2E1MA

Crystal structure of l-glutamate oxidase from streptomyces sp. x-119-6
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
369
structure length
356
Chain Sequence
MTYEQLARELLLVGPAPTNEDLKLRYLDVLIDNGLNPPGPPKRILIVGAGIAGLVAGDLLTRAGHDVTILEANANRVGGRIKTFHAKKGEPSPFADPAQYAEAGAMRLPSFHPLTLALIDKLGLKRRLFFNVDIDPQTGNQDAPVPPVFYKSFKDGKTWTNGAPSPEFKEPDKRNHTWIRTNREQVRRAQYATDPSSINEGFHLTGCETRLTVSDMVNQALEPVRDYYSVKQDDGTRVNKPFKEWLAGWADVVRDFDGYSMGRFLREYAEFSDEAVEAIGTIENMTSRLHLAFFHSFLGRSDIDPRATYWEIEGGSRMLPETLAKDLRDQIVMGQRMVRLEYYDPGPAVAIQTVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of l-glutamate oxidase from Streptomyces sp. X-119-6
pubmed doi rcsb
source organism Streptomyces sp.
molecule tags Oxidoreductase
molecule keywords L-glutamate oxidase
total genus 88
structure length 356
sequence length 369
ec nomenclature ec 1.4.3.11: L-glutamate oxidase.
pdb deposition date 2006-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 2e1mA05
1.10.1200.190 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2e1mA03
3.30.160.490 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2e1mA04
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2e1mA02
2YAUA 3SFEA 5U63A 3CTYA 2GAHB 1E39A 2B7SA 3GRTA 2NPXA 4AT0A 1K0IA 3PVCA 1IUVA 2WP5A 3BNUA 4U2TA 5FS9A 2TMDA 1RYIA 2OLNA 2C75A 2X3NA 3QVRA 4C77A 1XPQA 2J3NA 4H4XA 3G5QA 3I3LA 4ADWA 4AP1A 5IPYA 3D1CA 4CY8A 3AE2A 1D5TA 3LOVA 3NHOX 2BCPA 3UP4A 1CC2A 2E4GA 1CL0A 4AOSA 1NAAA 3UKAA 3UKFA 3AWIA 2XDOA 2YLZA 4U8IA 2C76A 2Q7VA 1E1MA 2RGHA 1B4VA 3B6DA 2EQ7A 3SGLA 3L1RA 4AT2A 4OPTA 5TR3A 3AEDA 1XANA 3REDA 3Q6JA 3P4SA 2WU5A 4OCGA 1Z6LA 1TDNA 1GTHA 1M6IA 1QLBA 3ICRA 4IA6A 1IUUA 3ZDNA 3ALMA 4CNKA 1PS9A 1BZLA 2GQWA 2IIDA 3VQRA 3AYLA 1ONFA 5JCKA 4TM0A 4YWOA 4YSXA 2A87A 1KSSA 3ICSA 3IF9A 3BHKA 4J31A 2YR5A 1DOCA 5EBKA 1L9EA 2BC1A 3FG2P 4TM3A 1CJ3A 1IUXA 4A65A 2QAEA 2B76A 2XVHA 2BYBA 3NK0X 2QA2A 1ZDLA 2XFUA 3AE5A 1B37A 4U8LA 1VG9A 4CNJA 2CFYA 1GPEA 2DKIA 1IUWA 1Q1RA 3GYJA 2WQYA 2JB3A 2VQ7A 3K7QX 4NTEA 3SM8A 2C66A 4OPCA 1F8SA 1H86A 1LTXR 1XHCA 3WE0A 3DJEA 4USQA 3NTAA 4H4QA 4XWZA 1CC4A 1PBCA 5ER0A 5EOWA 2GRTA 4YSYA 1GOSA 2X8GA 2YG4A 2BC0A 4NEWA 2Y6RA 3V76A 2WOWA 4EIQA 3B3RA 1OJ9A 4CRTA 3BI5A 2FJAA 2B9WA 4E0VA 4U8KA 1ELIA 3F8DA 5M0ZA 4J57A 4RSLA 2BS3A 4H4SA 2Y6QA 3I6DA 3DGHA 4GCMA 2I0ZA 2YVFA 1AOGA 3VRAA 4KX6A 4H50A 3F8PA 3NKSA 1YY5A 4UDRA 1GRBA 2XFPA 4X9MA 4C5OA 3KPFA 3BI4A 2GH5A 5JCNA 3UTHA 1S3EA 2ZBWA 2GAGB 4C74A 4K5RA 1COYA 2PYXA 2BS4A 1KNPA 1VDCA 3UKQA 1GTEA 1E1NA 4J33A 3O0HA 4X9NA 1H83A 1GRHA 1N4VA 3GMBA 4TM1A 3NG7X 2C64A 3ISHA 4H7UA 2A8XA 4FK1C 4J34A 2C67A 2X8HA 1GSNA 1RSGA 4H4VA 1TYPA 4OPIA 1PXBA 2RGJA 2XLTA 3P1WA 5GRTA 3C4AA 4D03A 4IVOB 1H6VA 1PBFA 2R0PA 3KD9A 4GF7A 1H81A 3P4PA 1M64A 4OPLA 4U8NA 1PJ7A 2OAMA 1DJNA 3ABVA 4B68A 3LZXA 2B9YA 1NG4A 1ZX9A 1TDKA 4NTCA 3NIXA 4FK1A 1PXCA 4J36A 2R0GA 5KWFA 3IC9A 2WPCA 1D4DA 3QSSA 2OA1A 4TM4A 2BXRA 5KVIA 4B1BA 5M10A 2WHDA 2YLWA 2O9ZA 3G5RA 3LZWA 3CPIG 1UKVG 4ZN0A 4KPRA 5JCLA 2AAQA 1NHSA 2GF3A 2VQBA 2UZZA 3K7MX 3KKJA 1QJDA 2YR6A 1D4CA 4EQXA 4B66A 3K7TA 2WOIA 4N9XA 5J7XA 3EPTA 2BA9A 1V59A 1CJ2A 2WPFA 4JDRA 2NVKX 4Z2UA 4B67A 1LQUA 3UTGA 2FJBA 2JB1A 3LB8A 1TRBA 3II4A 4DGKA 4NEVA 4IV9A 4ICYA 2WEUA 2EQ6A 4H4ZA 3GWDA 2Q6UA 2GV8A 1RP0A 2FBWA 1GNDA 3NLCA 3UP5A 4K8DA 3FMWA 1CHUA 1GRAA 3AEGA 3GDPA 2PHHA 2WDRA 5BRTA 1TDFA 1FECA 4K22A 4LIIA 3UOXA 3NT6A 3UKHA 4HB9A 4B65A 4H2NA 4YTPA 1O5WA 2XYOA 1DOBA 3LJPA 3CPJG 2Q0KA 2WDVA 4C3XA 2XLSA 3OZ2A 2BCGG 2JBVA 1PJ6A 2RGOA 4IVMB 4OPGA 2C72A 4B63A 3UKPA 1REOA 2V3AA 1JRYA 1ZY8A 2YLRA 1IUSA 2H88A 4A5LA 1E1LA 3NK2X 4K7ZA 5KOWA 4YSZA 1PBEA 3Q9TA 3URHA 5KVHA 4A99A 4H4PA 3AEFA 3BNMA 4GDEA 4UDPA 2BS2A 4U8PA 4EM3A 3S61A 1OJTA 4IA5A 3VRDB 1NEKA 1GERA 3V3NA 4Y4LA 5CQFA 5DBJA 3AE8A 4YKFA 1GV4A 1O94A 2W0HA 3RP6A 1CBOA 1JRXA 3CNDA 3ITJA 4Z26A 2C3CA 4PAAA 4A6NA 2AR8A 4OVIA 3AEEA 3EANA 3QSMA 4EMWA 1KFYA 1BGNA 1KNRA 5KXJA 1HYUA 4I58A 2JB2A 1GXFA 1PBDA 3UTFA 1D7LA 5U1OA 4AOXA 3PS9A 5J60A 1PXAA 3KA7A 3KU9A 4B64A 3QJ4A 2YG3A 1Y0PA 3AE3A 2BACA 3NN6X 2YVJA 2XLUA 4EQSA 1GRGA 4I59A 1LQTA 3JSKA 5BULA 4K5SA 2YM1A 1Y56A 4GUVA 4J56A 2R4JA 4Z44A 3QSEA 4YXDA 3NYEA 4A79A 3AD9B 1KDGA 4CCRA 2ARDA 1B8SA 3UCLA 3KVEA 1TYTA 2WP9A 3FPZA 3CNPA 3GWFA 4C3YA 2XFOA 5FS8A 4O5QA 5FMHA 2EQ8A 1GEUA 4BK2A 1L9CA 3ALJA 3SFDA 3GRSA 3NK1X 4BJZA 1JEHA 1N4WA 4XXGA 1PDHA 2YG5A 2GR2A 2BK5A 3NN0X 1ZK7A 3CGBA 2XFNA 1MXTA 4O5UA 2E1MA 3DK9A 3UKLA 4NZHA 3GSIA 5HY5A 2QCUA 3ATRA 4H2RA 2GR3A 1BKWA 2GVCA 3EF6A 5HYMA 1F3PA 3KLJA 3CNJA 1TDEA 3NYFA 1DOEA 2XLPA 4ZCDA 2B7RA 1K0JA 2YVGA 3M12A 3V3OA 3VR8A 3C96A 3H4KA 3CGCA 1DODA 3AE4A 4TLXA 5EB4A 1EL9A 2XLRA 3NRNA 2F5ZA 4H2PA 4DSHA 1F8RA 3P4QA 2XVFA 3T37A 1ZOYA 3E1TA 4ZCCA 1NDAA 1JU2A 3AE7A 4X4JA 1D4EA 3VRBA 1NG3A 3OC4A 1YKJA 3AD7B 3DH9A 2C73A 2Q0LA 1H7WA 3AXBA 3UKKA 2WS3A 4RG3A 1KSUA 3NH3X 2YM2A 3P9UA 1YQ4A 4GRTA 2H89A 3CNSA 2JKCA 4FDCB 2APGA 2GEWA 1FEAA 1Q9IA 3NGCX 4JN9A 4JY3A 4BURA 1OJAA 4JNAA 2VVLG 1P2HA 3PO7A 3QVPA 4Z43A 2WESA 2GMJA 4H4YA 4U8OA 3DJJA 3K30A 5KRQA 4JY2A 4GR1A 4APNA 4Z2RA 4RG4A 1YQ3A 3DJDA 1PJ5A 3AYJA 2CVJA 2BK3A 1PHHA 3FIMB 2XFQA 2HQMA 4H2QA 5BVAA 2YLXA 1E1KA 4CCQA 4AP3A 1P2EA 5FS7A 1K4QA 4Z24A 4LU6A 4Z2TA 2JK6A 3FBSA 4FX9A 3CGDA 1OJDA 1SEZA 3LADA 4OPDA 4BV6A 3H8LA 2RABA 3AEAA 4YKGA 4CY6A 2Z5XA 2WP6A 4UDQA 4EIPA 1GRFA 1NHPA 2OALA 1MOKA 1DXLA 2YLSA 1NHQA 1JRZA 2EQ9A 1EL7A 4OPUA 4H4RA 3RNMA 4YT0A 3RHAA 1EL5A 3P4RA 4CBQA 2CDUA 5JCMA 1JNZA 2ZZ0A 4BK1A 2QA1A 1E7PA 3BI2A 3GD4A 2V5ZA 1EBDA 5C3JA 2GQFA 1PBBA 1O95A 1MO9A 5HHFA 4YSHA 1QO8A 5KOXA 3IWAA 2GMHA 4XWRA 1FEBA 1GETA 2XVJA 2C7GA 2WETA 1EL8A 2YG7A 1LPFA 3IHGA 2X50A 2Z5YA 3DGZA 5U25A 3UOVA 2FJDA 1DJQA 3CGEA 5C2TA 4B69A 1K0LA 2C65A 3LXDA 5IQ1A 3ZYXA 1CJCA 2YG6A 4HA6A 2V3BA 1GALA 1ZKQA 3COXA 4Z25A 2DKHA 3UOYA 3QFAA 3NNEA 3EAOA 4EQWA 3SQPA 4U2SA 4MJWA 1B5QA 1TDOA 1FCDA 2YWLA 1NHRA 2VVLA 3GMCA 1H82A 2WU2A 2YQUA 3GD3A 1E6EA 4JNQA 3CNTA 1GRTA 3DK4A 1BGJA 1PN0A 3AE6A 3CIRA 1KF6A 2GR0A 2WOVA 4USRA 3ADAB 4WCTA 3M0OA 3UTEA 4P9SA 4U8JA 3IHMA 1IJHA 4UP3A 1X31B 1LJ1A 2WDQA 4M52A 2VRMA 2R0CA 1Q1WA 2CULA 4GDPA 3RP7A 3DMEA 5CKUA 4YTMA 3D8XA 3GDNA 4NTDA 2R45A 4JQ9A 3VR9A 4U2LA 1FL2A 1GESA 3GYIA 1H7XA 2YR4A 3CPHG 2ACZA 3C4NA 1S2QA 3F8RA 1ZP0A 3G5SA 4PABA 4BK3A 1BF3A 4REKA 1Y56B 1H84A 4K2XA 3UOZA 2BABA 5GSNA 2VZ2A 1CC6A 3RP8A 1JOAA 3AE9A 4D04A 2GB0A 1L0VA 1CJ4A 1XDIA 1ZMDA 4H4WA 1F8WA 2FJEA 1NPXA 3ALLA 2IVEA 2VVMA 1W4XA 3AE1A 2XCGA 1ZOVA 1LV0A 2BK4A 1N1PA 3HZLA 5BUKA 5L46A 3DJGX 2V6OA 4H4TA 3M13A 3BHFA 2A89A 2C70A 2JAEA 3ICTA 1ZMCA 3AD8B 3ATQA 1JNRA 2WBAA 1VG0A 4Y4NA 2ZZBA 5FS6A 2VOUA 3R9UA 4BJYA 4EMJA 4A6NB 1S2YA 3DK8A 1LVLA 2R46A 3AYIA 5LV9A 2R4EA 1GREA 2C3DA 1VQWA 2VRLA 1VRQB 3H8IA 1BWCA 3L8KA 1CF3A 4EM4A 3NYCA 4J2WA 2XVEA 1NENA 2R9ZA 5JCIA 4YTNA 2V60A 5IQ4A 4H4UA 1DNCA 1F6MA 5EB5A 2V61A 1OJCA 2B9XA 1D7YA 2OLOA 2XVIA 4A7AA 1FOHA 3CN8A 3S5WA 4EMIA 4DSGA 1L9DA 1N4UA 2X99A 3AEBA 1YQZA 3AECA 1IUTA 4EQRA 1GT8A 2TPRA 3AB1A 2BXSA 3QFBA 4WX1A 4Y4MA 4DNAA 5HXIA 3NTDA 4LA1A 2IVDA 1S3BA 2WPEA 2AQJA 4U8MA 2E5VA 2GR1A 4ECHA 4TLZA 4A9WA 2YLTA 2X8CA 3DA1A 2ZZCA
chains in the Genus database with same CATH superfamily
4B3ME 5U63A 2EOMA 1K0IA 3PVCA 1VQ9P 2TMDA 1RYIA 2PNGA 2C75A 2OLNA 2VLQA 3AUZA 1N8RQ 3QVRA 4X9JA 2EP3A 4C77A 4NNJA 2J7JA 2EIAA 2J3NA 3G5QA 3I3LA 4I8OA 4JV5E 4CY8A 2LKIA 3K6QA 2E5LE 2EOZA 1D5TA 3LOVA 3NHOX 2FQ2A 2E4GA 3UP4A 3UKFA 2XDOA 2YTQA 1B4VA 3CCJP 3SGLA 3L1RA 2LTEA 5TR3A 4GAPA 3AEDA 1X48A 4QKOA 1Z6LA 2LUPB 1TDNA 1QLBA 4IA6A 1IUUA 5F2NA 1X6EA 4JI7E 1ONFA 3Q20A 1FKAE 2A87A 3IF9A 4J31A 1DOCA 5EBKA 2EPMX 1CJ3A 3F6GA 4A65A 2QAEA 3H4EA 3CXCO 3ZOQB 2EMYA 3GYJA 2K4VA 1TF3A 5AE3A 4OPCA 1F8SA 2UUCE 1IUQA 1XHCA 3NTAA 2V88A 5EOWA 1N34E 3H47A 2EMCA 1GOSA 2CWOA 2Y6RA 2EOQA 2BUOA 2L0QA 2B9WA 3CCVP 3CC7P 4KX6A 1YFHA 4H50A 1BBOA 4BS9A 4C5OA 1A1HA 3BI4A 2K0XA 2K5XA 1S3EA 2PYXA 2FQ1A 5BS1A 1GTEA 2YTOA 4NZVA 2FAEA 2N98A 4J33A 3G26A 2YTFA 4R2SA 1NQ4A 1GSNA 5A6BD 2QNWA 4H4VA 4OPIA 1PXBA 2RGJA 2XLTA 3P1WA 1PBFA 3KD9A 4DR5E 1H81A 4OPLA 2MDGA 3ABVA 1IBLE 2EOOA 3EJDA 3LZXA 1TDKA 2EOXA 4WSPA 2R0GA 3U43A 3IC9A 5KWFA 4ZYEA 4TM4A 4B1BA 1G2FC 2WHDA 2EM4A 2JY9A 3LZWA 1NEIA 4KPRA 1Q81Q 1JJ2O 1YPNA 1QJDA 2NVKX 3UTGA 2FJBA 1TRBA 4BC9A 4IV9A 2LTRA 2VSQA 2EQ6A 3GWDA 1IBME 3H0DA 1RP0A 2FBWA 3NLCA 5EW5E 2K93A 3UP5A 1GRAA 2NA2A 4U0DA 2K92A 1IQOA 3UKHA 2XYOA 3G28A 2EPAA 1DOBA 3G29A 3CC4P 3G4SP 2BCGG 3HXLA 1VQMP 2GLIA 2JBVA 2EMXA 2RGOA 2C72A 1GXHA 1ZY8A 4A5LA 5KOWA 3DJWA 1PBEA 3HPSA 1VQLP 4M2ZA 3S61A 3VRDB 4LFAE 5A6KA 1RQ0A 4YKFA 1YJNP 4M0IA 2Z46A 4WFTA 4PAAA 2AR8A 1GZ6A 3QSMA 2B7TA 2FVAA 5KXJA 2JYGA 4I58A 2KR5A 