2E1MA

Crystal structure of l-glutamate oxidase from streptomyces sp. x-119-6
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
369
structure length
356
Chain Sequence
MTYEQLARELLLVGPAPTNEDLKLRYLDVLIDNGLNPPGPPKRILIVGAGIAGLVAGDLLTRAGHDVTILEANANRVGGRIKTFHAKKGEPSPFADPAQYAEAGAMRLPSFHPLTLALIDKLGLKRRLFFNVDIDPQTGNQDAPVPPVFYKSFKDGKTWTNGAPSPEFKEPDKRNHTWIRTNREQVRRAQYATDPSSINEGFHLTGCETRLTVSDMVNQALEPVRDYYSVKQDDGTRVNKPFKEWLAGWADVVRDFDGYSMGRFLREYAEFSDEAVEAIGTIENMTSRLHLAFFHSFLGRSDIDPRATYWEIEGGSRMLPETLAKDLRDQIVMGQRMVRLEYYDPGPAVAIQTVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-glutamate oxidase
publication title Structural characterization of l-glutamate oxidase from Streptomyces sp. X-119-6
pubmed doi rcsb
source organism Streptomyces sp.
molecule tags Oxidoreductase
total genus 88
structure length 356
sequence length 369
ec nomenclature ec 1.4.3.11: L-glutamate oxidase.
pdb deposition date 2006-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 2e1mA05
1.10.1200.190 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2e1mA03
3.30.160.490 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2e1mA04
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2e1mA02
5DBJA 1LVLA 2GV8A 1F8WA 2EQ6A 2F5ZA 1CC6A 5JCLA 2WEUA 4DSHA 3SM8A 1E1KA 3NK1X 2WU2A 3AE7A 3QVPA 1W4XA 1E39A 5HHFA 1CJ3A 1TYTA 3CPHG 1P2HA 2CULA 4BJZA 3NLCA 2VRMA 3P9UA 4FDCB 4K7ZA 4AT0A 3ADAB 1L9CA 1IUXA 3GMBA 4REKA 4K5SA 3CNTA 3AEAA 1OJTA 1IUVA 3NGCX 1BF3A 1KFYA 3G5SA 4NEWA 4NEVA 3GDPA 2Q0KA 1H84A 1BWCA 3P4RA 1GV4A 3AYIA 1F6MA 2WDQA 5KRQA 1VG9A 1JNRA 3P4PA 1F8SA 5ER0A 3BHKA 3KD9A 1Q1RA 1H82A 2XVJA 2YM2A 2AR8A 4OPGA 4UDRA 2BS2A 4A99A 4DSGA 1ZOYA 1GSNA 1BKWA 4CRTA 2GF3A 3IHGA 3ITJA 4OPCA 3CNPA 2XFQA 3M0OA 1MOKA 4AOXA 3L8KA 3COXA 5IPYA 1PBFA 2JBVA 1JOAA 1Q1WA 3GMCA 1QLBA 3NYCA 4Z43A 2JB1A 3NYFA 4TM3A 3ALMA 4BK2A 2YG7A 1GRHA 1PXAA 4BJYA 3DK9A 3Q9TA 3NTAA 1GRGA 4ZCDA 2OLOA 2C76A 2B76A 2DKIA 5CKUA 4X9NA 2Z5XA 5KOXA 1NG4A 1K0JA 1K0IA 1RSGA 4DGKA 2YR6A 5JCKA 4AT2A 1KNRA 2A87A 1JU2A 2YR4A 2FJEA 3FBSA 1H6VA 4EMIA 1E6EA 1GT8A 4ADWA 4J31A 2WOWA 2IIDA 1GRFA 4Z2RA 3NG7X 3NK2X 3BI5A 4H4TA 4C77A 3CTYA 4XXGA 2XVEA 4OPTA 1GTEA 1PHHA 3DJEA 4LU6A 2Y6RA 2GQFA 2H88A 5BVAA 3FG2P 4CNJA 2VRLA 1ZP0A 2YWLA 2ZBWA 4H4SA 2ARDA 1H86A 1GRBA 1M64A 2IVEA 3F8RA 2GB0A 4TM0A 4NZHA 2TMDA 4H2QA 2YG4A 3V3OA 4EMJA 4YSXA 3VRAA 1TYPA 2WHDA 5M10A 1VG0A 3AE6A 3AYLA 3NKSA 5KWFA 5U1OA 1FEAA 2JAEA 1D5TA 2C72A 2XLUA 3EF6A 3NTDA 1CF3A 3UP5A 2BC0A 2JKCA 4LA1A 4M52A 3RP7A 5BRTA 2BXSA 4K5RA 2XFPA 3H8LA 3O0HA 4CNKA 4J33A 1E1NA 5FMHA 4Y4LA 1GESA 1N4UA 4AP3A 3F8PA 3LB8A 3QSMA 1DJNA 3DJGX 1GALA 1N1PA 2VZ2A 3K7QX 2QCUA 4YTMA 2J3NA 1KSSA 3UKAA 4OPLA 1PBCA 1OJDA 1DOBA 4H2NA 1TRBA 1GOSA 2B9XA 4TM4A 4Y4NA 1IUWA 3EAOA 4NTDA 3UKKA 4EIQA 4ZN0A 2OLNA 4U8MA 3K30A 1ZX9A 3IHMA 4KX6A 2BABA 1NHQA 5KXJA 2YLTA 4LIIA 1CHUA 3AECA 3ICSA 2WP9A 2VQ7A 2X8HA 1E1MA 3C4AA 2PHHA 2WDVA 1UKVG 4OPIA 4H4WA 1DJQA 4FK1A 3CGEA 4GDEA 3UP4A 4K22A 1FOHA 4UP3A 1O94A 3T37A 1O5WA 4J57A 3CGBA 2YR5A 1ZMCA 3VR8A 3VR9A 3P4SA 3AE1A 3CPIG 2FJDA 2QA2A 2YLSA 4PABA 3I3LA 2V61A 4K2XA 3C96A 4YSZA 1BGJA 1EL8A 3LZWA 1GNDA 1K0LA 4B63A 4BK1A 1NG3A 4GCMA 4U2SA 1DNCA 1L9EA 4EIPA 3UOYA 1COYA 1RP0A 4BV6A 4K8DA 1QO8A 3FPZA 1GETA 1DXLA 3AXBA 1TDKA 3LZXA 1OJ9A 1PXCA 3NT6A 3PVCA 5KVIA 4H4UA 1L9DA 2YVFA 4B1BA 1FCDA 1H7WA 2GAGB 1FECA 4B69A 5CQFA 1IUSA 1KNPA 1E7PA 4DNAA 3GD4A 5BULA 2XDOA 3DJJA 3WE0A 4H7UA 3KU9A 4B68A 4N9XA 2WOIA 4RSLA 5HYMA 3RNMA 2XLSA 1NHPA 2APGA 3JSKA 3PS9A 4JDRA 4D04A 3NN6X 2WS3A 4APNA 2WPFA 2IVDA 1PBBA 2GR1A 1P2EA 1TDFA 4RG4A 1XDIA 2R4JA 3AE8A 1PS9A 3KVEA 1B37A 1D7YA 3LADA 2X8GA 4H4ZA 2GAHB 3I6DA 5BUKA 3NN0X 2GEWA 3P1WA 1XPQA 2C73A 2VVLG 4H50A 2V5ZA 2RGHA 2FBWA 4H2RA 3FIMB 4EQWA 2CDUA 1KDGA 2EQ8A 2XFOA 1ZOVA 2XLPA 3QVRA 4U8OA 4IVOB 1H7XA 2YAUA 4EM3A 1EL7A 4BK3A 2OALA 3H4KA 2PYXA 3GRTA 3DK8A 4YKFA 3CNSA 2BC1A 4GDPA 4XWRA 3RHAA 3NHOX 2WP6A 1FL2A 3K7MX 4GUVA 2YG3A 4USRA 4H4RA 5L46A 1CC2A 4H4XA 3GYIA 5LV9A 4CCRA 1Y56A 4Z25A 1BGNA 3G5RA 1IUTA 1H83A 4A6NA 2FJBA 4B65A 1CJ2A 3QJ4A 2R9ZA 1XANA 3VRDB 2WPEA 3ALLA 4GF7A 5KOWA 1Y56B 2X3NA 3UTFA 1D4DA 3AE9A 5JCNA 3UKPA 4A6NB 1QJDA 4CCQA 2GQWA 3GRSA 4A65A 4IA5A 3CIRA 4NTEA 1LV0A 2Q7VA 2ZZ0A 1KF6A 4ZCCA 1H81A 2A8XA 3REDA 1LTXR 3AEBA 3S5WA 3AD9B 4BURA 2BXRA 2OA1A 3SQPA 4FX9A 1GREA 2WETA 2XLRA 1XHCA 3F8DA 5IQ1A 3L1RA 3D1CA 2VOUA 2ZZBA 2YG5A 2GH5A 5FS8A 1ZY8A 4U2LA 4C3XA 2B9WA 2BS3A 2HQMA 4JN9A 4Y4MA 3UTHA 4C74A 2RGOA 3QFAA 3S61A 2V3BA 1ELIA 4NTCA 3UOVA 2DKHA 2B7SA 3PO7A 3EPTA 1OJAA 3GSIA 3QSEA 2Q6UA 2WU5A 2RABA 3AWIA 3AEGA 5EB4A 1D7LA 3AD8B 2EQ9A 2JK6A 4OPDA 1MXTA 4X4JA 1DOCA 3LJPA 3QFBA 1N4VA 5C3JA 1MO9A 2VVLA 2WDRA 1ZDLA 3LXDA 4H4PA 4OCGA 4AP1A 4CY8A 4A9WA 2GVCA 2W0HA 2NPXA 5TR3A 3OZ2A 3HZLA 1LQUA 2XCGA 2X50A 3KA7A 3ABVA 1PJ7A 3BHFA 2R46A 4YSHA 3CGDA 3CN8A 3AE5A 1PDHA 2NVKX 3DMEA 4XWZA 1TDNA 1ZK7A 4UDPA 2CVJA 1O95A 3M12A 2B7RA 2V6OA 2X99A 4HA6A 1ZKQA 2WP5A 1YQZA 2XFUA 2O9ZA 3ZDNA 1S3BA 1BZLA 3ISHA 4TM1A 3B6DA 1DOEA 5FS6A 1L0VA 4EQSA 3H8IA 5JCMA 2JB3A 2QA1A 2Z5YA 3NIXA 3E1TA 4I59A 4D03A 2C70A 2XFNA 1V59A 2GRTA 4HB9A 2R45A 4Z44A 3UKQA 1S2QA 1S2YA 1NDAA 3EANA 3GD3A 2ACZA 1JRYA 3G5QA 5FS9A 2XVHA 4H2PA 4U8LA 2C66A 1RYIA 1PBEA 2WOVA 1GEUA 2WQYA 2XVIA 2ZZCA 3II4A 4Z24A 1ONFA 2AQJA 4J2WA 2GR3A 3SFEA 4FK1C 2C7GA 1F3PA 4KPRA 3GWDA 2A89A 3AYJA 3NH3X 3UTGA 1B5QA 3AE2A 2BACA 2YLXA 4ICYA 3RP8A 4JNQA 4C5OA 1JRXA 2GMJA 1YY5A 3DJDA 4RG3A 1GRAA 1LQTA 5GSNA 4OPUA 3NYEA 4GRTA 2BCGG 4X9MA 3B3RA 4J56A 2GMHA 3SGLA 4B67A 2XVFA 3C4NA 3ICTA 3NK0X 3P4QA 3V76A 3UTEA 2XLTA 1VDCA 4H4VA 4U8NA 4EQRA 1E1LA 4IV9A 4TLZA 4YTPA 3Q6JA 3BNUA 3UCLA 1GXFA 2YLZA 4U8IA 3BNMA 3IC9A 1NAAA 3NRNA 4CBQA 3ATQA 1CJCA 1EL5A 4A5LA 2QAEA 3ATRA 4B64A 1REOA 3GYJA 2AAQA 2R0PA 1PN0A 1VQWA 4CY6A 2Q0LA 4U8PA 1NHRA 5HXIA 4YTNA 1D4CA 2R4EA 2GR2A 2VQBA 3GDNA 4O5UA 2X8CA 3IWAA 1Z6LA 1EL9A 1JNZA 1ZMDA 2E5VA 1PBDA 3CPJG 2BS4A 3NNEA 5C2TA 3KLJA 2TPRA 1TDOA 4A7AA 3DK4A 4UDQA 3KPFA 5GRTA 4U8KA 1YQ3A 4WX1A 3K7TA 2JB2A 2WBAA 3UKFA 1IJHA 2YLWA 1NEKA 4H4QA 1B8SA 3KKJA 2R0GA 4AOSA 5IQ4A 4J34A 4B66A 2BYBA 5FS7A 3UKLA 5U25A 4O5QA 1JRZA 3LOVA 3AD7B 3UOZA 2BK5A 3RP6A 3FMWA 5HY5A 4Z26A 3ICRA 3DA1A 3CNDA 2BK4A 1DODA 3QSSA 3UOXA 2YVGA 3M13A 1CBOA 3AEFA 2C3CA 2YVJA 2RGJA 4JNAA 4YSYA 3OC4A 3BI4A 3VQRA 5M0ZA 1EBDA 4U8JA 4JY2A 4TLXA 1KSUA 4U2TA 3AE3A 3BI2A 4GR1A 1IUUA 1X31B 4IA6A 1OJCA 4JQ9A 2BK3A 3VRBA 1FEBA 4YXDA 2Y6QA 4JY3A 4PAAA 4WCTA 4J36A 1GTHA 2E1MA 2EQ7A 2V3AA 2C75A 1Y0PA 5KVHA 1SEZA 2C3DA 5EOWA 5U63A 2C64A 1CC4A 4ECHA 2OAMA 1B4VA 4A79A 1NENA 4YWOA 4YT0A 3CGCA 4YKGA 3DGZA 5J60A 4OVIA 1LPFA 1NHSA 2YLRA 1GPEA 1JEHA 2H89A 4MJWA 2V60A 4H4YA 1F8RA 2C67A 2YG6A 4Z2UA 2WESA 1LJ1A 3AB1A 3CNJA 4EQXA 5J7XA 4E0VA 4P9SA 1M6IA 1YKJA 2I0ZA 3URHA 2CFYA 1GERA 2BA9A 2YQUA 1N4WA 1GRTA 1PXBA 4I58A 2B9YA 3V3NA 3AE4A 4EMWA 1AOGA 1YQ4A 4USQA 1CJ4A 2YM1A 3DH9A 4IVMB 1S3EA 1VRQB 2GR0A 3R9UA 1PJ6A 5EBKA 1NPXA 4Z2TA 2BCPA 2XYOA 3DGHA 5EB5A 1TDEA 5JCIA 3IF9A 1K4QA 3GWFA 3UKHA 1HYUA 4C3YA 2UZZA 1CL0A 1PJ5A 3ALJA 4EM4A 1Q9IA 2E4GA 3ZYXA 2WPCA 2VVMA 3AEDA 3D8XA 2C65A 3AEEA 2FJAA 3SFDA 2R0CA 1D4EA
chains in the Genus database with same CATH superfamily
