2E1MA

Crystal structure of l-glutamate oxidase from streptomyces sp. x-119-6
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
369
structure length
356
Chain Sequence
MTYEQLARELLLVGPAPTNEDLKLRYLDVLIDNGLNPPGPPKRILIVGAGIAGLVAGDLLTRAGHDVTILEANANRVGGRIKTFHAKKGEPSPFADPAQYAEAGAMRLPSFHPLTLALIDKLGLKRRLFFNVDIDPQTGNQDAPVPPVFYKSFKDGKTWTNGAPSPEFKEPDKRNHTWIRTNREQVRRAQYATDPSSINEGFHLTGCETRLTVSDMVNQALEPVRDYYSVKQDDGTRVNKPFKEWLAGWADVVRDFDGYSMGRFLREYAEFSDEAVEAIGTIENMTSRLHLAFFHSFLGRSDIDPRATYWEIEGGSRMLPETLAKDLRDQIVMGQRMVRLEYYDPGPAVAIQTVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-glutamate oxidase
publication title Structural characterization of l-glutamate oxidase from Streptomyces sp. X-119-6
pubmed doi rcsb
source organism Streptomyces sp.
molecule tags Oxidoreductase
total genus 88
structure length 356
sequence length 369
ec nomenclature ec 1.4.3.11: L-glutamate oxidase.
pdb deposition date 2006-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 2e1mA05
1.10.1200.190 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2e1mA03
3.30.160.490 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2e1mA04
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2e1mA02
2YG6A 1GPEA 3L1RA 3QJ4A 1COYA 2GH5A 2BC1A 4J33A 2VVLG 4JDRA 5J60A 1PXAA 4FK1A 2CVJA 4A5LA 1VQWA 2WOIA 5IQ4A 4U8OA 3DK8A 3CNDA 3UP5A 1PXBA 1B37A 3O0HA 4CBQA 5JCKA 5HYMA 1F3PA 3CGCA 1DODA 4NEVA 1QJDA 3ATQA 4GF7A 1LTXR 3CNJA 1O5WA 3BNMA 1P2EA 3GYIA 4B68A 1DNCA 2RABA 5L46A 4H4UA 2XLPA 2Y6QA 1H7XA 2WU5A 1NEKA 4U8MA 3VQRA 4U8LA 3NGCX 1E1MA 2GVCA 4USQA 5JCIA 1TDNA 3K7QX 2C70A 3AEAA 3AWIA 3KKJA 1GRGA 2WDRA 2DKHA 1YKJA 2YM1A 3BI5A 4AP3A 1IUVA 1UKVG 1BGJA 1YQZA 4H2RA 4Z43A 1ZY8A 2V6OA 1CHUA 2RGHA 3AEEA 4B67A 1VRQB 1AOGA 1Y56A 2PYXA 2XVFA 4Y4LA 1RP0A 4GDEA 3KD9A 4JNQA 4IVMB 3R9UA 2OA1A 2TMDA 1Q9IA 1FCDA 2B76A 3CNPA 4I59A 1GESA 3B3RA 4H7UA 5C3JA 1E7PA 1KSUA 3NRNA 4TLZA 3Q9TA 2GR1A 3OZ2A 1DJNA 3OC4A 3AE3A 3B6DA 2YM2A 2VRMA 2YLZA 3RNMA 3COXA 1IUUA 1ZOVA 1FEBA 2VZ2A 4U8NA 1F8SA 3ADAB 1F6MA 2XVJA 3S61A 1GXFA 4RSLA 3QSSA 1GRBA 1PBDA 1H82A 2C72A 2ZZBA 2C76A 2YG7A 2BC0A 3V3OA 2VRLA 2E4GA 3ATRA 1EBDA 1FEAA 4EQRA 2V5ZA 3AE9A 3I6DA 5HHFA 1PN0A 4M52A 1NAAA 5KVHA 1GOSA 1XANA 4TLXA 4ZCDA 3AD9B 3KVEA 3UKHA 4C3YA 3NYFA 3LXDA 4EQXA 3EAOA 4H4WA 1O95A 4TM0A 4IV9A 3UOYA 1OJCA 4U2TA 2ACZA 5FS7A 4XWRA 3AECA 4H4PA 4BK1A 1VG9A 3QVRA 4KX6A 5HXIA 4JQ9A 1E39A 2GF3A 2QAEA 4O5QA 3AE6A 3UTEA 1JRZA 3P4QA 3NK0X 1TDFA 5DBJA 3D8XA 3NH3X 2YR5A 1N1PA 5FMHA 4Z44A 4C5OA 1M64A 4EM4A 3SM8A 2C75A 4B64A 4H4ZA 4LA1A 2IVDA 1NPXA 4U8IA 4A6NA 1E6EA 2GR0A 4YKGA 5JCLA 2RGOA 4EQWA 2BXRA 1P2HA 3NTDA 4PAAA 2WS3A 1ZX9A 3BNUA 2XFOA 4OPUA 3S5WA 5CQFA 3CGBA 5TR3A 4BJZA 1CL0A 4C77A 4B69A 5KOWA 3UCLA 2AAQA 1IUWA 2CDUA 3AE5A 3DH9A 4ADWA 3ITJA 1Y56B 3NHOX 4B66A 3FMWA 1TYTA 4TM3A 4YTMA 4K7ZA 1BWCA 3CGEA 5CKUA 2VQBA 4A7AA 1TDOA 3CPHG 1GREA 5BULA 3CIRA 1KNPA 2H89A 4BURA 3C96A 3AEFA 2B7RA 1ZDLA 1Z6LA 2AR8A 2XLRA 1DJQA 2JB2A 3ABVA 3HZLA 1GTHA 3UKKA 3NIXA 1DOBA 4IA6A 2B9YA 2OAMA 1PJ7A 2WETA 3M12A 1KDGA 3DK4A 2UZZA 2EQ9A 1L9DA 4J2WA 1D5TA 1S3BA 1PDHA 2BS4A 3VR8A 2WDVA 2BK5A 1N4UA 3CN8A 1PBBA 1ZP0A 2AQJA 2XDOA 3AE1A 3RP6A 3C4NA 3CGDA 1KNRA 1O94A 4H2QA 1D4CA 4APNA 4CNJA 4B65A 4EIPA 3SQPA 1GTEA 2FJBA 2H88A 3QVPA 3FG2P 2YLTA 3NKSA 4H2PA 2BK3A 3VRAA 3GRTA 3UP4A 1REOA 2A87A 3RP8A 2VOUA 4OPTA 5C2TA 3REDA 1VG0A 1PBCA 2A8XA 5FS9A 3ALLA 2GB0A 3KLJA 2ZBWA 2YLRA 4H50A 3PS9A 2IIDA 3RP7A 2NPXA 2BYBA 1XDIA 4HB9A 3ZYXA 2X3NA 2JBVA 2WEUA 3IF9A 2PHHA 3G5SA 3GD3A 3NN6X 4H4YA 4XWZA 3UKQA 4BK2A 4H4TA 2X50A 1B8SA 4KPRA 3NK2X 1N4WA 4YTNA 2GQWA 1GRAA 4AT0A 1ZMCA 3DMEA 4U8KA 4O5UA 3VR9A 3DA1A 4A6NB 4J34A 4C3XA 4D03A 4YWOA 3KPFA 2JK6A 2OLOA 3FPZA 3P4PA 4EMIA 4B63A 2YVJA 1FL2A 3C4AA 1GV4A 1GNDA 2GMHA 1L0VA 4EMJA 4BV6A 1K0LA 1MOKA 3P4SA 4FX9A 1CF3A 2Q0KA 1GRFA 1H81A 5BVAA 2YWLA 3AEDA 4B1BA 5U63A 4I58A 3M0OA 1OJAA 4UDPA 4H4VA 3NNEA 2R46A 3LB8A 4YXDA 4CCRA 1NHSA 2GR2A 3DJJA 4H4SA 4NTCA 5IQ1A 4A65A 4AOSA 2XVIA 4YSYA 4NEWA 1S3EA 1ZMDA 2J3NA 3AEGA 2VVMA 1L9CA 3UKPA 1YQ3A 3GYJA 2YR6A 1ONFA 3AD7B 2E1MA 3DK9A 3P4RA 5KXJA 3BHFA 1ZOYA 3KU9A 4Z26A 4Z2RA 3LJPA 3FIMB 4OCGA 5KRQA 3EPTA 2R0CA 2CFYA 2WPCA 1CJ2A 2WQYA 2GR3A 1BGNA 2YG3A 1BKWA 3G5QA 3UTGA 5LV9A 2BCPA 2BS3A 4H2NA 4DNAA 1DXLA 4Y4MA 2BK4A 4N9XA 4OPCA 2Y6RA 1D4DA 2WESA 2FJAA 2WDQA 5BRTA 4LU6A 4A99A 3ICRA 4U2LA 2C66A 2R9ZA 2WHDA 5FS8A 2BACA 3AYLA 1NHRA 1NENA 2CULA 1PJ6A 5IPYA 3UKLA 3JSKA 4CY6A 1IJHA 3QSMA 1W4XA 3GMCA 1TDKA 4P9SA 4K5SA 1JOAA 2EQ7A 4NZHA 5ER0A 5GSNA 2BS2A 3UOXA 5JCNA 1CJ4A 2C3DA 2QCUA 4GDPA 4WX1A 2WOVA 4ECHA 5KWFA 3V3NA 3G5RA 3LOVA 3K7TA 2ZZCA 1H6VA 1JU2A 1JRYA 2V3BA 3CNSA 3QSEA 1KFYA 2F5ZA 3SFDA 2R4JA 1EL5A 4JY2A 1PJ5A 3GDPA 3K30A 4NTDA 1K4QA 1V59A 2DKIA 3CPJG 1OJDA 1F8RA 2BCGG 1TRBA 5JCMA 1PBEA 2FBWA 2C64A 4REKA 3CTYA 3F8PA 3NK1X 4J56A 2V60A 4U8JA 2EQ6A 3GD4A 1E1KA 2RGJA 4K8DA 5EOWA 2BA9A 2R4EA 2XFPA 1LQUA 1LQTA 2X99A 3IHGA 5FS6A 4CCQA 4D04A 2QA1A 1TYPA 1NG4A 1JEHA 1K0JA 1CBOA 5J7XA 4Z25A 1YQ4A 3NYCA 3ICTA 4H4XA 2WP9A 1GT8A 1JNZA 1D7LA 2XFNA 1XPQA 2YR4A 4IA5A 2C65A 4FK1C 1KSSA 2FJEA 1NG3A 2B9WA 3GSIA 2JAEA 4OPGA 1H84A 1S2QA 1NDAA 3GRSA 2B9XA 1GEUA 2E5VA 1K0IA 3DGZA 5BUKA 3H8LA 3E1TA 3Q6JA 4ZCCA 3AXBA 5KVIA 5HY5A 2OLNA 3AD8B 2XLUA 1N4VA 4WCTA 1YY5A 3UKAA 1GETA 1EL8A 1PBFA 3CNTA 3GWDA 2FJDA 2Z5YA 4J57A 4K2XA 4YSZA 4CNKA 2Q6UA 3FBSA 1DOCA 4YTPA 2BABA 3CPIG 1GERA 1MO9A 1NHPA 1X31B 2XLSA 2Q0LA 4MJWA 2HQMA 4YSHA 3PVCA 3T37A 2XVHA 1F8WA 2WPEA 3DJDA 3AEBA 2JKCA 2R0GA 3I3LA 1EL9A 2VVLA 2O9ZA 4JY3A 1FOHA 2WPFA 3QFAA 3M13A 3AE4A 1H7WA 2YVFA 3VRBA 1Q1WA 2WOWA 3NT6A 3UOVA 2YAUA 1GALA 4J31A 3GMBA 1IUXA 1H86A 1LV0A 2APGA 3GWFA 3LZXA 5EB5A 5M10A 2V61A 3SFEA 4OPDA 4AT2A 1B5QA 3AE7A 3UKFA 2XLTA 5GRTA 4Z2UA 2YQUA 1BF3A 1CC6A 1QLBA 2GAHB 4NTEA 4FDCB 1OJ9A 3BI4A 3NTAA 2C67A 2YLSA 2GV8A 1FECA 5EBKA 1HYUA 2ARDA 1LJ1A 3IHMA 1EL7A 2Z5XA 4X9MA 3ALMA 1LPFA 2ZZ0A 3BHKA 3LZWA 4UDQA 4UP3A 4RG3A 4A9WA 4H4QA 4YSXA 1PHHA 2YLWA 1SEZA 1DOEA 2WBAA 3K7MX 1GSNA 2IVEA 3SGLA 4EQSA 2I0ZA 1VDCA 2W0HA 4ZN0A 3ALJA 2R45A 1IUSA 2A89A 2GRTA 3NN0X 2C7GA 2OALA 1CJCA 2WP5A 5U1OA 3P1WA 3L8KA 3V76A 3P9UA 3URHA 1JNRA 4EM3A 3DJEA 3UOZA 4USRA 1PXCA 2GAGB 1ZKQA 5EB4A 2GQFA 3DGHA 2YG4A 2YG5A 2YVGA 2VQ7A 3AE2A 3LADA 1D7YA 1QO8A 4DSGA 2XFQA 1IUTA 3QFBA 1RSGA 4OPIA 4CRTA 2V3AA 3WE0A 1KF6A 3IWAA 4X4JA 4A79A 2TPRA 1B4VA 1JRXA 2EQ8A 3EANA 2XFUA 4GR1A 4H4RA 4J36A 1PS9A 2WU2A 3NG7X 2Q7VA 1TDEA 4OVIA 1RYIA 4EIQA 4YKFA 1Q1RA 2C3CA 3UTFA 2JB3A 2R0PA 1M6IA 4E0VA 4JN9A 4EMWA 3VRDB 3RHAA 3H8IA 1GRTA 3F8DA 1LVLA 4GRTA 3AB1A 1E1LA 2X8GA 3AE8A 3F8RA 4JNAA 1CJ3A 1ELIA 4AOXA 3AYIA 4TM4A 4Y4NA 3ICSA 1Y0PA 4HA6A 4RG4A 1MXTA 1BZLA 4U2SA 1ZK7A 2XCGA 2WP6A 2X8HA 4CY8A 2NVKX 4U8PA 2QA2A 2XYOA 4LIIA 4Z24A 4K22A 3ZDNA 3AYJA 3UTHA 3KA7A 2GEWA 4PABA 4DSHA 4TM1A 2JB1A 3EF6A 2C73A 4OPLA 5KOXA 4BK3A 1H83A 3NLCA 4XXGA 5U25A 2YLXA 4AP1A 4UDRA 3D1CA 3DJGX 1S2YA 2GMJA 1E1NA 4GCMA 1CC2A 4BJYA 2XVEA 3ISHA 5M0ZA 1L9EA 2B7SA 3PO7A 4C74A 3IC9A 4YT0A 1CC4A 3H4KA 4ICYA 4K5RA 3GDNA 2BXSA 1GRHA 4IVOB 4Z2TA 3BI2A 1D4EA 4X9NA 1OJTA 3II4A 3NYEA 2X8CA 4GUVA 1NHQA 4DGKA 1XHCA
chains in the Genus database with same CATH superfamily
1GPEA 2L0QA 2DB2A 4J33A 2EOJA 1A1HA 2CVJA 4FK1A 3T1YE 2WOIA 5IQ4A 3G26A 5LMUE 4R2EA 5JCKA 4NNJA 5HYMA 4NEVA 4PXHB 3KZZA 3CNJA 1O5WA 1P2EA 1DNCA 2RABA 4H4UA 3MHHC 1H7XA 2WU5A 4USQA 1TDNA 4G9KA 3AWIA 1A1JA 4O4KA 5KL2A 1GRGA 3KKJA 2WDRA 4MLVA 5KL4A 4H2RA 2V6OA 3T2ZA 2M7QA 2MKNA 1VRQB 1Z6MA 3NTEA 5CFFE 4F6NA 1BAJA 2LBSB 2OARA 2K0YA 1HQBA 1Q9IA 2B76A 2YTJA 1KSUA 3Q9TA 3OZ2A 1NJIQ 1DJNA 1WHQA 4MLQA 3B6DA 3DS2A 2YM2A 2NUEA 1ZOVA 2GZGA 2N8XA 1GXFA 3JTZA 2YG7A 2BC0A 2QA4P 2V85A 1EBDA 1FEAA 2V5ZA 5HHFA 1YYWA 2FVAA 3LLHA 3AD9B 4ZCDA 3UKHA 4C3YA 2QNWA 3LXDA 4EQXA 4H4WA 4TM0A 4U2TA 2N6YA 2JU2A 3HYXA 3G4SP 3T14A 2EFJA 4XWRA 1PJSA 2UUCE 1VG9A 3QVRA 5HXIA 2YTEA 1E39A 3UTEA 1TDFA 3NH3X 4Z44A 3CC7P 4C5OA 1M64A 3H0DA 5ADZA 2GZJA 3SM8A 2NABA 2FV4B 2YRHA 1NPXA 4A6NA 1X6FA 3SZ0A 1I94E 3H47A 3NTDA 1ZX9A 2XFOA 4OPUA 4B69A 3UCLA 2AAQA 3AE5A 3ITJA 2Z46A 4F9CB 1GTKA 1XNRE 5CKUA 4G6GA 2RSIA 3CPHG 1GREA 3CIRA 2L33A 2H89A 3CMMA 3C96A 5KMQA 2AR8A 3ABVA 1GTHA 3UKKA 2Z45A 2B9YA 2OAMA 4PH0A 3DS0A 4P7DA 3DK4A 2B9DA 1D5TA 1X49A 1S3BA 3VR8A 2BK5A 1ZP0A 2MDGA 2B7VA 1VQ6P 1KNRA 5AASA 1L0HA 2BK3A 3VRAA 1YYOA 2A87A 2LTSA 2JPAA 1XNQE 5C2TA 3REDA 2A8XA 2EMLA 4YY3E 5FS9A 2EOQA 3PS9A 3HYBA 2RSMA 2NPXA 3ZYXA 2HHHE 2LPKA 3IF9A 2EOIA 4DMIA 2PHHA 3G5SA 1JK1A 1Q81Q 1B8SA 4KPRA 3NK2X 4U8KA 4O5UA 2ZM6E 2LKIA 3C4AA 4BPHA 1X3CA 4BV6A 1K0LA 5HGOA 5HGMA 2Q0KA 5BVAA 1QU6A 4DR3E 3M0OA 4UDPA 4UHPB 4ZYEA 1F2IG 