5U1OA 3KA7A 4B64A 2YG3A 2BACA 2JU1A 2XLUA 2MVVA 4BPGA 4J56A 5KNLA 1A1GA 4Z44A 3QSEA 4YXDA 3AD9B 4HTGA 1IMUA 2LTSA 3KVEA 1TYTA 3FPZA 4C3YA 3VYXA 2JPAA 5FMHA 2EN6A 5AE2A 4BK2A 3SFDA 3NK1X 1JEHA 2GDWA 4XXGA 2DNWA 1T4NA 1ZK7A 3CGBA 3NN0X 4F9CB 2XFNA 1MXTA 1UILA 3CMAP 2QCUA 2H36X 2GR3A 5ADZA 4BPFA 2LV2A 2WZOA 4ZCDA 2L9FA 3NYFA 3C96A 1A1FA 1EL9A 2XLRA 4H2PA 3E1TA 1RO2A 1NDAA 3AE7A 1D4EA 2EG5A 3AD7B 2Q0LA 1DI2A 4F9BB 1KSUA 2KW2A 3NH3X 4GRTA 1GQEA 1BBGA 2LMLA 4ZYDA 3NGCX 2MR7A 2L92A 1P2HA 5HGMA 3K30A 2EHSA 4LA1A 2CVJA 4ZYHA 2BK3A 2YTJA 5BVAA 2HC5A 1E1KA 1ZU1A 4BPHA 1K4QA 4Z2TA 2YRHA 4COPA 4OPDA 3LADA 1L0HA 3AEAA 4X8WA 5KMRA 4CY6A 1EKZA 1PJSA 5KL4A 2YLSA 1JRZA 4YT0A 2D9HA 1EL5A 5JCMA 1JNZA 1S72P 1VQNP 3BI2A 2UXDE 2V5ZA 2K0DX 1K8AQ 2GQFA 4B3SE 3ECRA 3CMEP 2EPLX 1FEBA 2C7GA 3CPWO 2HJJA 1EL8A 1ZMBA 4H2XC 2LBSB 2VLOA 1DJQA 4WSGA 5IQ1A 3ZYXA 4J8ZA 2M4IA 2EPOA 1N32E 3EAOA 1MZ8A 3J7AG 4XROA 1NHRA 2UXCE 3HQ1A 2WU2A 4B3RE 1E6EA 4JNQA 3DK4A 4USRA 5KL2A 4II3A 3M0OA 3IHMA 4UP3A 1YYKA 1Q1WA 4DR2E 2KG6A 2GZJA 3RP7A 2KGEA 4H2YC 4NTDA 4N4RB 1IMQA 1T39A 1FL2A 1GESA 1J5EE 2P9XA 2EOEA 3F8RA 3G5SA 1BF3A 4REKA 3DS5A 4U0BA 1KQSO 5A2QC 2EN4A 2EMGA 2AF8A 4D04A 1XDIA 1Z6MA 2KOQA 2IVEA 2Q8UA 2VVMA 1N1PA 3DJGX 4H4TA 1EH8A 3M13A 3CCEP 2JAEA 2GDXA 2UUAE 3AD8B 3C6MA 2ADRA 4DV3E 1VG0A 1ZNVA 2EM2A 4M0VA 3CCQP 2EOYA 4R2EA 2C3DA 2VRLA 1CF3A 1NENA 4BCAA 5A6JA 5EB5A 2V61A 3S5WA 4DSGA 1L9DA 3SZ0A 1X3CA 4DNAA 2VLPA 2V89A 1UBDC 1SR9A 1S3BA 2X8CA 3DA1A 3SFEA 3J7Yp 2FQ0A 4KWYA 4AT0A 2RSMA 2NPXA 4YHHE 1IUVA 2WP5A 3BNUA 4U2TA 2XZ0D 2EPZA 3JU0A 4WX9A 1XPQA 2EN8A 4DV1E 4B3TE 2DRPA 2YT4A 4ADWA 4M9VC 3D1CA 4R0MA 4AOSA 1IMPA 4PH0A 3AWIA 2RGHA 3B6DA 1Q7YQ 2EQ7A 5LL6R 4DMIA 5KMSA 3ICRA 1UNKA 4X62E 1PS9A 2GQWA 4GKKE 3VQRA 2OTJP 4TM0A 4YWOA 4YSXA 3DS4A 1M6NA 3BHKA 1L9EA 2VRDA 2BC1A 4TM3A 1IUXA 2B76A 2BYBA 2XFUA 1B37A 2KORA 5A6AA 1AYIA 2CFYA 4DV0E 1IUWA 1Q1RA 4NTEA 1YYWA 3LRYA 1BB8A 3SM8A 2N5HA 2C66A 1H86A 4JI1E 3L00A 4USQA 1PBCA 4X65E 2MR8A 3WBHA 2YG4A 3NY7B 2BC0A 4EIQA 3B3RA 4CRTA 3BI5A 2FJAA 4E0VA 3GJNA 3F8DA 4RSLA 4RH8A 4G6HA 3SZCA 2I0ZA 2CNRA 3MSWA 1AOGA 5IV8B 2MDRA 4DUZE 1FJGE 4DR6E 2EM3A 1YY5A 4UDRA 3HZQA 2CG5B 2DB2A 3UTHA 4WPYA 2ELYA 2GAGB 3T31A 4K5RA 1COYA 5F2KA 3G1IA 3O0HA 1RC7A 2RTXA 4F6NA 4FK1C 3DS1A 2C67A 2X8HA 1UN6B 4D03A 3EPKA 1H6VA 4GF7A 3P4PA 2JU2A 5KP6B 1DJNA 1IQSA 4J36A 4IPYA 5DCKA 2WPCA 1D4DA 2WPTA 5M10A 4HKGA 2YLWA 1YUIA 1VQ4P 3G5RA 2B3TB 2LMZA 5JCLA 5BR8E 1A1IA 2EMAA 1PJQA 4EQXA 1YJ9P 1AAYA 4G9KA 2LJUA 1EOQA 2LL8A 2EL5A 3SZFA 2JB1A 4DGKA 4NEVA 3HYXA 4ICYA 2Q6UA 4R2RA 2QEXP 3OW2O 1HQBA 3AEGA 3GDPA 4O43A 3UOXA 2JP9A 2DGCA 4U0FA 1VQKP 3CPJG 2CSHA 2WDVA 4PXHB 1T4OA 1M90Q 3OZ2A 4IJDA 2EJ4A 4IVMB 3JAMC 1REOA 1K30A 3CCSP 4JI4E 1E1LA 3NK2X 2M8PA 3T1HE 2ONTA 1WHQA 3URHA 5KVHA 3BNMA 4GDEA 4UDPA 2BS2A 4U8PA 3IWBA 1OJTA 5A6BA 2EHTA 2XT1A 4Y4LA 5CQFA 2KHXA 3AE8A 1GV4A 1O94A 4Z26A 1E0HA 2C3CA 1WRJA 3AEEA 4EMWA 1KFYA 4DR3E 3PS9A 3NN6X 2F8BA 2AFEA 2Z45A 4WYMA 1GRGA 4I59A 4NHRA 3JSKA 5BULA 3CCRP 2YM1A 4GUVA 3G0VA 4LF8E 3UCLA 2AFDA 2XFOA 1AH5A 2LOLA 4O5QA 1GEUA 1L9CA 3KPKA 3GRSA 4LF5E 1PDHA 2YG5A 4COCA 2BK5A 2MY5A 3VYYA 3UKLA 5AC5A 5HY5A 1L0IA 3EPJA 1E6JP 4JI6E 3KLJA 3V3OA 2G7HA 4A99A 1K0JA 2EPUA 4TLXA 2BRAA 3NRNA 2F5ZA 2VQEE 4ZCCA 3VRBA 3OC4A 2PEOA 1YKJA 3UKKA 2JBGA 1AF8A 2L3JA 2EQ0A 2H89A 4KZSA 1UHZA 2JKCA 2APGA 5CZDB 1X6FA 2GEWA 4JN9A 1OJAA 2KG9A 4JNAA 2VVLG 4Z43A 2ELZA 3LMLA 2GMJA 4U8OA 4JI3E 2XV6A 5KRQA 2N50A 4Z2RA 2NUEA 1PHHA 2JVAA 1L4SA 4AP3A 1P2EA 5FS7A 4Z24A 4O4KA 4XFXA 2JQ4A 2PENA 1N33E 1EH6A 4DG9A 1GRFA 2EPCA 4F54A 2KONA 1NHQA 3P4RA 2CDUA 5IXMB 4BK1A 3DS0A 1K9MQ 5HGNA 1O95A 4P78A 1MO9A 4XWRA 1PDAA 1LPFA 3DGZA 3UOVA 3LXDA 1CJCA 1Q82Q 1GALA 1ZKQA 2DKHA 3UOYA 5BS2A 1DNYA 3DPHA 3SQPA 1TDOA 1FCDA 2YWLA 2LT7A 3GMCA 1OR5A 3AE6A 3CIRA 2GR0A 3EJBA 1B69A 2JYLA 4LF9E 4M52A 2WDQA 4F37A 2R0CA 2CULA 2L4BA 4GDPA 3DMEA 2F4VE 4G73A 2CPNA 1YHQP 2RQLA 3D8XA 3GDNA 4U2LA 3CPHG 2EM0A 4X64E 3C4NA 2M1SA 1S2QA 4PABA 4BK3A 4YY3E 2EORA 5LMUE 1H84A 1X49A 2BABA 1RNIA 2Z44A 2VZ2A 3RP8A 3AE9A 1XMQE 2FJEA 1F8WA 1NPXA 2EPNA 3AE1A 5L46A 1ZOVA 3HZLA 4U0CA 4L5NC 2EMWA 1ZMCA 4DKKA 4Y4NA 2VOUA 3MHSC 2M7QA 2R4EA 4H2WC 2YRMA 2EN3A 2YTEA 1VRQB 4EM4A 3NYCA 2VLNA 4J2WA 2KGAA 2R9ZA 2V60A 2XXMA 2L8TA 1OJCA 2FACA 2B9XA 5IT9C 2V8QB 1FOHA 3CN8A 4QNBA 2X99A 1QVFO 1YQZA 4K0KE 3CCUP 2MF4A 2TPRA 3AB1A 3QFBA 1VKUA 3H09A 4G74A 3C4TA 4DV4E 1XNQE 2E5VA 2ZZCA 4II2A 1YI2P 3CTYA 4NWZA 1E39A 2B7SA 2X3NA 2HHHE 2YPNA 3CE7A 4H4XA 4AP1A 2EN1A 3AE2A 1WXRA 2BCPA 1CC2A 1CL0A 2ENHA 1NAAA 3JTZA 1WHNA 3B4QA 2YLZA 2DLKA 2C76A 2Q7VA 1E1MA 2LVHA 1VQPP 1DV5A 3REDA 3Q6JA 1YSAC 1D1DA 1GTHA 2L6MA 1M6IA 4CNKA 3ALMA 1BZLA 2IIDA 3SYIA 3AYLA 2YTPA 1A1LA 5JCKA 5KP8B 4LF6E 1QNTA 1KSSA 1I94E 3G1GA 3OTOE 2YR5A 3FG2P 1EIAA 3CCMP 3HYVA 2QA2A 1ZDLA 4U8LA 4JI5E 1VG9A 1GPEA 2WQYA 2L6EA 2PEJA 2VQ7A 1YJWP 4DV2E 4LTYA 2N3GA 2BHVA 1LTXR 3HYBA 4GAVA 2FTXB 5ER0A 4YSYA 4NEWA 2X8GA 3V76A 3DTJA 1PKPA 2WOWA 1UJZA 1KD1Q 4KHPE 4U8KA 2IHR1 5M0ZA 2BS3A 4H4SA 3I6DA 4JYAE 1FR2A 3P1XA 4GCMA 1HNXE 3ADIA 3NKSA 2OTLP 4X9MA 3KPFA 2GH5A 5KP7B 4C74A 2FGGA 3UKQA 1VQ5P 1E1NA 2EM8A 5LLQA 1DGCA 3GMBA 4TM1A 3NG7X 2C64A 3ISHA 4H7UA 5I4TG 1HNWE 1RSGA 2M8LA 4MLVA 4IVOB 3BGHA 3GKLC 1M64A 1PJ7A 4B68A 1NG4A 1ZX9A 4R2QA 2JOXA 2JR1A 4FK1A 1PXCA 2PEQA 4AQYE 2OA1A 2BXRA 3P05A 2O9ZA 3CPIG 4ZN0A 2AAQA 3LMOA 4DV5E 1XMOE 2VQBA 2ROQA 3I55P 3K7MX 3KKJA 1D4CA 3K7TA 4G6GA 5J7XA 2BA9A 3CC2P 1V59A 1CJ2A 4JDRA 4Z2UA 4NXME 3II4A 1M1KQ 5KL6A 2K94A 2WEUA 2JXPA 3ADGA 2GDYA 2LUQA 1MGTA 3FMWA 1CHUA 3G6EP 2NUFA 2WDRA 1FECA 4K22A 4LIIA 1W2BO 2CT1A 4H2NA 4YTPA 4NXNE 1O5WA 1YIJP 2KOPA 1KLPA 5AE1A 4PWVB 2WBSA 2LF4A 3BBGA 2QA4P 3SZWA 2V3AA 1JRYA 2YLRA 1IUSA 2H88A 4PH1A 4YSZA 4OX9E 3Q9TA 4H4PA 5KL5A 2MC6A 2KWLA 4IA5A 2VF1A 1NEKA 2YTDA 3T0KA 3SX6A 3RP6A 1CBOA 1JRXA 2M5RA 2EN7A 2WBUA 4A6NA 4OVIA 3B5IA 2RS6A 4HEIA 3EANA 2FHSC 2JB2A 1GXFA 3UK3C 1D7LA 1PXAA 2GZIA 2I9IA 3QJ4A 5HVCA 2FV4B 2EPXA 2YVJA 1A1KA 1LQTA 4K5SA 3GZLA 1Y56A 2OARA 1T38A 3NYEA 2DMIA 4CCRA 2ARDA 1B8SA 2WP9A 3CNPA 5HGLA 2RS7A 3MGEA 3IWDA 4FK5C 4M30A 4BJZA 1N4WA 1CEIA 3DK9A 4H2RA 3MHHC 1BKWA 2GVCA 3EF6A 4YKGA 3VR8A 2B7RA 2YVGA 1T4LB 1DODA 5EB4A 1QU6A 3T37A 1ZOYA 1JU2A 4X4JA 4UHPB 3C4BA 4GKJE 1NG3A 2VQFE 1F2IG 3AXBA 2WS3A 2YM2A 2ZM6E 4GEQB 2K2QA 1Q9IA 4BURA 2HGHA 2EQ3A 3QVPA 2L2NA 4H4YA 4NEOA 4IS1C 4GR1A 4JI0E 2NUGA 3AYJA 4H2QA 3FIMB 2XFQA 2HQMA 2YLXA 2M9AA 1O0WA 2MC5A 2EM5A 4BBYA 5CFFE 2JK6A 5LMNE 3CGDA 1OJDA 1SEZA 4BV6A 1G2DC 2RABA 2EOFA 4BHBA 2C4CA 2Z5XA 4EIPA 2XZ1C 1YYOA 3VRLC 1NHPA 2OALA 1MOKA 2YTNA 1DXLA 4DR4E 4OPUA 1EL7A 4O24A 3RNMA 3RHAA 2FADA 4ZYGA 2NO8A 1E7PA 2EMLA 3GD4A 2KODA 2FVFA 5C3JA 2N3HA 1PBBA 5HHFA 2EWLA 1QO8A 2GMHA 2XVJA 2X50A 2FJDA 4B69A 1K0LA 2C65A 2YG6A 2YTIA 2V3BA 3T1YE 3QFAA 3HYWA 2JB0A 1PJTA 5KL3A 2VVLA 2ODRC 4F6MA 1H82A 2YQUA 2LRSA 3GD3A 1BGJA 3DS3A 1KF6A 5T6JA 5HGOA 3ADAB 5F3WA 4WXDA 2EL6A 3UTEA 4P9SA 1VQ8P 3IWCA 1IJHA 1X31B 2VRMA 4RHBB 4IZ6A 2LJHA 5FLXC 2VE7C 2YRKA 4BMJA 4JQ9A 3VR9A 1ZR9A 1H7XA 1A43A 2KGCA 3TQMA 1ZP0A 1Y56B 3UOZA 2JOBA 1QRJA 2PEKA 1JOAA 1A8OA 4XFYA 2GB0A 1L0VA 1CJ4A 4H4WA 3FIGA 1YUJA 2BK4A 4BC7A 2V6OA 3BHFA 1RMDA 2A89A 2C70A 3ICTA 3LLHA 1WJPA 2ZZBA 3DK8A 3AYIA 4L8NA 3H8IA 4CA3A 2XVEA 2ERHA 2JAZA 4YTNA 4H4UA 1DNCA 5IQ4A 1D7YA 4EMIA 2N5IA 3AEBA 1IUTA 1LLMC 3QG5C 4Y4MA 2BXSA 3NTDA 2IVDA 2UXBE 2AQJA 1VHNA 4ECHA 4TLZA 1AUMA 4A9WA 2YLTA 3KZYA 2YAUA 1KYQA 2GZEA 2GAHB 3GRTA 5FS9A 1Q86Q 2KG8A 3NTEA 2EMHA 1X3OA 2AVAA 5IPYA 4MLQA 2DMYA 3VK6A 1HNZE 1M74A 4JI8E 3UKAA 4U8IA 2L2KB 4DR1E 4AT2A 4OPTA 1EMVA 1XANA 2MVUA 3P4SA 2L33A 2FVEA 4F9AB 4R2AA 2WU5A 4OCGA 3ZDNA 2CGQA 3T2YA 3ICSA 3KWRA 2BBGA 2XVHA 3NK0X 3AE5A 4CNJA 4X66E 2DKIA 1KC8Q 3I56P 2BRYA 2JB3A 2R1FA 3CMMA 3K7QX 3HPZA 2ODRD 2N6YA 3F6HA 3WE0A 3DJEA 1XNRE 4H4QA 4XWZA 2LPKA 1CC4A 2YSOA 2GRTA 1ZBQA 2I13A 1OJ9A 2X2BA 1ELIA 4J57A 2N6ZA 2Y6QA 4LF7E 3DGHA 2GPIA 2YVFA 2N8XA 3VRAA 3F8PA 1GRBA 1JK1A 2XFPA 5JCNA 2EZ6A 2ZBWA 4OOGC 4DR7E 2BS4A 1KNPA 1VDCA 2LE2A 4X9NA 3ADLA 1H83A 1GRHA 1N4VA 3J80C 3SY4A 4LFCE 2A8XA 4J34A 3DS2A 1BAJA 1TYPA 1HY8A 5GRTA 3C4AA 2K7IA 2R0PA 4U8NA 4DV7E 2OAMA 4O5GA 2GZGA 2MKDA 2B9YA 4NTCA 3NIXA 2NABA 2EMBA 3QSSA 3AV0A 4TUGA 5KVIA 4R2CA 3M1MA 2ENAA 4LU9A 2EOHA 2V87A 3GZMA 2L3CA 1UKVG 2EQ1A 1NHSA 2GF3A 2E72A 1GTKA 1GPJA 2UZZA 2YR6A 4B66A 2WOIA 4N9XA 4TUIA 3EPTA 3T2KA 2WPFA 1TN9A 4B67A 1LQUA 3E2DA 3RG6C 3LB8A 2EFJA 4H4ZA 1J26A 3VHTB 2GV8A 1GNDA 2BB8A 4MRTC 4K8DA 2PHHA 5BRTA 2EMKA 1TDFA 2EN2A 4F2JC 1ZAAC 3NT6A 4HB9A 4B65A 3LJPA 1GXGA 1F80D 3M99B 2Q0KA 4C3XA 1QVGO 2XLSA 5KL7A 2KOOA 1PJ6A 4OPGA 4B63A 3UKPA 3CCLP 2KOSA 2JGPA 