2LIUA 2CPNA 5KL4A 1RO2A 1N36E 5EJDA 2VSQA 4MRTC 4BJZA 4O24A 2K5XA 1YJ9P 3GMBA 3AEAA 1IUVA 1KFYA 4G6HA 1BWCA 3AYIA 1F6MA 2WDQA 1Q7YQ 3P4PA 3SX6A 2EM2A 3WBHA 5A6KA 3KD9A 2XVJA 2YM2A 2AR8A 1DNYA 3IHGA 4OPCA 3VK6A 5A6BD 1TN9A 1AUMA 5IPYA 1VQMP 1PBFA 1JOAA 3GMCA 2JP9A 3NYFA 3ALMA 3SZ0A 2KWLA 4DR2E 2GZJA 3J80C 2C76A 2Z5XA 5KOXA 1IMPA 2AVAA 3ADLA 2YR6A 2JQ4A 1K30A 2A87A 2YR4A 2FJEA 2MKDA 1H6VA 1E6EA 1GT8A 2B7VA 1EH6A 2JO0A 4JI3E 3CTYA 2XVEA 4LFCE 1GTEA 3DJEA 4LU6A 2KOSA 2Y6RA 3EJEA 2H88A 2VRLA 1H86A 2IVEA 3F8RA 2MR8A 1ZBTA 3V3OA 4EMJA 4YHHE 3CCVP 4IZ6A 2WHDA 1VG0A 3AYLA 5U1OA 1D5TA 2M1SA 1VQ8P 3NTDA 2FQ0A 2BC0A 4DV2E 2XFPA 3O0HA 4DV3E 3LB8A 2VZ2A 2N50A 3RMPA 1TRBA 2B9XA 3EAOA 4NTDA 4EIQA 5KL7A 2EM3A 3IHMA 3LRYA 1GZ6A 4KX6A 2BABA 1NHQA 4JYAE 2K0DX 3ICSA 3C4AA 1EKZA 1E1MA 4R2SA 1DJQA 2KG9A 3JU0A 2LTEA 1O5WA 2EOYA 1ZMCA 2FJDA 2CNRA 5LL6R 1YJWP 2GDWA 2V61A 3C96A 2BBGA 1BGJA 4R03A 4B63A 1GNDA 1DNCA 4EIPA 3UOYA 3OMLA 4F9BB 1DXLA 1TDKA 1PXCA 1IBLE 1FCDA 2GAGB 1KNPA 2XDOA 2KG6A 3DJWA 5A6AA 4H7UA 5HYMA 2IVDA 1PBBA 2GR1A 2V83A 3T31A 1YHQP 3LADA 1LLMC 1XPQA 3CCRP 2RGHA 1X5WA 2L6EA 2CDUA 2XFOA 2MDRA 4QNBA 2YAUA 4BK3A 3HYVA 2MVVA 4GDPA 3RHAA 2YTFA 4USRA 4H4RA 1CC2A 4H4XA 2VRDA 1Y56A 3G5RA 2FJBA 4B65A 1NQ4A 1PJSA 1XANA 2EPAA 3GKLC 1Y56B 1D4DA 3AE9A 3UKPA 2EPPA 2GQWA 4MLVA 3MSWA 4LU9A 4X66E 2Z45A 2ZZ0A 1KF6A 3H0DA 2A8XA 2ONTA 3REDA 1LTXR 1QVFO 3G28A 5IV8B 3S5WA 3SQPA 3C6KA 4L8NA 1STUA 3EPLA 4LF7E 2GH5A 4C3XA 3MHSC 3QFAA 3S61A 1YIJP 4LF5E 3EPTA 3PO7A 3QSEA 2Q6UA 3G29A 3AWIA 2M8LA 3M99B 3AD8B 2EQ9A 2JK6A 3LJPA 2E72A 3QFBA 1MO9A 2VVLA 4H4PA 2MD9A 3DPHA 1M90Q 2RPCA 3OZ2A 2X50A 1IUQA 3K6QA 3BHFA 4YSHA 2EOEA 3DMEA 2NVKX 1TDNA 5LMNE 2M4IA 2UXCE 4UDPA 1CEIA 3M12A 2RSMA 2LMZA 4TM1A 1DOEA 1L0VA 4EQSA 2FVAA 2JB3A 4KZSA 1S72P 2KGAA 2L92A 1V59A 2GRTA 1S2YA 3G4SP 3GD3A 2ACZA 3G5QA 4R2EA 4H2PA 2C66A 1RYIA 1PBEA 2WQYA 2XVIA 4Z24A 1ONFA 3AYJA 1X6FA 3G71P 3AE2A 4NWZA 2BACA 4ICYA 1VQNP 4JNQA 2YTIA 4RG3A 1E0HA 1UBDC 5BS2A 4K0KE 2GMHA 4GR6A 3C4NA 2DGYA 1A1KA 3UTEA 2EOQA 2MR7A 2PEMA 3ADGA 4DV4E 3Q6JA 3UCLA 4XFXA 3EPJA 1AH5A 2LPKA 4JI0E 4A5LA 2QAEA 4B64A 4F9AB 3HXLA 2EOJA 3HPZA 4DKKA 5HXIA 2K4VA 4WPYA 2M8NA 2QNWA 1Z6LA 1JNZA 2JR1A 3DK4A 2EQ1A 5GRTA 1I94E 3K7TA 2JB2A 3NTEA 3EPKA 5IXMB 3HYWA 2D9HA 4XROA 3KKJA 2R0GA 4AOSA 4J34A 4B66A 1HY8A 3CCSP 2CT1A 4O5QA 4TUIA 2ZM6E 3UOZA 3ADIA 3I56P 2BK5A 2JVAA 1QVGO 3DS4A 1UJZA 2BK4A 4DUZE 3QSSA 4ZYGA 3M13A 2LTRA 2C3CA 1SFEA 2EM7A 4JY2A 4TLXA 4U2TA 3AE3A 1OJCA 2YRHA 2BK3A 2EOOA 4WCTA 2V3AA 2FADA 2EMYA 5EOWA 1BBGA 5A2QC 1CC4A 1NENA 2KGEA 3CGCA 3DGZA 4YKGA 2GZEA 1NHSA 1X6EA 5KL2A 2GPIA 4WXCA 3SXIA 2VE7C 2CFYA 1N4WA 1PXBA 2ELZA 4I58A 2B9YA 4ZYHA 4I8OA 1IBME 1AOGA 2DMIA 4LTYA 1VRQB 1NJIQ 1N3GA 1PJ6A 1UILA 2BCPA 2WBSA 2XYOA 2EN7A 3DGHA 2NA2A 1IQSA 3IF9A 3GWFA 1HYUA 1GXHA 1GQEA 1A1LA 1CL0A 2N8XA 2E4GA 3D8XA 5HV8A 2HGHA 3VYYA 2ENCA 4XFZA 1XMOE 2EL6A 3BBGA 2XXMA 2WEUA 4DSHA 1E1KA 3NK1X 3DS2A 2FQ2A 1VQ7P 4LF9E 2L2KB 1E39A 5HHFA 3NLCA 3AUZA 3P9UA 4FDCB 3ADAB 1L9CA 1IUXA 3SYIA 1EMVA 1DQ3A 3HQ1A 1KC8Q 2Q0KA 4R0MA 3LMLA 2JBGA 1VG9A 1F8SA 1X3CA 1N8RQ 1Q1RA 1H82A 4OPGA 4DSGA 2GF3A 3ITJA 3CNPA 3M0OA 1L0IA 2CSHA 2I13A 1T38A 3ZOQB 2JWOA 1Q1WA 1QLBA 1K9MQ 1AYIA 4BK2A 2YG7A 1PXAA 2QA4P 1M6NA 2OLOA 1VQPP 4COCA 4OOGC 1P47A 1K0IA 1RSGA 2MC5A 3MGEA 1MEYC 4BBYA 1OR5A 4J31A 2IIDA 2DLKA 1GRFA 4Z2RA 1EIAA 5KP6B 2EIAA 3FG2P 4CNJA 2K0XA 2ZBWA 1M64A 2ODRC 3DS5A 3BF2A 4NZHA 4YSXA 2EMAA 3VRAA 1TYPA 5M10A 3AE6A 3NKSA 5KWFA 2VQEE 1RO0A 2C72A 1CF3A 1QNTA 2EOHA 3UP5A 4LA1A 4M52A 2EOXA 2BXSA 2OARA 1RC7A 1E1NA 1GESA 1T4NA 1N4UA 3QSMA 5ADZA 2YSPA 2J3NA 3UKAA 1PBCA 1DOBA 4H2NA 2JYLA 1GOSA 4TM4A 1YSAC 1IUWA 2EOMA 1ZX9A 1N33E 2EM8A 5KXJA 2LF4A 1UHZA 4LIIA 3AECA 2WP9A 2X8HA 1HNZE 2PHHA 2RQLA 4FK1A 4GDEA 4K22A 1FOHA 1YJNP 3VR8A 3AE1A 1FJGE 4R2QA 4PABA 2V86A 1KYQA 2V8QB 2YRMA 3F6HA 3LZWA 1K0LA 2K2QA 4GCMA 2KGDA 1RP0A 5AC4A 2MY5A 4M0VA 4GKKE 3FPZA 1VKUA 3NT6A 5DNYA 5KVIA 1YITP 2UXDE 5LMUE 2JOBA 4B69A 5CQFA 1IUSA 1E7PA 2WCC3 3GD4A 5BULA 4N9XA 2WOIA 4RSLA 2GDYA 5A69A 4D04A 3J7AG 5JPAA 4APNA 1ZNVA 1P2EA 1TDFA 4RG4A 3DS1A 3KVEA 1D7YA 3I6DA 2EM5A 2VVLG 2C73A 2JOXA 2VLQA 4H2RA 3FIMB 4EQWA 1WXRA 2XLPA 4DR4E 3G26A 4YKFA 3NY7B 2BC1A 4WXDA 2E5LE 3FIGA 3KPKA 3SZFA 3K7MX 5IT9C 4U0DA 2N5HA 3G0VA 2NUEA 5DCKA 2KORA 2DMYA 2EJ4A 1BGNA 1IUTA 2EN3A 3MHHC 3ALLA 3CC2P 4FK5C 2X3NA 5TSEA 2LRSA 3UTFA 4GEQB 4IA5A 4WYQB 2ROQA 1YYOA 2CWOA 2XZ0D 2Q7VA 4ZCCA 5BR8E 4O4KA 4FX9A 1GREA 2WETA 2XLRA 3F8DA 5IQ1A 5CZDB 2ZZBA 1ZY8A 4WSPA 1N34E 2B9WA 2BS3A 2HQMA 4JN9A 3UTHA 4C74A 2V3BA 4NTCA 2DKHA 2UUCE 3LLHA 5F3WA 5EB4A 4G9KA 4OPDA 1DOCA 3LXDA 2WDRA 4AP1A 4CY8A 4OCGA 3CCMP 2EOSA 2W0HA 3HZLA 4PWVB 3ABVA 1PJ7A 2EPLX 1X48A 2FAEA 4ZYEA 1QRJA 1ZK7A 3H47A 3P05A 2X99A 4II3A 2WP5A 4WYMA 2EPKX 1YQZA 2XFUA 2LUQA 1DI2A 3ISHA 5FS6A 2N5IA 2EPCA 1Q81Q 5JCMA 2QA1A 2Z5YA 3E1TA 1ZAAC 4R2CA 2XFNA 4D03A 1A1GA 2AF8A 4Z44A 3UKQA 5AE2A 1S2QA 5FS9A 3SZCA 3II4A 4J2WA 3SFEA 5T6JA 4KPRA 2FQ1A 2A89A 3NH3X 3UTGA 2R1FA 3RP8A 4JI4E 2GMJA 4F37A 2YTQA 5A6BA 2L6MA 1GRAA 4OPUA 2BB8A 3B3RA 4J56A 4B67A 3ICTA 2XLTA 4H4VA 4U8NA 5KNLA 4EQRA 3RG6C 3UK3C 2L8TA 4TLZA 2KOUA 2EPRA 1B69A 1GXFA 1WJPA 2YLZA 3BNMA 3IC9A 1NAAA 2JAZA 4HKGA 2P9XA 4QKOA 3T14A 3GYJA 1PN0A 1VQWA 4IJDA 4CY6A 2DNWA 4F6NA 2NUFA 1NHRA 1YZ9A 2K7IA 1D4CA 2R4EA 4O5UA 1EL9A 1ZMDA 2CGQA 2BS4A 3AV0A 2TPRA 3KPFA 4U8KA 1YQ3A 2XZ1C 1PJTA 1VQ9P 4DR7E 1IJHA 3T2YA 1NEKA 4H4QA 1Q86Q 4B3ME 5U25A 2B7TA 4CA3A 1ZR9A 2JYAA 2BRYA 2ERHA 3RP6A 5HVCA 3ICRA 1DODA 1IMUA 3AEFA 2L22A 3P1XA 4YSYA 3OC4A 2C4CA 5M0ZA 3SY4A 4U8JA 1KSUA 1X31B 4JQ9A 3VRBA 5KL6A 2Y6QA 4PAAA 2EPMX 2HC5A 2Q8UA 2EQ7A 2C75A 1ACPA 1Y0PA 3B5IA 2AFDA 2C3DA 2FACA 2C64A 4BCAA 3T1YE 1B4VA 4YWOA 2V88A 1K73Q 1LPFA 5HGLA 3I55P 5KL5A 2V60A 1F8RA 2VLOA 3EJDA 4LFBE 4NXME 1M6IA 3J81C 2I0ZA 2LTSA 3C6MA 1W2BO 2N98A 3CCUP 1HR0E 2GDXA 4EMWA 2LV2A 1CJ4A 2YM1A 2K92A 1KLPA 1S3EA 3CXCO 5EBKA 4Z2TA 1YYWA 5JCIA 2NUGA 4M30A 4EM4A 3GZMA 2UXBE 1Q9IA 3AEDA 2WPCA 2EMLA 2C65A 5HGNA 2EL5A 3SFDA 1D4EA 5DBJA 2V87A 2GV8A 1F8WA 1UN6B 1CC6A 3SM8A 3RG2A 2WU2A 3AE7A 3QVPA 2YTDA 1TYTA 2PY8A 1P2HA 2VRMA 4AT0A 3CCEP 3CNTA 2FV4B 3NGCX 2EQ0A 3G5SA 3P4RA 1GPJA 4B3TE 4DR3E 5KRQA 1JNRA 5ER0A 3HYXA 3THOB 5KMPA 4A99A 2BS2A 2XV6A 2EPUA 4DR1E 4CRTA 1BKWA 1ZOYA 2XFQA 2CQ8A 5KMQA 2YSOA 3L8KA 3COXA 2JBVA 3C4TA 1GTKA 5BS1A 3G21A 3BIDA 2LKIA 1GRHA 2N6ZA 3NTAA 1GRGA 2B76A 2PEJA 2YTEA 1NG4A 1K0JA 2EN2A 4AT2A 1T4OA 4EMIA 3CMEP 3HYBA 4ADWA 4R2DA 1O0WA 3U43A 2YRKA 4BPFA 4X62E 3BI5A 2H36X 4H4TA 4C77A 4OPTA 1IMQA 1ZU1A 4HEIA 3T1HE 2GQFA 4H2YC 3CC4P 2YWLA 3CMMA 2L2NA 4H4SA 2ARDA 2GB0A 2N3GA 2PEQA 2TMDA 4O43A 2YG4A 1BBOA 2EG5A 5KP8B 3EF6A 2YTPA 2LJHA 4CNKA 3H8LA 4J33A 3VRLC 5FMHA 4Y4LA 4AP3A 1DJNA 4JI1E 4P7DA 1GALA 2QCUA 1OJDA 3HZQA 1MGTA 4ZN0A 2OLNA 4U8MA 3K30A 4O5GA 2GLIA 1EH8A 2WDVA 4OPIA 3CGEA 3GYXA 2YT4A 2RS6A 2DB2A 4UP3A 1WHQA 2LBSB 4J57A 3LMOA 3CGBA 2L9FA 2YR5A 2LL8A 2ENHA 1JK1A 3P4SA 3CPIG 4BS9A 2QA2A 1PKPA 4K2XA 3Q20A 1A43A 4F6MA 1XNQE 4R8OA 2B9DA 1NG3A 1L9EA 3CC7P 1T39A 1COYA 1GETA 3LZXA 1OJ9A 2YTGA 4ZYDA 4UHPB 3PVCA 4NNJA 1L9DA 4JI5E 4B1BA 4OX9E 2EORA 3DJJA 3WE0A 3KU9A 4XRQA 2EPNA 3RNMA 1IBKE 4BHBA 4JDRA 2V85A 4DR6E 2WS3A 3NN6X 5A6JA 1XDIA 2R4JA 3IWDA 1B37A 2GZIA 2BHVA 4BC7A 3HPSA 2X8GA 4H4ZA 2GAHB 1NEIA 5BUKA 3NN0X 3P1WA 3T0KA 2FBWA 1KDGA 4X9JA 3BGHA 4X65E 4GAVA 4U8OA 4LF8E 2OALA 3H4KA 2EPXA 3GRTA 3DK8A 3CNSA 2EQ3A 2WP6A 1FL2A 1EOQA 2GHFA 4M0IA 4HTGA 4Z25A 4A6NA 3KZZA 1H83A 5F2OA 1YYKA 3QJ4A 2R9ZA 2EL4A 3VRDB 4GF7A 1KJKA 4WFTA 5JCNA 4A6NB 4R2RA 5I4TG 3GRSA 3CIRA 4PH0A 1VQ4P 3AEBA 2RTXA 2M5RA 2BXRA 1XHCA 1QU6A 2YG5A 2RGOA 1ELIA 2NO8A 1OJAA 1T8KA 3B4QA 4G6GA 3ECRA 1JK2A 3OW2O 1PJQA 3AEGA 2EPZA 1MXTA 4X4JA 5C3JA 5KMSA 4U0EA 1ZDLA 1AF8A 4U0CA 1K8AQ 2NPXA 2F8BA 2EN8A 2XCGA 2L2MA 3CGDA 3CN8A 2B7RA 2V6OA 4BPGA 2VLPA 2O9ZA 1S3BA 1BZLA 3B6DA 2LMLA 4LF6E 1GXGA 3E2DA 4B3RE 2PEKA 2WBTA 3NIXA 4I59A 2C70A 2DSYA 2EN4A 4KWYA 3J7Yp 2GYKA 4G73A 2K0YA 1NDAA 1JRYA 2JY9A 4U8LA 2ZZCA 2WOVA 2EHTA 2AQJA 1F3PA 2C7GA 3GWDA 4P78A 5HGMA 1SR9A 1JRXA 1YY5A 2KG8A 2DGCA 3CMAP 5GSNA 2X2BA 2BCGG 4X9MA 3NK0X 4KHPE 3P4QA 3V76A 5F2KA 3EJBA 1VDCA 5F2NA 2B3TB 4IV9A 4YTPA 3OTOE 4G74A 2EM6A 2KOQA 3NRNA 2KODA 3ATQA 1CJCA 1EL5A 4X8WA 3ATRA 2QEXP 2AAQA 4GKJE 1D1DA 4YTNA 2VQBA 3GDNA 2X8CA 3IWAA 1VHNA 4XFYA 3CPJG 4AQYE 3KLJA 5CFFE 1TDOA 4A7AA 4UDQA 4WX1A 2LUPB 1X6HA 2EMKA 2WBAA 2EOFA 3UKFA 2YLWA 1L0HA 2EMCA 1BB8A 1B8SA 3L00A 2EMGA 2RSIA 3LOVA 3FMWA 5HY5A 3CNDA 1A1HA 1CBOA 1YFHA 2YVJA 4JNAA 4PXHB 2YTOA 5AE1A 2DRPA 3BI2A 3DS0A 2YU5A 2MC6A 4GR1A 4YXDA 1FEBA 4J36A 2KR5A 5KVHA 2G7HA 4U0AA 1A8OA 4YT0A 2UU9E 5J60A 4DMIA 4OVIA 1FR2A 4DV1E 3C4BA 1GPEA 1JEHA 3HTXA 4MJWA 4H4YA 2C67A 4Z2UA 1X3OA 1LJ1A 3AB1A 3GZLA 2EMBA 2VF1A 3URHA 2YQUA 1GRTA 4Q35B 1EH7A 4BHCA 1A1FA 3AE4A 1HNXE 3EQ1A 2JB0A 2WPTA 2JGPA 4USQA 3DH9A 1VQOP 4BMJA 2NABA 1VQKP 1K4QA 3QG5C 3T2ZA 2LVHA 2UZZA 5EW5E 1TF6A 4B3SE 3ZYXA 3AEEA 5KMRA 2FJAA 2YWQA 4GR2A 3ADJA 1LVLA 2EQ6A 2F5ZA 4DV5E 5JCLA 2IHR1 2GZGA 1W4XA 2N3HA 1CJ3A 3CPHG 2CULA 4LFAE 1AAYA 4K7ZA 4REKA 4K5SA 1OJTA 1BF3A 5IWAE 4NEWA 4NEVA 4GZNC 1XNRE 3GDPA 1H84A 4H2XC 4M9VC 1GV4A 2KOPA 1MZ8A 2FGGA 4F54A 3BHKA 4UDRA 1A1JA 1GSNA 5AASA 4DR5E 2KW2A 1MOKA 4AOXA 4TUGA 3VHTB 3NYCA 4Z43A 2JB1A 4TM3A 1L4SA 1VQ5P 4BJYA 3DK9A 3Q9TA 4ZCDA 4PH1A 1J5EE 2DKIA 3CCLP 5CKUA 4X9NA 4R2AA 2EPOA 2YPNA 2JYGA 2LOLA 2MKNA 2ENAA 2LCEA 4DGKA 2KGCA 5JCKA 4H2WC 1KNRA 1JU2A 4RHBB 4JI6E 3FBSA 2HJJA 4X64E 2WOWA 2EWLA 3NG7X 3NK2X 4XXGA 2EE8A 1PHHA 5BVAA 2KONA 1HNWE 4GAPA 1ZP0A 3GJNA 1GRBA 1YPNA 2L3JA 4TM0A 4H2QA 2OTJP 4JI2E 4U0BA 1FEAA 2JAEA 2XLUA 2JKCA 3RP7A 5BRTA 4K5RA 1NCSA 2EN1A 1KD1Q 3F8PA 3DJGX 3JAMC 1N1PA 2J7JA 