  2HOI A;  5CRX A;  2H3I A;  4FZN A;  2CPR A;  1A6S A;  3E0F A;  3AQE A;  2KJ5 A;  2G06 A;  3C28 A;  2F77 X;  1F44 A;  2H3Q A;  3DEE A;  2KD1 A;  2Z7J A;  2H3V A;  3F5A A;  3PST A;  4WJ3 B;  2F2A B;  1T94 A;  2CN1 A;  2K4I A;  2VJ4 A;  1KBU A;  2ZIX B;  2K4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...