4BHCA 3RG2A 4K7ZA 4GR6A 4JI2E 3AEFA 5AASA 4Q35B 4EM3A 7CEIA 3G21A 1P47A 1GERA 1BXIA 4LF4E 3V3NA 5DBJA 1N36E 2JO0A 2W0HA 3ITJA 3CNDA 5KMPA 3HTXA 2B7VA 3CD6P 2WCC3 1KNRA 1BGNA 1HYUA 4Q28A 1PBDA 1ZBTA 3UTFA 4AOXA 5J60A 3KU9A 1VQOP 1Y0PA 3AE3A 1T8KA 1YZ9A 4EQSA 5JPAA 2B9DA 2EM6A 2R4JA 4P7DA 2EM7A 4A79A 1KDGA 2YU5A 4DV6E 2EM9A 1JK2A 3T14A 3GWFA 5FS8A 2EQ8A 3EPLA 2EMZA 2RPCA 1X6HA 3ALJA 2WBTA 2UUBE 3ADJA 2LCEA 3C6KA 2GR2A 4R2PA 4O5UA 2E1MA 4NZHA 3GSIA 5HYMA 3ATRA 2PY8A 1F3PA 3CNJA 1TDEA 1DOEA 2XLPA 3M12A 3H4KA 3CGCA 1HR0E 3BF2A 3AE4A 3DF6A 4LFBE 4DSHA 1F8RA 3P4QA 2XVFA 1NJIQ 5KMQA 2DLQA 5A69A 1IBKE 3DH9A 2C73A 1H7WA 2GYKA 2RSIA 4RG3A 3P9UA 2EOJA 2LIUA 1YQ4A 2GHFA 3CNSA 2EPRA 3G71P 4FDCB 4DUYE 4R03A 2EPKX 2EOSA 3OMLA 1FEAA 4JY3A 2EOIA 3EQ1A 2KOUA 4XFZA 3THOB 3PO7A 2WESA 2L22A 2JWOA 3BIDA 2PEMA 3DJJA 4JY2A 3THNA 4APNA 1Z1BA 1YQ3A 3DJDA 1PJ5A 4RG4A 1X47A 2JYAA 1ACPA 1DQ3A 4CCQA 2GZFA 4LU6A 3FBSA 2ENCA 1X5WA 2V83A 4FX9A 3H8LA 3T2ZA 2M8NA 2DGYA 2WP6A 4UDQA 4R8OA 1N3GA 2EE8A 3J81C 2EQ9A 2YWQA 4H4RA 4GR2A 4CBQA 2ZZ0A 2V85A 2R76A 2QA1A 4XRQA 1EBDA 2CQ8A 1YITP 4YSHA 5KOXA 3IWAA 1VQ7P 1GETA 2WETA 2KGDA 2YG7A 3IHGA 2Z5YA 5U25A 3CGEA 5C2TA 2K0YA 4HA6A 3COXA 4Z25A 3NNEA 4EQWA 4U2SA 4MJWA 1B5QA 5HV8A 1KJKA 2MD9A 2EPPA 1GRTA 3CNTA 1EH7A 2YZTA 1PN0A 1M6EX 3SXIA 2WOVA 4WCTA 2YTGA 4U8JA 1LJ1A 2PEIA 5CKUA 4WXCA 4YTMA 2R45A 1SFEA 5TSEA 3GYIA 2PRTA 2YR4A 2ACZA 2DIXA 5DNYA 4K2XA 5GSNA 1CC6A 4U0AA 2EMIA 2UU9E 1ZMDA 3KZZA 2L2MA 2CTDA 5IWAE 3ALLA 4R2DA 1W4XA 2XCGA 2A25A 1LV0A 5BUKA 2YU8A 2LIWA 4WYQB 5F2OA 2YSPA 4GZNC 3ATQA 3GYXA 1JNRA 2WBAA 2V86A 5FS6A 3R9UA 4BJYA 4EMJA 4A6NB 1S2YA 1LVLA 2R46A 2MKNA 5LV9A 1GREA 5EJDA 1VQWA 1RO0A 1BWCA 3L8KA 3RMPA 1MEYC 5JCIA 1F6MA 4U0EA 3EJEA 2OLOA 2XVIA 1K73Q 4A7AA 1VQ6P 1N4UA 4EQRA 3AECA 1GT8A 4WX1A 3EPHA 5HXIA 1NCSA 1STUA 2LO3A 5AC4A 2WPEA 2EL4A 1TF6A 4U8MA 2GR1A 2EMFA 1A1JA 2DSYA
chains in the Genus database with same CATH topology
4B3ME 5U63A 1K0IA 3PVCA 1VQ9P 2TMDA 1RYIA 2OLNA 2C75A 3AUZA 1N8RQ 3QVRA 4C77A 4NNJA 2EIAA 2J3NA 3G5QA 3I3LA 4I8OA 4JV5E 4CY8A 3K6QA 2E5LE 1D5TA 3LOVA 3NHOX 3UP4A 2E4GA 3UKFA 2XDOA 1B4VA 3CCJP 3SGLA 3L1RA 5TR3A 4GAPA 3AEDA 1X48A 1Z6LA 2LUPB 1TDNA 1QLBA 4IA6A 1IUUA 5F2NA 4JI7E 1ONFA 3Q20A 1FKAE 2A87A 3IF9A 4J31A 1DOCA 5EBKA 1CJ3A 3F6GA 4A65A 2QAEA 3H4EA 3CXCO 3ZOQB 3GYJA 2K4VA 5AE3A 4OPCA 1F8SA 2UUCE 1IUQA 1XHCA 3NTAA 2V88A 5EOWA 1N34E 3H47A 1GOSA 2CWOA 2Y6RA 2BUOA 2B9WA 3CCVP 3CC7P 4KX6A 4H50A 4BS9A 4C5OA 3BI4A 1S3EA 2PYXA 5BS1A 1GTEA 4J33A 3G26A 1GSNA 4H4VA 4OPIA 1PXBA 2RGJA 2XLTA 3P1WA 1PBFA 3KD9A 4DR5E 1H81A 4OPLA 3ABVA 1IBLE 3LZXA 1TDKA 4WSPA 2R0GA 5KWFA 3IC9A 4TM4A 4B1BA 2WHDA 2JY9A 3LZWA 4KPRA 1Q81Q 1JJ2O 1QJDA 2NVKX 3UTGA 2FJBA 1TRBA 4BC9A 4IV9A 2LTRA 2EQ6A 3GWDA 1IBME 3H0DA 1RP0A 2FBWA 3NLCA 3UP5A 1GRAA 2NA2A 4U0DA 3UKHA 2XYOA 3G28A 1DOBA 3G29A 3CC4P 3G4SP 2BCGG 3HXLA 1VQMP 2JBVA 2RGOA 2C72A 1ZY8A 4A5LA 5KOWA 3DJWA 1PBEA 3HPSA 1VQLP 4M2ZA 3S61A 3VRDB 4LFAE 1RQ0A 4YKFA 1YJNP 4M0IA 2Z46A 4WFTA 4PAAA 2AR8A 1GZ6A 3QSMA 2B7TA 5KXJA 2JYGA 4I58A 5U1OA 3KA7A 4B64A 2YG3A 2BACA 2XLUA 4J56A 5KNLA 4Z44A 3QSEA 4YXDA 3AD9B 2LTSA 3KVEA 1TYTA 3FPZA 4C3YA 3VYXA 5FMHA 5AE2A 4BK2A 3SFDA 3NK1X 1JEHA 4XXGA 1T4NA 1ZK7A 3CGBA 3NN0X 4F9CB 2XFNA 1MXTA 1UILA 3CMAP 2QCUA 2H36X 2GR3A 5ADZA 2WZOA 4ZCDA 3NYFA 3C96A 1EL9A 2XLRA 4H2PA 3E1TA 1RO2A 1NDAA 3AE7A 1D4EA 2EG5A 3AD7B 2Q0LA 1DI2A 4F9BB 1KSUA 3NH3X 4GRTA 1GQEA 3NGCX 2L92A 1P2HA 5HGMA 3K30A 4LA1A 2CVJA 2BK3A 5BVAA 1E1KA 1K4QA 4Z2TA 4COPA 4OPDA 3LADA 3AEAA 4X8WA 5KMRA 4CY6A 1EKZA 2YLSA 1JRZA 4YT0A 1EL5A 5JCMA 1JNZA 1S72P 1VQNP 3BI2A 2UXDE 2V5ZA 1K8AQ 2GQFA 4B3SE 3CMEP 1FEBA 2C7GA 3CPWO 1EL8A 1ZMBA 2LBSB 1DJQA 5IQ1A 3ZYXA 4J8ZA 2M4IA 1N32E 3EAOA 3J7AG 4XROA 1NHRA 2UXCE 3HQ1A 2WU2A 4B3RE 1E6EA 4JNQA 3DK4A 4USRA 4II3A 3M0OA 3IHMA 4UP3A 1YYKA 1Q1WA 4DR2E 3RP7A 4NTDA 1FL2A 1GESA 1J5EE 2P9XA 3F8RA 3G5SA 1BF3A 4REKA 3DS5A 4U0BA 1KQSO 5A2QC 4D04A 1XDIA 2IVEA 2VVMA 1N1PA 3DJGX 4H4TA 3M13A 3CCEP 2JAEA 2UUAE 3AD8B 4DV3E 1VG0A 4M0VA 3CCQP 2C3DA 2VRLA 1CF3A 1NENA 4BCAA 5EB5A 2V61A 3S5WA 4DSGA 1L9DA 3SZ0A 4DNAA 2V89A 1SR9A 1S3BA 2X8CA 3DA1A 3SFEA 3J7Yp 4AT0A 2RSMA 2NPXA 4YHHE 1IUVA 2WP5A 3BNUA 4U2TA 3JU0A 1XPQA 4DV1E 4B3TE 2YT4A 4ADWA 3D1CA 4AOSA 4PH0A 3AWIA 2RGHA 3B6DA 1Q7YQ 2EQ7A 5LL6R 4DMIA 5KMSA 3ICRA 4X62E 1PS9A 2GQWA 4GKKE 3VQRA 2OTJP 4TM0A 4YWOA 4YSXA 3DS4A 1M6NA 3BHKA 1L9EA 2BC1A 4TM3A 1IUXA 2B76A 2BYBA 2XFUA 1B37A 2CFYA 4DV0E 1IUWA 1Q1RA 4NTEA 1YYWA 3LRYA 3SM8A 2C66A 1H86A 4JI1E 4USQA 1PBCA 4X65E 3WBHA 2YG4A 2BC0A 4EIQA 3B3RA 4CRTA 3BI5A 2FJAA 4E0VA 3F8DA 4RSLA 4G6HA 3SZCA 2I0ZA 3MSWA 1AOGA 2MDRA 4DUZE 1FJGE 4DR6E 1YY5A 4UDRA 3HZQA 2DB2A 3UTHA 4WPYA 2GAGB 3T31A 4K5RA 1COYA 5F2KA 3G1IA 3O0HA 1RC7A 2RTXA 4FK1C 3DS1A 2C67A 2X8HA 4D03A 1H6VA 4GF7A 3P4PA 1DJNA 4J36A 4IPYA 5DCKA 2WPCA 1D4DA 5M10A 2YLWA 1VQ4P 3G5RA 2B3TB 2LMZA 5JCLA 5BR8E 4EQXA 1YJ9P 4G9KA 1EOQA 3SZFA 2JB1A 4DGKA 4NEVA 3HYXA 4ICYA 2Q6UA 2QEXP 3OW2O 3AEGA 3GDPA 3UOXA 4U0FA 1VQKP 3CPJG 2WDVA 1T4OA 1M90Q 3OZ2A 4IVMB 3JAMC 1REOA 1K30A 3CCSP 4JI4E 1E1LA 3NK2X 2M8PA 3T1HE 2ONTA 1WHQA 3URHA 5KVHA 3BNMA 4GDEA 4UDPA 2BS2A 4U8PA 3IWBA 1OJTA 2XT1A 4Y4LA 5CQFA 2KHXA 3AE8A 1GV4A 1O94A 4Z26A 2C3CA 3AEEA 4EMWA 1KFYA 4DR3E 3PS9A 3NN6X 2F8BA 2Z45A 4WYMA 1GRGA 4I59A 3JSKA 5BULA 3CCRP 2YM1A 4GUVA 3G0VA 4LF8E 3UCLA 2XFOA 4O5QA 1GEUA 1L9CA 3KPKA 3GRSA 4LF5E 1PDHA 2YG5A 4COCA 2BK5A 3VYYA 3UKLA 5HY5A 1E6JP 4JI6E 3KLJA 3V3OA 2G7HA 4A99A 1K0JA 4TLXA 2BRAA 3NRNA 2F5ZA 2VQEE 4ZCCA 3VRBA 3OC4A 2PEOA 1YKJA 3UKKA 2L3JA 2H89A 4KZSA 1UHZA 2JKCA 2APGA 2GEWA 4JN9A 1OJAA 4JNAA 2VVLG 4Z43A 3LMLA 2GMJA 4U8OA 4JI3E 2XV6A 5KRQA 4Z2RA 2NUEA 1PHHA 2JVAA 4AP3A 1P2EA 5FS7A 4Z24A 4XFXA 2PENA 1N33E 1GRFA 4F54A 2KONA 1NHQA 3P4RA 2CDUA 4BK1A 3DS0A 1K9MQ 5HGNA 1O95A 4P78A 1MO9A 4XWRA 1LPFA 3DGZA 3UOVA 3LXDA 1CJCA 1Q82Q 1GALA 1ZKQA 2DKHA 3UOYA 5BS2A 3DPHA 3SQPA 1TDOA 1FCDA 2YWLA 3GMCA 3AE6A 3CIRA 2GR0A 2JYLA 4LF9E 4M52A 2WDQA 2R0CA 2CULA 4GDPA 3DMEA 2F4VE 4G73A 2CPNA 1YHQP 3D8XA 3GDNA 4U2LA 3CPHG 3C4NA 4X64E 2M1SA 1S2QA 4PABA 4BK3A 4YY3E 5LMUE 1H84A 1X49A 2BABA 1RNIA 2Z44A 2VZ2A 3RP8A 3AE9A 1XMQE 1F8WA 2FJEA 1NPXA 3AE1A 5L46A 1ZOVA 3HZLA 4U0CA 4L5NC 1ZMCA 4DKKA 4Y4NA 2VOUA 2M7QA 2R4EA 1VRQB 4EM4A 3NYCA 4J2WA 2R9ZA 2V60A 2XXMA 2L8TA 1OJCA 2B9XA 5IT9C 2V8QB 1FOHA 3CN8A 4QNBA 2X99A 1QVFO 1YQZA 4K0KE 3CCUP 2TPRA 3AB1A 3QFBA 3H09A 4G74A 3C4TA 4DV4E 1XNQE 2E5VA 2ZZCA 4II2A 1YI2P 3CTYA 4NWZA 1E39A 2B7SA 2X3NA 2HHHE 4H4XA 4AP1A 3AE2A 1WXRA 2BCPA 1CC2A 1CL0A 1NAAA 3JTZA 1WHNA 2YLZA 2C76A 2Q7VA 1E1MA 1VQPP 3REDA 3Q6JA 1D1DA 1GTHA 2L6MA 1M6IA 4CNKA 3ALMA 1BZLA 2IIDA 3SYIA 3AYLA 5JCKA 4LF6E 1KSSA 1I94E 3G1GA 3OTOE 2YR5A 3FG2P 1EIAA 3CCMP 3HYVA 2QA2A 1ZDLA 4U8LA 4JI5E 1VG9A 1GPEA 2WQYA 2L6EA 2PEJA 2VQ7A 1YJWP 4DV2E 4LTYA 2N3GA 2BHVA 1LTXR 3HYBA 4GAVA 2FTXB 5ER0A 4YSYA 4NEWA 2X8GA 3V76A 3DTJA 1PKPA 2WOWA 1KD1Q 4KHPE 4U8KA 2IHR1 5M0ZA 2BS3A 4H4SA 3I6DA 4JYAE 3P1XA 4GCMA 1HNXE 3ADIA 3NKSA 2OTLP 4X9MA 3KPFA 2GH5A 4C74A 2FGGA 3UKQA 1VQ5P 1E1NA 3GMBA 4TM1A 3NG7X 2C64A 3ISHA 4H7UA 5I4TG 1HNWE 1RSGA 2M8LA 4IVOB 1M64A 1PJ7A 4B68A 1NG4A 1ZX9A 2JOXA 2JR1A 4FK1A 1PXCA 2PEQA 4AQYE 2OA1A 2BXRA 3P05A 2O9ZA 3CPIG 4ZN0A 2AAQA 4DV5E 1XMOE 2VQBA 3I55P 3K7MX 3KKJA 1D4CA 3K7TA 4G6GA 5J7XA 3CC2P 1V59A 2BA9A 1CJ2A 4JDRA 4Z2UA 4NXME 3II4A 1M1KQ 2WEUA 3ADGA 2LUQA 3FMWA 1CHUA 3G6EP 2NUFA 2WDRA 1FECA 4K22A 4LIIA 1W2BO 4H2NA 4YTPA 4NXNE 1O5WA 1YIJP 5AE1A 2LF4A 2QA4P 3SZWA 2V3AA 1JRYA 2YLRA 1IUSA 2H88A 4PH1A 4YSZA 4OX9E 3Q9TA 4H4PA 2MC6A 4IA5A 2VF1A 1NEKA 3T0KA 3SX6A 3RP6A 1CBOA 1JRXA 4A6NA 4OVIA 3B5IA 2RS6A 3EANA 2JB2A 1GXFA 1D7LA 1PXAA 3QJ4A 2FV4B 2YVJA 1LQTA 4K5SA 1Y56A 2OARA 3NYEA 4CCRA 2ARDA 1B8SA 2WP9A 3CNPA 5HGLA 2RS7A 3MGEA 3IWDA 4M30A 4BJZA 1N4WA 3DK9A 4H2RA 2GVCA 1BKWA 3EF6A 4YKGA 3VR8A 2B7RA 2YVGA 1T4LB 1DODA 5EB4A 1QU6A 3T37A 1ZOYA 1JU2A 4X4JA 3C4BA 4GKJE 1NG3A 2VQFE 3AXBA 2WS3A 2YM2A 2ZM6E 4GEQB 1Q9IA 4BURA 3QVPA 2L2NA 4H4YA 4GR1A 4JI0E 2NUGA 3AYJA 4H2QA 3FIMB 2XFQA 2HQMA 2YLXA 1O0WA 2MC5A 4BBYA 5CFFE 2JK6A 5LMNE 3CGDA 1OJDA 1SEZA 4BV6A 2RABA 2C4CA 2Z5XA 4EIPA 1YYOA 3VRLC 1NHPA 2OALA 1MOKA 1DXLA 4DR4E 4OPUA 1EL7A 3RNMA 3RHAA 1E7PA 3GD4A 2KODA 5C3JA 2N3HA 1PBBA 5HHFA 2EWLA 1QO8A 2GMHA 2XVJA 2X50A 2FJDA 4B69A 1K0LA 2C65A 2YG6A 2V3BA 3T1YE 3QFAA 3HYWA 2VVLA 2ODRC 1H82A 2YQUA 2LRSA 3GD3A 1BGJA 3DS3A 1KF6A 5T6JA 5HGOA 3ADAB 5F3WA 3UTEA 4P9SA 1VQ8P 3IWCA 1IJHA 1X31B 2VRMA 2LJHA 5FLXC 2VE7C 4BMJA 4JQ9A 3VR9A 1H7XA 1A43A 1ZP0A 1Y56B 3UOZA 2JOBA 1QRJA 2PEKA 1JOAA 1A8OA 4XFYA 2GB0A 1L0VA 1CJ4A 4H4WA 3FIGA 2BK4A 4BC7A 2V6OA 3BHFA 2A89A 2C70A 3ICTA 