3K7QX 3H09A 4YTMA 1KSSA 4OPLA 4RH8A 4Y4NA 1WHNA 3UKKA 2MVUA 2EMHA 2LJUA 2L3CA 2YLTA 1CHUA 2VQ7A 1UKVG 4H4WA 3UP4A 1O94A 3T37A 3G1GA 1XMQE 3THNA 3VR9A 2JPAA 1JJ2O 2YLSA 3I3LA 2EOIA 2LO3A 4YSZA 1EL8A 4U0FA 1UNKA 4BK1A 2EMIA 3DTJA 1Q82Q 4U2SA 1RQ0A 3G1IA 1Z1BA 4BV6A 4K8DA 1QO8A 2ADRA 2PENA 3AXBA 2Z44A 2WZOA 2PEIA 1X49A 4F9CB 4JV5E 2BRAA 4NHRA 4H4UA 2YVFA 4R2PA 1H7WA 2YZTA 1FECA 2LT7A 1ZBQA 1M6EX 4DNAA 3T2KA 4II2A 3IWCA 4B68A 2AFEA 2L0QA 2XLSA 3CPWO 1NHPA 1FKAE 2APGA 3JSKA 3PS9A 2L4BA 2GZFA 2WPFA 1X47A 3AE8A 4DV0E 1PS9A 4COPA 4F2JC 1T4LB 4DG9A 1PDAA 2GEWA 4H50A 2V5ZA 2FHSC 4JI8E 2EQ8A 1ZOVA 3QVRA 4IVOB 1H7XA 4EM3A 2F4VE 1EL7A 2M7QA 2PYXA 1F80D 4XWRA 1G2DC 3NHOX 2JU1A 4GUVA 2YG3A 5L46A 3GYIA 5LV9A 4CCRA 5FLXC 2FVFA 3CCQP 5KP7B 2R76A 4IPYA 1CJ2A 2WPEA 5KOWA 2I9IA 1QJDA 4CCQA 2YTNA 4A65A 4NTEA 1LV0A 1G2FC 1H81A 3CCJP 2EOZA 3AD9B 4BURA 2OA1A 3DS3A 3L1RA 3D1CA 2VOUA 5FS8A 4U2LA 4L5NC 4Y4MA 4N4RB 3CD6P 3UOVA 4Q28A 2B7SA 3GSIA 2EMXA 2WU5A 2RABA 1D7LA 2WBUA 2JXPA 1N4VA 2OTLP 2FTXB 4A9WA 2GVCA 2EMWA 2V89A 5TR3A 4NZVA 7CEIA 4WX9A 2EP3A 1LQUA 3KA7A 2PNGA 2R46A 1TF3A 3AE5A 1PDHA 5AC5A 4XWZA 2EMFA 4WSGA 2CVJA 1O95A 4HA6A 1ZKQA 1RMDA 3ZDNA 2RS7A 2M8PA 2VQFE 4LF4E 3H8IA 5HGOA 1BAJA 2UUAE 4HB9A 2R45A 1YUIA 2ELYA 3EANA 1J26A 2PEOA 4BPHA 2XVHA 2XT1A 2MDGA 1GEUA 5KL3A 1Z6MA 2GR3A 4FK1C 1N32E 3CE7A 1B5QA 2CTDA 2YLXA 2HHHE 4C5OA 2DLQA 1ZMBA 2CG5B 3DJDA 3G6EP 3KZYA 1LQTA 4DV6E 3NYEA 4GRTA 3SGLA 1WRJA 2XVFA 2UUBE 4J8ZA 1YUJA 1E1LA 2KHXA 1DV5A 2MF4A 2PRTA 3TQMA 3BNUA 4U8IA 2M9AA 4CBQA 4JI7E 1REOA 4DUYE 2Z46A 2K94A 2R0PA 2KOOA 1YI2P 2Q0LA 4U8PA 4DV7E 3SZWA 4BC9A 2GR2A 1M74A 4IS1C 2E5VA 1PBDA 3NNEA 5C2TA 5AE3A 1IQOA 3M1MA 2YTJA 2EHSA 2EN6A 1E6JP 1HQBA 5IQ4A 2EM0A 2BYBA 5FS7A 3UKLA 2EM4A 1JRZA 3AD7B 2YU8A 4Z26A 3DA1A 3JTZA 3UOXA 2YVGA 2LE2A 1RNIA 2RGJA 3BI4A 2EM9A 3VQRA 1EBDA 3H4EA 1IUUA 4IA6A 3IWBA 4JY3A 1GTHA 2E1MA 2BUOA 1SEZA 5U63A 2JU2A 2A25A 4ECHA 2OAMA 4A79A 4YY3E 2YLRA 2L33A 4NXNE 2H89A 1BXIA 4M2ZA 2YG6A 2FVEA 1VQ6P 2WESA 3CNJA 4EQXA 2DIXA 3KWRA 5J7XA 4E0VA 4P9SA 1YKJA 4NEOA 3F6GA 1A1IA 1M1KQ 1GERA 2BA9A 1KQSO 2EFJA 2ODRD 1F2IG 3EPHA 3V3NA 5LLQA 2EZ6A 1DGCA 1YQ4A 3DF6A 4IVMB 2GR0A 3R9UA 2N6YA 2VLNA 3VYXA 2LIWA 1NPXA 2K93A 4MLQA 1VQLP 5EB5A 1TDEA 3UKHA 4C3YA 1PJ5A 3ALJA 2VVMA 2EMZA 2R0CA
chains in the Genus database with same CATH topology
2CPNA 1RO2A 1N36E 4BJZA 1YJ9P 3GMBA 3AEAA 1IUVA 1KFYA 4G6HA 1BWCA 3AYIA 1F6MA 2WDQA 1Q7YQ 3P4PA 3SX6A 3WBHA 3KD9A 2XVJA 2YM2A 2AR8A 3IHGA 4OPCA 3VK6A 1AUMA 5IPYA 1VQMP 1PBFA 1JOAA 3GMCA 3NYFA 3ALMA 3SZ0A 4DR2E 3J80C 2C76A 2Z5XA 5KOXA 3ADLA 2YR6A 1K30A 2A87A 2YR4A 2FJEA 1H6VA 1E6EA 1GT8A 2B7VA 2JO0A 4JI3E 3CTYA 2XVEA 4LFCE 1GTEA 3DJEA 4LU6A 2Y6RA 2H88A 2VRLA 1H86A 2IVEA 3F8RA 1ZBTA 3V3OA 4EMJA 4YHHE 3CCVP 2WHDA 1VG0A 3AYLA 5U1OA 1D5TA 2M1SA 1VQ8P 3NTDA 2BC0A 4DV2E 2XFPA 3O0HA 4DV3E 3LB8A 2VZ2A 3RMPA 1TRBA 2B9XA 3EAOA 4NTDA 4EIQA 3IHMA 3LRYA 1GZ6A 4KX6A 2BABA 1NHQA 4JYAE 3ICSA 3C4AA 1EKZA 1E1MA 1DJQA 3JU0A 1O5WA 1ZMCA 2FJDA 5LL6R 1YJWP 2V61A 3C96A 1BGJA 4R03A 4B63A 1GNDA 1DNCA 4EIPA 3UOYA 3OMLA 4F9BB 1DXLA 1TDKA 1PXCA 1IBLE 1FCDA 2GAGB 1KNPA 2XDOA 3DJWA 4H7UA 5HYMA 2IVDA 1PBBA 2GR1A 2V83A 3T31A 1YHQP 3LADA 1XPQA 3CCRP 2RGHA 2L6EA 2CDUA 2XFOA 2MDRA 4QNBA 2YAUA 4BK3A 3HYVA 4GDPA 3RHAA 4USRA 4H4RA 1CC2A 4H4XA 1Y56A 3G5RA 2FJBA 4B65A 1XANA 1Y56B 1D4DA 3AE9A 3UKPA 2GQWA 3MSWA 4LU9A 2Z45A 4X66E 2ZZ0A 1KF6A 3H0DA 2ONTA 2A8XA 3REDA 1LTXR 1QVFO 3G28A 3S5WA 3SQPA 4L8NA 1STUA 2GH5A 4LF7E 4C3XA 3QFAA 3S61A 1YIJP 4LF5E 3QSEA 3PO7A 3EPTA 2Q6UA 3G29A 3AWIA 2M8LA 3AD8B 2EQ9A 2JK6A 3LJPA 3QFBA 1MO9A 2VVLA 4H4PA 3DPHA 1M90Q 3OZ2A 2X50A 1IUQA 3K6QA 3BHFA 4YSHA 3DMEA 2NVKX 1TDNA 5LMNE 2M4IA 2UXCE 4UDPA 3M12A 2RSMA 2LMZA 4TM1A 1DOEA 1L0VA 4EQSA 2JB3A 4KZSA 2L92A 1S72P 1V59A 2GRTA 1S2YA 3G4SP 3GD3A 2ACZA 3G5QA 4H2PA 2C66A 1RYIA 1PBEA 2WQYA 2XVIA 4Z24A 1ONFA 3AYJA 3G71P 3AE2A 4NWZA 2BACA 4ICYA 1VQNP 4JNQA 4RG3A 5BS2A 4K0KE 2GMHA 4GR6A 3C4NA 2DGYA 3UTEA 2PEMA 3ADGA 4DV4E 3Q6JA 3UCLA 4XFXA 4JI0E 4A5LA 2QAEA 4B64A 4F9AB 3HXLA 3HPZA 4DKKA 5HXIA 2K4VA 4WPYA 2M8NA 1Z6LA 1JNZA 2JR1A 3DK4A 5GRTA 1I94E 3K7TA 2JB2A 3NTEA 3HYWA 4XROA 3KKJA 2R0GA 4AOSA 4J34A 4B66A 3CCSP 4O5QA 4TUIA 2ZM6E 3UOZA 3ADIA 3I56P 2BK5A 2JVAA 1QVGO 3DS4A 2BK4A 4DUZE 3QSSA 3M13A 2LTRA 2C3CA 4JY2A 4TLXA 4U2TA 3AE3A 1OJCA 2BK3A 4WCTA 2V3AA 5EOWA 5A2QC 1CC4A 1NENA 3CGCA 4YKGA 3DGZA 1NHSA 3SXIA 2VE7C 2CFYA 1N4WA 1PXBA 4I58A 2B9YA 4I8OA 1IBME 1AOGA 4LTYA 1VRQB 1NJIQ 1PJ6A 1UILA 2BCPA 2XYOA 3DGHA 2NA2A 3IF9A 3GWFA 1HYUA 1GQEA 1CL0A 2E4GA 3D8XA 3VYYA 4XFZA 1XMOE 2XXMA 2WEUA 4DSHA 1E1KA 3NK1X 3DS2A 1VQ7P 4LF9E 2L2KB 1E39A 5HHFA 3NLCA 3AUZA 3P9UA 4FDCB 3ADAB 1L9CA 1IUXA 3SYIA 1DQ3A 3HQ1A 1KC8Q 2Q0KA 3LMLA 1VG9A 1F8SA 1N8RQ 1Q1RA 1H82A 4OPGA 4DSGA 2GF3A 3ITJA 3CNPA 3M0OA 3ZOQB 2JWOA 1Q1WA 1QLBA 1K9MQ 4BK2A 2YG7A 1PXAA 2QA4P 1M6NA 2OLOA 1VQPP 4COCA 4OOGC 1K0IA 1RSGA 2MC5A 3MGEA 4BBYA 4J31A 2IIDA 1GRFA 4Z2RA 1EIAA 2EIAA 3FG2P 4CNJA 2ZBWA 1M64A 2ODRC 3DS5A 4NZHA 4YSXA 3VRAA 1TYPA 5M10A 3AE6A 3NKSA 5KWFA 2VQEE 1RO0A 2C72A 1CF3A 3UP5A 4LA1A 4M52A 2BXSA 2OARA 1RC7A 1E1NA 1GESA 1T4NA 1N4UA 3QSMA 5ADZA 2J3NA 3UKAA 1PBCA 1DOBA 4H2NA 2JYLA 1GOSA 4TM4A 1IUWA 1ZX9A 1N33E 5KXJA 2LF4A 1UHZA 4LIIA 3AECA 2WP9A 2X8HA 1HNZE 2PHHA 4FK1A 4GDEA 4K22A 1FOHA 1YJNP 3VR8A 3AE1A 1FJGE 4PABA 2V86A 2V8QB 3F6HA 3LZWA 1K0LA 4GCMA 1RP0A 4M0VA 4GKKE 3FPZA 3NT6A 5DNYA 5KVIA 1YITP 2UXDE 5LMUE 2JOBA 4B69A 5CQFA 1IUSA 1E7PA 3GD4A 5BULA 4N9XA 2WOIA 4RSLA 4D04A 3J7AG 5JPAA 4APNA 1P2EA 1TDFA 4RG4A 3DS1A 3KVEA 1D7YA 3I6DA 2VVLG 2C73A 2JOXA 4H2RA 3FIMB 4EQWA 1WXRA 2XLPA 4DR4E 3G26A 4YKFA 2BC1A 2E5LE 3FIGA 3KPKA 3SZFA 3K7MX 5IT9C 4U0DA 3G0VA 2NUEA 5DCKA 2DMYA 1BGNA 1IUTA 3ALLA 3CC2P 2X3NA 2LRSA 3UTFA 4GEQB 4IA5A 4WYQB 2CWOA 1YYOA 2Q7VA 4ZCCA 5BR8E 4FX9A 1GREA 2WETA 2XLRA 3F8DA 5IQ1A 2ZZBA 1ZY8A 4WSPA 1N34E 2B9WA 2BS3A 2HQMA 4JN9A 3UTHA 4C74A 2V3BA 4NTCA 2DKHA 2UUCE 3LLHA 5F3WA 5EB4A 4G9KA 4OPDA 1DOCA 3LXDA 2WDRA 4AP1A 4CY8A 4OCGA 3CCMP 2W0HA 3HZLA 3ABVA 1PJ7A 1X48A 1QRJA 1ZK7A 3H47A 3P05A 2X99A 4II3A 2WP5A 4WYMA 1YQZA 2XFUA 2LUQA 1DI2A 3ISHA 5FS6A 1Q81Q 5JCMA 2QA1A 2Z5YA 3E1TA 4D03A 2XFNA 4Z44A 3UKQA 5AE2A 1S2QA 5FS9A 3SZCA 3II4A 4J2WA 3SFEA 5T6JA 4KPRA 2A89A 3NH3X 3UTGA 3RP8A 4JI4E 2GMJA 2L6MA 1GRAA 4OPUA 3B3RA 4J56A 4B67A 3ICTA 2XLTA 4H4VA 4U8NA 5KNLA 4EQRA 3RG6C 2L8TA 4TLZA 2KOUA 1GXFA 2YLZA 3BNMA 3IC9A 1NAAA 2P9XA 3T14A 3GYJA 1PN0A 1VQWA 4CY6A 2NUFA 1NHRA 1YZ9A 1D4CA 2R4EA 4O5UA 1EL9A 1ZMDA 2BS4A 3AV0A 2TPRA 3KPFA 4U8KA 1YQ3A 1VQ9P 4DR7E 1IJHA 3T2YA 1NEKA 4H4QA 1Q86Q 4B3ME 5U25A 2B7TA 2BRYA 3RP6A 3ICRA 1DODA 3AEFA 3P1XA 4YSYA 3OC4A 2C4CA 5M0ZA 3SY4A 4U8JA 1KSUA 1X31B 4JQ9A 3VRBA 2Y6QA 4PAAA 2EQ7A 2C75A 1Y0PA 3B5IA 2C3DA 2C64A 4BCAA 3T1YE 1B4VA 4YWOA 2V88A 1K73Q 1LPFA 5HGLA 3I55P 2V60A 1F8RA 4LFBE 4NXME 1M6IA 3J81C 2I0ZA 2LTSA 1W2BO 3CCUP 1HR0E 4EMWA 1CJ4A 2YM1A 1S3EA 3CXCO 5EBKA 4Z2TA 1YYWA 5JCIA 2NUGA 4M30A 4EM4A 2UXBE 1Q9IA 3AEDA 2WPCA 2C65A 5HGNA 3SFDA 1D4EA 5DBJA 2V87A 2GV8A 1F8WA 1CC6A 3SM8A 2WU2A 3AE7A 3QVPA 1TYTA 2PY8A 1P2HA 2VRMA 4AT0A 3CCEP 3CNTA 2FV4B 3NGCX 3G5SA 3P4RA 4B3TE 4DR3E 5KRQA 1JNRA 5ER0A 3HYXA 5KMPA 4A99A 2BS2A 2XV6A 4DR1E 1BKWA 4CRTA 1ZOYA 2XFQA 5KMQA 3L8KA 3COXA 2JBVA 3C4TA 5BS1A 3G21A 1GRHA 3NTAA 1GRGA 2B76A 2PEJA 1NG4A 1K0JA 4AT2A 1T4OA 4EMIA 3CMEP 3HYBA 4ADWA 1O0WA 3BI5A 4H4TA 4X62E 4C77A 2H36X 4OPTA 3T1HE 2GQFA 3CC4P 2YWLA 3CMMA 2L2NA 4H4SA 2ARDA 2GB0A 2N3GA 2PEQA 2TMDA 2YG4A 2EG5A 3EF6A 2LJHA 4CNKA 3H8LA 4J33A 3VRLC 5FMHA 4Y4LA 4AP3A 1DJNA 4JI1E 4P7DA 1GALA 2QCUA 1OJDA 3HZQA 4ZN0A 2OLNA 4U8MA 3K30A 2WDVA 4OPIA 3CGEA 3GYXA 2YT4A 2RS6A 2DB2A 4UP3A 1WHQA 2LBSB 4J57A 3CGBA 2YR5A 3P4SA 3CPIG 4BS9A 2QA2A 1PKPA 4K2XA 3Q20A 1A43A 1XNQE 4R8OA 2B9DA 1NG3A 1L9EA 3CC7P 1COYA 1GETA 3LZXA 1OJ9A 3PVCA 4NNJA 1L9DA 4JI5E 4B1BA 4OX9E 3DJJA 3WE0A 3KU9A 4XRQA 3RNMA 1IBKE 4JDRA 2V85A 4DR6E 2WS3A 3NN6X 1XDIA 2R4JA 3IWDA 1B37A 2BHVA 4BC7A 3HPSA 2X8GA 4H4ZA 2GAHB 5BUKA 3NN0X 3P1WA 3T0KA 2FBWA 1KDGA 4X65E 4GAVA 4U8OA 4LF8E 2OALA 3H4KA 3GRTA 3DK8A 3CNSA 2WP6A 1FL2A 1EOQA 4M0IA 4Z25A 4A6NA 1H83A 5F2OA 1YYKA 3QJ4A 2R9ZA 3VRDB 4GF7A 4WFTA 5JCNA 4A6NB 5I4TG 3GRSA 3CIRA 4PH0A 1VQ4P 3AEBA 2RTXA 2BXRA 1XHCA 1QU6A 2YG5A 2RGOA 1ELIA 1OJAA 4G6GA 3OW2O 3AEGA 1MXTA 4X4JA 5C3JA 5KMSA 4U0EA 1ZDLA 4U0CA 1K8AQ 2NPXA 2F8BA 2XCGA 2L2MA 3CGDA 3CN8A 2B7RA 2V6OA 2O9ZA 1S3BA 1BZLA 3B6DA 4LF6E 3E2DA 4B3RE 2PEKA 3NIXA 4I59A 2C70A 