4AOSA 2XVIA 1RO0A 3AEGA 4U0BA 2PEMA 4OX9E 2JQ4A 3SX6A 2YR6A 1ONFA 2WPTA 2ELYA 2EPZA 5KRQA 3CCVP 3J7AG 2BS3A 4AQYE 3J81C 2BK4A 4OPCA 1D4DA 5DCKA 1RNIA 3C4BA 1Z1BA 1A43A 2C66A 1NENA 5IPYA 1D1DA 1GXHA 2EM2A 5ER0A 2EMWA 5F2OA 2WOVA 3CNSA 2YSOA 1JRYA 3DS4A 4DV0E 1HNZE 1PJ5A 3GDPA 3K30A 2MY5A 1VHNA 2DKIA 1F8RA 2FGGA 1TRBA 5JCMA 1PBEA 2FBWA 2EM5A 4REKA 4U8JA 2EMFA 1E1KA 4DV6E 3IHGA 4D04A 1TYPA 1K0JA 1CBOA 2EQ0A 3ICTA 2WP9A 2LUQA 1JNZA 1D7LA 2FJEA 1TF6A 2EPOA 2LTRA 5AE1A 1ZBTA 2B9XA 1EOQA 2EHSA 1K0IA 3E1TA 1SR9A 2XLUA 5EJDA 5FLXC 3CNTA 4K2XA 2Z5YA 4CNKA 1X31B 2XLSA 2EOHA 2Q0LA 4MJWA 2HQMA 3SZCA 2XVHA 3M13A 2YVFA 1Q1WA 4J31A 1GALA 2GDWA 5KNLA 2YTIA 2LTEA 3SFEA 2OTLP 2EPXA 2LRSA 4GKJE 4O43A 4B3RE 2YRMA 1CC6A 3NTAA 2C67A 4R2PA 2GV8A 1HYUA 1TN9A 1LJ1A 3IHMA 1LPFA 2ZZ0A 4UDQA 4H4QA 2PENA 2LL8A 1DOEA 3NY7B 2IVEA 3SGLA 1PJTA 2EJ4A 1IUSA 4XFXA 2KOPA 3NN0X 2C7GA 2WP5A 2AVAA 4DR2E 3V76A 3P9UA 2EZ6A 2YZTA 1PXCA 2GAGB 5EB4A 4F2JC 2L6EA 2PEJA 2YVGA 1ZAAC 2GHFA 1RSGA 3WE0A 2ENHA 3CCLP 2WCC3 1KF6A 2P9XA 4Q35B 4A79A 2EQ8A 4J36A 2WU2A 2MD9A 5HGNA 1SFEA 1RYIA 3UTFA 1Q1RA 2R0PA 1DGCA 4JN9A 2JB0A 5IV8B 1GRTA 3F8DA 2EM0A 3AB1A 3F8RA 2EG5A 4GRTA 3J80C 4JNAA 1ELIA 1IBKE 4AOXA 4Y4NA 3ICSA 2BB8A 2JBGA 4RG4A 1MXTA 3DJWA 2WP6A 1T4NA 1BXIA 3EF6A 1DI2A 2V86A 3NLCA 1A1GA 4BJYA 2XVEA 2ENAA 4NWZA 2YU8A 2CGQA 2EN2A 2B7SA 3H4KA 3GDNA 1GRHA 3ADLA 1D4EA 4X9NA 2DGCA 1OJTA 2N6ZA 1UILA 2QEXP 4O24A 2PEIA 1L0IA 1XHCA 2EOYA 4LF5E 1PXAA 1STUA 3DK8A 4H2XC 2AF8A 1PXBA 3O0HA 4CBQA 1EMVA 2M4IA 2EM3A 2GLIA 4GF7A 3BNMA 3GYIA 4JI5E 5LL6R 1NEKA 3VQRA 4U8LA 3NGCX 2JYGA 3K7QX 1XMOE 4RH8A 1YKJA 2JR1A 2YM1A 1UKVG 1BGJA 3CMAP 4Z43A 1ZY8A 2EMHA 1CHUA 3AEEA 1Y56A 2PYXA 4B3TE 1X48A 2KOUA 1FCDA 4I59A 1GESA 4COPA 2DLKA 3B3RA 5C3JA 4XFZA 1E7PA 4LF4E 2BRYA 2V83A 2N50A 3AE3A 2DMIA 2EE8A 3COXA 4U8NA 3ADAB 1VQ7P 2XVJA 4COCA 1GRBA 7CEIA 2ZZBA 4L5NC 2E4GA 1HNWE 2L9FA 5A6AA 3SZWA 3AE9A 4M52A 1N8RQ 4TLXA 4G6HA 3KVEA 3NYFA 3EAOA 2VF1A 4JI0E 3OTOE 1YFHA 3AECA 2MVUA 4R8OA 4KX6A 5JPAA 1KYQA 2GF3A 1DV5A 4O5QA 1JRZA 3P4QA 3D8XA 2YR5A 2M8NA 3FIGA 4EM4A 2C75A 2ROQA 2L22A 4GAPA 4B64A 4LA1A 5JCLA 2BXRA 3BNUA 5HV8A 2RS6A 3CGBA 4BJZA 2EWLA 1IUWA 3DH9A 4M2ZA 4ADWA 3NHOX 1VQLP 2DMYA 2D9HA 3L00A 1TYTA 2MR8A 1KQSO 5KMSA 4A7AA 2VLNA 1K9MQ 5CZDB 4BPGA 2XLRA 1DJQA 2JB2A 1KD1Q 2WETA 5DNYA 2DNWA 1M1KQ 5AE2A 3CCSP 2EPPA 2EQ9A 4WXDA 4J2WA 2WDVA 1N4UA 1K73Q 1PBBA 2KGDA 4BS9A 2WBSA 4B65A 4EIPA 1GTEA 3FG2P 3GRTA 3RP8A 1GQEA 3TQMA 4OPTA 5HVCA 3MSWA 2GB0A 5T6JA 2LO3A 4BC7A 2ZBWA 2YTOA 3RP7A 4JV5E 2BYBA 4HB9A 2JBVA 2WEUA 4XWZA 4II2A 2EMAA 4ZYGA 1N4WA 2GQWA 1GRAA 3DMEA 4A6NB 4C3XA 2NO8A 4Q28A 3FPZA 4B63A 5KMRA 1FL2A 3GJNA 4DV4E 1GV4A 1CEIA 1N34E 4EMJA 1X6EA 2LV2A 4GKKE 1CF3A 1TF3A 2ELZA 1GRFA 3CD6P 4F9AB 2AFEA 2KHXA 3AEDA 5U63A 4I58A 2EM4A 2R46A 2M8PA 4YXDA 4CCRA 2LVHA 4NTCA 4A65A 2EPUA 3CCUP 2RPCA 2V87A 2J3NA 3UKPA 5BS1A 1YQ3A 1WHNA 5KXJA 1BBOA 2R76A 1Q7YQ 2CFYA 5KMPA 5LV9A 3G5QA 1IMUA 1PKPA 2KGCA 4BHBA 3HQ1A 4LU6A 4A99A 4U2LA 2ADRA 3CCRP 5FS8A 3CPWO 3UKLA 3JSKA 4BMJA 1JOAA 5AE3A 3P05A 2BS2A 3UOXA 1CJ4A 2L6MA 1J5EE 3LOVA 2DIXA 2ZZCA 2A25A 1H6VA 1JU2A 2V3BA 3GYXA 3QSEA 1KFYA 5AC5A 2R4JA 1EL5A 2YTPA 2EPCA 4LTYA 5A6BA 4U0FA 2EOFA 4CA3A 3EPLA 3F8PA 1IUQA 2V60A 1EH7A 3GD4A 2B3TB 4LFBE 2X99A 2EN7A 1LLMC 1JEHA 2F4VE 1YQ4A 3NYCA 2LOLA 4DG9A 3ADGA 4IA5A 1XPQA 5I4TG 1FKAE 3DS1A 1KSSA 2B9WA 2EM7A 2KG6A 4O5GA 3GSIA 1YITP 1S2QA 3OMLA 1GEUA 2YSPA 1XMQE 2E5VA 3G29A 5F2NA 5IWAE 3AD8B 4WCTA 3C6KA 1GETA 3I56P 1EL8A 4NZVA 1G2DC 3GWDA 2PEQA 4X62E 2Q6UA 2X2BA 2K7IA 1DOCA 4YTPA 3EPKA 2EM9A 1A1IA 2WZOA 3PVCA 1YIJP 3DJDA 2JOXA 1EL9A 2VVLA 2O9ZA 4JY3A 3QFAA 3DS5A 4BPFA 1H7WA 3VRBA 4QKOA 3UOVA 2YAUA 2XXMA 1H86A 2LF4A 1PDAA 3LZXA 3RMPA 5EB5A 5M10A 2L2MA 3HPZA 4AT2A 2YRKA 3UKFA 3HXLA 4LF9E 2YQUA 1QLBA 4NTEA 2ODRC 4GR6A 3BI4A 1NQ4A 1FECA 3C4TA 2ARDA 1EL7A 3LZWA 2YLWA 3BGHA 2I0ZA 1VDCA 2W0HA 4OOGC 4BHCA 2XZ1C 5IXMB 2GRTA 2OALA 3L8KA 4JI8E 3URHA 4EM3A 5LMNE 2LIUA 2MR7A 4USRA 2YG4A 3LADA 2V89A 1D7YA 1T4OA 4DSGA 2EPRA 1GPJA 2LJUA 2L3JA 3QFBA 1JK2A 2V3AA 2LE2A 1JRXA 4H4RA 2XFUA 1TDEA 2KW2A 4YKFA 3I55P 2C3CA 4EMWA 3H8IA 2KOQA 4JI2E 1E1LA 3EJEA 3AYIA 1AH5A 1Y0PA 1BZLA 1ZK7A 2XCGA 4TUGA 2QA2A 3DPHA 3VYXA 2EL4A 3UTHA 3KA7A 2M5RA 2GEWA 4DSHA 5IT9C 2C73A 4OPLA 4WPYA 4BK3A 1RC7A 4LFAE 4WSPA 4UDRA 4K0KE 2GZEA 3D1CA 3DJGX 2VLPA 5HGLA 2YU5A 2E5LE 4BC9A 1E1NA 4GCMA 2EN8A 1CC2A 1X6HA 1AUMA 5TSEA 3IC9A 4YT0A 1VQ8P 2N3HA 2JVAA 1YJWP 4IVOB 3ADJA 4WFTA 4GUVA 1NHQA 3SYIA 3G28A 2KORA 2I9IA 1VQPP 1COYA 2LCEA 2VVLG 1IQSA 3EPJA 4JDRA 5J60A 4X8WA 4A5LA 1VQWA 1N3GA 3IWBA 3MGEA 4HKGA 2GDXA 3CNDA 3C6MA 2PEOA 2UXCE 1LTXR 2MKDA 2UUAE 4B68A 1K8AQ 1A1KA 5L46A 2XLPA 1ZMBA 4U8MA 2N98A 3GKLC 2KG9A 1E1MA 3THOB 3AEAA 2B7TA 1AYIA 1S72P 4AP3A 4LF7E 1YQZA 1Q82Q 1NCSA 2RGHA 1AOGA 2KOSA 2XVFA 1RP0A 2K93A 2JWOA 3KD9A 2DSYA 2OA1A 3CNPA 3AV0A 3JU0A 2VSQA 4H7UA 2N3GA 4I8OA 3NRNA 2EM6A 1VQ5P 3OC4A 1YHQP 2FVFA 1J26A 2FACA 3RNMA 3HZQA 3H09A 1HY8A 2VZ2A 2AFDA 1F8SA 1F6MA 3S61A 4GEQB 3QSSA 1W2BO 2MVVA 1PBDA 1H82A 2C72A 2C76A 3MHSC 4DV3E 4LFCE 2VRLA 1NAAA 1GOSA 2WBUA 1F80D 1O95A 4IV9A 1OJCA 5FS7A 2JOBA 2YTGA 1X3OA 1K30A 2RTXA 3ADIA 4JQ9A 2JAZA 2HJJA 1ZBQA 2JXPA 2J7JA 2CWOA 1N1PA 5FMHA 4IPYA 2EOMA 3CCEP 1T39A 4DV2E 2FHSC 4JI4E 2M9AA 2IVDA 1WJPA 2GR0A 4DV5E 4EQWA 1P2HA 2EOXA 2WS3A 3S5WA 5CQFA 2LIWA 5TR3A 4C77A 2EL5A 5KL7A 2CDUA 2XZ0D 1Y56B 4B66A 2N5HA 1PJQA 3FMWA 4YTMA 4K7ZA 2LMLA 3CGEA 5F3WA 2VE7C 1TDOA 1A8OA 5BULA 1EH8A 2KOOA 2JO0A 1KNPA 4BURA 1IMQA 1ZDLA 2YTDA 1DOBA 4IA6A 2EPMX 2JYLA 2KWLA 1PJ7A 4R03A 3M12A 4R2RA 1PDHA 3CN8A 2AQJA 2XDOA 3AE1A 3C4NA 3CGDA 1D4CA 2KONA 2FJBA 3QVPA 2YLTA 4H2PA 4X66E 2XT1A 2VOUA 3G0VA 2EMXA 4LF8E 3ALLA 4NXNE 2EIAA 4XFYA 4NHRA 3KLJA 2BHVA 2WBTA 2EMZA 4H50A 4DR4E 2GPIA 2KGEA 2X3NA 4F6MA 2MF4A 2BRAA 2X50A 3CCMP 2VQFE 3DA1A 4D03A 4J34A 1AF8A 4LU9A 4EMIA 3F6HA 1GNDA 2GMHA 4JI3E 1DNYA 3T0KA 4FX9A 1YJNP 1H81A 4HTGA 4JYAE 4X9JA 4FK5C 3CC4P 5F2KA 3DJJA 4YSYA 2V8QB 3RG2A 1ZMDA 1NEIA 2VVMA 1L9CA 2OTJP 1YI2P 3AD7B 3BHFA 1ZOYA 3KU9A 4Z2RA 3LJPA 3FIMB 2EPLX 4DR1E 1QVGO 4OCGA 3EPTA 2R0CA 2WQYA 1EIAA 1A1LA 2YG3A 1BGNA 1BKWA 4R0MA 3UTGA 2BCPA 4H2NA 4DNAA 4Y4MA 2FJAA 5BRTA 1RO2A 3VHTB 3ICRA 2WHDA 4BCAA 2BACA 1NHRA 3BIDA 4CY6A 2EMYA 4P9SA 5GSNA 2C3DA 2QCUA 5KWFA 1WRJA 3K7TA 4JI1E 2KG8A 4DKKA 3CPJG 2YTFA 5KP7B 5BR8E 1X5WA 2C64A 3GZMA 2UU9E 3CTYA 4PWVB 3NK1X 1YPNA 2EQ6A 3T1HE 2RGJA 4K8DA 1LQUA 1LQTA 1ZNVA 2QA1A 1JJ2O 4H2YC 2CSHA 3EJDA 5J7XA 4H4XA 1GT8A 2XFNA 4FK1C 1NG3A 2JAEA 4OPGA 1NDAA 5KL5A 2LT7A 1X47A 4DR7E 5A6JA 3B5IA 3E2DA 1VQNP 5HY5A 3AXBA 5KVIA 1UNKA 1N4VA 1YY5A 2EQ3A 2R1FA 4J57A 4YSZA 2FJDA 2BABA 3CXCO 2YPNA 3RG6C 4YSHA 4RHBB 1T4LB 1G2FC 2JY9A 2L2NA 2YTNA 3KWRA 2JKCA 2R0GA 3LRYA 3I3LA 5BS2A 1FOHA 2WPFA 3AE4A 2WOWA 3HPSA 3NT6A 1IUXA 2APGA 3H4EA 2V61A 1GXGA 2EQ1A 1B5QA 3AE7A 4XROA 2XLTA 4TUIA 5GRTA 4Z2UA 1BF3A 2GAHB 2EP3A 2YLSA 3CMEP 2Z5XA 2FVEA 3ALMA 4UP3A 4X9MA 4A9WA 4YSXA 4RG3A 2WBAA 3G6EP 4ZYHA 3K7MX 1GSNA 4ZN0A 2L92A 3ALJA 2R45A 2A89A 4IJDA 3P1WA 3CC2P 2K94A 1M90Q 2EMBA 1HR0E 3DJEA 2L2KB 1QNTA 2PRTA 3VYYA 5A6BD 3AE2A 4IS1C 1QO8A 3Q20A 3IWCA 3VK6A 3T2KA 4X4JA 1B4VA 3EANA 2FTXB 1YUJA 4LF6E 1PS9A 2EMGA 1MGTA 1M6IA 4E0VA 3VRDB 3RHAA 2X8GA 2PY8A 2FQ2A 1T8KA 2EOSA 4HA6A 4U2SA 2X8HA 4CY8A 4QNBA 2NVKX 4U8PA 2XYOA 1EKZA 4LIIA 4Z24A 4K22A 3ZDNA 3DF6A 3AYJA 4KZSA 2GZFA 4TM1A 5KP6B 5KOXA 4G73A 2YT4A 1H83A 1VKUA 5U25A 2YLXA 2FQ1A 2GMJA 1FR2A 3EPHA 4XRQA 5M0ZA 2H36X 4P78A 1L9EA 4J8ZA 3PO7A 4C74A 4R2DA 2DGYA 2MDRA 1CC4A 4ICYA 1YZ9A 1OR5A 4Z2TA 3SZFA 2EL6A 4DGKA 2YG6A 3L1RA 3QJ4A 2GH5A 2BC1A 2VRDA 4U8OA 3UP5A 1B37A 2CT1A 2IHR1 1F3PA 3CGCA 1DODA 1QJDA 3ATQA 1DQ3A 4YHHE 2LUPB 4KWYA 3EJBA 2Y6QA 1EH6A 3F6GA 3IWDA 2GVCA 5JCIA 2C70A 2BBGA 2MC5A 2DRPA 2DKHA 2ODRD 1A1FA 1RMDA 3BI5A 1IUVA 3K6QA 1AAYA 4B67A 2HC5A 3WBHA 4Y4LA 4GDEA 3THNA 4JNQA 4IVMB 3R9UA 4HEIA 2TMDA 1BBGA 2FADA 4TLZA 2EMIA 1BB8A 2GR1A 2EN4A 4GR2A 2JGPA 2VRMA 2YLZA 2PNGA 1IUUA 2UXBE 2YWQA 1FEBA 4WSGA 2EN3A 4RSLA 3G71P 2VLQA 3V3OA 2BUOA 1UJZA 2PEKA 3ATRA 1P47A 4EQRA 3I6DA 1PN0A 5KVHA 1XANA 2EN6A 4X64E 5KL6A 1HNXE 3UOYA 2K4VA 2ACZA 2M8LA 4H4PA 4G74A 3T31A 4BK1A 4DUZE 2QAEA 3AE6A 1N36E 3NK0X 5DBJA 2K5XA 2EOEA 4H4ZA 5KL3A 2EHTA 4U8IA 3QG5C 2NUFA 1E6EA 4YKGA 2RGOA 4PAAA 3LMLA 1YUIA 2CG5B 4F9BB 2ENCA 1ACPA 2CPNA 4F54A 1CL0A 5KOWA 4DR6E 3M1MA 1E0HA 4TM3A 1BWCA 3UK3C 2VQBA 4U0CA 1FJGE 2L3CA 2UXDE 4M0IA 3AEFA 2B7RA 1Z6LA 3P1XA 3HZLA 3JAMC 3NIXA 5EW5E 4JI7E 3CCJP 1KDGA 2UZZA 4M30A 1L9DA 4U0AA 3HYVA 1IBME 2BS4A 3RP6A 2KR5A 2K92A 3DTJA 3G1GA 1O94A 4H2QA 4APNA 4CNJA 3SQPA 3OW2O 2EM8A 2H88A 4WXCA 3NKSA 3UP4A 1REOA 1VG0A 1PBCA 