3LLHA 2ZZBA 3DK8A 3AYIA 4L8NA 3H8IA 2XVEA 4YTNA 5IQ4A 4H4UA 1DNCA 1D7YA 4EMIA 3AEBA 1IUTA 4Y4MA 2BXSA 2IVDA 3NTDA 2UXBE 2AQJA 4ECHA 4TLZA 1AUMA 4A9WA 2YLTA 2YAUA 2GAHB 3GRTA 5FS9A 1Q86Q 3NTEA 5IPYA 2DMYA 3VK6A 1HNZE 1M74A 4JI8E 3UKAA 4U8IA 2L2KB 4DR1E 4AT2A 4OPTA 1XANA 3P4SA 2L33A 4F9AB 2WU5A 4OCGA 3ZDNA 3T2YA 3ICSA 3KWRA 2XVHA 3NK0X 3AE5A 4CNJA 4X66E 2DKIA 1KC8Q 3I56P 2BRYA 2JB3A 3K7QX 3CMMA 3HPZA 2ODRD 3F6HA 3WE0A 3DJEA 1XNRE 4H4QA 4XWZA 1CC4A 2GRTA 1ZBQA 1OJ9A 1ELIA 4J57A 2Y6QA 4LF7E 3DGHA 2YVFA 3VRAA 3F8PA 1GRBA 2XFPA 5JCNA 2EZ6A 2ZBWA 4OOGC 4DR7E 2BS4A 1KNPA 1VDCA 2LE2A 4X9NA 3ADLA 1H83A 1GRHA 1N4VA 3J80C 3SY4A 4LFCE 2A8XA 4J34A 3DS2A 1BAJA 1TYPA 5GRTA 3C4AA 2R0PA 4U8NA 4DV7E 2OAMA 2B9YA 4NTCA 3NIXA 3QSSA 3AV0A 4TUGA 5KVIA 3M1MA 4LU9A 2V87A 2L3CA 1UKVG 1NHSA 2GF3A 2UZZA 2YR6A 4B66A 2WOIA 4N9XA 4TUIA 3EPTA 3T2KA 2WPFA 4B67A 1LQUA 3E2DA 3RG6C 3LB8A 2EFJA 4H4ZA 1J26A 2GV8A 1GNDA 4K8DA 2PHHA 5BRTA 1TDFA 3NT6A 4HB9A 4B65A 3LJPA 2Q0KA 4C3XA 1QVGO 2XLSA 1PJ6A 4OPGA 4B63A 3UKPA 3CCLP 4K7ZA 4GR6A 4JI2E 3AEFA 5AASA 4EM3A 3G21A 1GERA 4LF4E 3V3NA 5DBJA 1N36E 2JO0A 2W0HA 3ITJA 3CNDA 5KMPA 3HTXA 2B7VA 3CD6P 1KNRA 1BGNA 1HYUA 4Q28A 1PBDA 1ZBTA 3UTFA 4AOXA 5J60A 3KU9A 1VQOP 1Y0PA 3AE3A 1YZ9A 4EQSA 5JPAA 2B9DA 2R4JA 4P7DA 4A79A 1KDGA 4DV6E 3T14A 3GWFA 5FS8A 2EQ8A 3ALJA 2UUBE 3ADJA 2GR2A 4O5UA 2E1MA 4NZHA 3GSIA 5HYMA 3ATRA 2PY8A 1F3PA 3CNJA 1TDEA 1DOEA 2XLPA 3M12A 3H4KA 3CGCA 1HR0E 3AE4A 3DF6A 4LFBE 4DSHA 1F8RA 3P4QA 2XVFA 1NJIQ 5KMQA 1IBKE 3DH9A 2C73A 1H7WA 4RG3A 3P9UA 1YQ4A 3CNSA 3G71P 4FDCB 4DUYE 4R03A 3OMLA 1FEAA 4JY3A 2KOUA 4XFZA 3PO7A 2WESA 2JWOA 2PEMA 3DJJA 4JY2A 4APNA 4RG4A 1YQ3A 3DJDA 1PJ5A 1X47A 1DQ3A 4CCQA 4LU6A 3FBSA 2V83A 4FX9A 3H8LA 3T2ZA 2M8NA 2DGYA 2WP6A 4UDQA 4R8OA 3J81C 2EQ9A 4H4RA 4GR2A 4CBQA 2ZZ0A 2V85A 2QA1A 4XRQA 1EBDA 1YITP 4YSHA 5KOXA 3IWAA 1VQ7P 1GETA 2WETA 2YG7A 3IHGA 2Z5YA 5U25A 3CGEA 5C2TA 4HA6A 3COXA 4Z25A 3NNEA 4EQWA 4U2SA 4MJWA 1B5QA 3CNTA 1GRTA 2YZTA 1PN0A 1M6EX 3SXIA 2WOVA 4WCTA 4U8JA 1LJ1A 2PEIA 5CKUA 4YTMA 2R45A 3GYIA 2YR4A 2ACZA 2DIXA 5DNYA 4K2XA 5GSNA 1CC6A 4U0AA 2UU9E 1ZMDA 2L2MA 5IWAE 3ALLA 1W4XA 2XCGA 1LV0A 5BUKA 4WYQB 5F2OA 3ATQA 3GYXA 1JNRA 2WBAA 2V86A 5FS6A 3R9UA 4BJYA 4EMJA 4A6NB 1S2YA 1LVLA 2R46A 5LV9A 1GREA 1VQWA 1RO0A 1BWCA 3L8KA 3RMPA 5JCIA 1F6MA 4U0EA 2OLOA 2XVIA 1K73Q 4A7AA 1VQ6P 1N4UA 4EQRA 3AECA 1GT8A 4WX1A 5HXIA 1STUA 2WPEA 4U8MA 2GR1A 2DSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YAU A;  3SFE A;  5U63 A;  3CTY A;  2GAH B;  1E39 A;  2B7S A;  3GRT A;  2NPX A;  4AT0 A;  1K0I A;  3PVC A;  1IUV A;  2WP5 A;  3BNU A;  4U2T A;  5FS9 A;  2TMD A;  1RYI A;  2OLN A;  2C75 A;  2X3N A;  3QVR A;  4C77 A;  1XPQ A;  2J3N A;  4H4X A;  3G5Q A;  3I3L A;  4ADW A;  4AP1 A;  5IPY A;  3D1C A;  4CY8 A;  3AE2 A;  1D5T A;  3LOV A;  3NHO X;  2BCP A;  3UP4 A;  1CC2 A;  2E4G A;  1CL0 A;  4AOS A;  1NAA A;  3UKA A;  3UKF A;  3AWI A;  2XDO A;  2YLZ A;  4U8I A;  2C76 A;  2Q7V A;  1E1M A;  2RGH A;  1B4V A;  3B6D A;  2EQ7 A;  3SGL A;  3L1R A;  4AT2 A;  4OPT A;  5TR3 A;  3AED A;  1XAN A;  3RED A;  3Q6J A;  3P4S A;  2WU5 A;  4OCG A;  1Z6L A;  1TDN A;  1GTH A;  1M6I A;  1QLB A;  3ICR A;  4IA6 A;  1IUU A;  3ZDN A;  3ALM A;  4CNK A;  1PS9 A;  1BZL A;  2GQW A;  2IID A;  3VQR A;  3AYL A;  1ONF A;  5JCK A;  4TM0 A;  4YWO A;  4YSX A;  2A87 A;  1KSS A;  3ICS A;  3IF9 A;  3BHK A;  4J31 A;  2YR5 A;  1DOC A;  5EBK A;  1L9E A;  2BC1 A;  3FG2 P;  4TM3 A;  1CJ3 A;  1IUX A;  4A65 A;  2QAE A;  2B76 A;  2XVH A;  2BYB A;  3NK0 X;  2QA2 A;  1ZDL A;  2XFU A;  3AE5 A;  1B37 A;  4U8L A;  1VG9 A;  4CNJ A;  2CFY A;  1GPE A;  2DKI A;  1IUW A;  1Q1R A;  3GYJ A;  2WQY A;  2JB3 A;  2VQ7 A;  3K7Q X;  4NTE A;  3SM8 A;  2C66 A;  4OPC A;  1F8S A;  1H86 A;  1LTX R;  1XHC A;  3WE0 A;  3DJE A;  4USQ A;  3NTA A;  4H4Q A;  4XWZ A;  1CC4 A;  1PBC A;  5ER0 A;  5EOW A;  2GRT A;  4YSY A;  1GOS A;  2X8G A;  2YG4 A;  2BC0 A;  4NEW A;  2Y6R A;  3V76 A;  2WOW A;  4EIQ A;  3B3R A;  1OJ9 A;  4CRT A;  3BI5 A;  2FJA A;  2B9W A;  4E0V A;  4U8K A;  1ELI A;  3F8D A;  5M0Z A;  4J57 A;  4RSL A;  2BS3 A;  4H4S A;  2Y6Q A;  3I6D A;  3DGH A;  4GCM A;  2I0Z A;  2YVF A;  1AOG A;  3VRA A;  4KX6 A;  4H50 A;  3F8P A;  3NKS A;  1YY5 A;  4UDR A;  1GRB A;  2XFP A;  4X9M A;  4C5O A;  3KPF A;  3BI4 A;  2GH5 A;  5JCN A;  3UTH A;  1S3E A;  2ZBW A;  2GAG B;  4C74 A;  4K5R A;  1COY A;  2PYX A;  2BS4 A;  1KNP A;  1VDC A;  3UKQ A;  1GTE A;  1E1N A;  4J33 A;  3O0H A;  4X9N A;  1H83 A;  1GRH A;  1N4V A;  3GMB A;  4TM1 A;  3NG7 X;  2C64 A;  3ISH A;  4H7U A;  2A8X A;  4FK1 C;  4J34 A;  2C67 A;  2X8H A;  1GSN A;  1RSG A;  4H4V A;  1TYP A;  4OPI A;  1PXB A;  2RGJ A;  2XLT A;  3P1W A;  5GRT A;  3C4A A;  4D03 A;  4IVO B;  1H6V A;  1PBF A;  2R0P A;  3KD9 A;  4GF7 A;  1H81 A;  3P4P A;  1M64 A;  4OPL A;  4U8N A;  1PJ7 A;  2OAM A;  1DJN A;  3ABV A;  4B68 A;  3LZX A;  2B9Y A;  1NG4 A;  1ZX9 A;  1TDK A;  4NTC A;  3NIX A;  4FK1 A;  1PXC A;  4J36 A;  2R0G A;  5KWF A;  3IC9 A;  2WPC A;  1D4D A;  3QSS A;  2OA1 A;  4TM4 A;  2BXR A;  5KVI A;  4B1B A;  5M10 A;  2WHD A;  2YLW A;  2O9Z A;  3G5R A;  3LZW A;  3CPI G;  1UKV G;  4ZN0 A;  4KPR A;  5JCL A;  2AAQ A;  1NHS A;  2GF3 A;  2VQB A;  2UZZ A;  3K7M X;  3KKJ A;  1QJD A;  2YR6 A;  1D4C A;  4EQX A;  4B66 A;  3K7T A;  2WOI A;  4N9X A;  5J7X A;  3EPT A;  2BA9 A;  1V59 A;  1CJ2 A;  2WPF A;  4JDR A;  2NVK X;  4Z2U A;  4B67 A;  1LQU A;  3UTG A;  2FJB A;  2JB1 A;  3LB8 A;  1TRB A;  3II4 A;  4DGK A;  4NEV A;  4IV9 A;  4ICY A;  2WEU A;  2EQ6 A;  4H4Z A;  3GWD A;  2Q6U A;  2GV8 A;  1RP0 A;  2FBW A;  1GND A;  3NLC A;  3UP5 A;  4K8D A;  3FMW A;  1CHU A;  1GRA A;  3AEG A;  3GDP A;  2PHH A;  2WDR A;  5BRT A;  1TDF A;  1FEC A;  4K22 A;  4LII A;  3UOX A;  3NT6 A;  3UKH A;  4HB9 A;  4B65 A;  4H2N A;  4YTP A;  1O5W A;  2XYO A;  1DOB A;  3LJP A;  3CPJ G;  2Q0K A;  2WDV A;  4C3X A;  2XLS A;  3OZ2 A;  2BCG G;  2JBV A;  1PJ6 A;  2RGO A;  4IVM B;  4OPG A;  2C72 A;  4B63 A;  3UKP A;  1REO A;  2V3A A;  1JRY A;  1ZY8 A;  2YLR A;  1IUS A;  2H88 A;  4A5L A;  1E1L A;  3NK2 X;  4K7Z A;  5KOW A;  4YSZ A;  1PBE A;  3Q9T A;  3URH A;  5KVH A;  4A99 A;  4H4P A;  3AEF A;  3BNM A;  4GDE A;  4UDP A;  2BS2 A;  4U8P A;  4EM3 A;  3S61 A;  1OJT A;  4IA5 A;  3VRD B;  1NEK A;  1GER A;  3V3N A;  4Y4L A;  5CQF A;  5DBJ A;  3AE8 A;  4YKF A;  1GV4 A;  1O94 A;  2W0H A;  3RP6 A;  1CBO A;  1JRX A;  3CND A;  3ITJ A;  4Z26 A;  2C3C A;  4PAA A;  4A6N A;  2AR8 A;  4OVI A;  3AEE A;  3EAN A;  3QSM A;  4EMW A;  1KFY A;  1BGN A;  1KNR A;  5KXJ A;  1HYU A;  4I58 A;  2JB2 A;  1GXF A;  1PBD A;  3UTF A;  1D7L A;  5U1O A;  4AOX A;  3PS9 A;  5J60 A;  1PXA A;  3KA7 A;  3KU9 A;  4B64 A;  3QJ4 A;  2YG3 A;  1Y0P A;  3AE3 A;  2BAC A;  3NN6 X;  2YVJ A;  2XLU A;  4EQS A;  1GRG A;  4I59 A;  1LQT A;  3JSK A;  5BUL A;  4K5S A;  2YM1 A;  1Y56 A;  4GUV A;  4J56 A;  2R4J A;  4Z44 A;  3QSE A;  4YXD A;  3NYE A;  4A79 A;  3AD9 B;  1KDG A;  4CCR A;  2ARD A;  1B8S A;  3UCL A;  3KVE A;  1TYT A;  2WP9 A;  3FPZ A;  3CNP A;  3GWF A;  4C3Y A;  2XFO A;  5FS8 A;  4O5Q A;  5FMH A;  2EQ8 A;  1GEU A;  4BK2 A;  1L9C A;  3ALJ A;  3SFD A;  3GRS A;  3NK1 X;  4BJZ A;  1JEH A;  1N4W A;  4XXG A;  1PDH A;  2YG5 A;  2GR2 A;  2BK5 A;  3NN0 X;  1ZK7 A;  3CGB A;  2XFN A;  1MXT A;  4O5U A;  2E1M A;  3DK9 A;  3UKL A;  4NZH A;  3GSI A;  5HY5 A;  2QCU A;  3ATR A;  4H2R A;  2GR3 A;  1BKW A;  2GVC A;  3EF6 A;  5HYM A;  1F3P A;  3KLJ A;  3CNJ A;  1TDE A;  3NYF A;  1DOE A;  2XLP A;  4ZCD A;  2B7R A;  1K0J A;  2YVG A;  3M12 A;  3V3O A;  3VR8 A;  3C96 A;  3H4K A;  3CGC A;  1DOD A;  3AE4 A;  4TLX A;  5EB4 A;  1EL9 A;  2XLR A;  3NRN A;  2F5Z A;  4H2P A;  4DSH A;  1F8R A;  3P4Q A;  2XVF A;  3T37 A;  1ZOY A;  3E1T A;  4ZCC A;  1NDA A;  1JU2 A;  3AE7 A;  4X4J A;  1D4E A;  3VRB A;  1NG3 A;  3OC4 A;  1YKJ A;  3AD7 B;  3DH9 A;  2C73 A;  2Q0L A;  1H7W A;  3AXB A;  3UKK A;  2WS3 A;  4RG3 A;  1KSU A;  3NH3 X;  2YM2 A;  3P9U A;  1YQ4 A;  4GRT A;  2H89 A;  3CNS A;  2JKC A;  4FDC B;  2APG A;  2GEW A;  1FEA A;  1Q9I A;  3NGC X;  4JN9 A;  4JY3 A;  4BUR A;  1OJA A;  4JNA A;  2VVL G;  1P2H A;  3PO7 A;  3QVP A;  4Z43 A;  2WES A;  2GMJ A;  4H4Y A;  4U8O A;  3DJJ A;  3K30 A;  5KRQ A;  4JY2 A;  4GR1 A;  4APN A;  4Z2R A;  4RG4 A;  1YQ3 A;  3DJD A;  1PJ5 A;  3AYJ A;  2CVJ A;  2BK3 A;  1PHH A;  3FIM B;  2XFQ A;  2HQM A;  4H2Q A;  5BVA A;  2YLX A;  1E1K A;  4CCQ A;  4AP3 A;  1P2E A;  5FS7 A;  1K4Q A;  4Z24 A;  4LU6 A;  4Z2T A;  2JK6 A;  3FBS A;  4FX9 A;  3CGD A;  1OJD A;  1SEZ A;  3LAD A;  4OPD A;  4BV6 A;  3H8L A;  2RAB A;  3AEA A;  4YKG A;  4CY6 A;  