2DSYA 3J7Yp 4G73A 1NDAA 1JRYA 2JY9A 4U8LA 2ZZCA 2WOVA 2AQJA 1F3PA 2C7GA 3GWDA 4P78A 5HGMA 1SR9A 1JRXA 1YY5A 3CMAP 5GSNA 2BCGG 4X9MA 3NK0X 4KHPE 3P4QA 3V76A 5F2KA 1VDCA 5F2NA 2B3TB 4IV9A 4YTPA 3OTOE 4G74A 3NRNA 2KODA 3ATQA 1CJCA 1EL5A 4X8WA 3ATRA 2QEXP 2AAQA 4GKJE 1D1DA 4YTNA 2VQBA 3GDNA 2X8CA 3IWAA 4XFYA 3CPJG 4AQYE 3KLJA 5CFFE 1TDOA 4A7AA 4UDQA 4WX1A 2LUPB 2WBAA 3UKFA 2YLWA 1B8SA 3LOVA 3FMWA 5HY5A 3CNDA 1CBOA 2YVJA 4JNAA 5AE1A 3BI2A 3DS0A 4GR1A 2MC6A 4YXDA 1FEBA 4J36A 5KVHA 2G7HA 4U0AA 1A8OA 4YT0A 2UU9E 5J60A 4DMIA 4OVIA 4DV1E 3C4BA 1GPEA 1JEHA 3HTXA 4MJWA 4H4YA 2C67A 4Z2UA 1LJ1A 3AB1A 2VF1A 3URHA 2YQUA 1GRTA 3AE4A 1HNXE 4USQA 3DH9A 1VQOP 4BMJA 1VQKP 1K4QA 3T2ZA 2UZZA 2R0CA 4B3SE 3ZYXA 3AEEA 5KMRA 2FJAA 4GR2A 3ADJA 1LVLA 2EQ6A 2F5ZA 4DV5E 5JCLA 2IHR1 1W4XA 2N3HA 1CJ3A 3CPHG 2CULA 4LFAE 4K7ZA 4REKA 4K5SA 1OJTA 1BF3A 5IWAE 4NEWA 4NEVA 1XNRE 3GDPA 1H84A 1GV4A 2FGGA 4F54A 3BHKA 4UDRA 1GSNA 5AASA 4DR5E 1MOKA 4AOXA 4TUGA 3NYCA 4Z43A 2JB1A 4TM3A 1VQ5P 4BJYA 3DK9A 3Q9TA 4ZCDA 4PH1A 1J5EE 2DKIA 3CCLP 5CKUA 4X9NA 2JYGA 4DGKA 5JCKA 1KNRA 1JU2A 4JI6E 3FBSA 4X64E 2WOWA 2EWLA 3NG7X 3NK2X 4XXGA 1PHHA 5BVAA 2KONA 1HNWE 4GAPA 1ZP0A 1GRBA 2L3JA 4TM0A 4H2QA 2OTJP 4JI2E 4U0BA 1FEAA 2JAEA 2XLUA 2JKCA 3RP7A 5BRTA 4K5RA 1KD1Q 3F8PA 3DJGX 3JAMC 1N1PA 3K7QX 3H09A 4YTMA 1KSSA 4OPLA 4Y4NA 1WHNA 3UKKA 2L3CA 2YLTA 1CHUA 2VQ7A 1UKVG 4H4WA 3UP4A 1O94A 3T37A 3G1GA 1XMQE 3VR9A 1JJ2O 2YLSA 3I3LA 4YSZA 1EL8A 4U0FA 4BK1A 3DTJA 1Q82Q 4U2SA 1RQ0A 3G1IA 4BV6A 4K8DA 1QO8A 2PENA 3AXBA 2Z44A 2WZOA 2PEIA 1X49A 4F9CB 4JV5E 2BRAA 4H4UA 2YVFA 1H7WA 2YZTA 1FECA 1ZBQA 1M6EX 4DNAA 3T2KA 4II2A 3IWCA 4B68A 2XLSA 3CPWO 1NHPA 1FKAE 2APGA 3JSKA 3PS9A 2WPFA 1X47A 3AE8A 4DV0E 1PS9A 4COPA 1T4LB 2GEWA 4H50A 2V5ZA 4JI8E 2EQ8A 1ZOVA 3QVRA 4IVOB 1H7XA 4EM3A 2F4VE 1EL7A 2M7QA 2PYXA 4XWRA 3NHOX 4GUVA 2YG3A 5L46A 3GYIA 5LV9A 4CCRA 5FLXC 3CCQP 4IPYA 1CJ2A 2WPEA 5KOWA 1QJDA 4CCQA 4A65A 4NTEA 1LV0A 1H81A 3CCJP 3AD9B 4BURA 2OA1A 3DS3A 3L1RA 3D1CA 2VOUA 5FS8A 4U2LA 4L5NC 4Y4MA 3CD6P 3UOVA 4Q28A 2B7SA 3GSIA 2WU5A 2RABA 1D7LA 1N4VA 2OTLP 2FTXB 4A9WA 2GVCA 2V89A 5TR3A 1LQUA 3KA7A 2R46A 3AE5A 1PDHA 4XWZA 2CVJA 1O95A 4HA6A 1ZKQA 3ZDNA 2RS7A 2M8PA 2VQFE 4LF4E 3H8IA 5HGOA 1BAJA 2UUAE 4HB9A 2R45A 3EANA 1J26A 2PEOA 2XVHA 2XT1A 1GEUA 2GR3A 4FK1C 1N32E 1B5QA 2YLXA 2HHHE 4C5OA 1ZMBA 3DJDA 3G6EP 1LQTA 4DV6E 3NYEA 4GRTA 3SGLA 2XVFA 2UUBE 4J8ZA 1E1LA 2KHXA 3BNUA 4U8IA 4CBQA 4JI7E 1REOA 4DUYE 2Z46A 2R0PA 1YI2P 2Q0LA 4U8PA 4DV7E 3SZWA 4BC9A 2GR2A 1M74A 2E5VA 1PBDA 3NNEA 5C2TA 5AE3A 3M1MA 1E6JP 5IQ4A 2BYBA 5FS7A 3UKLA 1JRZA 3AD7B 4Z26A 3DA1A 3JTZA 3UOXA 2YVGA 2LE2A 1RNIA 2RGJA 3BI4A 3VQRA 1EBDA 3H4EA 1IUUA 4IA6A 3IWBA 4JY3A 1GTHA 2E1MA 2BUOA 1SEZA 5U63A 4ECHA 2OAMA 4A79A 4YY3E 2YLRA 2L33A 4NXNE 2H89A 4M2ZA 2YG6A 1VQ6P 2WESA 3CNJA 4EQXA 2DIXA 3KWRA 5J7XA 4E0VA 4P9SA 1YKJA 3F6GA 1M1KQ 1GERA 2BA9A 1KQSO 2EFJA 2ODRD 3V3NA 2EZ6A 1YQ4A 3DF6A 4IVMB 2GR0A 3R9UA 3VYXA 1NPXA 1VQLP 5EB5A 1TDEA 3UKHA 4C3YA 1PJ5A 2VVMA 3ALJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DBJ A;  1LVL A;  2GV8 A;  1F8W A;  2EQ6 A;  2F5Z A;  1CC6 A;  5JCL A;  2WEU A;  4DSH A;  3SM8 A;  1E1K A;  3NK1 X;  2WU2 A;  3AE7 A;  3QVP A;  1W4X A;  1E39 A;  5HHF A;  1CJ3 A;  1TYT A;  3CPH G;  1P2H A;  2CUL A;  4BJZ A;  3NLC A;  2VRM A;  3P9U A;  4FDC B;  4K7Z A;  4AT0 A;  3ADA B;  1L9C A;  1IUX A;  3GMB A;  4REK A;  4K5S A;  3CNT A;  3AEA A;  1OJT A;  1IUV A;  3NGC X;  1BF3 A;  1KFY A;  3G5S A;  4NEW A;  4NEV A;  3GDP A;  2Q0K A;  1H84 A;  1BWC A;  3P4R A;  1GV4 A;  3AYI A;  1F6M A;  2WDQ A;  5KRQ A;  1VG9 A;  1JNR A;  3P4P A;  1F8S A;  5ER0 A;  3BHK A;  3KD9 A;  1Q1R A;  1H82 A;  2XVJ A;  2YM2 A;  2AR8 A;  4OPG A;  4UDR A;  2BS2 A;  4A99 A;  4DSG A;  1ZOY A;  1GSN A;  1BKW A;  4CRT A;  2GF3 A;  3IHG A;  3ITJ A;  4OPC A;  3CNP A;  2XFQ A;  3M0O A;  1MOK A;  4AOX A;  3L8K A;  3COX A;  5IPY A;  1PBF A;  2JBV A;  1JOA A;  1Q1W A;  3GMC A;  1QLB A;  3NYC A;  4Z43 A;  2JB1 A;  3NYF A;  4TM3 A;  3ALM A;  4BK2 A;  2YG7 A;  1GRH A;  1PXA A;  4BJY A;  3DK9 A;  3Q9T A;  3NTA A;  1GRG A;  4ZCD A;  2OLO A;  2C76 A;  2B76 A;  2DKI A;  5CKU A;  4X9N A;  2Z5X A;  5KOX A;  1NG4 A;  1K0J A;  1K0I A;  1RSG A;  4DGK A;  2YR6 A;  5JCK A;  4AT2 A;  1KNR A;  2A87 A;  1JU2 A;  2YR4 A;  2FJE A;  3FBS A;  1H6V A;  4EMI A;  1E6E A;  1GT8 A;  4ADW A;  4J31 A;  2WOW A;  2IID A;  1GRF A;  4Z2R A;  3NG7 X;  3NK2 X;  3BI5 A;  4H4T A;  4C77 A;  3CTY A;  4XXG A;  2XVE A;  4OPT A;  1GTE A;  1PHH A;  3DJE A;  4LU6 A;  2Y6R A;  2GQF A;  2H88 A;  5BVA A;  3FG2 P;  4CNJ A;  2VRL A;  1ZP0 A;  2YWL A;  2ZBW A;  4H4S A;  2ARD A;  1H86 A;  1GRB A;  1M64 A;  2IVE A;  3F8R A;  2GB0 A;  4TM0 A;  4NZH A;  2TMD A;  4H2Q A;  2YG4 A;  3V3O A;  4EMJ A;  4YSX A;  3VRA A;  1TYP A;  2WHD A;  5M10 A;  1VG0 A;  3AE6 A;  3AYL A;  3NKS A;  5KWF A;  5U1O A;  1FEA A;  2JAE A;  1D5T A;  2C72 A;  2XLU A;  3EF6 A;  3NTD A;  1CF3 A;  3UP5 A;  2BC0 A;  2JKC A;  4LA1 A;  4M52 A;  3RP7 A;  5BRT A;  2BXS A;  4K5R A;  2XFP A;  3H8L A;  3O0H A;  4CNK A;  4J33 A;  1E1N A;  5FMH A;  4Y4L A;  1GES A;  1N4U A;  4AP3 A;  3F8P A;  3LB8 A;  3QSM A;  1DJN A;  3DJG X;  1GAL A;  1N1P A;  2VZ2 A;  3K7Q X;  2QCU A;  4YTM A;  2J3N A;  1KSS A;  3UKA A;  4OPL A;  1PBC A;  1OJD A;  1DOB A;  4H2N A;  1TRB A;  1GOS A;  2B9X A;  4TM4 A;  4Y4N A;  1IUW A;  3EAO A;  4NTD A;  3UKK A;  4EIQ A;  4ZN0 A;  2OLN A;  4U8M A;  3K30 A;  1ZX9 A;  3IHM A;  4KX6 A;  2BAB A;  1NHQ A;  5KXJ A;  2YLT A;  4LII A;  1CHU A;  3AEC A;  3ICS A;  2WP9 A;  2VQ7 A;  2X8H A;  1E1M A;  3C4A A;  2PHH A;  2WDV A;  1UKV G;  4OPI A;  4H4W A;  1DJQ A;  4FK1 A;  3CGE A;  4GDE A;  3UP4 A;  4K22 A;  1FOH A;  4UP3 A;  1O94 A;  3T37 A;  1O5W A;  4J57 A;  3CGB A;  2YR5 A;  1ZMC A;  3VR8 A;  3VR9 A;  3P4S A;  3AE1 A;  3CPI G;  2FJD A;  2QA2 A;  2YLS A;  4PAB A;  3I3L A;  2V61 A;  4K2X A;  3C96 A;  4YSZ A;  1BGJ A;  1EL8 A;  3LZW A;  1GND A;  1K0L A;  4B63 A;  4BK1 A;  1NG3 A;  4GCM A;  4U2S A;  1DNC A;  1L9E A;  4EIP A;  3UOY A;  1COY A;  1RP0 A;  4BV6 A;  4K8D A;  1QO8 A;  3FPZ A;  1GET A;  1DXL A;  3AXB A;  1TDK A;  3LZX A;  1OJ9 A;  1PXC A;  3NT6 A;  3PVC A;  5KVI A;  4H4U A;  1L9D A;  2YVF A;  4B1B A;  1FCD A;  1H7W A;  2GAG B;  1FEC A;  4B69 A;  5CQF A;  1IUS A;  1KNP A;  1E7P A;  4DNA A;  3GD4 A;  5BUL A;  2XDO A;  3DJJ A;  3WE0 A;  4H7U A;  3KU9 A;  4B68 A;  4N9X A;  2WOI A;  4RSL A;  5HYM A;  3RNM A;  2XLS A;  1NHP A;  2APG A;  3JSK A;  3PS9 A;  4JDR A;  4D04 A;  3NN6 X;  2WS3 A;  4APN A;  2WPF A;  2IVD A;  1PBB A;  2GR1 A;  1P2E A;  1TDF A;  4RG4 A;  1XDI A;  2R4J A;  3AE8 A;  1PS9 A;  3KVE A;  1B37 A;  1D7Y A;  3LAD A;  2X8G A;  4H4Z A;  2GAH B;  3I6D A;  5BUK A;  3NN0 X;  2GEW A;  3P1W A;  1XPQ A;  2C73 A;  2VVL G;  4H50 A;  2V5Z A;  2RGH A;  2FBW A;  4H2R A;  3FIM B;  4EQW A;  2CDU A;  1KDG A;  2EQ8 A;  2XFO A;  1ZOV A;  2XLP A;  3QVR A;  4U8O A;  4IVO B;  1H7X A;  2YAU A;  4EM3 A;  1EL7 A;  4BK3 A;  2OAL A;  3H4K A;  2PYX A;  3GRT A;  3DK8 A;  4YKF A;  3CNS A;  2BC1 A;  4GDP A;  4XWR A;  3RHA A;  3NHO X;  2WP6 A;  1FL2 A;  3K7M X;  4GUV A;  2YG3 A;  4USR A;  4H4R A;  5L46 A;  1CC2 A;  4H4X A;  3GYI A;  5LV9 A;  4CCR A;  1Y56 A;  4Z25 A;  1BGN A;  3G5R A;  1IUT A;  1H83 A;  4A6N A;  2FJB A;  4B65 A;  1CJ2 A;  3QJ4 A;  2R9Z A;  1XAN A;  3VRD B;  2WPE A;  3ALL A;  4GF7 A;  5KOW A;  1Y56 B;  2X3N A;  3UTF A;  1D4D A;  3AE9 A;  5JCN A;  3UKP A;  4A6N B;  1QJD A;  4CCQ A;  2GQW A;  3GRS A;  4A65 A;  4IA5 A;  3CIR A;  4NTE A;  1LV0 A;  2Q7V A;  2ZZ0 A;  1KF6 A;  4ZCC A;  1H81 A;  2A8X A;  3RED A;  1LTX R;  3AEB A;  3S5W A;  3AD9 B;  4BUR A;  2BXR A;  2OA1 A;  3SQP A;  4FX9 A;  1GRE A;  2WET A;  2XLR A;  1XHC A;  3F8D A;  5IQ1 A;  3L1R A;  3D1C A;  2VOU A;  2ZZB A;  2YG5 A;  2GH5 A;  5FS8 A;  1ZY8 A;  4U2L A;  4C3X A;  2B9W A;  2BS3 A;  2HQM A;  4JN9 A;  4Y4M A;  3UTH A;  4C74 A;  2RGO A;  3QFA A;  3S61 A;  2V3B A;  1ELI A;  4NTC A;  3UOV A;  2DKH A;  2B7S A;  3PO7 A;  3EPT A;  1OJA A;  3GSI A;  3QSE A;  2Q6U A;  2WU5 A;  2RAB A;  3AWI A;  3AEG A;  5EB4 A;  1D7L A;  3AD8 B;  2EQ9 A;  2JK6 A;  4OPD A;  1MXT A;  4X4J A;  1DOC A;  3LJP A;  3QFB A;  1N4V A;  5C3J A;  1MO9 A;  2VVL A;  2WDR A;  1ZDL A;  3LXD A;  4H4P A;  4OCG A;  4AP1 A;  4CY8 A;  4A9W A;  2GVC A;  2W0H A;  2NPX A;  5TR3 A;  3OZ2 A;  3HZL A;  1LQU A;  2XCG A;  2X50 A;  3KA7 A;  3ABV A;  