1E6JP 3BF2A 4U0EA 2YLRA 2IIDA 4H2WC 1XDIA 2UUBE 3GD3A 3NN6X 4H4YA 3UKQA 4BK2A 4H4TA 4YTNA 2F8BA 4R2SA 4AT0A 1ZMCA 3VR9A 2RS7A 2DLQA 3CE7A 4YWOA 3KPFA 2JK6A 2OLOA 3P4PA 2YVJA 4R2AA 1YYKA 4DV7E 2N5IA 1L0VA 1MOKA 3P4SA 3GZLA 2YWLA 1IBLE 5LLQA 4B1BA 2EOOA 4ZYDA 1OJAA 1ZU1A 3NNEA 4H4VA 3LB8A 1T38A 1M74A 2K0DX 1NHSA 2GR2A 4H4SA 5IQ1A 4NEWA 1S3EA 2EORA 1UBDC 2CNRA 3GYJA 2FQ0A 2L8TA 4R2CA 3DK9A 2E1MA 5A69A 3G21A 1WXRA 3P4RA 3HYWA 2LJHA 4Z26A 2GYKA 4NEOA 2CTDA 1IQOA 2WPCA 1CJ2A 5AC4A 2GR3A 4M9VC 4B3SE 1DXLA 4N9XA 1M6NA 2Y6RA 1KC8Q 4BBYA 2WESA 2WDQA 2L4BA 1Q86Q 2JP9A 4N4RB 1ZR9A 2R9ZA 3AYLA 2CULA 1PJ6A 1IJHA 3QSMA 1W4XA 3GMCA 1TDKA 2I13A 3HTXA 4K5SA 2EQ7A 1VQ9P 4NZHA 4X65E 5JCNA 1M6EX 3KPKA 4GDPA 1L4SA 4WX1A 4ECHA 3V3NA 3G5RA 1QVFO 2F5ZA 3SFDA 4JY2A 4NTDA 1K4QA 1V59A 2GDYA 1OJDA 3BBGA 3EQ1A 1VQ4P 4DR5E 2BCGG 2VQEE 4M0VA 1UHZA 4J56A 5EOWA 2EMKA 2BA9A 2R4EA 2XFPA 4DUYE 5FS6A 4CCQA 1YSAC 1NG4A 2YTQA 2K2QA 4Z25A 2RQLA 2ERHA 2YR4A 1RQ0A 2C65A 3CCQP 1H84A 3GRSA 4R2QA 2NA2A 3DGZA 5BUKA 2GZIA 2VLOA 3H8LA 4ZCCA 3Q6JA 2OLNA 3UKAA 5A6KA 1PBFA 1YJ9P 3FBSA 2EPAA 1NHPA 1MO9A 3CPIG 1N33E 1GERA 4MRTC 3KZYA 3T37A 3M99B 1F8WA 2WPEA 2EOZA 3AEBA 4DV1E 4KHPE 1MZ8A 3AUZA 3U43A 2EPNA 1KLPA 3GMBA 1LV0A 2KGAA 3GWFA 3J7Yp 4OPDA 1GZ6A 2M1SA 3G1IA 4GZNC 1B69A 4FDCB 1OJ9A 4IZ6A 5EBKA 2LMZA 3B4QA 4JI6E 3BHKA 2MC6A 1N32E 4B3ME 1PHHA 3DS3A 1SEZA 3T2YA 2FAEA 2HGHA 3ZOQB 4EQSA 4WYMA 3SXIA 2Z44A 1CJCA 5U1OA 1UN6B 1JNRA 3UOZA 1ZKQA 2GQFA 3DGHA 2YG5A 2VQ7A 4GAVA 4WYQB 1IMPA 2XFQA 1IUTA 3LMOA 2KODA 4F37A 4OPIA 4CRTA 2Q8UA 1MEYC 3IWAA 1VQOP 2TPRA 4GR1A 4NXME 2JYAA 3NG7X 2Q7VA 2JU1A 4OVIA 3SY4A 4EIQA 4II3A 2JB3A 3ECRA 4U0DA 1LVLA 3AE8A 2EMCA 1CJ3A 4TM4A 3VRLC 2V88A 2EN1A 1KJKA 4L8NA 2E72A 4PABA 2EPKX 2JB1A 1VQMP 4XXGA 2NUGA 4AP1A 5A2QC 1S2YA 2CQ8A 4WX9A 2C4CA 1QRJA 5KP8B 3ISHA 4PH1A 1O0WA 2G7HA 1VQKP 4K5RA 2BXSA 3BI2A 2K0XA 3II4A 3NYEA 2X8CA 2ONTA 2XV6A
chains in the Genus database with same CATH topology
1GPEA 2DB2A 4J33A 4FK1A 2CVJA 3T1YE 2WOIA 5IQ4A 3G26A 5LMUE 5JCKA 4NNJA 5HYMA 4NEVA 3CNJA 1O5WA 1P2EA 1DNCA 2RABA 4H4UA 1H7XA 2WU5A 4USQA 1TDNA 4G9KA 3AWIA 3KKJA 1GRGA 2WDRA 4H2RA 2V6OA 3T2ZA 2M7QA 1VRQB 3NTEA 5CFFE 1BAJA 2LBSB 2OARA 1Q9IA 2B76A 1KSUA 3Q9TA 3OZ2A 1NJIQ 1DJNA 1WHQA 3B6DA 3DS2A 2YM2A 2NUEA 1ZOVA 1GXFA 3JTZA 2YG7A 2BC0A 2QA4P 2V85A 1EBDA 1FEAA 2V5ZA 5HHFA 1YYWA 3LLHA 3AD9B 4ZCDA 3UKHA 4C3YA 3LXDA 4EQXA 4H4WA 4TM0A 4U2TA 3T14A 3HYXA 3G4SP 2EFJA 4XWRA 2UUCE 1VG9A 3QVRA 5HXIA 1E39A 3UTEA 1TDFA 3NH3X 4Z44A 3CC7P 4C5OA 1M64A 3H0DA 5ADZA 3SM8A 2FV4B 1NPXA 4A6NA 3SZ0A 1I94E 3H47A 3NTDA 1ZX9A 2XFOA 4OPUA 4B69A 3UCLA 2AAQA 3AE5A 3ITJA 2Z46A 4F9CB 1XNRE 5CKUA 4G6GA 3CPHG 1GREA 3CIRA 2L33A 2H89A 3CMMA 3C96A 5KMQA 2AR8A 3ABVA 1GTHA 3UKKA 2Z45A 2B9YA 2OAMA 4PH0A 3DS0A 4P7DA 3DK4A 2B9DA 1D5TA 1X49A 1S3BA 3VR8A 2BK5A 1ZP0A 2B7VA 1VQ6P 1KNRA 5AASA 2BK3A 3VRAA 1YYOA 2A87A 2LTSA 1XNQE 5C2TA 3REDA 2A8XA 4YY3E 5FS9A 3PS9A 3HYBA 2RSMA 2NPXA 3ZYXA 2HHHE 3IF9A 4DMIA 2PHHA 3G5SA 1Q81Q 1B8SA 4KPRA 3NK2X 4U8KA 4O5UA 2ZM6E 3C4AA 4BV6A 1K0LA 5HGOA 5HGMA 2Q0KA 5BVAA 1QU6A 4DR3E 3M0OA 4UDPA 4AOSA 2XVIA 1RO0A 3AEGA 4U0BA 2PEMA 4OX9E 3SX6A 2YR6A 1ONFA 5KRQA 3CCVP 3J7AG 2BS3A 4AQYE 3J81C 2BK4A 4OPCA 5DCKA 1D4DA 1RNIA 3C4BA 1A43A 2C66A 1NENA 5IPYA 1D1DA 5ER0A 5F2OA 2WOVA 3CNSA 1JRYA 3DS4A 4DV0E 1HNZE 1PJ5A 3GDPA 3K30A 2DKIA 1F8RA 2FGGA 1TRBA 5JCMA 1PBEA 2FBWA 4REKA 4U8JA 1E1KA 4DV6E 3IHGA 4D04A 1TYPA 1K0JA 1CBOA 3ICTA 2WP9A 2LUQA 1JNZA 1D7LA 2FJEA 2LTRA 5AE1A 1ZBTA 1EOQA 2B9XA 1K0IA 3E1TA 1SR9A 2XLUA 5FLXC 3CNTA 4K2XA 2Z5YA 4CNKA 1X31B 2XLSA 2Q0LA 4MJWA 2HQMA 3SZCA 2XVHA 3M13A 2YVFA 1Q1WA 4J31A 1GALA 5KNLA 3SFEA 2OTLP 2LRSA 4GKJE 4B3RE 1CC6A 3NTAA 2C67A 2GV8A 1HYUA 1LJ1A 3IHMA 1LPFA 2ZZ0A 4UDQA 4H4QA 2PENA 1DOEA 2IVEA 3SGLA 1IUSA 4XFXA 3NN0X 2C7GA 2WP5A 4DR2E 3V76A 3P9UA 2EZ6A 2YZTA 1PXCA 2GAGB 5EB4A 2L6EA 2PEJA 2YVGA 1RSGA 3WE0A 3CCLP 1KF6A 2P9XA 4A79A 2EQ8A 4J36A 2WU2A 5HGNA 1RYIA 3UTFA 1Q1RA 2R0PA 4JN9A 1GRTA 3F8DA 4GRTA 3AB1A 3F8RA 2EG5A 3J80C 4JNAA 1ELIA 1IBKE 4AOXA 4Y4NA 3ICSA 4RG4A 1MXTA 3DJWA 2WP6A 1T4NA 3EF6A 1DI2A 2V86A 3NLCA 4BJYA 2XVEA 4NWZA 2B7SA 3H4KA 3GDNA 1GRHA 3ADLA 1D4EA 4X9NA 1OJTA 1UILA 2QEXP 2PEIA 1XHCA 4LF5E 1PXAA 1STUA 3DK8A 1PXBA 3O0HA 4CBQA 2M4IA 4GF7A 3BNMA 3GYIA 4JI5E 5LL6R 1NEKA 3VQRA 4U8LA 3NGCX 2JYGA 3K7QX 1XMOE 1YKJA 2JR1A 2YM1A 1UKVG 1BGJA 3CMAP 4Z43A 1ZY8A 1CHUA 3AEEA 1Y56A 2PYXA 4B3TE 1X48A 2KOUA 1FCDA 4I59A 1GESA 4COPA 3B3RA 5C3JA 4XFZA 1E7PA 4LF4E 2BRYA 2V83A 3AE3A 3COXA 4U8NA 3ADAB 1VQ7P 2XVJA 4COCA 1GRBA 2ZZBA 4L5NC 2E4GA 1HNWE 3SZWA 3AE9A 4M52A 1N8RQ 4TLXA 4G6HA 3KVEA 3NYFA 3EAOA 2VF1A 4JI0E 3OTOE 3AECA 4R8OA 4KX6A 5JPAA 2GF3A 4O5QA 1JRZA 3P4QA 3D8XA 2YR5A 2M8NA 3FIGA 4EM4A 2C75A 4GAPA 4B64A 4LA1A 5JCLA 2BXRA 3BNUA 2RS6A 3CGBA 4BJZA 2EWLA 1IUWA 3DH9A 4M2ZA 4ADWA 3NHOX 1VQLP 2DMYA 1TYTA 1KQSO 5KMSA 4A7AA 1K9MQ 2XLRA 1DJQA 2JB2A 1KD1Q 2WETA 5DNYA 1M1KQ 5AE2A 3CCSP 2EQ9A 4J2WA 2WDVA 1N4UA 1K73Q 1PBBA 4BS9A 4B65A 4EIPA 1GTEA 3FG2P 3GRTA 3RP8A 1GQEA 4OPTA 3MSWA 2GB0A 5T6JA 4BC7A 2ZBWA 3RP7A 4JV5E 2BYBA 4HB9A 2JBVA 2WEUA 4XWZA 4II2A 1N4WA 2GQWA 1GRAA 3DMEA 4A6NB 4C3XA 4Q28A 3FPZA 4B63A 5KMRA 1FL2A 1GV4A 4DV4E 1N34E 4EMJA 4GKKE 1CF3A 1GRFA 3CD6P 4F9AB 2KHXA 3AEDA 5U63A 4I58A 2R46A 2M8PA 4YXDA 4CCRA 4NTCA 4A65A 3CCUP 2V87A 2J3NA 3UKPA 5BS1A 1YQ3A 1WHNA 5KXJA 1Q7YQ 2CFYA 5KMPA 5LV9A 3G5QA 1PKPA 3HQ1A 4LU6A 4A99A 4U2LA 3CCRP 5FS8A 3CPWO 3UKLA 3JSKA 4BMJA 1JOAA 5AE3A 3P05A 2BS2A 3UOXA 1CJ4A 2L6MA 1J5EE 3LOVA 2DIXA 3QSEA 2ZZCA 1H6VA 1JU2A 2V3BA 3GYXA 1KFYA 2R4JA 1EL5A 4LTYA 4U0FA 3F8PA 1IUQA 2V60A 3GD4A 2B3TB 4LFBE 2X99A 1JEHA 2F4VE 1YQ4A 3NYCA 3ADGA 4IA5A 1XPQA 5I4TG 1FKAE 3DS1A 1KSSA 2B9WA 3GSIA 1YITP 1S2QA 3OMLA 1GEUA 1XMQE 2E5VA 3G29A 5F2NA 5IWAE 3AD8B 4WCTA 1GETA 3I56P 1EL8A 3GWDA 2PEQA 4X62E 2Q6UA 1DOCA 4YTPA 2WZOA 3PVCA 1YIJP 3DJDA 2JOXA 1EL9A 2VVLA 2O9ZA 4JY3A 3QFAA 3DS5A 1H7WA 3VRBA 3UOVA 2YAUA 2XXMA 1H86A 2LF4A 3LZXA 3RMPA 5EB5A 5M10A 2L2MA 3HPZA 4AT2A 3UKFA 3HXLA 4LF9E 2YQUA 1QLBA 4NTEA 2ODRC 4GR6A 3BI4A 1FECA 3C4TA 2ARDA 1EL7A 3LZWA 2YLWA 2I0ZA 1VDCA 2W0HA 4OOGC 2GRTA 2OALA 3L8KA 4JI8E 3URHA 4EM3A 5LMNE 4USRA 2YG4A 3LADA 2V89A 1D7YA 1T4OA 4DSGA 2L3JA 3QFBA 2V3AA 2LE2A 1JRXA 4H4RA 2XFUA 1TDEA 4YKFA 3I55P 2C3CA 4EMWA 3H8IA 4JI2E 1E1LA 3AYIA 1Y0PA 1BZLA 1ZK7A 2XCGA 4TUGA 2QA2A 3DPHA 3VYXA 3UTHA 3KA7A 2GEWA 4DSHA 5IT9C 2C73A 4OPLA 4WPYA 4BK3A 1RC7A 4LFAE 4WSPA 4UDRA 4K0KE 3D1CA 3DJGX 5HGLA 2E5LE 4BC9A 1E1NA 4GCMA 1CC2A 1AUMA 3IC9A 4YT0A 1VQ8P 2N3HA 2JVAA 1YJWP 4IVOB 3ADJA 4WFTA 4GUVA 1NHQA 3SYIA 3G28A 1VQPP 1COYA 2VVLG 4JDRA 5J60A 4X8WA 4A5LA 1VQWA 3IWBA 3MGEA 3CNDA 2PEOA 2UXCE 1LTXR 2UUAE 4B68A 1K8AQ 5L46A 2XLPA 1ZMBA 4U8MA 1E1MA 3AEAA 2B7TA 1S72P 4AP3A 4LF7E 1YQZA 1Q82Q 2RGHA 1AOGA 2XVFA 1RP0A 2JWOA 3KD9A 2DSYA 2OA1A 3CNPA 3AV0A 3JU0A 4H7UA 2N3GA 4I8OA 3NRNA 1VQ5P 3OC4A 1YHQP 1J26A 3RNMA 3HZQA 3H09A 2VZ2A 1F8SA 1F6MA 3S61A 4GEQB 3QSSA 1W2BO 1PBDA 1H82A 2C72A 2C76A 4DV3E 4LFCE 2VRLA 1NAAA 1GOSA 1O95A 4IV9A 1OJCA 5FS7A 2JOBA 1K30A 2RTXA 3ADIA 4JQ9A 1ZBQA 2CWOA 1N1PA 5FMHA 4IPYA 3CCEP 4DV2E 4JI4E 2IVDA 2GR0A 4DV5E 4EQWA 1P2HA 2WS3A 3S5WA 5CQFA 5TR3A 4C77A 2CDUA 1Y56B 4B66A 3FMWA 4YTMA 4K7ZA 3CGEA 5F3WA 2VE7C 1TDOA 1A8OA 5BULA 1KNPA 2JO0A 4BURA 1ZDLA 1DOBA 4IA6A 2JYLA 1PJ7A 4R03A 3M12A 1PDHA 3CN8A 2AQJA 2XDOA 3AE1A 3C4NA 3CGDA 1D4CA 2KONA 2FJBA 3QVPA 2YLTA 4H2PA 4X66E 2XT1A 2VOUA 3G0VA 4LF8E 3ALLA 4NXNE 2EIAA 4XFYA 3KLJA 2BHVA 4H50A 4DR4E 2X3NA 2BRAA 2X50A 3CCMP 2VQFE 3DA1A 4D03A 4J34A 4LU9A 4EMIA 3F6HA 1GNDA 2GMHA 4JI3E 3T0KA 4FX9A 1YJNP 1H81A 4JYAE 3CC4P 5F2KA 3DJJA 4YSYA 2V8QB 1ZMDA 2VVMA 1L9CA 2OTJP 1YI2P 3AD7B 3BHFA 1ZOYA 3KU9A 4Z2RA 3LJPA 3FIMB 4DR1E 4OCGA 1QVGO 3EPTA 2R0CA 2WQYA 1EIAA 1BGNA 2YG3A 1BKWA 3UTGA 2BCPA 4H2NA 4DNAA 4Y4MA 2FJAA 5BRTA 1RO2A 3ICRA 2WHDA 4BCAA 2BACA 1NHRA 4CY6A 4P9SA 5GSNA 2C3DA 2QCUA 5KWFA 3K7TA 4JI1E 4DKKA 3CPJG 5BR8E 2C64A 2UU9E 3CTYA 3NK1X 2EQ6A 3T1HE 2RGJA 4K8DA 1LQUA 1LQTA 2QA1A 1JJ2O 5J7XA 4H4XA 1GT8A 2XFNA 4FK1C 1NG3A 2JAEA 4OPGA 1NDAA 1X47A 4DR7E 3B5IA 3E2DA 1VQNP 5HY5A 3AXBA 5KVIA 1N4VA 1YY5A 4J57A 4YSZA 2FJDA 2BABA 3CXCO 3RG6C 4YSHA 1T4LB 2JY9A 2L2NA 3KWRA 2JKCA 2R0GA 3LRYA 3I3LA 5BS2A 1FOHA 2WPFA 3AE4A 2WOWA 3HPSA 3NT6A 1IUXA 2APGA 3H4EA 2V61A 1B5QA 3AE7A 4XROA 2XLTA 4TUIA 5GRTA 4Z2UA 1BF3A 2GAHB 2YLSA 3CMEP 2Z5XA 4X9MA 3ALMA 4UP3A 4A9WA 4YSXA 4RG3A 2WBAA 3G6EP 3K7MX 1GSNA 4ZN0A 2L92A 3ALJA 2R45A 2A89A 3P1WA 3CC2P 1M90Q 1HR0E 3DJEA 2L2KB 3VYYA 3AE2A 1QO8A 3Q20A 3IWCA 3VK6A 3T2KA 4X4JA 1B4VA 3EANA 2FTXB 4LF6E 1PS9A 1M6IA 4E0VA 3VRDB 3RHAA 2X8GA 2PY8A 4HA6A 4U2SA 2X8HA 4CY8A 