2Z5X A;  2WP6 A;  4UDQ A;  4EIP A;  1GRF A;  1NHP A;  2OAL A;  1MOK A;  1DXL A;  2YLS A;  1NHQ A;  1JRZ A;  2EQ9 A;  1EL7 A;  4OPU A;  4H4R A;  3RNM A;  4YT0 A;  3RHA A;  1EL5 A;  3P4R A;  4CBQ A;  2CDU A;  5JCM A;  1JNZ A;  2ZZ0 A;  4BK1 A;  2QA1 A;  1E7P A;  3BI2 A;  3GD4 A;  2V5Z A;  1EBD A;  5C3J A;  2GQF A;  1PBB A;  1O95 A;  1MO9 A;  5HHF A;  4YSH A;  1QO8 A;  5KOX A;  3IWA A;  2GMH A;  4XWR A;  1FEB A;  1GET A;  2XVJ A;  2C7G A;  2WET A;  1EL8 A;  2YG7 A;  1LPF A;  3IHG A;  2X50 A;  2Z5Y A;  3DGZ A;  5U25 A;  3UOV A;  2FJD A;  1DJQ A;  3CGE A;  5C2T A;  4B69 A;  1K0L A;  2C65 A;  3LXD A;  5IQ1 A;  3ZYX A;  1CJC A;  2YG6 A;  4HA6 A;  2V3B A;  1GAL A;  1ZKQ A;  3COX A;  4Z25 A;  2DKH A;  3UOY A;  3QFA A;  3NNE A;  3EAO A;  4EQW A;  3SQP A;  4U2S A;  4MJW A;  1B5Q A;  1TDO A;  1FCD A;  2YWL A;  1NHR A;  2VVL A;  3GMC A;  1H82 A;  2WU2 A;  2YQU A;  3GD3 A;  1E6E A;  4JNQ A;  3CNT A;  1GRT A;  3DK4 A;  1BGJ A;  1PN0 A;  3AE6 A;  3CIR A;  1KF6 A;  2GR0 A;  2WOV A;  4USR A;  3ADA B;  4WCT A;  3M0O A;  3UTE A;  4P9S A;  4U8J A;  3IHM A;  1IJH A;  4UP3 A;  1X31 B;  1LJ1 A;  2WDQ A;  4M52 A;  2VRM A;  2R0C A;  1Q1W A;  2CUL A;  4GDP A;  3RP7 A;  3DME A;  5CKU A;  4YTM A;  3D8X A;  3GDN A;  4NTD A;  2R45 A;  4JQ9 A;  3VR9 A;  4U2L A;  1FL2 A;  1GES A;  3GYI A;  1H7X A;  2YR4 A;  3CPH G;  2ACZ A;  3C4N A;  1S2Q A;  3F8R A;  1ZP0 A;  3G5S A;  4PAB A;  4BK3 A;  1BF3 A;  4REK A;  1Y56 B;  1H84 A;  4K2X A;  3UOZ A;  2BAB A;  5GSN A;  2VZ2 A;  1CC6 A;  3RP8 A;  1JOA A;  3AE9 A;  4D04 A;  2GB0 A;  1L0V A;  1CJ4 A;  1XDI A;  1ZMD A;  4H4W A;  1F8W A;  2FJE A;  1NPX A;  3ALL A;  2IVE A;  2VVM A;  1W4X A;  3AE1 A;  2XCG A;  1ZOV A;  1LV0 A;  2BK4 A;  1N1P A;  3HZL A;  5BUK A;  5L46 A;  3DJG X;  2V6O A;  4H4T A;  3M13 A;  3BHF A;  2A89 A;  2C70 A;  2JAE A;  3ICT A;  1ZMC A;  3AD8 B;  3ATQ A;  1JNR A;  2WBA A;  1VG0 A;  4Y4N A;  2ZZB A;  5FS6 A;  2VOU A;  3R9U A;  4BJY A;  4EMJ A;  4A6N B;  1S2Y A;  3DK8 A;  1LVL A;  2R46 A;  3AYI A;  5LV9 A;  2R4E A;  1GRE A;  2C3D A;  1VQW A;  2VRL A;  1VRQ B;  3H8I A;  1BWC A;  3L8K A;  1CF3 A;  4EM4 A;  3NYC A;  4J2W A;  2XVE A;  1NEN A;  2R9Z A;  5JCI A;  4YTN A;  2V60 A;  5IQ4 A;  4H4U A;  1DNC A;  1F6M A;  5EB5 A;  2V61 A;  1OJC A;  2B9X A;  1D7Y A;  2OLO A;  2XVI A;  4A7A A;  1FOH A;  3CN8 A;  3S5W A;  4EMI A;  4DSG A;  1L9D A;  1N4U A;  2X99 A;  3AEB A;  1YQZ A;  3AEC A;  1IUT A;  4EQR A;  1GT8 A;  2TPR A;  3AB1 A;  2BXS A;  3QFB A;  4WX1 A;  4Y4M A;  4DNA A;  5HXI A;  3NTD A;  4LA1 A;  2IVD A;  1S3B A;  2WPE A;  2AQJ A;  4U8M A;  2E5V A;  2GR1 A;  4ECH A;  4TLZ A;  4A9W A;  2YLT A;  2X8C A;  3DA1 A;  2ZZC A; 
#chains in the Genus database with same CATH topology
 4B3M E;  5U63 A;  2EOM A;  1K0I A;  3PVC A;  1VQ9 P;  2TMD A;  1RYI A;  2PNG A;  2C75 A;  2OLN A;  2VLQ A;  3AUZ A;  1N8R Q;  3QVR A;  4X9J A;  2EP3 A;  4C77 A;  4NNJ A;  2J7J A;  2EIA A;  2J3N A;  3G5Q A;  3I3L A;  4I8O A;  4JV5 E;  4CY8 A;  2LKI A;  3K6Q A;  2E5L E;  2EOZ A;  1D5T A;  3LOV A;  3NHO X;  2FQ2 A;  2E4G A;  3UP4 A;  3UKF A;  2XDO A;  2YTQ A;  1B4V A;  3CCJ P;  3SGL A;  3L1R A;  2LTE A;  5TR3 A;  4GAP A;  3AED A;  1X48 A;  4QKO A;  1Z6L A;  2LUP B;  1TDN A;  1QLB A;  4IA6 A;  1IUU A;  5F2N A;  1X6E A;  4JI7 E;  1ONF A;  3Q20 A;  1FKA E;  2A87 A;  3IF9 A;  4J31 A;  1DOC A;  5EBK A;  2EPM X;  1CJ3 A;  3F6G A;  4A65 A;  2QAE A;  3H4E A;  3CXC O;  3ZOQ B;  2EMY A;  3GYJ A;  2K4V A;  1TF3 A;  5AE3 A;  4OPC A;  1F8S A;  2UUC E;  1IUQ A;  1XHC A;  3NTA A;  2V88 A;  5EOW A;  1N34 E;  3H47 A;  2EMC A;  1GOS A;  2CWO A;  2Y6R A;  2EOQ A;  2BUO A;  2L0Q A;  2B9W A;  3CCV P;  3CC7 P;  4KX6 A;  1YFH A;  4H50 A;  1BBO A;  4BS9 A;  4C5O A;  1A1H A;  3BI4 A;  2K0X A;  2K5X A;  1S3E A;  2PYX A;  2FQ1 A;  5BS1 A;  1GTE A;  2YTO A;  4NZV A;  2FAE A;  2N98 A;  4J33 A;  3G26 A;  2YTF A;  4R2S A;  1NQ4 A;  1GSN A;  5A6B D;  2QNW A;  4H4V A;  4OPI A;  1PXB A;  2RGJ A;  2XLT A;  3P1W A;  1PBF A;  3KD9 A;  4DR5 E;  1H81 A;  4OPL A;  2MDG A;  3ABV A;  1IBL E;  2EOO A;  3EJD A;  3LZX A;  1TDK A;  2EOX A;  4WSP A;  2R0G A;  3U43 A;  3IC9 A;  5KWF A;  4ZYE A;  4TM4 A;  4B1B A;  1G2F C;  2WHD A;  2EM4 A;  2JY9 A;  3LZW A;  1NEI A;  4KPR A;  1Q81 Q;  1JJ2 O;  1YPN A;  1QJD A;  2NVK X;  3UTG A;  2FJB A;  1TRB A;  4BC9 A;  4IV9 A;  2LTR A;  2VSQ A;  2EQ6 A;  3GWD A;  1IBM E;  3H0D A;  1RP0 A;  2FBW A;  3NLC A;  5EW5 E;  2K93 A;  3UP5 A;  1GRA A;  2NA2 A;  4U0D A;  2K92 A;  1IQO A;  3UKH A;  2XYO A;  3G28 A;  2EPA A;  1DOB A;  3G29 A;  3CC4 P;  3G4S P;  2BCG G;  3HXL A;  1VQM P;  2GLI A;  2JBV A;  2EMX A;  2RGO A;  2C72 A;  1GXH A;  1ZY8 A;  4A5L A;  5KOW A;  3DJW A;  1PBE A;  3HPS A;  1VQL P;  4M2Z A;  3S61 A;  3VRD B;  4LFA E;  5A6K A;  1RQ0 A;  4YKF A;  1YJN P;  4M0I A;  2Z46 A;  4WFT A;  4PAA A;  2AR8 A;  1GZ6 A;  3QSM A;  2B7T A;  2FVA A;  5KXJ A;  2JYG A;  4I58 A;  2KR5 A;  5U1O A;  3KA7 A;  4B64 A;  2YG3 A;  2BAC A;  2JU1 A;  2XLU A;  2MVV A;  4BPG A;  4J56 A;  5KNL A;  1A1G A;  4Z44 A;  3QSE A;  4YXD A;  3AD9 B;  4HTG A;  1IMU A;  2LTS A;  3KVE A;  1TYT A;  3FPZ A;  4C3Y A;  3VYX A;  2JPA A;  5FMH A;  2EN6 A;  5AE2 A;  4BK2 A;  3SFD A;  3NK1 X;  1JEH A;  2GDW A;  4XXG A;  2DNW A;  1T4N A;  1ZK7 A;  3CGB A;  3NN0 X;  4F9C B;  2XFN A;  1MXT A;  1UIL A;  3CMA P;  2QCU A;  2H36 X;  2GR3 A;  5ADZ A;  4BPF A;  2LV2 A;  2WZO A;  4ZCD A;  2L9F A;  3NYF A;  3C96 A;  1A1F A;  1EL9 A;  2XLR A;  4H2P A;  3E1T A;  1RO2 A;  1NDA A;  3AE7 A;  1D4E A;  2EG5 A;  3AD7 B;  2Q0L A;  1DI2 A;  4F9B B;  1KSU A;  2KW2 A;  3NH3 X;  4GRT A;  1GQE A;  1BBG A;  2LML A;  4ZYD A;  3NGC X;  2MR7 A;  2L92 A;  1P2H A;  5HGM A;  3K30 A;  2EHS A;  4LA1 A;  2CVJ A;  4ZYH A;  2BK3 A;  2YTJ A;  5BVA A;  2HC5 A;  1E1K A;  1ZU1 A;  4BPH A;  1K4Q A;  4Z2T A;  2YRH A;  4COP A;  4OPD A;  3LAD A;  1L0H A;  3AEA A;  4X8W A;  5KMR A;  4CY6 A;  1EKZ A;  1PJS A;  5KL4 A;  2YLS A;  1JRZ A;  4YT0 A;  2D9H A;  1EL5 A;  5JCM A;  1JNZ A;  1S72 P;  1VQN P;  3BI2 A;  2UXD E;  2V5Z A;  2K0D X;  1K8A Q;  2GQF A;  4B3S E;  3ECR A;  3CME P;  2EPL X;  1FEB A;  2C7G A;  3CPW O;  2HJJ A;  1EL8 A;  1ZMB A;  4H2X C;  2LBS B;  2VLO A;  1DJQ A;  4WSG A;  5IQ1 A;  3ZYX A;  4J8Z A;  2M4I A;  2EPO A;  1N32 E;  3EAO A;  1MZ8 A;  3J7A G;  4XRO A;  1NHR A;  2UXC E;  3HQ1 A;  2WU2 A;  4B3R E;  1E6E A;  4JNQ A;  3DK4 A;  4USR A;  5KL2 A;  4II3 A;  3M0O A;  3IHM A;  4UP3 A;  1YYK A;  1Q1W A;  4DR2 E;  2KG6 A;  2GZJ A;  3RP7 A;  2KGE A;  4H2Y C;  4NTD A;  4N4R B;  1IMQ A;  1T39 A;  1FL2 A;  1GES A;  1J5E E;  2P9X A;  2EOE A;  3F8R A;  3G5S A;  1BF3 A;  4REK A;  3DS5 A;  4U0B A;  1KQS O;  5A2Q C;  2EN4 A;  2EMG A;  2AF8 A;  4D04 A;  1XDI A;  1Z6M A;  2KOQ A;  2IVE A;  2Q8U A;  2VVM A;  1N1P A;  3DJG X;  4H4T A;  1EH8 A;  3M13 A;  3CCE P;  2JAE A;  2GDX A;  2UUA E;  3AD8 B;  3C6M A;  2ADR A;  4DV3 E;  1VG0 A;  1ZNV A;  2EM2 A;  4M0V A;  3CCQ P;  2EOY A;  4R2E A;  2C3D A;  2VRL A;  1CF3 A;  1NEN A;  4BCA A;  5A6J A;  5EB5 A;  2V61 A;  3S5W A;  4DSG A;  1L9D A;  3SZ0 A;  1X3C A;  4DNA A;  2VLP A;  2V89 A;  1UBD C;  1SR9 A;  1S3B A;  2X8C A;  3DA1 A;  3SFE A;  3J7Y p;  2FQ0 A;  4KWY A;  4AT0 A;  2RSM A;  2NPX A;  4YHH E;  1IUV A;  2WP5 A;  3BNU A;  4U2T A;  2XZ0 D;  2EPZ A;  3JU0 A;  4WX9 A;  1XPQ A;  2EN8 A;  4DV1 E;  4B3T E;  2DRP A;  2YT4 A;  4ADW A;  4M9V C;  3D1C A;  4R0M A;  4AOS A;  1IMP A;  4PH0 A;  3AWI A;  2RGH A;  3B6D A;  1Q7Y Q;  2EQ7 A;  5LL6 R;  4DMI A;  5KMS A;  3ICR A;  1UNK A;  4X62 E;  1PS9 A;  2GQW A;  4GKK E;  3VQR A;  2OTJ P;  4TM0 A;  4YWO A;  4YSX A;  3DS4 A;  1M6N A;  3BHK A;  1L9E A;  2VRD A;  2BC1 A;  4TM3 A;  1IUX A;  2B76 A;  2BYB A;  2XFU A;  1B37 A;  2KOR A;  5A6A A;  1AYI A;  2CFY A;  4DV0 E;  1IUW A;  1Q1R A;  4NTE A;  1YYW A;  3LRY A;  1BB8 A;  3SM8 A;  2N5H A;  2C66 A;  1H86 A;  4JI1 E;  3L00 A;  4USQ A;  1PBC A;  4X65 E;  2MR8 A;  3WBH A;  2YG4 A;  3NY7 B;  2BC0 A;  4EIQ A;  3B3R A;  4CRT A;  3BI5 A;  2FJA A;  4E0V A;  3GJN A;  3F8D A;  4RSL A;  4RH8 A;  4G6H A;  3SZC A;  2I0Z A;  2CNR A;  3MSW A;  1AOG A;  5IV8 B;  2MDR A;  4DUZ E;  1FJG E;  4DR6 E;  2EM3 A;  1YY5 A;  4UDR A;  3HZQ A;  2CG5 B;  2DB2 A;  3UTH A;  4WPY A;  2ELY A;  2GAG B;  3T31 A;  4K5R A;  1COY A;  5F2K A;  3G1I A;  3O0H A;  1RC7 A;  2RTX A;  4F6N A;  4FK1 C;  3DS1 A;  2C67 A;  2X8H A;  1UN6 B;  4D03 A;  3EPK A;  1H6V A;  4GF7 A;  3P4P A;  2JU2 A;  5KP6 B;  1DJN A;  1IQS A;  4J36 A;  4IPY A;  5DCK A;  2WPC A;  1D4D A;  2WPT A;  5M10 A;  4HKG A;  2YLW A;  1YUI A;  1VQ4 P;  3G5R A;  2B3T