1PJ7 A;  3BHF A;  2R46 A;  4YSH A;  3CGD A;  3CN8 A;  3AE5 A;  1PDH A;  2NVK X;  3DME A;  4XWZ A;  1TDN A;  1ZK7 A;  4UDP A;  2CVJ A;  1O95 A;  3M12 A;  2B7R A;  2V6O A;  2X99 A;  4HA6 A;  1ZKQ A;  2WP5 A;  1YQZ A;  2XFU A;  2O9Z A;  3ZDN A;  1S3B A;  1BZL A;  3ISH A;  4TM1 A;  3B6D A;  1DOE A;  5FS6 A;  1L0V A;  4EQS A;  3H8I A;  5JCM A;  2JB3 A;  2QA1 A;  2Z5Y A;  3NIX A;  3E1T A;  4I59 A;  4D03 A;  2C70 A;  2XFN A;  1V59 A;  2GRT A;  4HB9 A;  2R45 A;  4Z44 A;  3UKQ A;  1S2Q A;  1S2Y A;  1NDA A;  3EAN A;  3GD3 A;  2ACZ A;  1JRY A;  3G5Q A;  5FS9 A;  2XVH A;  4H2P A;  4U8L A;  2C66 A;  1RYI A;  1PBE A;  2WOV A;  1GEU A;  2WQY A;  2XVI A;  2ZZC A;  3II4 A;  4Z24 A;  1ONF A;  2AQJ A;  4J2W A;  2GR3 A;  3SFE A;  4FK1 C;  2C7G A;  1F3P A;  4KPR A;  3GWD A;  2A89 A;  3AYJ A;  3NH3 X;  3UTG A;  1B5Q A;  3AE2 A;  2BAC A;  2YLX A;  4ICY A;  3RP8 A;  4JNQ A;  4C5O A;  1JRX A;  2GMJ A;  1YY5 A;  3DJD A;  4RG3 A;  1GRA A;  1LQT A;  5GSN A;  4OPU A;  3NYE A;  4GRT A;  2BCG G;  4X9M A;  3B3R A;  4J56 A;  2GMH A;  3SGL A;  4B67 A;  2XVF A;  3C4N A;  3ICT A;  3NK0 X;  3P4Q A;  3V76 A;  3UTE A;  2XLT A;  1VDC A;  4H4V A;  4U8N A;  4EQR A;  1E1L A;  4IV9 A;  4TLZ A;  4YTP A;  3Q6J A;  3BNU A;  3UCL A;  1GXF A;  2YLZ A;  4U8I A;  3BNM A;  3IC9 A;  1NAA A;  3NRN A;  4CBQ A;  3ATQ A;  1CJC A;  1EL5 A;  4A5L A;  2QAE A;  3ATR A;  4B64 A;  1REO A;  3GYJ A;  2AAQ A;  2R0P A;  1PN0 A;  1VQW A;  4CY6 A;  2Q0L A;  4U8P A;  1NHR A;  5HXI A;  4YTN A;  1D4C A;  2R4E A;  2GR2 A;  2VQB A;  3GDN A;  4O5U A;  2X8C A;  3IWA A;  1Z6L A;  1EL9 A;  1JNZ A;  1ZMD A;  2E5V A;  1PBD A;  3CPJ G;  2BS4 A;  3NNE A;  5C2T A;  3KLJ A;  2TPR A;  1TDO A;  4A7A A;  3DK4 A;  4UDQ A;  3KPF A;  5GRT A;  4U8K A;  1YQ3 A;  4WX1 A;  3K7T A;  2JB2 A;  2WBA A;  3UKF A;  1IJH A;  2YLW A;  1NEK A;  4H4Q A;  1B8S A;  3KKJ A;  2R0G A;  4AOS A;  5IQ4 A;  4J34 A;  4B66 A;  2BYB A;  5FS7 A;  3UKL A;  5U25 A;  4O5Q A;  1JRZ A;  3LOV A;  3AD7 B;  3UOZ A;  2BK5 A;  3RP6 A;  3FMW A;  5HY5 A;  4Z26 A;  3ICR A;  3DA1 A;  3CND A;  2BK4 A;  1DOD A;  3QSS A;  3UOX A;  2YVG A;  3M13 A;  1CBO A;  3AEF A;  2C3C A;  2YVJ A;  2RGJ A;  4JNA A;  4YSY A;  3OC4 A;  3BI4 A;  3VQR A;  5M0Z A;  1EBD A;  4U8J A;  4JY2 A;  4TLX A;  1KSU A;  4U2T A;  3AE3 A;  3BI2 A;  4GR1 A;  1IUU A;  1X31 B;  4IA6 A;  1OJC A;  4JQ9 A;  2BK3 A;  3VRB A;  1FEB A;  4YXD A;  2Y6Q A;  4JY3 A;  4PAA A;  4WCT A;  4J36 A;  1GTH A;  2E1M A;  2EQ7 A;  2V3A A;  2C75 A;  1Y0P A;  5KVH A;  1SEZ A;  2C3D A;  5EOW A;  5U63 A;  2C64 A;  1CC4 A;  4ECH A;  2OAM A;  1B4V A;  4A79 A;  1NEN A;  4YWO A;  4YT0 A;  3CGC A;  4YKG A;  3DGZ A;  5J60 A;  4OVI A;  1LPF A;  1NHS A;  2YLR A;  1GPE A;  1JEH A;  2H89 A;  4MJW A;  2V60 A;  4H4Y A;  1F8R A;  2C67 A;  2YG6 A;  4Z2U A;  2WES A;  1LJ1 A;  3AB1 A;  3CNJ A;  4EQX A;  5J7X A;  4E0V A;  4P9S A;  1M6I A;  1YKJ A;  2I0Z A;  3URH A;  2CFY A;  1GER A;  2BA9 A;  2YQU A;  1N4W A;  1GRT A;  1PXB A;  4I58 A;  2B9Y A;  3V3N A;  3AE4 A;  4EMW A;  1AOG A;  1YQ4 A;  4USQ A;  1CJ4 A;  2YM1 A;  3DH9 A;  4IVM B;  1S3E A;  1VRQ B;  2GR0 A;  3R9U A;  1PJ6 A;  5EBK A;  1NPX A;  4Z2T A;  2BCP A;  2XYO A;  3DGH A;  5EB5 A;  1TDE A;  5JCI A;  3IF9 A;  1K4Q A;  3GWF A;  3UKH A;  1HYU A;  4C3Y A;  2UZZ A;  1CL0 A;  1PJ5 A;  3ALJ A;  4EM4 A;  1Q9I A;  2E4G A;  3ZYX A;  2WPC A;  2VVM A;  3AED A;  3D8X A;  2C65 A;  3AEE A;  2FJA A;  3SFD A;  2R0C A;  1D4E A; 
#chains in the Genus database with same CATH topology
 2LIU A;  2CPN A;  5KL4 A;  1RO2 A;  1N36 E;  5EJD A;  2VSQ A;  4MRT C;  4BJZ A;  4O24 A;  2K5X A;  1YJ9 P;  3GMB A;  3AEA A;  1IUV A;  1KFY A;  4G6H A;  1BWC A;  3AYI A;  1F6M A;  2WDQ A;  1Q7Y Q;  3P4P A;  3SX6 A;  2EM2 A;  3WBH A;  5A6K A;  3KD9 A;  2XVJ A;  2YM2 A;  2AR8 A;  1DNY A;  3IHG A;  4OPC A;  3VK6 A;  5A6B D;  1TN9 A;  1AUM A;  5IPY A;  1VQM P;  1PBF A;  1JOA A;  3GMC A;  2JP9 A;  3NYF A;  3ALM A;  3SZ0 A;  2KWL A;  4DR2 E;  2GZJ A;  3J80 C;  2C76 A;  2Z5X A;  5KOX A;  1IMP A;  2AVA A;  3ADL A;  2YR6 A;  2JQ4 A;  1K30 A;  2A87 A;  2YR4 A;  2FJE A;  2MKD A;  1H6V A;  1E6E A;  1GT8 A;  2B7V A;  1EH6 A;  2JO0 A;  4JI3 E;  3CTY A;  2XVE A;  4LFC E;  1GTE A;  3DJE A;  4LU6 A;  2KOS A;  2Y6R A;  3EJE A;  2H88 A;  2VRL A;  1H86 A;  2IVE A;  3F8R A;  2MR8 A;  1ZBT A;  3V3O A;  4EMJ A;  4YHH E;  3CCV P;  4IZ6 A;  2WHD A;  1VG0 A;  3AYL A;  5U1O A;  1D5T A;  2M1S A;  1VQ8 P;  3NTD A;  2FQ0 A;  2BC0 A;  4DV2 E;  2XFP A;  3O0H A;  4DV3 E;  3LB8 A;  2VZ2 A;  2N50 A;  3RMP A;  1TRB A;  2B9X A;  3EAO A;  4NTD A;  4EIQ A;  5KL7 A;  2EM3 A;  3IHM A;  3LRY A;  1GZ6 A;  4KX6 A;  2BAB A;  1NHQ A;  4JYA E;  2K0D X;  3ICS A;  3C4A A;  1EKZ A;  1E1M A;  4R2S A;  1DJQ A;  2KG9 A;  3JU0 A;  2LTE A;  1O5W A;  2EOY A;  1ZMC A;  2FJD A;  2CNR A;  5LL6 R;  1YJW P;  2GDW A;  2V61 A;  3C96 A;  2BBG A;  1BGJ A;  4R03 A;  4B63 A;  1GND A;  1DNC A;  4EIP A;  3UOY A;  3OML A;  4F9B B;  1DXL A;  1TDK A;  1PXC A;  1IBL E;  1FCD A;  2GAG B;  1KNP A;  2XDO A;  2KG6 A;  3DJW A;  5A6A A;  4H7U A;  5HYM A;  2IVD A;  1PBB A;  2GR1 A;  2V83 A;  3T31 A;  1YHQ P;  3LAD A;  1LLM C;  1XPQ A;  3CCR P;  2RGH A;  1X5W A;  2L6E A;  2CDU A;  2XFO A;  2MDR A;  4QNB A;  2YAU A;  4BK3 A;  3HYV A;  2MVV A;  4GDP A;  3RHA A;  2YTF A;  4USR A;  4H4R A;  1CC2 A;  4H4X A;  2VRD A;  1Y56 A;  3G5R A;  2FJB A;  4B65 A;  1NQ4 A;  1PJS A;  1XAN A;  2EPA A;  3GKL C;  1Y56 B;  1D4D A;  3AE9 A;  3UKP A;  2EPP A;  2GQW A;  4MLV A;  3MSW A;  4LU9 A;  4X66 E;  2Z45 A;  2ZZ0 A;  1KF6 A;  3H0D A;  2A8X A;  2ONT A;  3RED A;  1LTX R;  1QVF O;  3G28 A;  5IV8 B;  3S5W A;  3SQP A;  3C6K A;  4L8N A;  1STU A;  3EPL A;  4LF7 E;  2GH5 A;  4C3X A;  3MHS C;  3QFA A;  3S61 A;  1YIJ P;  4LF5 E;  3EPT A;  3PO7 A;  3QSE A;  2Q6U A;  3G29 A;  3AWI A;  2M8L A;  3M99 B;  3AD8 B;  2EQ9 A;  2JK6 A;  3LJP A;  2E72 A;  3QFB A;  1MO9 A;  2VVL A;  4H4P A;  2MD9 A;  3DPH A;  1M90 Q;  2RPC A;  3OZ2 A;  2X50 A;  1IUQ A;  3K6Q A;  3BHF A;  4YSH A;  2EOE A;  3DME A;  2NVK X;  1TDN A;  5LMN E;  2M4I A;  2UXC E;  4UDP A;  1CEI A;  3M12 A;  2RSM A;  2LMZ A;  4TM1 A;  1DOE A;  1L0V A;  4EQS A;  2FVA A;  2JB3 A;  4KZS A;  1S72 P;  2KGA A;  2L92 A;  1V59 A;  2GRT A;  1S2Y A;  3G4S P;  3GD3 A;  2ACZ A;  3G5Q A;  4R2E A;  4H2P A;  2C66 A;  1RYI A;  1PBE A;  2WQY A;  2XVI A;  4Z24 A;  1ONF A;  3AYJ A;  1X6F A;  3G71 P;  3AE2 A;  4NWZ A;  2BAC A;  4ICY A;  1VQN P;  4JNQ A;  2YTI A;  4RG3 A;  1E0H A;  1UBD C;  5BS2 A;  4K0K E;  2GMH A;  4GR6 A;  3C4N A;  2DGY A;  1A1K A;  3UTE A;  2EOQ A;  2MR7 A;  2PEM A;  3ADG A;  4DV4 E;  3Q6J A;  3UCL A;  4XFX A;  3EPJ A;  1AH5 A;  2LPK A;  4JI0 E;  4A5L A;  2QAE A;  4B64 A;  4F9A B;  3HXL A;  2EOJ A;  3HPZ A;  4DKK A;  5HXI A;  2K4V A;  4WPY A;  2M8N A;  2QNW A;  1Z6L A;  1JNZ A;  2JR1 A;  3DK4 A;  2EQ1 A;  5GRT A;  1I94 E;  3K7T A;  2JB2 A;  3NTE A;  3EPK A;  5IXM B;  3HYW A;  2D9H A;  4XRO A;  3KKJ A;  2R0G A;  4AOS A;  4J34 A;  4B66 A;  1HY8 A;  3CCS P;  2CT1 A;  4O5Q A;  4TUI A;  2ZM6 E;  3UOZ A;  3ADI A;  3I56 P;  2BK5 A;  2JVA A;  1QVG O;  3DS4 A;  1UJZ A;  2BK4 A;  4DUZ E;  3QSS A;  4ZYG A;  3M13 A;  2LTR A;  2C3C A;  1SFE A;  2EM7 A;  4JY2 A;  4TLX A;  4U2T A;  3AE3 A;  1OJC A;  2YRH A;  2BK3 A;  2EOO A;  4WCT A;  2V3A A;  2FAD A;  2EMY A;  5EOW A;  1BBG A;  5A2Q C;  1CC4 A;  1NEN A;  2KGE A;  3CGC A;  3DGZ A;  4YKG A;  2GZE A;  1NHS A;  1X6E A;  5KL2 A;  2GPI A;  4WXC A;  3SXI A;  2VE7 C;  2CFY A;  1N4W A;  1PXB A;  2ELZ A;  4I58 A;  2B9Y A;  4ZYH A;  4I8O A;  1IBM E;  1AOG A;  2DMI A;  4LTY A;  1VRQ B;  1NJI Q;  1N3G A;  1PJ6 A;  1UIL A;  2BCP A;  2WBS A;  2XYO A;  2EN7 A;  3DGH A;  2NA2 A;  1IQS A;  3IF9 A;  3GWF A;  1HYU A;  1GXH A;  1GQE A;  1A1L A;  1CL0 A;  2N8X A;  2E4G A;  3D8X A;  5HV8 A;  2HGH A;  3VYY A;  2ENC A;  4XFZ A;  1XMO E;  2EL6 A;  3BBG A;  2XXM A;  2WEU A;  4DSH A;  1E1K A;  3NK1 X;  3DS2 A;  2FQ2 A;  1VQ7 P;  4LF9 E;  2L2K B;  1E39 A;  5HHF A;  3NLC A;  3AUZ A;  3P9U A;  4FDC B;  3ADA B;  1L9C A;  1IUX A;  3SYI A;  1EMV A;  1DQ3 A;  3HQ1 A;  1KC8 Q;  2Q0K A;  4R0M A;  3LML A;  2JBG A;  1VG9 A;  1F8S A;  1X3C A;  1N8R Q;  1Q1R A;  1H82 A;  4OPG A;  4DSG A;  2GF3 A;  3ITJ A;  3CNP A;  3M0O A;  1L0I A;  2CSH A;  2I13 A;  1T38 A;  3ZOQ B;  2JWO A;  1Q1W A;  1QLB A;  1K9M Q;  1AYI A;  4BK2 A;  2YG7 A;  1PXA A;  2QA4 P;  1M6N A;  2OLO