4QNBA 2NVKX 4U8PA 2XYOA 1EKZA 4LIIA 4Z24A 4K22A 3ZDNA 3DF6A 3AYJA 4KZSA 4TM1A 5KOXA 4G73A 2YT4A 1H83A 5U25A 2YLXA 2GMJA 4XRQA 5M0ZA 2H36X 4P78A 1L9EA 4J8ZA 3PO7A 4C74A 2DGYA 2MDRA 4ICYA 1CC4A 1YZ9A 4Z2TA 3SZFA 4DGKA 2YG6A 3L1RA 3QJ4A 2GH5A 2BC1A 4U8OA 3UP5A 1B37A 2IHR1 1F3PA 3CGCA 1DODA 1QJDA 3ATQA 1DQ3A 4YHHE 2LUPB 2Y6QA 3F6GA 3IWDA 2GVCA 5JCIA 2C70A 2MC5A 2DKHA 2ODRD 3BI5A 1IUVA 3K6QA 4B67A 3WBHA 4Y4LA 4GDEA 4JNQA 4IVMB 3R9UA 2TMDA 4TLZA 2GR1A 4GR2A 2VRMA 2YLZA 1IUUA 2UXBE 1FEBA 4RSLA 3G71P 3V3OA 2BUOA 2PEKA 3ATRA 4EQRA 3I6DA 1PN0A 5KVHA 1XANA 4X64E 1HNXE 3UOYA 2K4VA 2ACZA 2M8LA 4H4PA 4G74A 3T31A 4BK1A 4DUZE 2QAEA 3AE6A 1N36E 3NK0X 5DBJA 4H4ZA 4U8IA 2NUFA 1E6EA 4YKGA 2RGOA 4PAAA 3LMLA 4F9BB 2CPNA 4F54A 1CL0A 5KOWA 4DR6E 3M1MA 4TM3A 1BWCA 2VQBA 4U0CA 1FJGE 2L3CA 2UXDE 4M0IA 3AEFA 2B7RA 1Z6LA 3P1XA 3HZLA 3JAMC 3NIXA 4JI7E 3CCJP 1KDGA 2UZZA 4M30A 1L9DA 4U0AA 3HYVA 1IBME 2BS4A 3RP6A 3DTJA 3G1GA 1O94A 4H2QA 4APNA 4CNJA 3SQPA 3OW2O 2H88A 3NKSA 3UP4A 1REOA 1VG0A 1PBCA 1E6JP 4U0EA 2YLRA 2IIDA 1XDIA 2UUBE 3GD3A 3NN6X 4H4YA 3UKQA 4BK2A 4H4TA 4YTNA 2F8BA 4AT0A 1ZMCA 3VR9A 2RS7A 4YWOA 3KPFA 2JK6A 2OLOA 3P4PA 2YVJA 1YYKA 4DV7E 1L0VA 1MOKA 3P4SA 2YWLA 1IBLE 4B1BA 1OJAA 4H4VA 3NNEA 3LB8A 1M74A 1NHSA 2GR2A 4H4SA 5IQ1A 4NEWA 1S3EA 3GYJA 2L8TA 3DK9A 2E1MA 3G21A 1WXRA 3P4RA 3HYWA 2LJHA 4Z26A 2WPCA 1CJ2A 2GR3A 4B3SE 1DXLA 4N9XA 1M6NA 2Y6RA 1KC8Q 4BBYA 2WESA 2WDQA 1Q86Q 2R9ZA 3AYLA 2CULA 1PJ6A 1IJHA 3QSMA 1W4XA 3GMCA 1TDKA 3HTXA 4K5SA 2EQ7A 1VQ9P 4NZHA 4X65E 5JCNA 1M6EX 3KPKA 4GDPA 4WX1A 4ECHA 3V3NA 3G5RA 1QVFO 2F5ZA 3SFDA 4JY2A 4NTDA 1K4QA 1V59A 1OJDA 4DR5E 1VQ4P 2BCGG 2VQEE 4M0VA 1UHZA 4J56A 5EOWA 2BA9A 2R4EA 2XFPA 4DUYE 5FS6A 4CCQA 1NG4A 4Z25A 2YR4A 1RQ0A 2C65A 3CCQP 1H84A 3GRSA 2NA2A 3DGZA 5BUKA 3H8LA 4ZCCA 3Q6JA 2OLNA 3UKAA 1PBFA 1YJ9P 3FBSA 3CPIG 1N33E 1GERA 1MO9A 1NHPA 3T37A 1F8WA 2WPEA 3AEBA 4DV1E 4KHPE 3AUZA 3GMBA 1LV0A 3GWFA 3J7Yp 4OPDA 1GZ6A 2M1SA 3G1IA 4FDCB 1OJ9A 5EBKA 2LMZA 4JI6E 3BHKA 2MC6A 1N32E 4B3ME 1PHHA 3DS3A 1SEZA 3T2YA 3ZOQB 4EQSA 4WYMA 3SXIA 2Z44A 1CJCA 5U1OA 1JNRA 3UOZA 1ZKQA 2GQFA 3DGHA 2YG5A 2VQ7A 4GAVA 4WYQB 2XFQA 1IUTA 2KODA 4OPIA 4CRTA 3IWAA 1VQOP 2TPRA 4GR1A 4NXME 3NG7X 2Q7VA 4OVIA 3SY4A 4EIQA 4II3A 2JB3A 4U0DA 1LVLA 3AE8A 1CJ3A 4TM4A 3VRLC 2V88A 4L8NA 4PABA 2JB1A 1VQMP 4XXGA 2NUGA 4AP1A 5A2QC 1S2YA 2C4CA 1QRJA 3ISHA 4PH1A 1O0WA 2G7HA 1VQKP 4K5RA 2BXSA 3BI2A 3II4A 3NYEA 2X8CA 2ONTA 2XV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YG6 A;  1GPE A;  3L1R A;  3QJ4 A;  1COY A;  2GH5 A;  2BC1 A;  4J33 A;  2VVL G;  4JDR A;  5J60 A;  1PXA A;  4FK1 A;  2CVJ A;  4A5L A;  1VQW A;  2WOI A;  5IQ4 A;  4U8O A;  3DK8 A;  3CND A;  3UP5 A;  1PXB A;  1B37 A;  3O0H A;  4CBQ A;  5JCK A;  5HYM A;  1F3P A;  3CGC A;  1DOD A;  4NEV A;  1QJD A;  3ATQ A;  4GF7 A;  1LTX R;  3CNJ A;  1O5W A;  3BNM A;  1P2E A;  3GYI A;  4B68 A;  1DNC A;  2RAB A;  5L46 A;  4H4U A;  2XLP A;  2Y6Q A;  1H7X A;  2WU5 A;  1NEK A;  4U8M A;  3VQR A;  4U8L A;  3NGC X;  1E1M A;  2GVC A;  4USQ A;  5JCI A;  1TDN A;  3K7Q X;  2C70 A;  3AEA A;  3AWI A;  3KKJ A;  1GRG A;  2WDR A;  2DKH A;  1YKJ A;  2YM1 A;  3BI5 A;  4AP3 A;  1IUV A;  1UKV G;  1BGJ A;  1YQZ A;  4H2R A;  4Z43 A;  1ZY8 A;  2V6O A;  1CHU A;  2RGH A;  3AEE A;  4B67 A;  1VRQ B;  1AOG A;  1Y56 A;  2PYX A;  2XVF A;  4Y4L A;  1RP0 A;  4GDE A;  3KD9 A;  4JNQ A;  4IVM B;  3R9U A;  2OA1 A;  2TMD A;  1Q9I A;  1FCD A;  2B76 A;  3CNP A;  4I59 A;  1GES A;  3B3R A;  4H7U A;  5C3J A;  1E7P A;  1KSU A;  3NRN A;  4TLZ A;  3Q9T A;  2GR1 A;  3OZ2 A;  1DJN A;  3OC4 A;  3AE3 A;  3B6D A;  2YM2 A;  2VRM A;  2YLZ A;  3RNM A;  3COX A;  1IUU A;  1ZOV A;  1FEB A;  2VZ2 A;  4U8N A;  1F8S A;  3ADA B;  1F6M A;  2XVJ A;  3S61 A;  1GXF A;  4RSL A;  3QSS A;  1GRB A;  1PBD A;  1H82 A;  2C72 A;  2ZZB A;  2C76 A;  2YG7 A;  2BC0 A;  3V3O A;  2VRL A;  2E4G A;  3ATR A;  1EBD A;  1FEA A;  4EQR A;  2V5Z A;  3AE9 A;  3I6D A;  5HHF A;  1PN0 A;  4M52 A;  1NAA A;  5KVH A;  1GOS A;  1XAN A;  4TLX A;  4ZCD A;  3AD9 B;  3KVE A;  3UKH A;  4C3Y A;  3NYF A;  3LXD A;  4EQX A;  3EAO A;  4H4W A;  1O95 A;  4TM0 A;  4IV9 A;  3UOY A;  1OJC A;  4U2T A;  2ACZ A;  5FS7 A;  4XWR A;  3AEC A;  4H4P A;  4BK1 A;  1VG9 A;  3QVR A;  4KX6 A;  5HXI A;  4JQ9 A;  1E39 A;  2GF3 A;  2QAE A;  4O5Q A;  3AE6 A;  3UTE A;  1JRZ A;  3P4Q A;  3NK0 X;  1TDF A;  5DBJ A;  3D8X A;  3NH3 X;  2YR5 A;  1N1P A;  5FMH A;  4Z44 A;  4C5O A;  1M64 A;  4EM4 A;  3SM8 A;  2C75 A;  4B64 A;  4H4Z A;  4LA1 A;  2IVD A;  1NPX A;  4U8I A;  4A6N A;  1E6E A;  2GR0 A;  4YKG A;  5JCL A;  2RGO A;  4EQW A;  2BXR A;  1P2H A;  3NTD A;  4PAA A;  2WS3 A;  1ZX9 A;  3BNU A;  2XFO A;  4OPU A;  3S5W A;  5CQF A;  3CGB A;  5TR3 A;  4BJZ A;  1CL0 A;  4C77 A;  4B69 A;  5KOW A;  3UCL A;  2AAQ A;  1IUW A;  2CDU A;  3AE5 A;  3DH9 A;  4ADW A;  3ITJ A;  1Y56 B;  3NHO X;  4B66 A;  3FMW A;  1TYT A;  4TM3 A;  4YTM A;  4K7Z A;  1BWC A;  3CGE A;  5CKU A;  2VQB A;  4A7A A;  1TDO A;  3CPH G;  1GRE A;  5BUL A;  3CIR A;  1KNP A;  2H89 A;  4BUR A;  3C96 A;  3AEF A;  2B7R A;  1ZDL A;  1Z6L A;  2AR8 A;  2XLR A;  1DJQ A;  2JB2 A;  3ABV A;  3HZL A;  1GTH A;  3UKK A;  3NIX A;  1DOB A;  4IA6 A;  2B9Y A;  2OAM A;  1PJ7 A;  2WET A;  3M12 A;  1KDG A;  3DK4 A;  2UZZ A;  2EQ9 A;  1L9D A;  4J2W A;  1D5T A;  1S3B A;  1PDH A;  2BS4 A;  3VR8 A;  2WDV A;  2BK5 A;  1N4U A;  3CN8 A;  1PBB A;  1ZP0 A;  2AQJ A;  2XDO A;  3AE1 A;  3RP6 A;  3C4N A;  3CGD A;  1KNR A;  1O94 A;  4H2Q A;  1D4C A;  4APN A;  4CNJ A;  4B65 A;  4EIP A;  3SQP A;  1GTE A;  2FJB A;  2H88 A;  3QVP A;  3FG2 P;  2YLT A;  3NKS A;  4H2P A;  2BK3 A;  3VRA A;  3GRT A;  3UP4 A;  1REO A;  2A87 A;  3RP8 A;  2VOU A;  4OPT A;  5C2T A;  3RED A;  1VG0 A;  1PBC A;  2A8X A;  5FS9 A;  3ALL A;  2GB0 A;  3KLJ A;  2ZBW A;  2YLR A;  4H50 A;  3PS9 A;  2IID A;  3RP7 A;  2NPX A;  2BYB A;  1XDI A;  4HB9 A;  3ZYX A;  2X3N A;  2JBV A;  2WEU A;  3IF9 A;  2PHH A;  3G5S A;  3GD3 A;  3NN6 X;  4H4Y A;  4XWZ A;  3UKQ A;  4BK2 A;  4H4T A;  2X50 A;  1B8S A;  4KPR A;  3NK2 X;  1N4W A;  4YTN A;  2GQW A;  1GRA A;  4AT0 A;  1ZMC A;  3DME A;  4U8K A;  4O5U A;  3VR9 A;  3DA1 A;  4A6N B;  4J34 A;  4C3X A;  4D03 A;  4YWO A;  3KPF A;  2JK6 A;  2OLO A;  3FPZ A;  3P4P A;  4EMI A;  4B63 A;  2YVJ A;  1FL2 A;  3C4A A;  1GV4 A;  1GND A;  2GMH A;  1L0V A;  4EMJ A;  4BV6 A;  1K0L A;  1MOK A;  3P4S A;  4FX9 A;  1CF3 A;  2Q0K A;  1GRF A;  1H81 A;  5BVA A;  2YWL A;  3AED A;  4B1B A;  5U63 A;  4I58 A;  3M0O A;  1OJA A;  4UDP A;  4H4V A;  3NNE A;  2R46 A;  3LB8 A;  4YXD A;  4CCR A;  1NHS A;  2GR2 A;  3DJJ A;  4H4S A;  4NTC A;  5IQ1 A;  4A65 A;  4AOS A;  2XVI A;  4YSY A;  4NEW A;  1S3E A;  1ZMD A;  2J3N A;  3AEG A;  2VVM A;  1L9C A;  3UKP A;  1YQ3 A;  3GYJ A;  2YR6 A;  1ONF A;  3AD7 B;  2E1M A;  3DK9 A;  3P4R A;  5KXJ A;  3BHF A;  1ZOY A;  3KU9 A;  4Z26 A;  4Z2R A;  3LJP A;  3FIM B;  4OCG A;  5KRQ A;  3EPT A;  2R0C A;  2CFY A;  2WPC A;  1CJ2 A;  2WQY A;  2GR3 A;  1BGN A;  2YG3 A;  1BKW A;  3G5Q A;  3UTG A;  5LV9 A;  2BCP A;  2BS3 A;  4H2N A;  4DNA A;  1DXL A;  4Y4M A;  2BK4 A;  4N9X A;  4OPC A;  2Y6R A;  1D4D A;  2WES A;  2FJA A;  2WDQ A;  5BRT A;  4LU6 A;  4A99 A;  3ICR A;  4U2L A;  2C66 A;  2R9Z A;  2WHD A;  5FS8 A;  2BAC A;  3AYL A;  1NHR A;  1NEN A;  2CUL A;  1PJ6 A;  5IPY A;  3UKL A;  3JSK A;  4CY6 A;  1IJH A;  3QSM A;  1W4X A;  3GMC A;  1TDK A;  4P9S A;  4K5S A;  1JOA A;  2EQ7 A;  4NZH A;  5ER0 A;  5GSN A;  2BS2 A;  3UOX A;  5JCN A;  1CJ4 A;  2C3D A;  2QCU A;  4GDP A;  4WX1 A;  2WOV A;  4ECH A;  5KWF A;  3V3N A;  3G5R A;  3LOV A;  3K7T A;  2ZZC A;  1H6V A;  1JU2 A;  1JRY A;  2V3B A;  3CNS A;  3QSE A;  1KFY A;  2F5Z A;  3SFD A;  2R4J A;  1EL5 A;  4JY2 A;  1PJ5 A;  3GDP A;  3K30 A;  4NTD A;  1K4Q A;  1V59 A;  2DKI A;  3CPJ G;  1OJD A;  1F8R A;  2BCG G;  1TRB A;  5JCM A;  1PBE A;  2FBW A;  2C64 A;  4REK A;  3CTY A;  3F8P A;  3NK1 X;  4J56 A;  2V60 A;  4U8J A;  2EQ6 A;  3GD4 A;  1E1K A;  2RGJ A;  4K8D A;  5EOW A;  2BA9 A;  2R4E A;  2XFP A;  1LQU A;  1LQT A;  2X99 A;  3IHG A;  5FS6 A;  4CCQ A;  4D04 A;  2QA1 A;  1TYP A;  1NG4 A;  1JEH A;  1K0J A;  1CBO A;  5J7X A;  4Z25 A;  1YQ4 A;  3NYC A;  3ICT A;  4H4X A;  2WP9 A;  1GT8 A;  1JNZ A;  1D7L A;  2XFN A;  1XPQ A;  2YR4 A;  4IA5 A;  2C65 A;  4FK1 C;  1KSS A;  2FJE A;  1NG3 A;  2B9W A;  3GSI A;  2JAE A;  4OPG A;  1H84 A;  1S2Q A;  1NDA A;  3GRS A;  2B9X A;  1GEU A;  2E5V A;  1K0I A;  3DGZ A;  5BUK A;  3H8L A;  3E1T A;  3Q6J A;  4ZCC A;  3AXB A;  5KVI A;  5HY5 A;  2OLN A;  3AD8 B;  2XLU A;  1N4V A;  4WCT A;  1YY5 A;  3UKA A;  1GET A;  1EL8 A;  1PBF A;  3CNT