B;  2LMZ A;  5JCL A;  5BR8 E;  1A1I A;  2EMA A;  1PJQ A;  4EQX A;  1YJ9 P;  1AAY A;  4G9K A;  2LJU A;  1EOQ A;  2LL8 A;  2EL5 A;  3SZF A;  2JB1 A;  4DGK A;  4NEV A;  3HYX A;  4ICY A;  2Q6U A;  4R2R A;  2QEX P;  3OW2 O;  1HQB A;  3AEG A;  3GDP A;  4O43 A;  3UOX A;  2JP9 A;  2DGC A;  4U0F A;  1VQK P;  3CPJ G;  2CSH A;  2WDV A;  4PXH B;  1T4O A;  1M90 Q;  3OZ2 A;  4IJD A;  2EJ4 A;  4IVM B;  3JAM C;  1REO A;  1K30 A;  3CCS P;  4JI4 E;  1E1L A;  3NK2 X;  2M8P A;  3T1H E;  2ONT A;  1WHQ A;  3URH A;  5KVH A;  3BNM A;  4GDE A;  4UDP A;  2BS2 A;  4U8P A;  3IWB A;  1OJT A;  5A6B A;  2EHT A;  2XT1 A;  4Y4L A;  5CQF A;  2KHX A;  3AE8 A;  1GV4 A;  1O94 A;  4Z26 A;  1E0H A;  2C3C A;  1WRJ A;  3AEE A;  4EMW A;  1KFY A;  4DR3 E;  3PS9 A;  3NN6 X;  2F8B A;  2AFE A;  2Z45 A;  4WYM A;  1GRG A;  4I59 A;  4NHR A;  3JSK A;  5BUL A;  3CCR P;  2YM1 A;  4GUV A;  3G0V A;  4LF8 E;  3UCL A;  2AFD A;  2XFO A;  1AH5 A;  2LOL A;  4O5Q A;  1GEU A;  1L9C A;  3KPK A;  3GRS A;  4LF5 E;  1PDH A;  2YG5 A;  4COC A;  2BK5 A;  2MY5 A;  3VYY A;  3UKL A;  5AC5 A;  5HY5 A;  1L0I A;  3EPJ A;  1E6J P;  4JI6 E;  3KLJ A;  3V3O A;  2G7H A;  4A99 A;  1K0J A;  2EPU A;  4TLX A;  2BRA A;  3NRN A;  2F5Z A;  2VQE E;  4ZCC A;  3VRB A;  3OC4 A;  2PEO A;  1YKJ A;  3UKK A;  2JBG A;  1AF8 A;  2L3J A;  2EQ0 A;  2H89 A;  4KZS A;  1UHZ A;  2JKC A;  2APG A;  5CZD B;  1X6F A;  2GEW A;  4JN9 A;  1OJA A;  2KG9 A;  4JNA A;  2VVL G;  4Z43 A;  2ELZ A;  3LML A;  2GMJ A;  4U8O A;  4JI3 E;  2XV6 A;  5KRQ A;  2N50 A;  4Z2R A;  2NUE A;  1PHH A;  2JVA A;  1L4S A;  4AP3 A;  1P2E A;  5FS7 A;  4Z24 A;  4O4K A;  4XFX A;  2JQ4 A;  2PEN A;  1N33 E;  1EH6 A;  4DG9 A;  1GRF A;  2EPC A;  4F54 A;  2KON A;  1NHQ A;  3P4R A;  2CDU A;  5IXM B;  4BK1 A;  3DS0 A;  1K9M Q;  5HGN A;  1O95 A;  4P78 A;  1MO9 A;  4XWR A;  1PDA A;  1LPF A;  3DGZ A;  3UOV A;  3LXD A;  1CJC A;  1Q82 Q;  1GAL A;  1ZKQ A;  2DKH A;  3UOY A;  5BS2 A;  1DNY A;  3DPH A;  3SQP A;  1TDO A;  1FCD A;  2YWL A;  2LT7 A;  3GMC A;  1OR5 A;  3AE6 A;  3CIR A;  2GR0 A;  3EJB A;  1B69 A;  2JYL A;  4LF9 E;  4M52 A;  2WDQ A;  4F37 A;  2R0C A;  2CUL A;  2L4B A;  4GDP A;  3DME A;  2F4V E;  4G73 A;  2CPN A;  1YHQ P;  2RQL A;  3D8X A;  3GDN A;  4U2L A;  3CPH G;  2EM0 A;  4X64 E;  3C4N A;  2M1S A;  1S2Q A;  4PAB A;  4BK3 A;  4YY3 E;  2EOR A;  5LMU E;  1H84 A;  1X49 A;  2BAB A;  1RNI A;  2Z44 A;  2VZ2 A;  3RP8 A;  3AE9 A;  1XMQ E;  2FJE A;  1F8W A;  1NPX A;  2EPN A;  3AE1 A;  5L46 A;  1ZOV A;  3HZL A;  4U0C A;  4L5N C;  2EMW A;  1ZMC A;  4DKK A;  4Y4N A;  2VOU A;  3MHS C;  2M7Q A;  2R4E A;  4H2W C;  2YRM A;  2EN3 A;  2YTE A;  1VRQ B;  4EM4 A;  3NYC A;  2VLN A;  4J2W A;  2KGA A;  2R9Z A;  2V60 A;  2XXM A;  2L8T A;  1OJC A;  2FAC A;  2B9X A;  5IT9 C;  2V8Q B;  1FOH A;  3CN8 A;  4QNB A;  2X99 A;  1QVF O;  1YQZ A;  4K0K E;  3CCU P;  2MF4 A;  2TPR A;  3AB1 A;  3QFB A;  1VKU A;  3H09 A;  4G74 A;  3C4T A;  4DV4 E;  1XNQ E;  2E5V A;  2ZZC A;  4II2 A;  1YI2 P;  3CTY A;  4NWZ A;  1E39 A;  2B7S A;  2X3N A;  2HHH E;  2YPN A;  3CE7 A;  4H4X A;  4AP1 A;  2EN1 A;  3AE2 A;  1WXR A;  2BCP A;  1CC2 A;  1CL0 A;  2ENH A;  1NAA A;  3JTZ A;  1WHN A;  3B4Q A;  2YLZ A;  2DLK A;  2C76 A;  2Q7V A;  1E1M A;  2LVH A;  1VQP P;  1DV5 A;  3RED A;  3Q6J A;  1YSA C;  1D1D A;  1GTH A;  2L6M A;  1M6I A;  4CNK A;  3ALM A;  1BZL A;  2IID A;  3SYI A;  3AYL A;  2YTP A;  1A1L A;  5JCK A;  5KP8 B;  4LF6 E;  1QNT A;  1KSS A;  1I94 E;  3G1G A;  3OTO E;  2YR5 A;  3FG2 P;  1EIA A;  3CCM P;  3HYV A;  2QA2 A;  1ZDL A;  4U8L A;  4JI5 E;  1VG9 A;  1GPE A;  2WQY A;  2L6E A;  2PEJ A;  2VQ7 A;  1YJW P;  4DV2 E;  4LTY A;  2N3G A;  2BHV A;  1LTX R;  3HYB A;  4GAV A;  2FTX B;  5ER0 A;  4YSY A;  4NEW A;  2X8G A;  3V76 A;  3DTJ A;  1PKP A;  2WOW A;  1UJZ A;  1KD1 Q;  4KHP E;  4U8K A;  2IHR 1;  5M0Z A;  2BS3 A;  4H4S A;  3I6D A;  4JYA E;  1FR2 A;  3P1X A;  4GCM A;  1HNX E;  3ADI A;  3NKS A;  2OTL P;  4X9M A;  3KPF A;  2GH5 A;  5KP7 B;  4C74 A;  2FGG A;  3UKQ A;  1VQ5 P;  1E1N A;  2EM8 A;  5LLQ A;  1DGC A;  3GMB A;  4TM1 A;  3NG7 X;  2C64 A;  3ISH A;  4H7U A;  5I4T G;  1HNW E;  1RSG A;  2M8L A;  4MLV A;  4IVO B;  3BGH A;  3GKL C;  1M64 A;  1PJ7 A;  4B68 A;  1NG4 A;  1ZX9 A;  4R2Q A;  2JOX A;  2JR1 A;  4FK1 A;  1PXC A;  2PEQ A;  4AQY E;  2OA1 A;  2BXR A;  3P05 A;  2O9Z A;  3CPI G;  4ZN0 A;  2AAQ A;  3LMO A;  4DV5 E;  1XMO E;  2VQB A;  2ROQ A;  3I55 P;  3K7M X;  3KKJ A;  1D4C A;  3K7T A;  4G6G A;  5J7X A;  2BA9 A;  3CC2 P;  1V59 A;  1CJ2 A;  4JDR A;  4Z2U A;  4NXM E;  3II4 A;  1M1K Q;  5KL6 A;  2K94 A;  2WEU A;  2JXP A;  3ADG A;  2GDY A;  2LUQ A;  1MGT A;  3FMW A;  1CHU A;  3G6E P;  2NUF A;  2WDR A;  1FEC A;  4K22 A;  4LII A;  1W2B O;  2CT1 A;  4H2N A;  4YTP A;  4NXN E;  1O5W A;  1YIJ P;  2KOP A;  1KLP A;  5AE1 A;  4PWV B;  2WBS A;  2LF4 A;  3BBG A;  2QA4 P;  3SZW A;  2V3A A;  1JRY A;  2YLR A;  1IUS A;  2H88 A;  4PH1 A;  4YSZ A;  4OX9 E;  3Q9T A;  4H4P A;  5KL5 A;  2MC6 A;  2KWL A;  4IA5 A;  2VF1 A;  1NEK A;  2YTD A;  3T0K A;  3SX6 A;  3RP6 A;  1CBO A;  1JRX A;  2M5R A;  2EN7 A;  2WBU A;  4A6N A;  4OVI A;  3B5I A;  2RS6 A;  4HEI A;  3EAN A;  2FHS C;  2JB2 A;  1GXF A;  3UK3 C;  1D7L A;  1PXA A;  2GZI A;  2I9I A;  3QJ4 A;  5HVC A;  2FV4 B;  2EPX A;  2YVJ A;  1A1K A;  1LQT A;  4K5S A;  3GZL A;  1Y56 A;  2OAR A;  1T38 A;  3NYE A;  2DMI A;  4CCR A;  2ARD A;  1B8S A;  2WP9 A;  3CNP A;  5HGL A;  2RS7 A;  3MGE A;  3IWD A;  4FK5 C;  4M30 A;  4BJZ A;  1N4W A;  1CEI A;  3DK9 A;  4H2R A;  3MHH C;  1BKW A;  2GVC A;  3EF6 A;  4YKG A;  3VR8 A;  2B7R A;  2YVG A;  1T4L B;  1DOD A;  5EB4 A;  1QU6 A;  3T37 A;  1ZOY A;  1JU2 A;  4X4J A;  4UHP B;  3C4B A;  4GKJ E;  1NG3 A;  2VQF E;  1F2I G;  3AXB A;  2WS3 A;  2YM2 A;  2ZM6 E;  4GEQ B;  2K2Q A;  1Q9I A;  4BUR A;  2HGH A;  2EQ3 A;  3QVP A;  2L2N A;  4H4Y A;  4NEO A;  4IS1 C;  4GR1 A;  4JI0 E;  2NUG A;  3AYJ A;  4H2Q A;  3FIM B;  2XFQ A;  2HQM A;  2YLX A;  2M9A A;  1O0W A;  2MC5 A;  2EM5 A;  4BBY A;  5CFF E;  2JK6 A;  5LMN E;  3CGD A;  1OJD A;  1SEZ A;  4BV6 A;  1G2D C;  2RAB A;  2EOF A;  4BHB A;  2C4C A;  2Z5X A;  4EIP A;  2XZ1 C;  1YYO A;  3VRL C;  1NHP A;  2OAL A;  1MOK A;  2YTN A;  1DXL A;  4DR4 E;  4OPU A;  1EL7 A;  4O24 A;  3RNM A;  3RHA A;  2FAD A;  4ZYG A;  2NO8 A;  1E7P A;  2EML A;  3GD4 A;  2KOD A;  2FVF A;  5C3J A;  2N3H A;  1PBB A;  5HHF A;  2EWL A;  1QO8 A;  2GMH A;  2XVJ A;  2X50 A;  2FJD A;  4B69 A;  1K0L A;  2C65 A;  2YG6 A;  2YTI A;  2V3B A;  3T1Y E;  3QFA A;  3HYW A;  2JB0 A;  1PJT A;  5KL3 A;  2VVL A;  2ODR C;  4F6M A;  1H82 A;  2YQU A;  2LRS A;  3GD3 A;  1BGJ A;  3DS3 A;  1KF6 A;  5T6J A;  5HGO A;  3ADA B;  5F3W A;  4WXD A;  2EL6 A;  3UTE A;  4P9S A;  1VQ8 P;  3IWC A;  1IJH A;  1X31 B;  2VRM A;  4RHB B;  4IZ6 A;  2LJH A;  5FLX C;  2VE7 C;  2YRK A;  4BMJ A;  4JQ9 A;  3VR9 A;  1ZR9 A;  1H7X A;  1A43 A;  2KGC A;  3TQM A;  1ZP0 A;  1Y56 B;  3UOZ A;  2JOB A;  1QRJ A;  2PEK A;  1JOA A;  1A8O A;  4XFY A;  2GB0 A;  1L0V A;  1CJ4 A;  4H4W A;  3FIG A;  1YUJ A;  2BK4 A;  4BC7 A;  2V6O A;  3BHF A;  1RMD A;  2A89 A;  2C70 A;  3ICT A;  3LLH A;  1WJP A;  2ZZB A;  3DK8 A;  3AYI A;  4L8N A;  3H8I A;  4CA3 A;  2XVE A;  2ERH A;  2JAZ A;  4YTN A;  4H4U A;  1DNC A;  5IQ4 A;  1D7Y A;  4EMI A;  2N5I A;  3AEB A;  1IUT A;  1LLM C;  3QG5 C;  4Y4M A;  2BXS A;  3NTD A;  2IVD A;  2UXB E;  2AQJ A;  1VHN A;  4ECH A;  4TLZ A;  1AUM A;  4A9W A;  2YLT A;  3KZY A;  2YAU A;  1KYQ A;  2GZE A;  2GAH B;  3GRT A;  5FS9 A;  1Q86 Q;  2KG8 A;  3NTE A;  2EMH A;  1X3O A;  2AVA A;  5IPY A;  4MLQ A;  2DMY A;  3VK6 A;  1HNZ E;  1M74 A;  4JI8 E;  3UKA A;  4U8I A;  2L2K B;  4DR1 E;  4AT2 A;  4OPT A;  1EMV A;  1XAN A;  2MVU A;  3P4S A;  2L33 A;  2FVE A;  4F9A B;  4R2A A;  2WU5 A;  4OCG A;  3ZDN A;  2CGQ A;  3T2Y A;  3ICS A;  3KWR A;  2BBG A;  2XVH A;  3NK0 X;  3AE5 A;  4CNJ A;  4X66 E;  2DKI A;  1KC8 Q;  3I56 P;  2BRY A;  2JB3 A;  2R1F A;  3CMM A;  3K7Q X;  3HPZ A;  2ODR D;  2N6Y A;  3F6H A;  3WE0 A;  3DJE A;  1XNR E;  4H4Q A;  4XWZ A;  2LPK A;  1CC4 A;  2YSO A;  2GRT A;  1ZBQ A;  2I13 A;  1OJ9 A;  2X2B A;  1ELI A;  4J57 A;  2N6Z A;  2Y6Q A;  4LF7 E;  3DGH A;  2GPI A;  2YVF A;  2N8X A;  3VRA A;  3F8P A;  1GRB A;  1JK1 A;  2XFP A;  5JCN A;  2EZ6 A;  2ZBW A;  4OOG C;  4DR7 E;  2BS4 A;  1KNP A;  1VDC A;  2LE2 A;  4X9N A;  3ADL A;  1H83 A;  1GRH A;  1N4V A;  3J80 C;  3SY4 A;  4LFC E;  2A8X A;  4J34 A;  3DS2 A;  1BAJ A;  1TYP A;  1HY8 A;  5GRT A;  3C4A A;  2K7I A;  2R0P A;  4U8N A;  4DV7 E;  2OAM A;  4O5G A;  2GZG A;  2MKD A;  2B9Y A;  4NTC A;  3NIX A;  2NAB A;  2EMB A;  3QSS A;  3AV0 A;  4TUG A;  5KVI A;  4R2C A;  3M1M A;  2ENA A;  4LU9 A;  2EOH A;  2V87 A;  3GZM A;  2L3C A;  1UKV G;  2EQ1 A;  1NHS A;  2GF3 A;  2E72 A;  1GTK A;  1GPJ A;  2UZZ A;  2YR6 A;  4B66 A;  2WOI A;  4N9X A;  4TUI A;  3EPT A;  3T2K A;  2WPF A;  1TN9 A;  4B67 A;  1LQU A;  3E2D A;  3RG6 C;  3LB8 A;  2EFJ A;  4H4Z A;  1J26 A;  3VHT B;  2GV8 A;  1GND A;  2BB8 A;  4MRT C;  4K8D A;  2PHH A;  5BRT A;  2EMK A;  1TDF A;  2EN2 A;  4F2J C;  1ZAA C;  3NT6 A;  4HB9 A;  4B65 A;  3LJP A;  1GXG A;  1F80 D;  3M99 B;  2Q0K A;  4C3X A;  1QVG O;  2XLS A;  5KL7 A;  2KOO A;  1PJ6 A;  4OPG A;  4B63 A;  3UKP A;  3CCL P;  2KOS A;  2JGP A;  4BHC A;  3RG2 A;  4K7Z A;  4GR6 A;  4JI2 E;  3AEF A;  5AAS A;  4Q35 B;  4EM3 A;  7CEI A;  3G21 A;  1P47 A;  1GER A;  1BXI A;  4LF4 E;  3V3N A;  5DBJ A;  1N36 E;  2JO0 A;  2W0H A;  3ITJ A;  3CND A;  5KMP A;  3HTX A;  2B7V A;  3CD6 P;  2WCC 3;  1KNR A;  1BGN A;  1HYU A;  4Q28 A;  1PBD A;  1ZBT A;  3UTF A;  4AOX A;  5J60 A;  3KU9 A;  1VQO P;  1Y0P A;  3AE3 A;  1T8K A;  1YZ9 A;  4EQS A;  5JPA A;  2B9D A;  2EM6 A;  2R4J A;  4P7D A;  2EM7 A;  4A79 A;  1KDG A;  2YU5 A;  4DV6 E;  2EM9 A;  1JK2 A;  3T14 A;  3GWF A;  5FS8 A;  2EQ8 A;  3EPL A;  2EMZ A;  2RPC A;  1X6H A;  3ALJ A;  2WBT A;  2UUB E;  3ADJ A;  2LCE A;  3C6K A;  2GR2 A;  4R2P A;  4O5U A;  2E1M A;  4NZH A;  3GSI A;  5HYM A;  3ATR A;  2PY8 A;  1F3P A;  3CNJ A;  1TDE A;  1DOE A;  2XLP A;  3M12 A;  3H4K A;  3CGC A;  1HR0 E;  3BF2 A;  3AE4 A;  3DF6 A;  4LFB E;  4DSH A;  1F8R A;  3P4Q A;  2XVF A;  1NJI Q;  5KMQ A;  2DLQ A;  5A69 A;  1IBK E;  3DH9 A;  2C73 A;  1H7W A;  2GYK A;  2RSI A;  4RG3 A;  3P9U A;  2EOJ A;  2LIU A;  1YQ4 A;  2GHF A;  3CNS A;  2EPR A;  3G71 P;  4FDC B;  4DUY E;  4R03 A;  2EPK X;  2EOS A;  3OML A;  1FEA A;  4JY3 A;  2EOI A;  3EQ1 A;  2KOU A;  4XFZ A;  3THO B;  3PO7 A;  2WES A;  2L22 A;  2JWO A;  3BID A;  2PEM A;  3DJJ A;  4JY2 A;  3THN A;  4APN A;  1Z1B A;  1YQ3 A;  3DJD A;  1PJ5 A;  4RG4 A;  1X47 A;  2JYA A;  1ACP A;  1DQ3 A;  4CCQ A;  2GZF A;  4LU6 A;  3FBS A;  2ENC A;  1X5W A;  2V83 A;  4FX9 A;  3H8L A;  3T2Z A;  2M8N A;  2DGY A;  2WP6 A;  4UDQ A;  4R8O A;  1N3G A;  2EE8 A;  3J81 C;  2EQ9 A;  2YWQ A;  4H4R A;  4GR2 A;  4CBQ A;  2ZZ0 A;  2V85 A;  2R76 A;  2QA1 A;  4XRQ A;  1EBD A;  2CQ8 A;  1YIT P;  4YSH A;  5KOX A;  3IWA A;  1VQ7 P;  1GET A;  2WET A;  2KGD A;  2YG7 A;  3IHG A;  2Z5Y A;  5U25 A;  3CGE A;  5C2T A;  2K0Y A;  4HA6 A;  3COX A;  4Z25 A;  3NNE A;  4EQW A;  4U2S A;  4MJW A;  1B5Q A;  5HV8 A;  1KJK A;  2MD9 A;  2EPP A;  1GRT A;  3CNT A;  1EH7 A;  2YZT A;  1PN0 A;  1M6E X;  3SXI A;  2WOV A;  4WCT A;  2YTG A;  4U8J A;  1LJ1 A;  2PEI A;  5CKU A;  4WXC A;  4YTM A;  2R45 A;  1SFE A;  5TSE A;  3GYI A;  2PRT A;  2YR4 A;  2ACZ A;  2DIX A;  5DNY A;  4K2X A;  5GSN A;  1CC6 A;  4U0A A;  2EMI A;  2UU9 E;  1ZMD A;  3KZZ A;  2L2M A;  2CTD A;  5IWA E;  3ALL A;  4R2D A;  1W4X A;  2XCG A;  2A25 A;  1LV0 A;  5BUK A;  2YU8 A;  2LIW A;  4WYQ B;  5F2O A;  2YSP A;  4GZN C;  3ATQ A;  3GYX A;  1JNR A;  2WBA A;  2V86 A;  5FS6 A;  3R9U A;  4BJY A;  4EMJ A;  4A6N B;  1S2Y A;  1LVL A;  2R46 A;  2MKN A;  5LV9 A;  1GRE A;  5EJD A;  1VQW A;  1RO0 A;  1BWC A;  3L8K A;  3RMP A;  1MEY C;  5JCI A;  1F6M A;  4U0E A;  3EJE A;  2OLO A;  2XVI A;  1K73 Q;  4A7A A;  1VQ6 P;  1N4U A;  4EQR A;  3AEC A;  1GT8 A;  4WX1 A;  3EPH A;  5HXI A;  1NCS A;  1STU A;  2LO3 A;  5AC4 A;  2WPE A;  2EL4 A;  1TF6 A;  4U8M A;  2GR1 A;  2EMF A;  1A1J A;  2DSY A; 
#chains in the Genus database with same CATH homology
 4B3M E;  5U63 A;  1K0I A;  3PVC A;  1VQ9 P;  2TMD A;  1RYI A;  2OLN A;  2C75 A;  3AUZ A;  1N8R Q;  3QVR A;  4C77 A;  4NNJ A;  2EIA A;  2J3N A;  3G5Q A;  3I3L A;  4I8O A;  4JV5 E;  4CY8 A;  3K6Q A;  2E5L E;  1D5T A;  3LOV A;  3NHO X;  3UP4 A;  2E4G A;  3UKF A;  2XDO A;  1B4V A;  3CCJ P;  3SGL A;  3L1R A;  5TR3 A;  4GAP A;  3AED A;  1X48 A;  1Z6L A;  2LUP B;  1TDN A;  1QLB A;  4IA6 A;  1IUU A;  5F2N A;  4JI7 E;  1ONF A;  3Q20 A;  1FKA E;  2A87 A;  3IF9 A;  4J31 A;  1DOC A;  5EBK A;  1CJ3 A;  3F6G A;  4A65 A;  2QAE A;  3H4E A;  3CXC O;  3ZOQ B;  3GYJ A;  2K4V A;  5AE3 A;  4OPC A;  1F8S A;  2UUC E;  1IUQ A;  1XHC A;  3NTA A;  2V88 A;  5EOW A;  1N34 E;  3H47 A;  1GOS A;  2CWO A;  2Y6R A;  2BUO A;  2B9W A;  3CCV P;  3CC7 P;  4KX6 A;  4H50 A;  4BS9 A;  4C5O A;  3BI4 A;  1S3E A;  2PYX A;  5BS1 A;  1GTE A;  4J33 A;  3G26 A;  1GSN A;  4H4V A;  4OPI A;  1PXB A;  2RGJ A;  2XLT A;  3P1W A;  1PBF A;  3KD9 A;  4DR5 E;  1H81 A;  4OPL A;  3ABV A;  1IBL E;  3LZX A;  1TDK A;  4WSP A;  2R0G A;  5KWF A;  3IC9 A;  4TM4 A;  4B1B A;  2WHD A;  2JY9 A;  3LZW A;  4KPR A;  1Q81 Q;  1JJ2 O;  1QJD A;  2NVK X;  3UTG A;  2FJB A;  1TRB A;  4BC9 A;  4IV9 A;  2LTR A;  2EQ6 A;  3GWD A;  1IBM E;  3H0D A;  1RP0 A;  2FBW A;  3NLC A;  3UP5 A;  1GRA A;  2NA2 A;  4U0D A;  3UKH A;  2XYO A;  3G28 A;  1DOB A;  3G29 A;  3CC4 P;  3G4S P;  2BCG G;  3HXL A;  1VQM P;  2JBV A;  2RGO A;  2C72 A;  1ZY8 A;  4A5L A;  5KOW A;  3DJW A;  1PBE A;  3HPS A;  1VQL P;  4M2Z A;  3S61 A;  3VRD B;  4LFA E;  1RQ0 A;  4YKF A;  1YJN P;  4M0I A;  2Z46 A;  4WFT A;  4PAA A;  2AR8 A;  1GZ6 A;  3QSM A;  2B7T A;  5KXJ A;  2JYG A;  4I58 A;  5U1O A;  3KA7 A;  4B64 A;  2YG3 A;  2BAC A;  2XLU A;  4J56 A;  5KNL A;  4Z44 A;  3QSE A;  4YXD A;  3AD9 B;  2LTS A;  3KVE A;  1TYT A;  3FPZ A;  4C3Y A;  3VYX A;  5FMH A;  5AE2 A;  4BK2 A;  3SFD A;  3NK1 X;  1JEH A;  4XXG A;  1T4N A;  1ZK7 A;  3CGB A;  3NN0 X;  4F9C B;  2XFN A;  1MXT A;  1UIL A;  3CMA P;  2QCU A;  2H36 X;  2GR3 A;  5ADZ A;  2WZO A;  4ZCD A;  3NYF A;  3C96 A;  1EL9 A;  2XLR A;  4H2P A;  3E1T A;  1RO2 A;  1NDA A;  3AE7 A;  1D4E A;  2EG5 A;  3AD7 B;  2Q0L A;  1DI2 A;  4F9B B;  1KSU A;  3NH3 X;  4GRT A;  1GQE A;  3NGC X;  2L92 A;  1P2H A;  5HGM A;  3K30 A;  4LA1 A;  2CVJ A;  2BK3 A;  5BVA A;  1E1K A;  1K4Q A;  4Z2T A;  4COP A;  4OPD A;  3LAD A;  3AEA A;  4X8W A;  5KMR A;  4CY6 A;  1EKZ A;  2YLS A;  1JRZ A;  4YT0 A;  1EL5 A;  5JCM A;  1JNZ A;  1S72 P;  1VQN P;  3BI2 A;  2UXD E;  2V5Z A;  1K8A Q;  2GQF A;  4B3S E;  3CME P;  1FEB A;  2C7G A;  3CPW O;  1EL8 A;  1ZMB A;  2LBS B;  1DJQ A;  5IQ1 A;  3ZYX A;  4J8Z A;  2M4I A;  1N32 E;  3EAO A;  3J7A G;  4XRO A;  1NHR A;  2UXC E;  3HQ1 A;  2WU2 A;  4B3R E;  1E6E A;  4JNQ A;  3DK4 A;  4USR A;  4II3 A;  3M0O A;  3IHM A;  4UP3 A;  1YYK A;  1Q1W A;  4DR2 E;  3RP7 A;  4NTD A;  1FL2 A;  1GES A;  1J5E E;  2P9X A;  3F8R A;  3G5S A;  1BF3 A;  4REK A;  3DS5 A;  4U0B A;  1KQS O;  5A2Q C;  4D04 A;  1XDI A;  2IVE A;  2VVM A;  1N1P A;  3DJG X;  4H4T A;  3M13 A;  3CCE P;  2JAE A;  2UUA E;  3AD8 B;  4DV3 E;  1VG0 A;  4M0V A;  3CCQ P;  2C3D A;  2VRL A;  1CF3 A;  1NEN A;  4BCA A;  5EB5 A;  2V61 A;  3S5W A;  4DSG A;  1L9D A;  3SZ0 A;  4DNA A;  2V89 A;  1SR9 A;  1S3B A;  2X8C A;  3DA1 A;  3SFE A;  3J7Y p;  4AT0 A;  2RSM A;  2NPX A;  4YHH E;  1IUV A;  2WP5 A;  3BNU A;  4U2T A;  3JU0 A;  1XPQ A;  4DV1 E;  4B3T E;  2YT4 A;  4ADW A;  3D1C A;  4AOS A;  4PH0 A;  3AWI A;  2RGH A;  3B6D A;  1Q7Y Q;  2EQ7 A;  5LL6 R;  4DMI A;  5KMS A;  3ICR A;  4X62 E;  1PS9 A;  2GQW A;  4GKK E;  3VQR A;  2OTJ P;  4TM0 A;  4YWO A;  4YSX A;  3DS4 A;  1M6N A;  3BHK A;  1L9E A;  2BC1 A;  4TM3 A;  1IUX A;  2B76 A;  2BYB A;  2XFU A;  1B37 A;  2CFY A;  4DV0 E;  1IUW A;  1Q1R A;  4NTE A;  1YYW A;  3LRY A;  3SM8 A;  2C66 A;  1H86 A;  4JI1 E;  4USQ A;  1PBC A;  4X65 E;  3WBH A;  2YG4 A;  2BC0 A;  4EIQ A;  3B3R A;  4CRT A;  3BI5 A;  2FJA A;  4E0V A;  3F8D A;  4RSL A;  4G6H A;  3SZC A;  2I0Z A;  3MSW A;  1AOG A;  2MDR A;  4DUZ E;  1FJG E;  4DR6 E;  1YY5 A;  4UDR A;  3HZQ A;  2DB2 A;  3UTH A;  4WPY A;  2GAG B;  3T31 A;  4K5R A;  1COY A;  5F2K A;  3G1I A;  3O0H A;  1RC7 A;  2RTX A;  4FK1 C;  3DS1 A;  2C67 A;  2X8H A;  4D03 A;  1H6V A;  4GF7 A;  3P4P A;  1DJN A;  4J36 A;  4IPY A;  5DCK A;  2WPC A;  1D4D A;  5M10 A;  2YLW A;  1VQ4 P;  3G5R A;  2B3T B;  2LMZ A;  5JCL A;  5BR8 E;  4EQX A;  1YJ9 P;  4G9K A;  1EOQ A;  3SZF A;  2JB1 A;  4DGK A;  4NEV A;  3HYX A;  4ICY A;  2Q6U A;  2QEX P;  3OW2 O;  3AEG A;  3GDP A;  3UOX A;  4U0F A;  1VQK P;  3CPJ G;  2WDV A;  1T4O A;  1M90 Q;  3OZ2 A;  4IVM B;  3JAM C;  1REO A;  1K30 A;  3CCS P;  4JI4 E;  1E1L A;  3NK2 X;  2M8P A;  3T1H E;  2ONT A;  1WHQ A;  3URH A;  5KVH A;  3BNM A;  4GDE A;  4UDP A;  2BS2 A;  4U8P A;  3IWB A;  1OJT A;  2XT1 A;  4Y4L A;  5CQF A;  2KHX A;  3AE8 A;  1GV4 A;  1O94 A;  4Z26 A;  2C3C A;  3AEE A;  4EMW A;  1KFY A;  4DR3 E;  3PS9 A;  3NN6 X;  2F8B A;  2Z45 A;  4WYM A;  1GRG A;  4I59 A;  3JSK A;  5BUL A;  3CCR P;  2YM1 A;  4GUV A;  3G0V A;  