A;  1VQP P;  4COC A;  4OOG C;  1P47 A;  1K0I A;  1RSG A;  2MC5 A;  3MGE A;  1MEY C;  4BBY A;  1OR5 A;  4J31 A;  2IID A;  2DLK A;  1GRF A;  4Z2R A;  1EIA A;  5KP6 B;  2EIA A;  3FG2 P;  4CNJ A;  2K0X A;  2ZBW A;  1M64 A;  2ODR C;  3DS5 A;  3BF2 A;  4NZH A;  4YSX A;  2EMA A;  3VRA A;  1TYP A;  5M10 A;  3AE6 A;  3NKS A;  5KWF A;  2VQE E;  1RO0 A;  2C72 A;  1CF3 A;  1QNT A;  2EOH A;  3UP5 A;  4LA1 A;  4M52 A;  2EOX A;  2BXS A;  2OAR A;  1RC7 A;  1E1N A;  1GES A;  1T4N A;  1N4U A;  3QSM A;  5ADZ A;  2YSP A;  2J3N A;  3UKA A;  1PBC A;  1DOB A;  4H2N A;  2JYL A;  1GOS A;  4TM4 A;  1YSA C;  1IUW A;  2EOM A;  1ZX9 A;  1N33 E;  2EM8 A;  5KXJ A;  2LF4 A;  1UHZ A;  4LII A;  3AEC A;  2WP9 A;  2X8H A;  1HNZ E;  2PHH A;  2RQL A;  4FK1 A;  4GDE A;  4K22 A;  1FOH A;  1YJN P;  3VR8 A;  3AE1 A;  1FJG E;  4R2Q A;  4PAB A;  2V86 A;  1KYQ A;  2V8Q B;  2YRM A;  3F6H A;  3LZW A;  1K0L A;  2K2Q A;  4GCM A;  2KGD A;  1RP0 A;  5AC4 A;  2MY5 A;  4M0V A;  4GKK E;  3FPZ A;  1VKU A;  3NT6 A;  5DNY A;  5KVI A;  1YIT P;  2UXD E;  5LMU E;  2JOB A;  4B69 A;  5CQF A;  1IUS A;  1E7P A;  2WCC 3;  3GD4 A;  5BUL A;  4N9X A;  2WOI A;  4RSL A;  2GDY A;  5A69 A;  4D04 A;  3J7A G;  5JPA A;  4APN A;  1ZNV A;  1P2E A;  1TDF A;  4RG4 A;  3DS1 A;  3KVE A;  1D7Y A;  3I6D A;  2EM5 A;  2VVL G;  2C73 A;  2JOX A;  2VLQ A;  4H2R A;  3FIM B;  4EQW A;  1WXR A;  2XLP A;  4DR4 E;  3G26 A;  4YKF A;  3NY7 B;  2BC1 A;  4WXD A;  2E5L E;  3FIG A;  3KPK A;  3SZF A;  3K7M X;  5IT9 C;  4U0D A;  2N5H A;  3G0V A;  2NUE A;  5DCK A;  2KOR A;  2DMY A;  2EJ4 A;  1BGN A;  1IUT A;  2EN3 A;  3MHH C;  3ALL A;  3CC2 P;  4FK5 C;  2X3N A;  5TSE A;  2LRS A;  3UTF A;  4GEQ B;  4IA5 A;  4WYQ B;  2ROQ A;  1YYO A;  2CWO A;  2XZ0 D;  2Q7V A;  4ZCC A;  5BR8 E;  4O4K A;  4FX9 A;  1GRE A;  2WET A;  2XLR A;  3F8D A;  5IQ1 A;  5CZD B;  2ZZB A;  1ZY8 A;  4WSP A;  1N34 E;  2B9W A;  2BS3 A;  2HQM A;  4JN9 A;  3UTH A;  4C74 A;  2V3B A;  4NTC A;  2DKH A;  2UUC E;  3LLH A;  5F3W A;  5EB4 A;  4G9K A;  4OPD A;  1DOC A;  3LXD A;  2WDR A;  4AP1 A;  4CY8 A;  4OCG A;  3CCM P;  2EOS A;  2W0H A;  3HZL A;  4PWV B;  3ABV A;  1PJ7 A;  2EPL X;  1X48 A;  2FAE A;  4ZYE A;  1QRJ A;  1ZK7 A;  3H47 A;  3P05 A;  2X99 A;  4II3 A;  2WP5 A;  4WYM A;  2EPK X;  1YQZ A;  2XFU A;  2LUQ A;  1DI2 A;  3ISH A;  5FS6 A;  2N5I A;  2EPC A;  1Q81 Q;  5JCM A;  2QA1 A;  2Z5Y A;  3E1T A;  1ZAA C;  4R2C A;  2XFN A;  4D03 A;  1A1G A;  2AF8 A;  4Z44 A;  3UKQ A;  5AE2 A;  1S2Q A;  5FS9 A;  3SZC A;  3II4 A;  4J2W A;  3SFE A;  5T6J A;  4KPR A;  2FQ1 A;  2A89 A;  3NH3 X;  3UTG A;  2R1F A;  3RP8 A;  4JI4 E;  2GMJ A;  4F37 A;  2YTQ A;  5A6B A;  2L6M A;  1GRA A;  4OPU A;  2BB8 A;  3B3R A;  4J56 A;  4B67 A;  3ICT A;  2XLT A;  4H4V A;  4U8N A;  5KNL A;  4EQR A;  3RG6 C;  3UK3 C;  2L8T A;  4TLZ A;  2KOU A;  2EPR A;  1B69 A;  1GXF A;  1WJP A;  2YLZ A;  3BNM A;  3IC9 A;  1NAA A;  2JAZ A;  4HKG A;  2P9X A;  4QKO A;  3T14 A;  3GYJ A;  1PN0 A;  1VQW A;  4IJD A;  4CY6 A;  2DNW A;  4F6N A;  2NUF A;  1NHR A;  1YZ9 A;  2K7I A;  1D4C A;  2R4E A;  4O5U A;  1EL9 A;  1ZMD A;  2CGQ A;  2BS4 A;  3AV0 A;  2TPR A;  3KPF A;  4U8K A;  1YQ3 A;  2XZ1 C;  1PJT A;  1VQ9 P;  4DR7 E;  1IJH A;  3T2Y A;  1NEK A;  4H4Q A;  1Q86 Q;  4B3M E;  5U25 A;  2B7T A;  4CA3 A;  1ZR9 A;  2JYA A;  2BRY A;  2ERH A;  3RP6 A;  5HVC A;  3ICR A;  1DOD A;  1IMU A;  3AEF A;  2L22 A;  3P1X A;  4YSY A;  3OC4 A;  2C4C A;  5M0Z A;  3SY4 A;  4U8J A;  1KSU A;  1X31 B;  4JQ9 A;  3VRB A;  5KL6 A;  2Y6Q A;  4PAA A;  2EPM X;  2HC5 A;  2Q8U A;  2EQ7 A;  2C75 A;  1ACP A;  1Y0P A;  3B5I A;  2AFD A;  2C3D A;  2FAC A;  2C64 A;  4BCA A;  3T1Y E;  1B4V A;  4YWO A;  2V88 A;  1K73 Q;  1LPF A;  5HGL A;  3I55 P;  5KL5 A;  2V60 A;  1F8R A;  2VLO A;  3EJD A;  4LFB E;  4NXM E;  1M6I A;  3J81 C;  2I0Z A;  2LTS A;  3C6M A;  1W2B O;  2N98 A;  3CCU P;  1HR0 E;  2GDX A;  4EMW A;  2LV2 A;  1CJ4 A;  2YM1 A;  2K92 A;  1KLP A;  1S3E A;  3CXC O;  5EBK A;  4Z2T A;  1YYW A;  5JCI A;  2NUG A;  4M30 A;  4EM4 A;  3GZM A;  2UXB E;  1Q9I A;  3AED A;  2WPC A;  2EML A;  2C65 A;  5HGN A;  2EL5 A;  3SFD A;  1D4E A;  5DBJ A;  2V87 A;  2GV8 A;  1F8W A;  1UN6 B;  1CC6 A;  3SM8 A;  3RG2 A;  2WU2 A;  3AE7 A;  3QVP A;  2YTD A;  1TYT A;  2PY8 A;  1P2H A;  2VRM A;  4AT0 A;  3CCE P;  3CNT A;  2FV4 B;  3NGC X;  2EQ0 A;  3G5S A;  3P4R A;  1GPJ A;  4B3T E;  4DR3 E;  5KRQ A;  1JNR A;  5ER0 A;  3HYX A;  3THO B;  5KMP A;  4A99 A;  2BS2 A;  2XV6 A;  2EPU A;  4DR1 E;  4CRT A;  1BKW A;  1ZOY A;  2XFQ A;  2CQ8 A;  5KMQ A;  2YSO A;  3L8K A;  3COX A;  2JBV A;  3C4T A;  1GTK A;  5BS1 A;  3G21 A;  3BID A;  2LKI A;  1GRH A;  2N6Z A;  3NTA A;  1GRG A;  2B76 A;  2PEJ A;  2YTE A;  1NG4 A;  1K0J A;  2EN2 A;  4AT2 A;  1T4O A;  4EMI A;  3CME P;  3HYB A;  4ADW A;  4R2D A;  1O0W A;  3U43 A;  2YRK A;  4BPF A;  4X62 E;  3BI5 A;  2H36 X;  4H4T A;  4C77 A;  4OPT A;  1IMQ A;  1ZU1 A;  4HEI A;  3T1H E;  2GQF A;  4H2Y C;  3CC4 P;  2YWL A;  3CMM A;  2L2N A;  4H4S A;  2ARD A;  2GB0 A;  2N3G A;  2PEQ A;  2TMD A;  4O43 A;  2YG4 A;  1BBO A;  2EG5 A;  5KP8 B;  3EF6 A;  2YTP A;  2LJH A;  4CNK A;  3H8L A;  4J33 A;  3VRL C;  5FMH A;  4Y4L A;  4AP3 A;  1DJN A;  4JI1 E;  4P7D A;  1GAL A;  2QCU A;  1OJD A;  3HZQ A;  1MGT A;  4ZN0 A;  2OLN A;  4U8M A;  3K30 A;  4O5G A;  2GLI A;  1EH8 A;  2WDV A;  4OPI A;  3CGE A;  3GYX A;  2YT4 A;  2RS6 A;  2DB2 A;  4UP3 A;  1WHQ A;  2LBS B;  4J57 A;  3LMO A;  3CGB A;  2L9F A;  2YR5 A;  2LL8 A;  2ENH A;  1JK1 A;  3P4S A;  3CPI G;  4BS9 A;  2QA2 A;  1PKP A;  4K2X A;  3Q20 A;  1A43 A;  4F6M A;  1XNQ E;  4R8O A;  2B9D A;  1NG3 A;  1L9E A;  3CC7 P;  1T39 A;  1COY A;  1GET A;  3LZX A;  1OJ9 A;  2YTG A;  4ZYD A;  4UHP B;  3PVC A;  4NNJ A;  1L9D A;  4JI5 E;  4B1B A;  4OX9 E;  2EOR A;  3DJJ A;  3WE0 A;  3KU9 A;  4XRQ A;  2EPN A;  3RNM A;  1IBK E;  4BHB A;  4JDR A;  2V85 A;  4DR6 E;  2WS3 A;  3NN6 X;  5A6J A;  1XDI A;  2R4J A;  3IWD A;  1B37 A;  2GZI A;  2BHV A;  4BC7 A;  3HPS A;  2X8G A;  4H4Z A;  2GAH B;  1NEI A;  5BUK A;  3NN0 X;  3P1W A;  3T0K A;  2FBW A;  1KDG A;  4X9J A;  3BGH A;  4X65 E;  4GAV A;  4U8O A;  4LF8 E;  2OAL A;  3H4K A;  2EPX A;  3GRT A;  3DK8 A;  3CNS A;  2EQ3 A;  2WP6 A;  1FL2 A;  1EOQ A;  2GHF A;  4M0I A;  4HTG A;  4Z25 A;  4A6N A;  3KZZ A;  1H83 A;  5F2O A;  1YYK A;  3QJ4 A;  2R9Z A;  2EL4 A;  3VRD B;  4GF7 A;  1KJK A;  4WFT A;  5JCN A;  4A6N B;  4R2R A;  5I4T G;  3GRS A;  3CIR A;  4PH0 A;  1VQ4 P;  3AEB A;  2RTX A;  2M5R A;  2BXR A;  1XHC A;  1QU6 A;  2YG5 A;  2RGO A;  1ELI A;  2NO8 A;  1OJA A;  1T8K A;  3B4Q A;  4G6G A;  3ECR A;  1JK2 A;  3OW2 O;  1PJQ A;  3AEG A;  2EPZ A;  1MXT A;  4X4J A;  5C3J A;  5KMS A;  4U0E A;  1ZDL A;  1AF8 A;  4U0C A;  1K8A Q;  2NPX A;  2F8B A;  2EN8 A;  2XCG A;  2L2M A;  3CGD A;  3CN8 A;  2B7R A;  2V6O A;  4BPG A;  2VLP A;  2O9Z A;  1S3B A;  1BZL A;  3B6D A;  2LML A;  4LF6 E;  1GXG A;  3E2D A;  4B3R E;  2PEK A;  2WBT A;  3NIX A;  4I59 A;  2C70 A;  2DSY A;  2EN4 A;  4KWY A;  3J7Y p;  2GYK A;  4G73 A;  2K0Y A;  1NDA A;  1JRY A;  2JY9 A;  4U8L A;  2ZZC A;  2WOV A;  2EHT A;  2AQJ A;  1F3P A;  2C7G A;  3GWD A;  4P78 A;  5HGM A;  1SR9 A;  1JRX A;  1YY5 A;  2KG8 A;  2DGC A;  3CMA P;  5GSN A;  2X2B A;  2BCG G;  4X9M A;  3NK0 X;  4KHP E;  3P4Q A;  3V76 A;  5F2K A;  3EJB A;  1VDC A;  5F2N A;  2B3T B;  4IV9 A;  4YTP A;  3OTO E;  4G74 A;  2EM6 A;  2KOQ A;  3NRN A;  2KOD A;  3ATQ A;  1CJC A;  1EL5 A;  4X8W A;  3ATR A;  2QEX P;  2AAQ A;  4GKJ E;  1D1D A;  4YTN A;  2VQB A;  3GDN A;  2X8C A;  3IWA A;  1VHN A;  4XFY A;  3CPJ G;  4AQY E;  3KLJ A;  5CFF E;  1TDO A;  4A7A A;  4UDQ A;  4WX1 A;  2LUP B;  1X6H A;  2EMK A;  2WBA A;  2EOF A;  3UKF A;  2YLW A;  1L0H A;  2EMC A;  1BB8 A;  1B8S A;  3L00 A;  2EMG A;  2RSI A;  3LOV A;  3FMW A;  5HY5 A;  3CND A;  1A1H A;  1CBO A;  1YFH A;  2YVJ A;  4JNA A;  4PXH B;  2YTO A;  5AE1 A;  2DRP A;  3BI2 A;  3DS0 A;  2YU5 A;  2MC6 A;  4GR1 A;  4YXD A;  1FEB A;  4J36 A;  2KR5 A;  5KVH A;  2G7H A;  4U0A A;  1A8O A;  4YT0 A;  2UU9 E;  5J60 A;  4DMI A;  4OVI A;  1FR2 A;  4DV1 E;  3C4B A;  1GPE A;  1JEH A;  3HTX A;  4MJW A;  4H4Y A;  2C67 A;  4Z2U A;  1X3O A;  1LJ1 A;  3AB1 A;  3GZL A;  2EMB A;  2VF1 A;  3URH A;  2YQU A;  1GRT A;  4Q35 B;  1EH7 A;  4BHC A;  1A1F A;  3AE4 A;  1HNX E;  3EQ1 A;  2JB0 A;  2WPT A;  2JGP A;  4USQ A;  3DH9 A;  1VQO P;  4BMJ A;  2NAB A;  1VQK P;  1K4Q A;  3QG5 C;  3T2Z A;  2LVH A;  2UZZ A;  5EW5 E;  1TF6 A;  4B3S E;  3ZYX A;  3AEE A;  5KMR A;  2FJA A;  2YWQ A;  4GR2 A;  3ADJ A;  1LVL A;  2EQ6 A;  2F5Z A;  4DV5 E;  5JCL A;  2IHR 1;  2GZG A;  1W4X A;  2N3H A;  1CJ3 A;  3CPH G;  2CUL A;  4LFA E;  1AAY A;  4K7Z A;  4REK A;  4K5S A;  1OJT A;  1BF3 A;  5IWA E;  4NEW A;  4NEV A;  4GZN C;  1XNR E;  3GDP A;  1H84 A;  4H2X C;  4M9V C;  1GV4 A;  2KOP A;  1MZ8 A;  2FGG A;  4F54 A;  3BHK A;  4UDR A;  1A1J A;  1GSN A;  5AAS A;  4DR5 E;  2KW2 A;  1MOK A;  4AOX A;  4TUG A;  3VHT B;  3NYC A;  4Z43 A;  2JB1 A;  4TM3 A;  1L4S A;  1VQ5 P;  4BJY A;  3DK9 A;  3Q9T A;  4ZCD A;  4PH1 A;  1J5E E;  2DKI A;  3CCL P;  5CKU A;  4X9N A;  4R2A A;  2EPO A;  2YPN A;  2JYG A;  2LOL A;  2MKN A;  2ENA A;  2LCE A;  4DGK A;  2KGC A;  5JCK A;  4H2W C;  1KNR A;  1JU2 A;  4RHB B;  4JI6 E;  3FBS A;  2HJJ A;  4X64 E;  2WOW A;  2EWL A;  3NG7 X;  3NK2 X;  4XXG A;  2EE8 A;  1PHH A;  5BVA A;  2KON A;  1HNW E;  4GAP A;  1ZP0 A;  3GJN A;  1GRB A;  1YPN A;  2L3J A;  4TM0 A;  4H2Q A;  2OTJ P;  4JI2 E;  4U0B A;  1FEA A;  2JAE A;  2XLU A;  2JKC A;  3RP7 A;  5BRT A;  4K5R A;  1NCS A;  2EN1 A;  1KD1 Q;  3F8P A;  3DJG X;  3JAM C;  1N1P A;  2J7J A;  3K7Q X;  3H09 A;  4YTM A;  1KSS A;  4OPL A;  4RH8 A;  4Y4N A;  1WHN A;  3UKK A;  2MVU A;  2EMH A;  2LJU A;  2L3C A;  2YLT A;  1CHU A;  2VQ7 A;  1UKV G;  4H4W A;  3UP4 A;  1O94 A;  3T37 A;  3G1G A;  1XMQ E;  3THN A;  3VR9 A;  2JPA A;  1JJ2 O;  2YLS A;  3I3L A;  2EOI A;  2LO3 A;  4YSZ A;  1EL8 A;  4U0F A;  1UNK A;  4BK1 A;  2EMI A;  3DTJ A;  1Q82 Q;  4U2S A;  1RQ0 A;  3G1I A;  1Z1B A;  4BV6 A;  4K8D A;  1QO8 A;  2ADR A;  2PEN A;  3AXB A;  2Z44 A;  2WZO A;  2PEI A;  1X49 A;  4F9C B;  4JV5 E;  2BRA A;  4NHR A;  4H4U A;  2YVF A;  4R2P A;  1H7W A;  2YZT A;  1FEC A;  2LT7 A;  1ZBQ A;  1M6E X;  4DNA A;  3T2K A;  4II2 A;  3IWC A;  4B68 A;  2AFE A;  2L0Q A;  2XLS A;  3CPW O;  1NHP A;  1FKA E;  2APG A;  3JSK A;  3PS9 A;  2L4B A;  2GZF A;  2WPF A;  1X47 A;  3AE8 A;  4DV0 E;  1PS9 A;  4COP A;  4F2J C;  1T4L B;  4DG9 A;  1PDA A;  2GEW A;  4H50 A;  2V5Z A;  2FHS C;  4JI8 E;  2EQ8 A;  1ZOV A;  3QVR A;  4IVO B;  1H7X A;  4EM3 A;  2F4V E;  1EL7 A;  2M7Q A;  2PYX A;  1F80 D;  4XWR A;  1G2D C;  3NHO X;  2JU1 A;  4GUV A;  2YG3 A;  5L46 A;  3GYI A;  5LV9 A;  4CCR A;  5FLX C;  2FVF A;  3CCQ P;  5KP7 B;  2R76 A;  4IPY A;  1CJ2 A;  2WPE A;  5KOW A;  2I9I A;  1QJD A;  4CCQ A;  2YTN A;  4A65 A;  4NTE A;  1LV0 A;  1G2F C;  1H81 A;  3CCJ P;  2EOZ A;  3AD9 B;  4BUR A;  2OA1 A;  3DS3 A;  3L1R A;  3D1C A;  2VOU A;  5FS8 A;  4U2L A;  4L5N C;  4Y4M A;  4N4R B;  3CD6 P;  3UOV A;  4Q28 A;  2B7S A;  3GSI A;  2EMX A;  2WU5 A;  2RAB A;  1D7L A;  2WBU A;  2JXP A;  1N4V A;  2OTL P;  2FTX B;  4A9W A;  2GVC A;  2EMW A;  2V89 A;  5TR3 A;  4NZV A;  7CEI A;  4WX9 A;  2EP3 A;  1LQU A;  3KA7 A;  2PNG A;  2R46 A;  1TF3 A;  3AE5 A;  1PDH A;  5AC5 A;  4XWZ A;  2EMF A;  4WSG A;  2CVJ A;  1O95 A;  4HA6 A;  1ZKQ A;  1RMD A;  3ZDN A;  2RS7 A;  2M8P A;  2VQF E;  4LF4 E;  3H8I A;  5HGO A;  1BAJ A;  2UUA E;  4HB9 A;  2R45 A;  1YUI A;  2ELY A;  3EAN A;  1J26 A;  2PEO A;  4BPH A;  2XVH A;  2XT1 A;  2MDG A;  1GEU A;  5KL3 A;  1Z6M A;  2GR3 A;  4FK1 C;  1N32 E;  3CE7 A;  1B5Q A;  2CTD A;  2YLX A;  2HHH E;  4C5O A;  2DLQ A;  1ZMB A;  2CG5 B;  3DJD A;  3G6E P;  3KZY A;  1LQT A;  4DV6 E;  3NYE A;  4GRT A;  3SGL A;  1WRJ A;  2XVF A;  2UUB E;  4J8Z A;  1YUJ A;  1E1L A;  2KHX A;  1DV5 A;  2MF4 A;  2PRT A;  3TQM A;  3BNU A;  4U8I A;  2M9A A;  4CBQ A;  4JI7 E;  1REO A;  4DUY E;  2Z46 A;  2K94 A;  2R0P A;  2KOO A;  1YI2 P;  2Q0L A;  4U8P A;  4DV7 E;  3SZW A;  4BC9 A;  2GR2 A;  1M74 A;  4IS1 C;  2E5V A;  1PBD A;  3NNE A;  5C2T A;  5AE3 A;  1IQO A;  3M1M A;  2YTJ A;  2EHS A;  2EN6 A;  1E6J P;  1HQB A;  5IQ4 A;  2EM0 A;  2BYB A;  5FS7 A;  3UKL A;  2EM4 A;  1JRZ A;  3AD7 B;  2YU8 A;  4Z26 A;  3DA1 A;  3JTZ A;  3UOX A;  2YVG A;  2LE2 A;  1RNI A;  2RGJ A;  3BI4 A;  2EM9 A;  3VQR A;  1EBD A;  3H4E A;  1IUU A;  4IA6 A;  3IWB A;  4JY3 A;  1GTH A;  2E1M A;  2BUO A;  1SEZ A;  5U63 A;  2JU2 A;  2A25 A;  4ECH A;  2OAM A;  4A79 A;  4YY3 E;  2YLR A;  2L33 A;  4NXN E;  2H89 A;  1BXI A;  4M2Z A;  2YG6 A;  2FVE A;  1VQ6 P;  2WES A;  3CNJ A;  4EQX A;  2DIX A;  3KWR A;  5J7X A;  4E0V A;  4P9S A;  1YKJ A;  4NEO A;  3F6G A;  1A1I A;  1M1K Q;  1GER A;  2BA9 A;  1KQS O;  2EFJ A;  2ODR D;  1F2I G;  3EPH A;  3V3N A;  5LLQ A;  2EZ6 A;  1DGC A;  1YQ4 A;  3DF6 A;  4IVM B;  2GR0 A;  3R9U A;  2N6Y A;  2VLN A;  3VYX A;  2LIW A;  1NPX A;  2K93 A;  4MLQ A;  1VQL P;  5EB5 A;  1TDE A;  3UKH A;  4C3Y A;  1PJ5 A;  3ALJ A;  2VVM A;  2EMZ A;  2R0C A; 
#chains in the Genus database with same CATH homology
 2CPN A;  1RO2 A;  1N36 E;  4BJZ A;  1YJ9 P;  3GMB A;  3AEA A;  1IUV A;  1KFY A;  4G6H A;  1BWC A;  3AYI A;  1F6M A;  2WDQ A;  1Q7Y Q;  3P4P A;  3SX6 A;  3WBH A;  3KD9 A;  2XVJ A;  2YM2 A;  2AR8 A;  3IHG A;  4OPC A;  3VK6 A;  1AUM A;  5IPY A;  1VQM P;  1PBF A;  1JOA A;  3GMC A;  3NYF A;  3ALM A;  3SZ0 A;  4DR2 E;  3J80 C;  2C76 A;  2Z5X A;  5KOX A;  3ADL A;  2YR6 A;  1K30 A;  2A87 A;  2YR4 A;  2FJE A;  1H6V A;  1E6E A;  1GT8 A;  2B7V A;  2JO0 A;  4JI3 E;  3CTY A;  2XVE A;  4LFC E;  1GTE A;  3DJE A;  4LU6 A;  2Y6R A;  2H88 A;  2VRL A;  1H86 A;  2IVE A;  3F8R A;  1ZBT A;  3V3O A;  4EMJ A;  4YHH E;  3CCV P;  2WHD A;  1VG0 A;  3AYL A;  5U1O A;  1D5T A;  2M1S A;  1VQ8 P;  3NTD A;  2BC0 A;  4DV2 E;  2XFP A;  3O0H A;  4DV3 E;  3LB8 A;  2VZ2 A;  3RMP A;  1TRB A;  2B9X A;  3EAO A;  4NTD A;  4EIQ A;  3IHM A;  3LRY A;  1GZ6 A;  4KX6 A;  2BAB A;  1NHQ A;  4JYA E;  3ICS A;  3C4A A;  1EKZ A;  1E1M A;  1DJQ A;  3JU0 A;  1O5W A;  1ZMC A;  2FJD A;  5LL6 R;  1YJW P;  2V61 A;  3C96 A;  1BGJ A;  4R03 A;  4B63 A;  1GND A;  1DNC A;  4EIP A;  3UOY A;  3OML A;  4F9B B;  1DXL A;  1TDK A;  1PXC A;  1IBL E;  1FCD A;  2GAG B;  1KNP A;  2XDO A;  3DJW A;  4H7U A;  5HYM A;  2IVD A;  1PBB A;  2GR1 A;  2V83 A;  3T31 A;  1YHQ P;  3LAD A;  1XPQ A;  3CCR P;  2RGH A;  2L6E A;  2CDU A;  2XFO A;  2MDR A;  4QNB A;  2YAU A;  4BK3 A;  3HYV A;  4GDP A;  3RHA A;  4USR A;  4H4R A;  1CC2 A;  4H4X A;  1Y56 A;  3G5R A;  2FJB A;  4B65 A;  1XAN A;  1Y56 B;  1D4D A;  3AE9 A;  3UKP A;  2GQW A;  3MSW A;  4LU9 A;  2Z45 A;  4X66 E;  2ZZ0 A;  1KF6 A;  3H0D A;  2ONT A;  2A8X A;  3RED A;  1LTX R;  1QVF O;  3G28 A;  3S5W A;  3SQP A;  4L8N A;  1STU A;  2GH5 A;  4LF7 E;  4C3X A;  3QFA A;  3S61 A;  1YIJ P;  4LF5 E;  3QSE A;  3PO7 A;  3EPT A;  2Q6U A;  3G29 A;  3AWI A;  2M8L A;  3AD8 B;  2EQ9 A;  2JK6 A;  3LJP A;  3QFB A;  1MO9 A;  2VVL A;  4H4P A;  3DPH A;  1M90 Q;  3OZ2 A;  2X50 A;  1IUQ A;  3K6Q A;  3BHF A;  4YSH A;  3DME A;  2NVK X;  1TDN A;  5LMN E;  2M4I A;  2UXC E;  4UDP A;  3M12 A;  2RSM A;  2LMZ A;  4TM1 A;  1DOE A;  1L0V A;  4EQS A;  2JB3 A;  4KZS A;  2L92 A;  1S72 P;  1V59 A;  2GRT A;  1S2Y A;  3G4S P;  3GD3 A;  2ACZ A;  3G5Q A;  4H2P A;  2C66 A;  1RYI A;  1PBE A;  2WQY A;  2XVI A;  4Z24 A;  1ONF A;  3AYJ A;  3G71 P;  3AE2 A;  4NWZ A;  2BAC A;  4ICY A;  1VQN P;  4JNQ A;  4RG3 A;  5BS2 A;  4K0K E;  2GMH A;  4GR6 A;  3C4N A;  2DGY A;  3UTE A;  2PEM A;  3ADG A;  4DV4 E;  3Q6J A;  3UCL A;  4XFX A;  4JI0 E;  4A5L A;  2QAE A;  4B64 A;  4F9A B;  3HXL A;  3HPZ A;  4DKK A;  5HXI A;  2K4V A;  4WPY A;  2M8N A;  1Z6L A;  1JNZ A;  2JR1 A;  3DK4 A;  5GRT A;  1I94 E;  3K7T A;  2JB2 A;  3NTE A;  3HYW A;  4XRO A;  3KKJ A;  2R0G A;  4AOS A;  4J34 A;  4B66 A;  3CCS P;  4O5Q A;  4TUI A;  2ZM6 E;  3UOZ A;  3ADI A;  3I56 P;  2BK5 A;  2JVA A;  1QVG O;  3DS4 A;  2BK4 A;  4DUZ E;  3QSS A;  3M13 A;  2LTR A;  2C3C A;  4JY2 A;  4TLX A;  4U2T A;  3AE3 A;  1OJC A;  2BK3 A;  4WCT A;  2V3A A;  5EOW A;  5A2Q C;  1CC4 A;  1NEN A;  3CGC A;  4YKG A;  3DGZ A;  1NHS A;  3SXI A;  2VE7 C;  2CFY A;  1N4W A;  1PXB A;  4I58 A;  2B9Y A;  4I8O A;  1IBM E;  1AOG A;  4LTY A;  1VRQ B;  1NJI Q;  1PJ6 A;  1UIL A;  2BCP A;  2XYO A;  3DGH A;  2NA2 A;  3IF9 A;  3GWF A;  1HYU A;  1GQE A;  1CL0 A;  2E4G A;  3D8X A;  3VYY A;  4XFZ A;  1XMO E;  2XXM A;  2WEU A;  4DSH A;  1E1K A;  3NK1 X;  3DS2 A;  1VQ7 P;  4LF9 E;  2L2K B;  1E39 A;  5HHF A;  3NLC A;  3AUZ A;  3P9U A;  4FDC B;  3ADA B;  1L9C A;  1IUX A;  3SYI A;  1DQ3 A;  3HQ1 A;  1KC8 Q;  2Q0K A;  3LML A;  1VG9 A;  1F8S A;  1N8R Q;  1Q1R A;  1H82 A;  4OPG A;  4DSG A;  2GF3 A;  3ITJ A;  3CNP A;  3M0O A;  3ZOQ B;  2JWO A;  1Q1W A;  1QLB A;  1K9M Q;  4BK2 A;  2YG7 A;  