A;  3GWD A;  2FJD A;  2Z5Y A;  4J57 A;  4K2X A;  4YSZ A;  4CNK A;  2Q6U A;  3FBS A;  1DOC A;  4YTP A;  2BAB A;  3CPI G;  1GER A;  1MO9 A;  1NHP A;  1X31 B;  2XLS A;  2Q0L A;  4MJW A;  2HQM A;  4YSH A;  3PVC A;  3T37 A;  2XVH A;  1F8W A;  2WPE A;  3DJD A;  3AEB A;  2JKC A;  2R0G A;  3I3L A;  1EL9 A;  2VVL A;  2O9Z A;  4JY3 A;  1FOH A;  2WPF A;  3QFA A;  3M13 A;  3AE4 A;  1H7W A;  2YVF A;  3VRB A;  1Q1W A;  2WOW A;  3NT6 A;  3UOV A;  2YAU A;  1GAL A;  4J31 A;  3GMB A;  1IUX A;  1H86 A;  1LV0 A;  2APG A;  3GWF A;  3LZX A;  5EB5 A;  5M10 A;  2V61 A;  3SFE A;  4OPD A;  4AT2 A;  1B5Q A;  3AE7 A;  3UKF A;  2XLT A;  5GRT A;  4Z2U A;  2YQU A;  1BF3 A;  1CC6 A;  1QLB A;  2GAH B;  4NTE A;  4FDC B;  1OJ9 A;  3BI4 A;  3NTA A;  2C67 A;  2YLS A;  2GV8 A;  1FEC A;  5EBK A;  1HYU A;  2ARD A;  1LJ1 A;  3IHM A;  1EL7 A;  2Z5X A;  4X9M A;  3ALM A;  1LPF A;  2ZZ0 A;  3BHK A;  3LZW A;  4UDQ A;  4UP3 A;  4RG3 A;  4A9W A;  4H4Q A;  4YSX A;  1PHH A;  2YLW A;  1SEZ A;  1DOE A;  2WBA A;  3K7M X;  1GSN A;  2IVE A;  3SGL A;  4EQS A;  2I0Z A;  1VDC A;  2W0H A;  4ZN0 A;  3ALJ A;  2R45 A;  1IUS A;  2A89 A;  2GRT A;  3NN0 X;  2C7G A;  2OAL A;  1CJC A;  2WP5 A;  5U1O A;  3P1W A;  3L8K A;  3V76 A;  3P9U A;  3URH A;  1JNR A;  4EM3 A;  3DJE A;  3UOZ A;  4USR A;  1PXC A;  2GAG B;  1ZKQ A;  5EB4 A;  2GQF A;  3DGH A;  2YG4 A;  2YG5 A;  2YVG A;  2VQ7 A;  3AE2 A;  3LAD A;  1D7Y A;  1QO8 A;  4DSG A;  2XFQ A;  1IUT A;  3QFB A;  1RSG A;  4OPI A;  4CRT A;  2V3A A;  3WE0 A;  1KF6 A;  3IWA A;  4X4J A;  4A79 A;  2TPR A;  1B4V A;  1JRX A;  2EQ8 A;  3EAN A;  2XFU A;  4GR1 A;  4H4R A;  4J36 A;  1PS9 A;  2WU2 A;  3NG7 X;  2Q7V A;  1TDE A;  4OVI A;  1RYI A;  4EIQ A;  4YKF A;  1Q1R A;  2C3C A;  3UTF A;  2JB3 A;  2R0P A;  1M6I A;  4E0V A;  4JN9 A;  4EMW A;  3VRD B;  3RHA A;  3H8I A;  1GRT A;  3F8D A;  1LVL A;  4GRT A;  3AB1 A;  1E1L A;  2X8G A;  3AE8 A;  3F8R A;  4JNA A;  1CJ3 A;  1ELI A;  4AOX A;  3AYI A;  4TM4 A;  4Y4N A;  3ICS A;  1Y0P A;  4HA6 A;  4RG4 A;  1MXT A;  1BZL A;  4U2S A;  1ZK7 A;  2XCG A;  2WP6 A;  2X8H A;  4CY8 A;  2NVK X;  4U8P A;  2QA2 A;  2XYO A;  4LII A;  4Z24 A;  4K22 A;  3ZDN A;  3AYJ A;  3UTH A;  3KA7 A;  2GEW A;  4PAB A;  4DSH A;  4TM1 A;  2JB1 A;  3EF6 A;  2C73 A;  4OPL A;  5KOX A;  4BK3 A;  1H83 A;  3NLC A;  4XXG A;  5U25 A;  2YLX A;  4AP1 A;  4UDR A;  3D1C A;  3DJG X;  1S2Y A;  2GMJ A;  1E1N A;  4GCM A;  1CC2 A;  4BJY A;  2XVE A;  3ISH A;  5M0Z A;  1L9E A;  2B7S A;  3PO7 A;  4C74 A;  3IC9 A;  4YT0 A;  1CC4 A;  3H4K A;  4ICY A;  4K5R A;  3GDN A;  2BXS A;  1GRH A;  4IVO B;  4Z2T A;  3BI2 A;  1D4E A;  4X9N A;  1OJT A;  3II4 A;  3NYE A;  2X8C A;  4GUV A;  1NHQ A;  4DGK A;  1XHC A; 
#chains in the Genus database with same CATH topology
 1GPE A;  2L0Q A;  2DB2 A;  4J33 A;  2EOJ A;  1A1H A;  2CVJ A;  4FK1 A;  3T1Y E;  2WOI A;  5IQ4 A;  3G26 A;  5LMU E;  4R2E A;  5JCK A;  4NNJ A;  5HYM A;  4NEV A;  4PXH B;  3KZZ A;  3CNJ A;  1O5W A;  1P2E A;  1DNC A;  2RAB A;  4H4U A;  3MHH C;  1H7X A;  2WU5 A;  4USQ A;  1TDN A;  4G9K A;  3AWI A;  1A1J A;  4O4K A;  5KL2 A;  1GRG A;  3KKJ A;  2WDR A;  4MLV A;  5KL4 A;  4H2R A;  2V6O A;  3T2Z A;  2M7Q A;  2MKN A;  1VRQ B;  1Z6M A;  3NTE A;  5CFF E;  4F6N A;  1BAJ A;  2LBS B;  2OAR A;  2K0Y A;  1HQB A;  1Q9I A;  2B76 A;  2YTJ A;  1KSU A;  3Q9T A;  3OZ2 A;  1NJI Q;  1DJN A;  1WHQ A;  4MLQ A;  3B6D A;  3DS2 A;  2YM2 A;  2NUE A;  1ZOV A;  2GZG A;  2N8X A;  1GXF A;  3JTZ A;  2YG7 A;  2BC0 A;  2QA4 P;  2V85 A;  1EBD A;  1FEA A;  2V5Z A;  5HHF A;  1YYW A;  2FVA A;  3LLH A;  3AD9 B;  4ZCD A;  3UKH A;  4C3Y A;  2QNW A;  3LXD A;  4EQX A;  4H4W A;  4TM0 A;  4U2T A;  2N6Y A;  2JU2 A;  3HYX A;  3G4S P;  3T14 A;  2EFJ A;  4XWR A;  1PJS A;  2UUC E;  1VG9 A;  3QVR A;  5HXI A;  2YTE A;  1E39 A;  3UTE A;  1TDF A;  3NH3 X;  4Z44 A;  3CC7 P;  4C5O A;  1M64 A;  3H0D A;  5ADZ A;  2GZJ A;  3SM8 A;  2NAB A;  2FV4 B;  2YRH A;  1NPX A;  4A6N A;  1X6F A;  3SZ0 A;  1I94 E;  3H47 A;  3NTD A;  1ZX9 A;  2XFO A;  4OPU A;  4B69 A;  3UCL A;  2AAQ A;  3AE5 A;  3ITJ A;  2Z46 A;  4F9C B;  1GTK A;  1XNR E;  5CKU A;  4G6G A;  2RSI A;  3CPH G;  1GRE A;  3CIR A;  2L33 A;  2H89 A;  3CMM A;  3C96 A;  5KMQ A;  2AR8 A;  3ABV A;  1GTH A;  3UKK A;  2Z45 A;  2B9Y A;  2OAM A;  4PH0 A;  3DS0 A;  4P7D A;  3DK4 A;  2B9D A;  1D5T A;  1X49 A;  1S3B A;  3VR8 A;  2BK5 A;  1ZP0 A;  2MDG A;  2B7V A;  1VQ6 P;  1KNR A;  5AAS A;  1L0H A;  2BK3 A;  3VRA A;  1YYO A;  2A87 A;  2LTS A;  2JPA A;  1XNQ E;  5C2T A;  3RED A;  2A8X A;  2EML A;  4YY3 E;  5FS9 A;  2EOQ A;  3PS9 A;  3HYB A;  2RSM A;  2NPX A;  3ZYX A;  2HHH E;  2LPK A;  3IF9 A;  2EOI A;  4DMI A;  2PHH A;  3G5S A;  1JK1 A;  1Q81 Q;  1B8S A;  4KPR A;  3NK2 X;  4U8K A;  4O5U A;  2ZM6 E;  2LKI A;  3C4A A;  4BPH A;  1X3C A;  4BV6 A;  1K0L A;  5HGO A;  5HGM A;  2Q0K A;  5BVA A;  1QU6 A;  4DR3 E;  3M0O A;  4UDP A;  4UHP B;  4ZYE A;  1F2I G;  4AOS A;  2XVI A;  1RO0 A;  3AEG A;  4U0B A;  2PEM A;  4OX9 E;  2JQ4 A;  3SX6 A;  2YR6 A;  1ONF A;  2WPT A;  2ELY A;  2EPZ A;  5KRQ A;  3CCV P;  3J7A G;  2BS3 A;  4AQY E;  3J81 C;  2BK4 A;  4OPC A;  1D4D A;  5DCK A;  1RNI A;  3C4B A;  1Z1B A;  1A43 A;  2C66 A;  1NEN A;  5IPY A;  1D1D A;  1GXH A;  2EM2 A;  5ER0 A;  2EMW A;  5F2O A;  2WOV A;  3CNS A;  2YSO A;  1JRY A;  3DS4 A;  4DV0 E;  1HNZ E;  1PJ5 A;  3GDP A;  3K30 A;  2MY5 A;  1VHN A;  2DKI A;  1F8R A;  2FGG A;  1TRB A;  5JCM A;  1PBE A;  2FBW A;  2EM5 A;  4REK A;  4U8J A;  2EMF A;  1E1K A;  4DV6 E;  3IHG A;  4D04 A;  1TYP A;  1K0J A;  1CBO A;  2EQ0 A;  3ICT A;  2WP9 A;  2LUQ A;  1JNZ A;  1D7L A;  2FJE A;  1TF6 A;  2EPO A;  2LTR A;  5AE1 A;  1ZBT A;  2B9X A;  1EOQ A;  2EHS A;  1K0I A;  3E1T A;  1SR9 A;  2XLU A;  5EJD A;  5FLX C;  3CNT A;  4K2X A;  2Z5Y A;  4CNK A;  1X31 B;  2XLS A;  2EOH A;  2Q0L A;  4MJW A;  2HQM A;  3SZC A;  2XVH A;  3M13 A;  2YVF A;  1Q1W A;  4J31 A;  1GAL A;  2GDW A;  5KNL A;  2YTI A;  2LTE A;  3SFE A;  2OTL P;  2EPX A;  2LRS A;  4GKJ E;  4O43 A;  4B3R E;  2YRM A;  1CC6 A;  3NTA A;  2C67 A;  4R2P A;  2GV8 A;  1HYU A;  1TN9 A;  1LJ1 A;  3IHM A;  1LPF A;  2ZZ0 A;  4UDQ A;  4H4Q A;  2PEN A;  2LL8 A;  1DOE A;  3NY7 B;  2IVE A;  3SGL A;  1PJT A;  2EJ4 A;  1IUS A;  4XFX A;  2KOP A;  3NN0 X;  2C7G A;  2WP5 A;  2AVA A;  4DR2 E;  3V76 A;  3P9U A;  2EZ6 A;  2YZT A;  1PXC A;  2GAG B;  5EB4 A;  4F2J C;  2L6E A;  2PEJ A;  2YVG A;  1ZAA C;  2GHF A;  1RSG A;  3WE0 A;  2ENH A;  3CCL P;  2WCC 3;  1KF6 A;  2P9X A;  4Q35 B;  4A79 A;  2EQ8 A;  4J36 A;  2WU2 A;  2MD9 A;  5HGN A;  1SFE A;  1RYI A;  3UTF A;  1Q1R A;  2R0P A;  1DGC A;  4JN9 A;  2JB0 A;  5IV8 B;  1GRT A;  3F8D A;  2EM0 A;  3AB1 A;  3F8R A;  2EG5 A;  4GRT A;  3J80 C;  4JNA A;  1ELI A;  1IBK E;  4AOX A;  4Y4N A;  3ICS A;  2BB8 A;  2JBG A;  4RG4 A;  1MXT A;  3DJW A;  2WP6 A;  1T4N A;  1BXI A;  3EF6 A;  1DI2 A;  2V86 A;  3NLC A;  1A1G A;  4BJY A;  2XVE A;  2ENA A;  4NWZ A;  2YU8 A;  2CGQ A;  2EN2 A;  2B7S A;  3H4K A;  3GDN A;  1GRH A;  3ADL A;  1D4E A;  4X9N A;  2DGC A;  1OJT A;  2N6Z A;  1UIL A;  2QEX P;  4O24 A;  2PEI A;  1L0I A;  1XHC A;  2EOY A;  4LF5 E;  1PXA A;  1STU A;  3DK8 A;  4H2X C;  2AF8 A;  1PXB A;  3O0H A;  4CBQ A;  1EMV A;  2M4I A;  2EM3 A;  2GLI A;  4GF7 A;  3BNM A;  3GYI A;  4JI5 E;  5LL6 R;  1NEK A;  3VQR A;  4U8L A;  3NGC X;  2JYG A;  3K7Q X;  1XMO E;  4RH8 A;  1YKJ A;  2JR1 A;  2YM1 A;  1UKV G;  1BGJ A;  3CMA P;  4Z43 A;  1ZY8 A;  2EMH A;  1CHU A;  3AEE A;  1Y56 A;  2PYX A;  4B3T E;  1X48 A;  2KOU A;  1FCD A;  4I59 A;  1GES A;  4COP A;  2DLK A;  3B3R A;  5C3J A;  4XFZ A;  1E7P A;  4LF4 E;  2BRY A;  2V83 A;  2N50 A;  3AE3 A;  2DMI A;  2EE8 A;  3COX A;  4U8N A;  3ADA B;  1VQ7 P;  2XVJ A;  4COC A;  1GRB A;  7CEI A;  2ZZB A;  4L5N C;  2E4G A;  1HNW E;  2L9F A;  5A6A A;  3SZW A;  3AE9 A;  4M52 A;  1N8R Q;  4TLX A;  4G6H A;  3KVE A;  3NYF A;  3EAO A;  2VF1 A;  4JI0 E;  3OTO E;  1YFH A;  3AEC A;  2MVU A;  4R8O A;  4KX6 A;  5JPA A;  1KYQ A;  2GF3 A;  1DV5 A;  4O5Q A;  1JRZ A;  3P4Q A;  3D8X A;  2YR5 A;  2M8N A;  3FIG A;  4EM4 A;  2C75 A;  2ROQ A;  2L22 A;  4GAP A;  4B64 A;  4LA1 A;  5JCL A;  2BXR A;  3BNU A;  5HV8 A;  2RS6 A;  3CGB A;  4BJZ A;  2EWL A;  1IUW A;  3DH9 A;  4M2Z A;  4ADW A;  3NHO X;  1VQL P;  2DMY A;  2D9H A;  3L00 A;  1TYT A;  2MR8 A;  1KQS O;  5KMS A;  4A7A A;  2VLN A;  1K9M Q;  5CZD B;  4BPG A;  2XLR A;  1DJQ A;  2JB2 A;  1KD1 Q;  2WET A;  5DNY A;  2DNW A;  1M1K Q;  5AE2 A;  3CCS P;  2EPP A;  2EQ9 A;  4WXD A;  4J2W A;  2WDV A;  1N4U A;  1K73 Q;  1PBB A;  2KGD A;  4BS9 A;  2WBS A;  4B65 A;  4EIP A;  1GTE A;  3FG2 P;  3GRT A;  3RP8 A;  1GQE A;  3TQM A;  4OPT A;  5HVC A;  3MSW A;  2GB0 A;  5T6J A;  2LO3 A;  4BC7 A;  2ZBW A;  2YTO A;  3RP7 A;  4JV5 E;  2BYB A;  4HB9 A;  2JBV A;  2WEU A;  4XWZ A;  4II2 A;  2EMA A;  4ZYG A;  1N4W A;  2GQW A;  1GRA A;  3DME A;  4A6N B;  4C3X A;  2NO8 A;  4Q28 A;  3FPZ A;  4B63 A;  5KMR A;  1FL2 A;  3GJN A;  4DV4 E;  1GV4 A;  1CEI A;  1N34 E;  4EMJ A;  1X6E A;  2LV2 A;  4GKK E;  1CF3 A;  1TF3 A;  2ELZ A;  1GRF A;  3CD6 P;  4F9A B;  2AFE A;  2KHX A;  3AED A;  5U63 A;  4I58 A;  2EM4 A;  2R46 A;  2M8P A;  4YXD A;  4CCR A;  2LVH A;  4NTC A;  4A65 A;  2EPU A;  3CCU P;  2RPC A;  2V87 A;  2J3N A;  3UKP A;  5BS1 A;  1YQ3 A;  1WHN A;  5KXJ A;  1BBO A;  2R76 A;  1Q7Y Q;  2CFY A;  5KMP A;  5LV9 A;  3G5Q A;  1IMU A;  1PKP A;  2KGC A;  4BHB A;  3HQ1 A;  4LU6 A;  4A99 A;  4U2L A;  2ADR A;  3CCR P;  5FS8 A;  3CPW O;  3UKL A;  3JSK A;  4BMJ A;  1JOA A;  5AE3 A;  3P05 A;  2BS2 A;  3UOX A;  1CJ4 A;  2L6M A;  1J5E E;  3LOV A;  2DIX A;  2ZZC A;  2A25 A;  1H6V A;  1JU2 A;  2V3B A;  3GYX A;  3QSE A;  1KFY A;  5AC5 A;  2R4J A;  1EL5 A;  2YTP A;  2EPC A;  4LTY A;  5A6B A;  4U0F A;  2EOF A;  4CA3 A;  3EPL A;  3F8P A;  1IUQ A;  2V60 A;  1EH7 A;  3GD4 A;  2B3T B;  4LFB E;  2X99 A;  2EN7 A;  1LLM C;  1JEH A;  2F4V E;  1YQ4 A;  3NYC A;  2LOL A;  4DG9 A;  3ADG A;  4IA5 A;  1XPQ A;  5I4T G;  1FKA E;  3DS1 A;  1KSS A;  2B9W A;  2EM7 A;  2KG6 A;  4O5G A;  3GSI A;  1YIT P;  1S2Q A;  3OML A;  1GEU A;  2YSP A;  1XMQ E;  2E5V A;  3G29 A;  5F2N A;  5IWA E;  3AD8 B;  4WCT A;  3C6K A;  1GET A;  3I56 P;  1EL8 A;  4NZV A;  1G2D C;  3GWD A;  2PEQ A;  4X62 E;  2Q6U A;  2X2B A;  2K7I A;  1DOC A;  4YTP A;  3EPK A;  2EM9 A;  1A1I A;  2WZO A;  3PVC A;  1YIJ P;  3DJD A;  2JOX A;  1EL9 A;  2VVL A;  2O9Z A;  4JY3 A;  3QFA A;  3DS5 A;  4BPF A;  1H7W A;  3VRB A;  4QKO A;  3UOV A;  2YAU A;  2XXM A;  1H86 A;  2LF4 A;  1PDA A;  3LZX A;  3RMP A;  5EB5 A;  5M10 A;  2L2M A;  3HPZ A;  4AT2 A;  2YRK A;  3UKF A;  3HXL A;  4LF9 E;  2YQU A;  1QLB A;  4NTE A;  2ODR C;  4GR6 A;  3BI4 A;  1NQ4 A;  1FEC A;  3C4T A;  2ARD A;  1EL7 A;  3LZW A;  2YLW A;  3BGH A;  2I0Z A;  1VDC A;  2W0H A;  4OOG C;  4BHC A;  2XZ1 C;  5IXM B;  2GRT A;  2OAL A;  3L8K A;  4JI8 E;  3URH A;  4EM3 A;  5LMN E;  2LIU A;  2MR7 A;  4USR A;  2YG4 A;  3LAD A;  2V89 A;  1D7Y A;  1T4O A;  4DSG A;  2EPR A;  1GPJ A;  2LJU A;  2L3J A;  3QFB A;  1JK2 A;  2V3A A;  2LE2 A;  1JRX A;  4H4R A;  2XFU A;  1TDE A;  2KW2 A;  4YKF A;  3I55 P;  2C3C A;  4EMW A;  3H8I A;  2KOQ A;  4JI2 E;  1E1L A;  3EJE A;  3AYI A;  1AH5 A;  1Y0P A;  1BZL A;  1ZK7 A;  2XCG A;  4TUG A;  2QA2 A;  3DPH A;  3VYX A;  2EL4 A;  3UTH A;  3KA7 A;  2M5R A;  2GEW A;  4DSH A;  5IT9 C;  2C73 A;  4OPL A;  4WPY A;  4BK3 A;  1RC7 A;  4LFA E;  4WSP A;  4UDR A;  4K0K E;  2GZE A;  3D1C A;  3DJG X;  2VLP A;  5HGL A;  2YU5 A;  2E5L E;  4BC9 A;  1E1N A;  4GCM A;  2EN8 A;  1CC2 A;  1X6H A;  1AUM A;  5TSE A;  3IC9 A;  4YT0 A;  1VQ8 P;  2N3H A;  2JVA A;  1YJW P;  4IVO B;  3ADJ A;  4WFT A;  4GUV A;  1NHQ A;  3SYI A;  3G28 A;  2KOR A;  2I9I A;  1VQP P;  1COY A;  2LCE A;  2VVL G;  1IQS A;  3EPJ A;  4JDR A;  5J60 A;  4X8W A;  4A5L A;  1VQW A;  1N3G A;  3IWB A;  3MGE A;  4HKG A;  2GDX A;  3CND A;  3C6M A;  2PEO A;  2UXC E;  1LTX R;  2MKD A;  2UUA E;  4B68 A;  1K8A Q;  1A1K A;  5L46 A;  2XLP A;  1ZMB A;  4U8M A;  2N98 A;  3GKL C;  2KG9 A;  1E1M A;  3THO B;  3AEA A;  2B7T A;  1AYI A;  1S72 P;  4AP3 A;  4LF7 E;  1YQZ A;  1Q82 Q;  1NCS A;  2RGH A;  1AOG A;  2KOS A;  2XVF A;  1RP0 A;  2K93 A;  2JWO A;  3KD9 A;  2DSY A;  2OA1 A;  3CNP A;  3AV0 A;  3JU0 A;  2VSQ A;  4H7U A;  2N3G A;  4I8O A;  3NRN A;  2EM6 A;  1VQ5 P;  3OC4 A;  1YHQ P;  2FVF A;  1J26 A;  2FAC A;  3RNM A;  3HZQ A;  3H09 A;  1HY8 A;  2VZ2 A;  2AFD A;  1F8S A;  1F6M A;  3S61 A;  4GEQ B;  3QSS A;  1W2B O;  2MVV A;  1PBD A;  1H82 A;  2C72 A;  2C76 A;  3MHS C;  4DV3 E;  4LFC E;  2VRL A;  1NAA A;  1GOS A;  2WBU A;  1F80 D;  1O95 A;  4IV9 A;  1OJC A;  5FS7 A;  2JOB A;  2YTG A;  1X3O A;  1K30 A;  2RTX A;  3ADI A;  4JQ9 A;  2JAZ A;  2HJJ A;  1ZBQ A;  2JXP A;  2J7J A;  2CWO A;  1N1P A;  5FMH A;  4IPY A;  2EOM A;  3CCE P;  1T39 A;  4DV2 E;  2FHS C;  4JI4 E;  2M9A A;  2IVD A;  1WJP A;  2GR0 A;  4DV5 E;  4EQW A;  1P2H A;  2EOX A;  2WS3 A;  3S5W A;  5CQF A;  2LIW A;  5TR3 A;  4C77 A;  2EL5 A;  5KL7 A;  2CDU A;  2XZ0 D;  1Y56 B;  4B66 A;  2N5H A;  1PJQ A;  3FMW A;  4YTM A;  4K7Z A;  2LML A;  3CGE A;  5F3W A;  2VE7 C;  1TDO A;  1A8O A;  5BUL A;  1EH8 A;  2KOO A;  2JO0 A;  1KNP A;  4BUR A;  1IMQ A;  1ZDL A;  2YTD A;  1DOB A;  4IA6 A;  2EPM X;  2JYL A;  2KWL A;  1PJ7 A;  4R03 A;  3M12 A;  4R2R A;  1PDH A;  3CN8 A;  2AQJ A;  2XDO A;  3AE1 A;  3C4N A;  3CGD A;  1D4C A;  2KON A;  2FJB A;  3QVP A;  2YLT A;  4H2P A;  4X66 E;  2XT1 A;  2VOU A;  3G0V A;  2EMX A;  4LF8 E;  3ALL A;  4NXN E;  2EIA A;  4XFY A;  4NHR A;  3KLJ A;  2BHV A;  2WBT A;  2EMZ A;  4H50 A;  4DR4 E;  2GPI A;  2KGE A;  2X3N A;  4F6M A;  2MF4 A;  2BRA A;  2X50 A;  3CCM P;  2VQF E;  3DA1 A;  4D03 A;  4J34 A;  1AF8 A;  4LU9 A;  4EMI A;  3F6H A;  1GND A;  2GMH A;  4JI3 E;  1DNY A;  3T0K A;  4FX9 A;  1YJN P;  1H81 A;  4HTG A;  4JYA E;  4X9J A;  4FK5 C;  3CC4 P;  5F2K A;  3DJJ A;  4YSY A;  2V8Q B;  3RG2 A;  1ZMD A;  1NEI A;  2VVM A;  1L9C A;  2OTJ P;  1YI2 P;  3AD7 B;  3BHF A;  1ZOY A;  3KU9 A;  4Z2R A;  3LJP A;  3FIM B;  2EPL X;  4DR1 E;  1QVG O;  4OCG A;  3EPT A;  2R0C A;  2WQY A;  1EIA A;  1A1L A;  2YG3 A;  1BGN A;  1BKW A;  4R0M A;  3UTG A;  2BCP A;  4H2N A;  4DNA A;  4Y4M A;  2FJA A;  5BRT A;  1RO2 A;  3VHT B;  3ICR A;  2WHD A;  4BCA A;  2BAC A;  1NHR A;  3BID A;  4CY6 A;  2EMY A;  4P9S A;  5GSN A;  2C3D A;  2QCU A;  5KWF A;  1WRJ A;  3K7T A;  4JI1 E;  2KG8 A;  4DKK A;  3CPJ G;  2YTF A;  5KP7 B;  5BR8 E;  1X5W A;  2C64 A;  3GZM A;  2UU9 E;  3CTY A;  4PWV B;  3NK1 X;  1YPN A;  2EQ6 A;  3T1H E;  2RGJ A;  4K8D A;  1LQU A;  1LQT A;  1ZNV A;  2QA1 A;  1JJ2 O;  4H2Y C;  2CSH A;  3EJD A;  5J7X A;  4H4X A;  1GT8 A;  2XFN A;  4FK1 C;  1NG3 A;  2JAE A;  4OPG A;  1NDA A;  5KL5 A;  2LT7 A;  1X47 A;  4DR7 E;  5A6J A;  3B5I A;  3E2D A;  1VQN P;  5HY5 A;  3AXB A;  5KVI A;  1UNK A;  1N4V A;  1YY5 A;  2EQ3 A;  2R1F A;  4J57 A;  4YSZ A;  2FJD A;  2BAB A;  3CXC O;  2YPN A;  3RG6 C;  4YSH A;  4RHB B;  1T4L B;  1G2F C;  2JY9 A;  2L2N A;  2YTN A;  3KWR A;  2JKC A;  2R0G A;  3LRY A;  3I3L A;  5BS2 A;  1FOH A;  2WPF A;  3AE4 A;  2WOW A;  3HPS A;  3NT6 A;  1IUX A;  2APG A;  3H4E A;  2V61 A;  1GXG A;  2EQ1 A;  1B5Q A;  3AE7 A;  4XRO A;  2XLT A;  4TUI A;  5GRT A;  4Z2U A;  1BF3 A;  2GAH B;  2EP3 A;  2YLS A;  3CME P;  2Z5X A;  2FVE A;  3ALM A;  4UP3 A;  4X9M A;  4A9W A;  4YSX A;  4RG3 A;  2WBA A;  3G6E P;  4ZYH A;  3K7M X;  1GSN A;  4ZN0 A;  2L92 A;  3ALJ A;  2R45 A;  2A89 A;  4IJD A;  3P1W A;  3CC2 P;  2K94 A;  1M90 Q;  2EMB A;  1HR0 E;  3DJE A;  2L2K B;  1QNT A;  2PRT A;  3VYY A;  5A6B D;  3AE2 A;  4IS1 C;  1QO8 A;  3Q20 A;  3IWC A;  3VK6 A;  3T2K A;  4X4J A;  1B4V A;  3EAN A;  2FTX B;  1YUJ A;  4LF6 E;  1PS9 A;  2EMG A;  1MGT A;  1M6I A;  4E0V A;  3VRD B;  3RHA A;  2X8G A;  2PY8 A;  2FQ2 A;  1T8K A;  2EOS A;  4HA6 A;  4U2S A;  2X8H A;  4CY8 A;  4QNB A;  2NVK X;  4U8P A;  2XYO A;  1EKZ A;  4LII A;  4Z24 A;  4K22 A;  3ZDN A;  3DF6 A;  3AYJ A;  4KZS A;  2GZF A;  4TM1 A;  5KP6 B;  5KOX A;  4G73 A;  2YT4 A;  1H83 A;  1VKU A;  5U25 A;  2YLX A;  2FQ1 A;  2GMJ A;  1FR2 A;  3EPH A;  4XRQ A;  5M0Z A;  2H36 X;  4P78 A;  1L9E A;  4J8Z A;  3PO7 A;  4C74 A;  4R2D A;  2DGY A;  2MDR A;  1CC4 A;  4ICY A;  1YZ9 A;  1OR5 A;  4Z2T A;  3SZF A;  2EL6 A;  4DGK A;  2YG6 A;  3L1R A;  3QJ4 A;  2GH5 A;  2BC1 A;  2VRD A;  4U8O A;  3UP5 A;  1B37 A;  2CT1 A;  2IHR 1;  1F3P A;  3CGC A;  1DOD A;  1QJD A;  3ATQ A;  1DQ3 A;  4YHH E;  2LUP B;  4KWY A;  3EJB A;  2Y6Q A;  1EH6 A;  3F6G A;  3IWD A;  2GVC A;  5JCI A;  2C70 A;  2BBG A;  2MC5 A;  2DRP A;  2DKH A;  2ODR D;  1A1F A;  1RMD A;  3BI5 A;  1IUV A;  3K6Q A;  1AAY A;  4B67 A;  2HC5 A;  3WBH A;  4Y4L A;  4GDE A;  3THN A;  4JNQ A;  4IVM B;  3R9U A;  4HEI A;  2TMD A;  1BBG A;  2FAD A;  4TLZ A;  2EMI A;  1BB8 A;  2GR1 A;  2EN4 A;  4GR2 A;  2JGP A;  2VRM A;  2YLZ A;  2PNG A;  1IUU A;  2UXB E;  2YWQ A;  1FEB A;  4WSG A;  2EN3 A;  4RSL A;  3G71 P;  2VLQ A;  3V3O A;  2BUO A;  1UJZ A;  2PEK A;  3ATR A;  1P47 A;  4EQR A;  3I6D A;  1PN0 A;  5KVH A;  1XAN A;  2EN6 A;  4X64 E;  5KL6 A;  1HNX E;  3UOY A;  2K4V A;  2ACZ A;  2M8L A;  4H4P A;  4G74 A;  3T31 A;  4BK1 A;  4DUZ E;  2QAE A;  3AE6 A;  1N36 E;  3NK0 X;  5DBJ A;  2K5X A;  2EOE A;  4H4Z A;  5KL3 A;  2EHT A;  