4LF8 E;  3UCL A;  2XFO A;  4O5Q A;  1GEU A;  1L9C A;  3KPK A;  3GRS A;  4LF5 E;  1PDH A;  2YG5 A;  4COC A;  2BK5 A;  3VYY A;  3UKL A;  5HY5 A;  1E6J P;  4JI6 E;  3KLJ A;  3V3O A;  2G7H A;  4A99 A;  1K0J A;  4TLX A;  2BRA A;  3NRN A;  2F5Z A;  2VQE E;  4ZCC A;  3VRB A;  3OC4 A;  2PEO A;  1YKJ A;  3UKK A;  2L3J A;  2H89 A;  4KZS A;  1UHZ A;  2JKC A;  2APG A;  2GEW A;  4JN9 A;  1OJA A;  4JNA A;  2VVL G;  4Z43 A;  3LML A;  2GMJ A;  4U8O A;  4JI3 E;  2XV6 A;  5KRQ A;  4Z2R A;  2NUE A;  1PHH A;  2JVA A;  4AP3 A;  1P2E A;  5FS7 A;  4Z24 A;  4XFX A;  2PEN A;  1N33 E;  1GRF A;  4F54 A;  2KON A;  1NHQ A;  3P4R A;  2CDU A;  4BK1 A;  3DS0 A;  1K9M Q;  5HGN A;  1O95 A;  4P78 A;  1MO9 A;  4XWR A;  1LPF A;  3DGZ A;  3UOV A;  3LXD A;  1CJC A;  1Q82 Q;  1GAL A;  1ZKQ A;  2DKH A;  3UOY A;  5BS2 A;  3DPH A;  3SQP A;  1TDO A;  1FCD A;  2YWL A;  3GMC A;  3AE6 A;  3CIR A;  2GR0 A;  2JYL A;  4LF9 E;  4M52 A;  2WDQ A;  2R0C A;  2CUL A;  4GDP A;  3DME A;  2F4V E;  4G73 A;  2CPN A;  1YHQ P;  3D8X A;  3GDN A;  4U2L A;  3CPH G;  3C4N A;  4X64 E;  2M1S A;  1S2Q A;  4PAB A;  4BK3 A;  4YY3 E;  5LMU E;  1H84 A;  1X49 A;  2BAB A;  1RNI A;  2Z44 A;  2VZ2 A;  3RP8 A;  3AE9 A;  1XMQ E;  1F8W A;  2FJE A;  1NPX A;  3AE1 A;  5L46 A;  1ZOV A;  3HZL A;  4U0C A;  4L5N C;  1ZMC A;  4DKK A;  4Y4N A;  2VOU A;  2M7Q A;  2R4E A;  1VRQ B;  4EM4 A;  3NYC A;  4J2W A;  2R9Z A;  2V60 A;  2XXM A;  2L8T A;  1OJC A;  2B9X A;  5IT9 C;  2V8Q B;  1FOH A;  3CN8 A;  4QNB A;  2X99 A;  1QVF O;  1YQZ A;  4K0K E;  3CCU P;  2TPR A;  3AB1 A;  3QFB A;  3H09 A;  4G74 A;  3C4T A;  4DV4 E;  1XNQ E;  2E5V A;  2ZZC A;  4II2 A;  1YI2 P;  3CTY A;  4NWZ A;  1E39 A;  2B7S A;  2X3N A;  2HHH E;  4H4X A;  4AP1 A;  3AE2 A;  1WXR A;  2BCP A;  1CC2 A;  1CL0 A;  1NAA A;  3JTZ A;  1WHN A;  2YLZ A;  2C76 A;  2Q7V A;  1E1M A;  1VQP P;  3RED A;  3Q6J A;  1D1D A;  1GTH A;  2L6M A;  1M6I A;  4CNK A;  3ALM A;  1BZL A;  2IID A;  3SYI A;  3AYL A;  5JCK A;  4LF6 E;  1KSS A;  1I94 E;  3G1G A;  3OTO E;  2YR5 A;  3FG2 P;  1EIA A;  3CCM P;  3HYV A;  2QA2 A;  1ZDL A;  4U8L A;  4JI5 E;  1VG9 A;  1GPE A;  2WQY A;  2L6E A;  2PEJ A;  2VQ7 A;  1YJW P;  4DV2 E;  4LTY A;  2N3G A;  2BHV A;  1LTX R;  3HYB A;  4GAV A;  2FTX B;  5ER0 A;  4YSY A;  4NEW A;  2X8G A;  3V76 A;  3DTJ A;  1PKP A;  2WOW A;  1KD1 Q;  4KHP E;  4U8K A;  2IHR 1;  5M0Z A;  2BS3 A;  4H4S A;  3I6D A;  4JYA E;  3P1X A;  4GCM A;  1HNX E;  3ADI A;  3NKS A;  2OTL P;  4X9M A;  3KPF A;  2GH5 A;  4C74 A;  2FGG A;  3UKQ A;  1VQ5 P;  1E1N A;  3GMB A;  4TM1 A;  3NG7 X;  2C64 A;  3ISH A;  4H7U A;  5I4T G;  1HNW E;  1RSG A;  2M8L A;  4IVO B;  1M64 A;  1PJ7 A;  4B68 A;  1NG4 A;  1ZX9 A;  2JOX A;  2JR1 A;  4FK1 A;  1PXC A;  2PEQ A;  4AQY E;  2OA1 A;  2BXR A;  3P05 A;  2O9Z A;  3CPI G;  4ZN0 A;  2AAQ A;  4DV5 E;  1XMO E;  2VQB A;  3I55 P;  3K7M X;  3KKJ A;  1D4C A;  3K7T A;  4G6G A;  5J7X A;  3CC2 P;  1V59 A;  2BA9 A;  1CJ2 A;  4JDR A;  4Z2U A;  4NXM E;  3II4 A;  1M1K Q;  2WEU A;  3ADG A;  2LUQ A;  3FMW A;  1CHU A;  3G6E P;  2NUF A;  2WDR A;  1FEC A;  4K22 A;  4LII A;  1W2B O;  4H2N A;  4YTP A;  4NXN E;  1O5W A;  1YIJ P;  5AE1 A;  2LF4 A;  2QA4 P;  3SZW A;  2V3A A;  1JRY A;  2YLR A;  1IUS A;  2H88 A;  4PH1 A;  4YSZ A;  4OX9 E;  3Q9T A;  4H4P A;  2MC6 A;  4IA5 A;  2VF1 A;  1NEK A;  3T0K A;  3SX6 A;  3RP6 A;  1CBO A;  1JRX A;  4A6N A;  4OVI A;  3B5I A;  2RS6 A;  3EAN A;  2JB2 A;  1GXF A;  1D7L A;  1PXA A;  3QJ4 A;  2FV4 B;  2YVJ A;  1LQT A;  4K5S A;  1Y56 A;  2OAR A;  3NYE A;  4CCR A;  2ARD A;  1B8S A;  2WP9 A;  3CNP A;  5HGL A;  2RS7 A;  3MGE A;  3IWD A;  4M30 A;  4BJZ A;  1N4W A;  3DK9 A;  4H2R A;  2GVC A;  1BKW A;  3EF6 A;  4YKG A;  3VR8 A;  2B7R A;  2YVG A;  1T4L B;  1DOD A;  5EB4 A;  1QU6 A;  3T37 A;  1ZOY A;  1JU2 A;  4X4J A;  3C4B A;  4GKJ E;  1NG3 A;  2VQF E;  3AXB A;  2WS3 A;  2YM2 A;  2ZM6 E;  4GEQ B;  1Q9I A;  4BUR A;  3QVP A;  2L2N A;  4H4Y A;  4GR1 A;  4JI0 E;  2NUG A;  3AYJ A;  4H2Q A;  3FIM B;  2XFQ A;  2HQM A;  2YLX A;  1O0W A;  2MC5 A;  4BBY A;  5CFF E;  2JK6 A;  5LMN E;  3CGD A;  1OJD A;  1SEZ A;  4BV6 A;  2RAB A;  2C4C A;  2Z5X A;  4EIP A;  1YYO A;  3VRL C;  1NHP A;  2OAL A;  1MOK A;  1DXL A;  4DR4 E;  4OPU A;  1EL7 A;  3RNM A;  3RHA A;  1E7P A;  3GD4 A;  2KOD A;  5C3J A;  2N3H A;  1PBB A;  5HHF A;  2EWL A;  1QO8 A;  2GMH A;  2XVJ A;  2X50 A;  2FJD A;  4B69 A;  1K0L A;  2C65 A;  2YG6 A;  2V3B A;  3T1Y E;  3QFA A;  3HYW A;  2VVL A;  2ODR C;  1H82 A;  2YQU A;  2LRS A;  3GD3 A;  1BGJ A;  3DS3 A;  1KF6 A;  5T6J A;  5HGO A;  3ADA B;  5F3W A;  3UTE A;  4P9S A;  1VQ8 P;  3IWC A;  1IJH A;  1X31 B;  2VRM A;  2LJH A;  5FLX C;  2VE7 C;  4BMJ A;  4JQ9 A;  3VR9 A;  1H7X A;  1A43 A;  1ZP0 A;  1Y56 B;  3UOZ A;  2JOB A;  1QRJ A;  2PEK A;  1JOA A;  1A8O A;  4XFY A;  2GB0 A;  1L0V A;  1CJ4 A;  4H4W A;  3FIG A;  2BK4 A;  4BC7 A;  2V6O A;  3BHF A;  2A89 A;  2C70 A;  3ICT A;  3LLH A;  2ZZB A;  3DK8 A;  3AYI A;  4L8N A;  3H8I A;  2XVE A;  4YTN A;  5IQ4 A;  4H4U A;  1DNC A;  1D7Y A;  4EMI A;  3AEB A;  1IUT A;  4Y4M A;  2BXS A;  2IVD A;  3NTD A;  2UXB E;  2AQJ A;  4ECH A;  4TLZ A;  1AUM A;  4A9W A;  2YLT A;  2YAU A;  2GAH B;  3GRT A;  5FS9 A;  1Q86 Q;  3NTE A;  5IPY A;  2DMY A;  3VK6 A;  1HNZ E;  1M74 A;  4JI8 E;  3UKA A;  4U8I A;  2L2K B;  4DR1 E;  4AT2 A;  4OPT A;  1XAN A;  3P4S A;  2L33 A;  4F9A B;  2WU5 A;  4OCG A;  3ZDN A;  3T2Y A;  3ICS A;  3KWR A;  2XVH A;  3NK0 X;  3AE5 A;  4CNJ A;  4X66 E;  2DKI A;  1KC8 Q;  3I56 P;  2BRY A;  2JB3 A;  3K7Q X;  3CMM A;  3HPZ A;  2ODR D;  3F6H A;  3WE0 A;  3DJE A;  1XNR E;  4H4Q A;  4XWZ A;  1CC4 A;  2GRT A;  1ZBQ A;  1OJ9 A;  1ELI A;  4J57 A;  2Y6Q A;  4LF7 E;  3DGH A;  2YVF A;  3VRA A;  3F8P A;  1GRB A;  2XFP A;  5JCN A;  2EZ6 A;  2ZBW A;  4OOG C;  4DR7 E;  2BS4 A;  1KNP A;  1VDC A;  2LE2 A;  4X9N A;  3ADL A;  1H83 A;  1GRH A;  1N4V A;  3J80 C;  3SY4 A;  4LFC E;  2A8X A;  4J34 A;  3DS2 A;  1BAJ A;  1TYP A;  5GRT A;  3C4A A;  2R0P A;  4U8N A;  4DV7 E;  2OAM A;  2B9Y A;  4NTC A;  3NIX A;  3QSS A;  3AV0 A;  4TUG A;  5KVI A;  3M1M A;  4LU9 A;  2V87 A;  2L3C A;  1UKV G;  1NHS A;  2GF3 A;  2UZZ A;  2YR6 A;  4B66 A;  2WOI A;  4N9X A;  4TUI A;  3EPT A;  3T2K A;  2WPF A;  4B67 A;  1LQU A;  3E2D A;  3RG6 C;  3LB8 A;  2EFJ A;  4H4Z A;  1J26 A;  2GV8 A;  1GND A;  4K8D A;  2PHH A;  5BRT A;  1TDF A;  3NT6 A;  4HB9 A;  4B65 A;  3LJP A;  2Q0K A;  4C3X A;  1QVG O;  2XLS A;  1PJ6 A;  4OPG A;  4B63 A;  3UKP A;  3CCL P;  4K7Z A;  4GR6 A;  4JI2 E;  3AEF A;  5AAS A;  4EM3 A;  3G21 A;  1GER A;  4LF4 E;  3V3N A;  5DBJ A;  1N36 E;  2JO0 A;  2W0H A;  3ITJ A;  3CND A;  5KMP A;  3HTX A;  2B7V A;  3CD6 P;  1KNR A;  1BGN A;  1HYU A;  4Q28 A;  1PBD A;  1ZBT A;  3UTF A;  4AOX A;  5J60 A;  3KU9 A;  1VQO P;  1Y0P A;  3AE3 A;  1YZ9 A;  4EQS A;  5JPA A;  2B9D A;  2R4J A;  4P7D A;  4A79 A;  1KDG A;  4DV6 E;  3T14 A;  3GWF A;  5FS8 A;  2EQ8 A;  3ALJ A;  2UUB E;  3ADJ A;  2GR2 A;  4O5U A;  2E1M A;  4NZH A;  3GSI A;  5HYM A;  3ATR A;  2PY8 A;  1F3P A;  3CNJ A;  1TDE A;  1DOE A;  2XLP A;  3M12 A;  3H4K A;  3CGC A;  1HR0 E;  3AE4 A;  3DF6 A;  4LFB E;  4DSH A;  1F8R A;  3P4Q A;  2XVF A;  1NJI Q;  5KMQ A;  1IBK E;  3DH9 A;  2C73 A;  1H7W A;  4RG3 A;  3P9U A;  1YQ4 A;  3CNS A;  3G71 P;  4FDC B;  4DUY E;  4R03 A;  3OML A;  1FEA A;  4JY3 A;  2KOU A;  4XFZ A;  3PO7 A;  2WES A;  2JWO A;  2PEM A;  3DJJ A;  4JY2 A;  4APN A;  4RG4 A;  1YQ3 A;  3DJD A;  1PJ5 A;  1X47 A;  1DQ3 A;  4CCQ A;  4LU6 A;  3FBS A;  2V83 A;  4FX9 A;  3H8L A;  3T2Z A;  2M8N A;  2DGY A;  2WP6 A;  4UDQ A;  4R8O A;  3J81 C;  2EQ9 A;  4H4R A;  4GR2 A;  4CBQ A;  2ZZ0 A;  2V85 A;  2QA1 A;  4XRQ A;  1EBD A;  1YIT P;  4YSH A;  5KOX A;  3IWA A;  1VQ7 P;  1GET A;  2WET A;  2YG7 A;  3IHG A;  2Z5Y A;  5U25 A;  3CGE A;  5C2T A;  4HA6 A;  3COX A;  4Z25 A;  3NNE A;  4EQW A;  4U2S A;  4MJW A;  1B5Q A;  3CNT A;  1GRT A;  2YZT A;  1PN0 A;  1M6E X;  3SXI A;  2WOV A;  4WCT A;  4U8J A;  1LJ1 A;  2PEI A;  5CKU A;  4YTM A;  2R45 A;  3GYI A;  2YR4 A;  2ACZ A;  2DIX A;  5DNY A;  4K2X A;  5GSN A;  1CC6 A;  4U0A A;  2UU9 E;  1ZMD A;  2L2M A;  5IWA E;  3ALL A;  1W4X A;  2XCG A;  1LV0 A;  5BUK A;  4WYQ B;  5F2O A;  3ATQ A;  3GYX A;  1JNR A;  2WBA A;  2V86 A;  5FS6 A;  3R9U A;  4BJY A;  4EMJ A;  4A6N B;  1S2Y A;  1LVL A;  2R46 A;  5LV9 A;  1GRE A;  1VQW A;  1RO0 A;  1BWC A;  3L8K A;  3RMP A;  5JCI A;  1F6M A;  4U0E A;  2OLO A;  2XVI A;  1K73 Q;  4A7A A;  1VQ6 P;  1N4U A;  4EQR A;  3AEC A;  1GT8 A;  4WX1 A;  5HXI A;  1STU A;  2WPE A;  4U8M A;  2GR1 A;  2DSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...