4U8I A;  3QG5 C;  2NUF A;  1E6E A;  4YKG A;  2RGO A;  4PAA A;  3LML A;  1YUI A;  2CG5 B;  4F9B B;  2ENC A;  1ACP A;  2CPN A;  4F54 A;  1CL0 A;  5KOW A;  4DR6 E;  3M1M A;  1E0H A;  4TM3 A;  1BWC A;  3UK3 C;  2VQB A;  4U0C A;  1FJG E;  2L3C A;  2UXD E;  4M0I A;  3AEF A;  2B7R A;  1Z6L A;  3P1X A;  3HZL A;  3JAM C;  3NIX A;  5EW5 E;  4JI7 E;  3CCJ P;  1KDG A;  2UZZ A;  4M30 A;  1L9D A;  4U0A A;  3HYV A;  1IBM E;  2BS4 A;  3RP6 A;  2KR5 A;  2K92 A;  3DTJ A;  3G1G A;  1O94 A;  4H2Q A;  4APN A;  4CNJ A;  3SQP A;  3OW2 O;  2EM8 A;  2H88 A;  4WXC A;  3NKS A;  3UP4 A;  1REO A;  1VG0 A;  1PBC A;  1E6J P;  3BF2 A;  4U0E A;  2YLR A;  2IID A;  4H2W C;  1XDI A;  2UUB E;  3GD3 A;  3NN6 X;  4H4Y A;  3UKQ A;  4BK2 A;  4H4T A;  4YTN A;  2F8B A;  4R2S A;  4AT0 A;  1ZMC A;  3VR9 A;  2RS7 A;  2DLQ A;  3CE7 A;  4YWO A;  3KPF A;  2JK6 A;  2OLO A;  3P4P A;  2YVJ A;  4R2A A;  1YYK A;  4DV7 E;  2N5I A;  1L0V A;  1MOK A;  3P4S A;  3GZL A;  2YWL A;  1IBL E;  5LLQ A;  4B1B A;  2EOO A;  4ZYD A;  1OJA A;  1ZU1 A;  3NNE A;  4H4V A;  3LB8 A;  1T38 A;  1M74 A;  2K0D X;  1NHS A;  2GR2 A;  4H4S A;  5IQ1 A;  4NEW A;  1S3E A;  2EOR A;  1UBD C;  2CNR A;  3GYJ A;  2FQ0 A;  2L8T A;  4R2C A;  3DK9 A;  2E1M A;  5A69 A;  3G21 A;  1WXR A;  3P4R A;  3HYW A;  2LJH A;  4Z26 A;  2GYK A;  4NEO A;  2CTD A;  1IQO A;  2WPC A;  1CJ2 A;  5AC4 A;  2GR3 A;  4M9V C;  4B3S E;  1DXL A;  4N9X A;  1M6N A;  2Y6R A;  1KC8 Q;  4BBY A;  2WES A;  2WDQ A;  2L4B A;  1Q86 Q;  2JP9 A;  4N4R B;  1ZR9 A;  2R9Z A;  3AYL A;  2CUL A;  1PJ6 A;  1IJH A;  3QSM A;  1W4X A;  3GMC A;  1TDK A;  2I13 A;  3HTX A;  4K5S A;  2EQ7 A;  1VQ9 P;  4NZH A;  4X65 E;  5JCN A;  1M6E X;  3KPK A;  4GDP A;  1L4S A;  4WX1 A;  4ECH A;  3V3N A;  3G5R A;  1QVF O;  2F5Z A;  3SFD A;  4JY2 A;  4NTD A;  1K4Q A;  1V59 A;  2GDY A;  1OJD A;  3BBG A;  3EQ1 A;  1VQ4 P;  4DR5 E;  2BCG G;  2VQE E;  4M0V A;  1UHZ A;  4J56 A;  5EOW A;  2EMK A;  2BA9 A;  2R4E A;  2XFP A;  4DUY E;  5FS6 A;  4CCQ A;  1YSA C;  1NG4 A;  2YTQ A;  2K2Q A;  4Z25 A;  2RQL A;  2ERH A;  2YR4 A;  1RQ0 A;  2C65 A;  3CCQ P;  1H84 A;  3GRS A;  4R2Q A;  2NA2 A;  3DGZ A;  5BUK A;  2GZI A;  2VLO A;  3H8L A;  4ZCC A;  3Q6J A;  2OLN A;  3UKA A;  5A6K A;  1PBF A;  1YJ9 P;  3FBS A;  2EPA A;  1NHP A;  1MO9 A;  3CPI G;  1N33 E;  1GER A;  4MRT C;  3KZY A;  3T37 A;  3M99 B;  1F8W A;  2WPE A;  2EOZ A;  3AEB A;  4DV1 E;  4KHP E;  1MZ8 A;  3AUZ A;  3U43 A;  2EPN A;  1KLP A;  3GMB A;  1LV0 A;  2KGA A;  3GWF A;  3J7Y p;  4OPD A;  1GZ6 A;  2M1S A;  3G1I A;  4GZN C;  1B69 A;  4FDC B;  1OJ9 A;  4IZ6 A;  5EBK A;  2LMZ A;  3B4Q A;  4JI6 E;  3BHK A;  2MC6 A;  1N32 E;  4B3M E;  1PHH A;  3DS3 A;  1SEZ A;  3T2Y A;  2FAE A;  2HGH A;  3ZOQ B;  4EQS A;  4WYM A;  3SXI A;  2Z44 A;  1CJC A;  5U1O A;  1UN6 B;  1JNR A;  3UOZ A;  1ZKQ A;  2GQF A;  3DGH A;  2YG5 A;  2VQ7 A;  4GAV A;  4WYQ B;  1IMP A;  2XFQ A;  1IUT A;  3LMO A;  2KOD A;  4F37 A;  4OPI A;  4CRT A;  2Q8U A;  1MEY C;  3IWA A;  1VQO P;  2TPR A;  4GR1 A;  4NXM E;  2JYA A;  3NG7 X;  2Q7V A;  2JU1 A;  4OVI A;  3SY4 A;  4EIQ A;  4II3 A;  2JB3 A;  3ECR A;  4U0D A;  1LVL A;  3AE8 A;  2EMC A;  1CJ3 A;  4TM4 A;  3VRL C;  2V88 A;  2EN1 A;  1KJK A;  4L8N A;  2E72 A;  4PAB A;  2EPK X;  2JB1 A;  1VQM P;  4XXG A;  2NUG A;  4AP1 A;  5A2Q C;  1S2Y A;  2CQ8 A;  4WX9 A;  2C4C A;  1QRJ A;  5KP8 B;  3ISH A;  4PH1 A;  1O0W A;  2G7H A;  1VQK P;  4K5R A;  2BXS A;  3BI2 A;  2K0X A;  3II4 A;  3NYE A;  2X8C A;  2ONT A;  2XV6 A; 
#chains in the Genus database with same CATH homology
 1GPE A;  2DB2 A;  4J33 A;  4FK1 A;  2CVJ A;  3T1Y E;  2WOI A;  5IQ4 A;  3G26 A;  5LMU E;  5JCK A;  4NNJ A;  5HYM A;  4NEV A;  3CNJ A;  1O5W A;  1P2E A;  1DNC A;  2RAB A;  4H4U A;  1H7X A;  2WU5 A;  4USQ A;  1TDN A;  4G9K A;  3AWI A;  3KKJ A;  1GRG A;  2WDR A;  4H2R A;  2V6O A;  3T2Z A;  2M7Q A;  1VRQ B;  3NTE A;  5CFF E;  1BAJ A;  2LBS B;  2OAR A;  1Q9I A;  2B76 A;  1KSU A;  3Q9T A;  3OZ2 A;  1NJI Q;  1DJN A;  1WHQ A;  3B6D A;  3DS2 A;  2YM2 A;  2NUE A;  1ZOV A;  1GXF A;  3JTZ A;  2YG7 A;  2BC0 A;  2QA4 P;  2V85 A;  1EBD A;  1FEA A;  2V5Z A;  5HHF A;  1YYW A;  3LLH A;  3AD9 B;  4ZCD A;  3UKH A;  4C3Y A;  3LXD A;  4EQX A;  4H4W A;  4TM0 A;  4U2T A;  3T14 A;  3HYX A;  3G4S P;  2EFJ A;  4XWR A;  2UUC E;  1VG9 A;  3QVR A;  5HXI A;  1E39 A;  3UTE A;  1TDF A;  3NH3 X;  4Z44 A;  3CC7 P;  4C5O A;  1M64 A;  3H0D A;  5ADZ A;  3SM8 A;  2FV4 B;  1NPX A;  4A6N A;  3SZ0 A;  1I94 E;  3H47 A;  3NTD A;  1ZX9 A;  2XFO A;  4OPU A;  4B69 A;  3UCL A;  2AAQ A;  3AE5 A;  3ITJ A;  2Z46 A;  4F9C B;  1XNR E;  5CKU A;  4G6G A;  3CPH G;  1GRE A;  3CIR A;  2L33 A;  2H89 A;  3CMM A;  3C96 A;  5KMQ A;  2AR8 A;  3ABV A;  1GTH A;  3UKK A;  2Z45 A;  2B9Y A;  2OAM A;  4PH0 A;  3DS0 A;  4P7D A;  3DK4 A;  2B9D A;  1D5T A;  1X49 A;  1S3B A;  3VR8 A;  2BK5 A;  1ZP0 A;  2B7V A;  1VQ6 P;  1KNR A;  5AAS A;  2BK3 A;  3VRA A;  1YYO A;  2A87 A;  2LTS A;  1XNQ E;  5C2T A;  3RED A;  2A8X A;  4YY3 E;  5FS9 A;  3PS9 A;  3HYB A;  2RSM A;  2NPX A;  3ZYX A;  2HHH E;  3IF9 A;  4DMI A;  2PHH A;  3G5S A;  1Q81 Q;  1B8S A;  4KPR A;  3NK2 X;  4U8K A;  4O5U A;  2ZM6 E;  3C4A A;  4BV6 A;  1K0L A;  5HGO A;  5HGM A;  2Q0K A;  5BVA A;  1QU6 A;  4DR3 E;  3M0O A;  4UDP A;  4AOS A;  2XVI A;  1RO0 A;  3AEG A;  4U0B A;  2PEM A;  4OX9 E;  3SX6 A;  2YR6 A;  1ONF A;  5KRQ A;  3CCV P;  3J7A G;  2BS3 A;  4AQY E;  3J81 C;  2BK4 A;  4OPC A;  5DCK A;  1D4D A;  1RNI A;  3C4B A;  1A43 A;  2C66 A;  1NEN A;  5IPY A;  1D1D A;  5ER0 A;  5F2O A;  2WOV A;  3CNS A;  1JRY A;  3DS4 A;  4DV0 E;  1HNZ E;  1PJ5 A;  3GDP A;  3K30 A;  2DKI A;  1F8R A;  2FGG A;  1TRB A;  5JCM A;  1PBE A;  2FBW A;  4REK A;  4U8J A;  1E1K A;  4DV6 E;  3IHG A;  4D04 A;  1TYP A;  1K0J A;  1CBO A;  3ICT A;  2WP9 A;  2LUQ A;  1JNZ A;  1D7L A;  2FJE A;  2LTR A;  5AE1 A;  1ZBT A;  1EOQ A;  2B9X A;  1K0I A;  3E1T A;  1SR9 A;  2XLU A;  5FLX C;  3CNT A;  4K2X A;  2Z5Y A;  4CNK A;  1X31 B;  2XLS A;  2Q0L A;  4MJW A;  2HQM A;  3SZC A;  2XVH A;  3M13 A;  2YVF A;  1Q1W A;  4J31 A;  1GAL A;  5KNL A;  3SFE A;  2OTL P;  2LRS A;  4GKJ E;  4B3R E;  1CC6 A;  3NTA A;  2C67 A;  2GV8 A;  1HYU A;  1LJ1 A;  3IHM A;  1LPF A;  2ZZ0 A;  4UDQ A;  4H4Q A;  2PEN A;  1DOE A;  2IVE A;  3SGL A;  1IUS A;  4XFX A;  3NN0 X;  2C7G A;  2WP5 A;  4DR2 E;  3V76 A;  3P9U A;  2EZ6 A;  2YZT A;  1PXC A;  2GAG B;  5EB4 A;  2L6E A;  2PEJ A;  2YVG A;  1RSG A;  3WE0 A;  3CCL P;  1KF6 A;  2P9X A;  4A79 A;  2EQ8 A;  4J36 A;  2WU2 A;  5HGN A;  1RYI A;  3UTF A;  1Q1R A;  2R0P A;  4JN9 A;  1GRT A;  3F8D A;  4GRT A;  3AB1 A;  3F8R A;  2EG5 A;  3J80 C;  4JNA A;  1ELI A;  1IBK E;  4AOX A;  4Y4N A;  3ICS A;  4RG4 A;  1MXT A;  3DJW A;  2WP6 A;  1T4N A;  3EF6 A;  1DI2 A;  2V86 A;  3NLC A;  4BJY A;  2XVE A;  4NWZ A;  2B7S A;  3H4K A;  3GDN A;  1GRH A;  3ADL A;  1D4E A;  4X9N A;  1OJT A;  1UIL A;  2QEX P;  2PEI A;  1XHC A;  4LF5 E;  1PXA A;  1STU A;  3DK8 A;  1PXB A;  3O0H A;  4CBQ A;  2M4I A;  4GF7 A;  3BNM A;  3GYI A;  4JI5 E;  5LL6 R;  1NEK A;  3VQR A;  4U8L A;  3NGC X;  2JYG A;  3K7Q X;  1XMO E;  1YKJ A;  2JR1 A;  2YM1 A;  1UKV G;  1BGJ A;  3CMA P;  4Z43 A;  1ZY8 A;  1CHU A;  3AEE A;  1Y56 A;  2PYX A;  4B3T E;  1X48 A;  2KOU A;  1FCD A;  4I59 A;  1GES A;  4COP A;  3B3R A;  5C3J A;  4XFZ A;  1E7P A;  4LF4 E;  2BRY A;  2V83 A;  3AE3 A;  3COX A;  4U8N A;  3ADA B;  1VQ7 P;  2XVJ A;  4COC A;  1GRB A;  2ZZB A;  4L5N C;  2E4G A;  1HNW E;  3SZW A;  3AE9 A;  4M52 A;  1N8R Q;  4TLX A;  4G6H A;  3KVE A;  3NYF A;  3EAO A;  2VF1 A;  4JI0 E;  3OTO E;  3AEC A;  4R8O A;  4KX6 A;  5JPA A;  2GF3 A;  4O5Q A;  1JRZ A;  3P4Q A;  3D8X A;  2YR5 A;  2M8N A;  3FIG A;  4EM4 A;  2C75 A;  4GAP A;  4B64 A;  4LA1 A;  5JCL A;  2BXR A;  3BNU A;  2RS6 A;  3CGB A;  4BJZ A;  2EWL A;  1IUW A;  3DH9 A;  4M2Z A;  4ADW A;  3NHO X;  1VQL P;  2DMY A;  1TYT A;  1KQS O;  5KMS A;  4A7A A;  1K9M Q;  2XLR A;  1DJQ A;  2JB2 A;  1KD1 Q;  2WET A;  5DNY A;  1M1K Q;  5AE2 A;  3CCS P;  2EQ9 A;  4J2W A;  2WDV A;  1N4U A;  1K73 Q;  1PBB A;  4BS9 A;  4B65 A;  4EIP A;  1GTE A;  3FG2 P;  3GRT A;  3RP8 A;  1GQE A;  4OPT A;  3MSW A;  2GB0 A;  5T6J A;  4BC7 A;  2ZBW A;  3RP7 A;  4JV5 E;  2BYB A;  4HB9 A;  2JBV A;  2WEU A;  4XWZ A;  4II2 A;  1N4W A;  2GQW A;  1GRA A;  3DME A;  4A6N B;  4C3X A;  4Q28 A;  3FPZ A;  4B63 A;  5KMR A;  1FL2 A;  1GV4 A;  4DV4 E;  1N34 E;  4EMJ A;  4GKK E;  1CF3 A;  1GRF A;  3CD6 P;  4F9A B;  2KHX A;  3AED A;  5U63 A;  4I58 A;  2R46 A;  2M8P A;  4YXD A;  4CCR A;  4NTC A;  4A65 A;  3CCU P;  2V87 A;  2J3N A;  3UKP A;  5BS1 A;  1YQ3 A;  1WHN A;  5KXJ A;  1Q7Y Q;  2CFY A;  5KMP A;  5LV9 A;  3G5Q A;  1PKP A;  3HQ1 A;  4LU6 A;  4A99 A;  4U2L A;  3CCR P;  5FS8 A;  3CPW O;  3UKL A;  3JSK A;  4BMJ A;  1JOA A;  5AE3 A;  3P05 A;  2BS2 A;  3UOX A;  1CJ4 A;  2L6M A;  1J5E E;  3LOV A;  2DIX A;  3QSE A;  2ZZC A;  1H6V A;  1JU2 A;  2V3B A;  3GYX A;  1KFY A;  2R4J A;  1EL5 A;  4LTY A;  4U0F A;  3F8P A;  1IUQ A;  2V60 A;  3GD4 A;  2B3T B;  4LFB E;  2X99 A;  1JEH A;  2F4V E;  1YQ4 A;  3NYC A;  3ADG A;  4IA5 A;  1XPQ A;  5I4T G;  1FKA E;  3DS1 A;  1KSS A;  2B9W A;  3GSI A;  1YIT P;  1S2Q A;  3OML A;  1GEU A;  1XMQ E;  2E5V A;  3G29 A;  5F2N A;  5IWA E;  3AD8 B;  4WCT A;  1GET A;  3I56 P;  1EL8 A;  3GWD A;  2PEQ A;  4X62 E;  2Q6U A;  1DOC A;  4YTP A;  2WZO A;  3PVC A;  1YIJ P;  3DJD A;  2JOX A;  1EL9 A;  2VVL A;  2O9Z A;  4JY3 A;  3QFA A;  3DS5 A;  1H7W A;  3VRB A;  3UOV A;  2YAU A;  2XXM A;  1H86 A;  2LF4 A;  3LZX A;  3RMP A;  5EB5 A;  5M10 A;  2L2M A;  3HPZ A;  4AT2 A;  3UKF A;  3HXL A;  4LF9 E;  2YQU A;  1QLB A;  4NTE A;  2ODR C;  4GR6 A;  3BI4 A;  1FEC A;  3C4T A;  2ARD A;  1EL7 A;  3LZW A;  2YLW A;  2I0Z A;  1VDC A;  2W0H A;  4OOG C;  2GRT A;  2OAL A;  3L8K A;  4JI8 E;  3URH A;  4EM3 A;  5LMN E;  4USR A;  2YG4 A;  3LAD A;  2V89 A;  1D7Y A;  1T4O A;  4DSG A;  2L3J A;  3QFB A;  2V3A A;  2LE2 A;  1JRX A;  4H4R A;  2XFU A;  1TDE A;  4YKF A;  3I55 P;  2C3C A;  4EMW A;  3H8I A;  4JI2 E;  1E1L A;  3AYI A;  1Y0P A;  1BZL A;  1ZK7 A;  2XCG A;  4TUG A;  2QA2 A;  3DPH A;  3VYX A;  3UTH A;  3KA7 A;  2GEW A;  4DSH A;  5IT9 C;  2C73 A;  4OPL A;  4WPY A;  4BK3 A;  1RC7 A;  4LFA E;  4WSP A;  4UDR A;  4K0K E;  3D1C A;  3DJG X;  5HGL A;  2E5L E;  4BC9 A;  1E1N A;  4GCM A;  1CC2 A;  1AUM A;  3IC9 A;  4YT0 A;  1VQ8 P;  2N3H A;  2JVA A;  1YJW P;  4IVO B;  3ADJ A;  4WFT A;  4GUV A;  1NHQ A;  3SYI A;  3G28 A;  1VQP P;  1COY A;  2VVL G;  4JDR A;  5J60 A;  4X8W A;  4A5L A;  1VQW A;  3IWB A;  3MGE A;  3CND A;  2PEO A;  2UXC E;  1LTX R;  2UUA E;  4B68 A;  1K8A Q;  5L46 A;  2XLP A;  1ZMB A;  4U8M A;  1E1M A;  3AEA A;  2B7T A;  1S72 P;  4AP3 A;  4LF7 E;  1YQZ A;  1Q82 Q;  2RGH A;  1AOG A;  2XVF A;  1RP0 A;  2JWO A;  3KD9 A;  2DSY A;  2OA1 A;  3CNP A;  3AV0 A;  3JU0 A;  4H7U A;  2N3G A;  4I8O A;  3NRN A;  1VQ5 P;  3OC4 A;  1YHQ P;  1J26 A;  3RNM A;  3HZQ A;  3H09 A;  2VZ2 A;  1F8S A;  1F6M A;  3S61 A;  4GEQ B;  3QSS A;  1W2B O;  1PBD A;  1H82 A;  2C72 A;  2C76 A;  4DV3 E;  4LFC E;  2VRL A;  1NAA A;  1GOS A;  1O95 A;  4IV9 A;  1OJC A;  5FS7 A;  2JOB A;  1K30 A;  2RTX A;  3ADI A;  4JQ9 A;  1ZBQ A;  2CWO A;  1N1P A;  5FMH A;  4IPY A;  3CCE P;  4DV2 E;  4JI4 E;  2IVD A;  2GR0 A;  4DV5 E;  4EQW A;  1P2H A;  2WS3 A;  3S5W A;  5CQF A;  5TR3 A;  4C77 A;  2CDU A;  1Y56 B;  4B66 A;  3FMW A;  4YTM A;  4K7Z A;  3CGE A;  5F3W A;  2VE7 C;  1TDO A;  1A8O A;  5BUL A;  1KNP A;  2JO0 A;  4BUR A;  1ZDL A;  1DOB A;  4IA6 A;  2JYL A;  1PJ7 A;  4R03 A;  3M12 A;  1PDH A;  3CN8 A;  2AQJ A;  2XDO A;  3AE1 A;  3C4N A;  3CGD A;  1D4C A;  2KON A;  2FJB A;  3QVP A;  2YLT A;  4H2P A;  4X66 E;  2XT1 A;  2VOU A;  3G0V A;  4LF8 E;  3ALL A;  4NXN E;  2EIA A;  4XFY A;  3KLJ A;  2BHV A;  4H50 A;  4DR4 E;  2X3N A;  2BRA A;  2X50 A;  3CCM P;  2VQF E;  3DA1 A;  4D03 A;  4J34 A;  4LU9 A;  4EMI A;  3F6H A;  1GND A;  2GMH A;  4JI3 E;  3T0K A;  4FX9 A;  1YJN P;  1H81 A;  4JYA E;  3CC4 P;  5F2K A;  3DJJ A;  4YSY A;  2V8Q B;  1ZMD A;  2VVM A;  1L9C A;  2OTJ P;  1YI2 P;  3AD7 B;  3BHF A;  1ZOY A;  3KU9 A;  4Z2R A;  3LJP A;  3FIM B;  4DR1 E;  4OCG A;  1QVG O;  3EPT A;  2R0C A;  2WQY A;  1EIA A;  1BGN A;  2YG3 A;  1BKW A;  3UTG A;  2BCP A;  4H2N A;  4DNA A;  4Y4M A;  2FJA A;  5BRT A;  1RO2 A;  3ICR A;  2WHD A;  4BCA A;  2BAC A;  1NHR A;  4CY6 A;  4P9S A;  5GSN A;  2C3D A;  2QCU A;  5KWF A;  3K7T A;  4JI1 E;  4DKK A;  3CPJ G;  5BR8 E;  2C64 A;  2UU9 E;  3CTY A;  3NK1 X;  2EQ6 A;  3T1H E;  2RGJ A;  4K8D A;  1LQU A;  1LQT A;  2QA1 A;  1JJ2 O;  5J7X A;  4H4X A;  1GT8 A;  2XFN A;  4FK1 C;  1NG3 A;  2JAE A;  4OPG A;  1NDA A;  1X47 A;  4DR7 E;  3B5I A;  3E2D A;  1VQN P;  5HY5 A;  3AXB A;  5KVI A;  1N4V A;  1YY5 A;  4J57 A;  4YSZ A;  2FJD A;  2BAB A;  3CXC O;  3RG6 C;  4YSH A;  1T4L B;  2JY9 A;  2L2N A;  3KWR A;  2JKC A;  2R0G A;  3LRY A;  3I3L A;  5BS2 A;  1FOH A;  2WPF A;  3AE4 A;  2WOW A;  3HPS A;  3NT6 A;  1IUX A;  2APG A;  3H4E A;  2V61 A;  1B5Q A;  3AE7 A;  4XRO A;  2XLT A;  4TUI A;  5GRT A;  4Z2U A;  1BF3 A;  2GAH B;  2YLS A;  3CME P;  2Z5X A;  4X9M A;  3ALM A;  4UP3 A;  4A9W A;  4YSX A;  4RG3 A;  2WBA A;  3G6E P;  3K7M X;  1GSN A;  4ZN0 A;  2L92 A;  3ALJ A;  2R45 A;  2A89 A;  3P1W A;  3CC2 P;  1M90 Q;  1HR0 E;  3DJE A;  2L2K B;  3VYY A;  3AE2 A;  1QO8 A;  3Q20 A;  3IWC A;  3VK6 A;  3T2K A;  4X4J A;  1B4V A;  3EAN A;  2FTX B;  4LF6 E;  1PS9 A;  1M6I A;  4E0V A;  3VRD B;  3RHA A;  2X8G A;  2PY8 A;  4HA6 A;  4U2S A;  2X8H A;  4CY8 A;  4QNB A;  2NVK X;  4U8P A;  2XYO A;  1EKZ A;  4LII A;  4Z24 A;  4K22 A;  3ZDN A;  3DF6 A;  3AYJ A;  4KZS A;  4TM1 A;  5KOX A;  4G73 A;  2YT4 A;  1H83 A;  5U25 A;  2YLX A;  2GMJ A;  4XRQ A;  5M0Z A;  2H36 X;  4P78 A;  1L9E A;  4J8Z A;  3PO7 A;  4C74 A;  2DGY A;  2MDR A;  4ICY A;  1CC4 A;  1YZ9 A;  4Z2T A;  3SZF A;  4DGK A;  2YG6 A;  3L1R A;  3QJ4 A;  2GH5 A;  2BC1 A;  4U8O A;  3UP5 A;  1B37 A;  2IHR 1;  1F3P A;  3CGC A;  1DOD A;  1QJD A;  3ATQ A;  1DQ3 A;  4YHH E;  2LUP B;  2Y6Q A;  3F6G A;  3IWD A;  2GVC A;  5JCI A;  2C70 A;  2MC5 A;  2DKH A;  2ODR D;  3BI5 A;  1IUV A;  3K6Q A;  4B67 A;  3WBH A;  4Y4L A;  4GDE A;  4JNQ A;  4IVM B;  3R9U A;  2TMD A;  4TLZ A;  2GR1 A;  4GR2 A;  2VRM A;  2YLZ A;  1IUU A;  2UXB E;  1FEB A;  4RSL A;  3G71 P;  3V3O A;  2BUO A;  2PEK A;  3ATR A;  4EQR A;  3I6D A;  1PN0 A;  5KVH A;  1XAN A;  4X64 E;  1HNX E;  3UOY A;  2K4V A;  2ACZ A;  2M8L A;  4H4P A;  4G74 A;  3T31 A;  4BK1 A;  4DUZ E;  2QAE A;  3AE6 A;  1N36 E;  3NK0 X;  5DBJ A;  4H4Z A;  4U8I A;  2NUF A;  1E6E A;  4YKG A;  2RGO A;  4PAA A;  3LML A;  4F9B B;  2CPN A;  4F54 A;  1CL0 A;  5KOW A;  4DR6 E;  3M1M A;  4TM3 A;  1BWC A;  2VQB A;  4U0C A;  1FJG E;  2L3C A;  2UXD E;  4M0I A;  3AEF A;  2B7R A;  1Z6L A;  3P1X A;  3HZL A;  3JAM C;  3NIX A;  4JI7 E;  3CCJ P;  1KDG A;  2UZZ A;  4M30 A;  1L9D A;  4U0A A;  3HYV A;  1IBM E;  2BS4 A;  3RP6 A;  3DTJ A;  3G1G A;  1O94 A;  4H2Q A;  4APN A;  4CNJ A;  3SQP A;  3OW2 O;  2H88 A;  3NKS A;  3UP4 A;  1REO A;  1VG0 A;  1PBC A;  1E6J P;  4U0E A;  2YLR A;  2IID A;  1XDI A;  2UUB E;  3GD3 A;  3NN6 X;  4H4Y A;  3UKQ A;  4BK2 A;  4H4T A;  4YTN A;  2F8B A;  4AT0 A;  1ZMC A;  3VR9 A;  2RS7 A;  4YWO A;  3KPF A;  2JK6 A;  2OLO A;  3P4P A;  2YVJ A;  1YYK A;  4DV7 E;  1L0V A;  1MOK A;  3P4S A;  2YWL A;  1IBL E;  4B1B A;  1OJA A;  4H4V A;  3NNE A;  3LB8 A;  1M74 A;  1NHS A;  2GR2 A;  4H4S A;  5IQ1 A;  4NEW A;  1S3E A;  3GYJ A;  2L8T A;  3DK9 A;  2E1M A;  3G21 A;  1WXR A;  3P4R A;  3HYW A;  2LJH A;  4Z26 A;  2WPC A;  1CJ2 A;  2GR3 A;  4B3S E;  1DXL A;  4N9X A;  1M6N A;  2Y6R A;  1KC8 Q;  4BBY A;  2WES A;  2WDQ A;  1Q86 Q;  2R9Z A;  3AYL A;  2CUL A;  1PJ6 A;  1IJH A;  3QSM A;  1W4X A;  3GMC A;  1TDK A;  3HTX A;  4K5S A;  2EQ7 A;  1VQ9 P;  4NZH A;  4X65 E;  5JCN A;  1M6E X;  3KPK A;  4GDP A;  4WX1 A;  4ECH A;  3V3N A;  3G5R A;  1QVF O;  2F5Z A;  3SFD A;  4JY2 A;  4NTD A;  1K4Q A;  1V59 A;  1OJD A;  4DR5 E;  1VQ4 P;  2BCG G;  2VQE E;  4M0V A;  1UHZ A;  4J56 A;  5EOW A;  2BA9 A;  2R4E A;  2XFP A;  4DUY E;  5FS6 A;  4CCQ A;  1NG4 A;  4Z25 A;  2YR4 A;  1RQ0 A;  2C65 A;  3CCQ P;  1H84 A;  3GRS A;  2NA2 A;  3DGZ A;  5BUK A;  3H8L A;  4ZCC A;  3Q6J A;  2OLN A;  3UKA A;  1PBF A;  1YJ9 P;  3FBS A;  3CPI G;  1N33 E;  1GER A;  1MO9 A;  1NHP A;  3T37 A;  1F8W A;  2WPE A;  3AEB A;  4DV1 E;  4KHP E;  3AUZ A;  3GMB A;  1LV0 A;  3GWF A;  3J7Y p;  4OPD A;  1GZ6 A;  2M1S A;  3G1I A;  4FDC B;  1OJ9 A;  5EBK A;  2LMZ A;  4JI6 E;  3BHK A;  2MC6 A;  1N32 E;  4B3M E;  1PHH A;  3DS3 A;  1SEZ A;  3T2Y A;  3ZOQ B;  4EQS A;  4WYM A;  3SXI A;  2Z44 A;  1CJC A;  5U1O A;  1JNR A;  3UOZ A;  1ZKQ A;  2GQF A;  3DGH A;  2YG5 A;  2VQ7 A;  4GAV A;  4WYQ B;  2XFQ A;  1IUT A;  2KOD A;  4OPI A;  4CRT A;  3IWA A;  1VQO P;  2TPR A;  4GR1 A;  4NXM E;  3NG7 X;  2Q7V A;  4OVI A;  3SY4 A;  4EIQ A;  4II3 A;  2JB3 A;  4U0D A;  1LVL A;  3AE8 A;  1CJ3 A;  4TM4 A;  3VRL C;  2V88 A;  4L8N A;  4PAB A;  2JB1 A;  1VQM P;  4XXG A;  2NUG A;  4AP1 A;  5A2Q C;  1S2Y A;  2C4C A;  1QRJ A;  3ISH A;  4PH1 A;  1O0W A;  2G7H A;  1VQK P;  4K5R A;  2BXS A;  3BI2 A;  3II4 A;  3NYE A;  2X8C A;  2ONT A;  2XV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...