1PXA A;  2QA4 P;  1M6N A;  2OLO A;  1VQP P;  4COC A;  4OOG C;  1K0I A;  1RSG A;  2MC5 A;  3MGE A;  4BBY A;  4J31 A;  2IID A;  1GRF A;  4Z2R A;  1EIA A;  2EIA A;  3FG2 P;  4CNJ A;  2ZBW A;  1M64 A;  2ODR C;  3DS5 A;  4NZH A;  4YSX A;  3VRA A;  1TYP A;  5M10 A;  3AE6 A;  3NKS A;  5KWF A;  2VQE E;  1RO0 A;  2C72 A;  1CF3 A;  3UP5 A;  4LA1 A;  4M52 A;  2BXS A;  2OAR A;  1RC7 A;  1E1N A;  1GES A;  1T4N A;  1N4U A;  3QSM A;  5ADZ A;  2J3N A;  3UKA A;  1PBC A;  1DOB A;  4H2N A;  2JYL A;  1GOS A;  4TM4 A;  1IUW A;  1ZX9 A;  1N33 E;  5KXJ A;  2LF4 A;  1UHZ A;  4LII A;  3AEC A;  2WP9 A;  2X8H A;  1HNZ E;  2PHH A;  4FK1 A;  4GDE A;  4K22 A;  1FOH A;  1YJN P;  3VR8 A;  3AE1 A;  1FJG E;  4PAB A;  2V86 A;  2V8Q B;  3F6H A;  3LZW A;  1K0L A;  4GCM A;  1RP0 A;  4M0V A;  4GKK E;  3FPZ A;  3NT6 A;  5DNY A;  5KVI A;  1YIT P;  2UXD E;  5LMU E;  2JOB A;  4B69 A;  5CQF A;  1IUS A;  1E7P A;  3GD4 A;  5BUL A;  4N9X A;  2WOI A;  4RSL A;  4D04 A;  3J7A G;  5JPA A;  4APN A;  1P2E A;  1TDF A;  4RG4 A;  3DS1 A;  3KVE A;  1D7Y A;  3I6D A;  2VVL G;  2C73 A;  2JOX A;  4H2R A;  3FIM B;  4EQW A;  1WXR A;  2XLP A;  4DR4 E;  3G26 A;  4YKF A;  2BC1 A;  2E5L E;  3FIG A;  3KPK A;  3SZF A;  3K7M X;  5IT9 C;  4U0D A;  3G0V A;  2NUE A;  5DCK A;  2DMY A;  1BGN A;  1IUT A;  3ALL A;  3CC2 P;  2X3N A;  2LRS A;  3UTF A;  4GEQ B;  4IA5 A;  4WYQ B;  2CWO A;  1YYO A;  2Q7V A;  4ZCC A;  5BR8 E;  4FX9 A;  1GRE A;  2WET A;  2XLR A;  3F8D A;  5IQ1 A;  2ZZB A;  1ZY8 A;  4WSP A;  1N34 E;  2B9W A;  2BS3 A;  2HQM A;  4JN9 A;  3UTH A;  4C74 A;  2V3B A;  4NTC A;  2DKH A;  2UUC E;  3LLH A;  5F3W A;  5EB4 A;  4G9K A;  4OPD A;  1DOC A;  3LXD A;  2WDR A;  4AP1 A;  4CY8 A;  4OCG A;  3CCM P;  2W0H A;  3HZL A;  3ABV A;  1PJ7 A;  1X48 A;  1QRJ A;  1ZK7 A;  3H47 A;  3P05 A;  2X99 A;  4II3 A;  2WP5 A;  4WYM A;  1YQZ A;  2XFU A;  2LUQ A;  1DI2 A;  3ISH A;  5FS6 A;  1Q81 Q;  5JCM A;  2QA1 A;  2Z5Y A;  3E1T A;  4D03 A;  2XFN A;  4Z44 A;  3UKQ A;  5AE2 A;  1S2Q A;  5FS9 A;  3SZC A;  3II4 A;  4J2W A;  3SFE A;  5T6J A;  4KPR A;  2A89 A;  3NH3 X;  3UTG A;  3RP8 A;  4JI4 E;  2GMJ A;  2L6M A;  1GRA A;  4OPU A;  3B3R A;  4J56 A;  4B67 A;  3ICT A;  2XLT A;  4H4V A;  4U8N A;  5KNL A;  4EQR A;  3RG6 C;  2L8T A;  4TLZ A;  2KOU A;  1GXF A;  2YLZ A;  3BNM A;  3IC9 A;  1NAA A;  2P9X A;  3T14 A;  3GYJ A;  1PN0 A;  1VQW A;  4CY6 A;  2NUF A;  1NHR A;  1YZ9 A;  1D4C A;  2R4E A;  4O5U A;  1EL9 A;  1ZMD A;  2BS4 A;  3AV0 A;  2TPR A;  3KPF A;  4U8K A;  1YQ3 A;  1VQ9 P;  4DR7 E;  1IJH A;  3T2Y A;  1NEK A;  4H4Q A;  1Q86 Q;  4B3M E;  5U25 A;  2B7T A;  2BRY A;  3RP6 A;  3ICR A;  1DOD A;  3AEF A;  3P1X A;  4YSY A;  3OC4 A;  2C4C A;  5M0Z A;  3SY4 A;  4U8J A;  1KSU A;  1X31 B;  4JQ9 A;  3VRB A;  2Y6Q A;  4PAA A;  2EQ7 A;  2C75 A;  1Y0P A;  3B5I A;  2C3D A;  2C64 A;  4BCA A;  3T1Y E;  1B4V A;  4YWO A;  2V88 A;  1K73 Q;  1LPF A;  5HGL A;  3I55 P;  2V60 A;  1F8R A;  4LFB E;  4NXM E;  1M6I A;  3J81 C;  2I0Z A;  2LTS A;  1W2B O;  3CCU P;  1HR0 E;  4EMW A;  1CJ4 A;  2YM1 A;  1S3E A;  3CXC O;  5EBK A;  4Z2T A;  1YYW A;  5JCI A;  2NUG A;  4M30 A;  4EM4 A;  2UXB E;  1Q9I A;  3AED A;  2WPC A;  2C65 A;  5HGN A;  3SFD A;  1D4E A;  5DBJ A;  2V87 A;  2GV8 A;  1F8W A;  1CC6 A;  3SM8 A;  2WU2 A;  3AE7 A;  3QVP A;  1TYT A;  2PY8 A;  1P2H A;  2VRM A;  4AT0 A;  3CCE P;  3CNT A;  2FV4 B;  3NGC X;  3G5S A;  3P4R A;  4B3T E;  4DR3 E;  5KRQ A;  1JNR A;  5ER0 A;  3HYX A;  5KMP A;  4A99 A;  2BS2 A;  2XV6 A;  4DR1 E;  1BKW A;  4CRT A;  1ZOY A;  2XFQ A;  5KMQ A;  3L8K A;  3COX A;  2JBV A;  3C4T A;  5BS1 A;  3G21 A;  1GRH A;  3NTA A;  1GRG A;  2B76 A;  2PEJ A;  1NG4 A;  1K0J A;  4AT2 A;  1T4O A;  4EMI A;  3CME P;  3HYB A;  4ADW A;  1O0W A;  3BI5 A;  4H4T A;  4X62 E;  4C77 A;  2H36 X;  4OPT A;  3T1H E;  2GQF A;  3CC4 P;  2YWL A;  3CMM A;  2L2N A;  4H4S A;  2ARD A;  2GB0 A;  2N3G A;  2PEQ A;  2TMD A;  2YG4 A;  2EG5 A;  3EF6 A;  2LJH A;  4CNK A;  3H8L A;  4J33 A;  3VRL C;  5FMH A;  4Y4L A;  4AP3 A;  1DJN A;  4JI1 E;  4P7D A;  1GAL A;  2QCU A;  1OJD A;  3HZQ A;  4ZN0 A;  2OLN A;  4U8M A;  3K30 A;  2WDV A;  4OPI A;  3CGE A;  3GYX A;  2YT4 A;  2RS6 A;  2DB2 A;  4UP3 A;  1WHQ A;  2LBS B;  4J57 A;  3CGB A;  2YR5 A;  3P4S A;  3CPI G;  4BS9 A;  2QA2 A;  1PKP A;  4K2X A;  3Q20 A;  1A43 A;  1XNQ E;  4R8O A;  2B9D A;  1NG3 A;  1L9E A;  3CC7 P;  1COY A;  1GET A;  3LZX A;  1OJ9 A;  3PVC A;  4NNJ A;  1L9D A;  4JI5 E;  4B1B A;  4OX9 E;  3DJJ A;  3WE0 A;  3KU9 A;  4XRQ A;  3RNM A;  1IBK E;  4JDR A;  2V85 A;  4DR6 E;  2WS3 A;  3NN6 X;  1XDI A;  2R4J A;  3IWD A;  1B37 A;  2BHV A;  4BC7 A;  3HPS A;  2X8G A;  4H4Z A;  2GAH B;  5BUK A;  3NN0 X;  3P1W A;  3T0K A;  2FBW A;  1KDG A;  4X65 E;  4GAV A;  4U8O A;  4LF8 E;  2OAL A;  3H4K A;  3GRT A;  3DK8 A;  3CNS A;  2WP6 A;  1FL2 A;  1EOQ A;  4M0I A;  4Z25 A;  4A6N A;  1H83 A;  5F2O A;  1YYK A;  3QJ4 A;  2R9Z A;  3VRD B;  4GF7 A;  4WFT A;  5JCN A;  4A6N B;  5I4T G;  3GRS A;  3CIR A;  4PH0 A;  1VQ4 P;  3AEB A;  2RTX A;  2BXR A;  1XHC A;  1QU6 A;  2YG5 A;  2RGO A;  1ELI A;  1OJA A;  4G6G A;  3OW2 O;  3AEG A;  1MXT A;  4X4J A;  5C3J A;  5KMS A;  4U0E A;  1ZDL A;  4U0C A;  1K8A Q;  2NPX A;  2F8B A;  2XCG A;  2L2M A;  3CGD A;  3CN8 A;  2B7R A;  2V6O A;  2O9Z A;  1S3B A;  1BZL A;  3B6D A;  4LF6 E;  3E2D A;  4B3R E;  2PEK A;  3NIX A;  4I59 A;  2C70 A;  2DSY A;  3J7Y p;  4G73 A;  1NDA A;  1JRY A;  2JY9 A;  4U8L A;  2ZZC A;  2WOV A;  2AQJ A;  1F3P A;  2C7G A;  3GWD A;  4P78 A;  5HGM A;  1SR9 A;  1JRX A;  1YY5 A;  3CMA P;  5GSN A;  2BCG G;  4X9M A;  3NK0 X;  4KHP E;  3P4Q A;  3V76 A;  5F2K A;  1VDC A;  5F2N A;  2B3T B;  4IV9 A;  4YTP A;  3OTO E;  4G74 A;  3NRN A;  2KOD A;  3ATQ A;  1CJC A;  1EL5 A;  4X8W A;  3ATR A;  2QEX P;  2AAQ A;  4GKJ E;  1D1D A;  4YTN A;  2VQB A;  3GDN A;  2X8C A;  3IWA A;  4XFY A;  3CPJ G;  4AQY E;  3KLJ A;  5CFF E;  1TDO A;  4A7A A;  4UDQ A;  4WX1 A;  2LUP B;  2WBA A;  3UKF A;  2YLW A;  1B8S A;  3LOV A;  3FMW A;  5HY5 A;  3CND A;  1CBO A;  2YVJ A;  4JNA A;  5AE1 A;  3BI2 A;  3DS0 A;  4GR1 A;  2MC6 A;  4YXD A;  1FEB A;  4J36 A;  5KVH A;  2G7H A;  4U0A A;  1A8O A;  4YT0 A;  2UU9 E;  5J60 A;  4DMI A;  4OVI A;  4DV1 E;  3C4B A;  1GPE A;  1JEH A;  3HTX A;  4MJW A;  4H4Y A;  2C67 A;  4Z2U A;  1LJ1 A;  3AB1 A;  2VF1 A;  3URH A;  2YQU A;  1GRT A;  3AE4 A;  1HNX E;  4USQ A;  3DH9 A;  1VQO P;  4BMJ A;  1VQK P;  1K4Q A;  3T2Z A;  2UZZ A;  2R0C A;  4B3S E;  3ZYX A;  3AEE A;  5KMR A;  2FJA A;  4GR2 A;  3ADJ A;  1LVL A;  2EQ6 A;  2F5Z A;  4DV5 E;  5JCL A;  2IHR 1;  1W4X A;  2N3H A;  1CJ3 A;  3CPH G;  2CUL A;  4LFA E;  4K7Z A;  4REK A;  4K5S A;  1OJT A;  1BF3 A;  5IWA E;  4NEW A;  4NEV A;  1XNR E;  3GDP A;  1H84 A;  1GV4 A;  2FGG A;  4F54 A;  3BHK A;  4UDR A;  1GSN A;  5AAS A;  4DR5 E;  1MOK A;  4AOX A;  4TUG A;  3NYC A;  4Z43 A;  2JB1 A;  4TM3 A;  1VQ5 P;  4BJY A;  3DK9 A;  3Q9T A;  4ZCD A;  4PH1 A;  1J5E E;  2DKI A;  3CCL P;  5CKU A;  4X9N A;  2JYG A;  4DGK A;  5JCK A;  1KNR A;  1JU2 A;  4JI6 E;  3FBS A;  4X64 E;  2WOW A;  2EWL A;  3NG7 X;  3NK2 X;  4XXG A;  1PHH A;  5BVA A;  2KON A;  1HNW E;  4GAP A;  1ZP0 A;  1GRB A;  2L3J A;  4TM0 A;  4H2Q A;  2OTJ P;  4JI2 E;  4U0B A;  1FEA A;  2JAE A;  2XLU A;  2JKC A;  3RP7 A;  5BRT A;  4K5R A;  1KD1 Q;  3F8P A;  3DJG X;  3JAM C;  1N1P A;  3K7Q X;  3H09 A;  4YTM A;  1KSS A;  4OPL A;  4Y4N A;  1WHN A;  3UKK A;  2L3C A;  2YLT A;  1CHU A;  2VQ7 A;  1UKV G;  4H4W A;  3UP4 A;  1O94 A;  3T37 A;  3G1G A;  1XMQ E;  3VR9 A;  1JJ2 O;  2YLS A;  3I3L A;  4YSZ A;  1EL8 A;  4U0F A;  4BK1 A;  3DTJ A;  1Q82 Q;  4U2S A;  1RQ0 A;  3G1I A;  4BV6 A;  4K8D A;  1QO8 A;  2PEN A;  3AXB A;  2Z44 A;  2WZO A;  2PEI A;  1X49 A;  4F9C B;  4JV5 E;  2BRA A;  4H4U A;  2YVF A;  1H7W A;  2YZT A;  1FEC A;  1ZBQ A;  1M6E X;  4DNA A;  3T2K A;  4II2 A;  3IWC A;  4B68 A;  2XLS A;  3CPW O;  1NHP A;  1FKA E;  2APG A;  3JSK A;  3PS9 A;  2WPF A;  1X47 A;  3AE8 A;  4DV0 E;  1PS9 A;  4COP A;  1T4L B;  2GEW A;  4H50 A;  2V5Z A;  4JI8 E;  2EQ8 A;  1ZOV A;  3QVR A;  4IVO B;  1H7X A;  4EM3 A;  2F4V E;  1EL7 A;  2M7Q A;  2PYX A;  4XWR A;  3NHO X;  4GUV A;  2YG3 A;  5L46 A;  3GYI A;  5LV9 A;  4CCR A;  5FLX C;  3CCQ P;  4IPY A;  1CJ2 A;  2WPE A;  5KOW A;  1QJD A;  4CCQ A;  4A65 A;  4NTE A;  1LV0 A;  1H81 A;  3CCJ P;  3AD9 B;  4BUR A;  2OA1 A;  3DS3 A;  3L1R A;  3D1C A;  2VOU A;  5FS8 A;  4U2L A;  4L5N C;  4Y4M A;  3CD6 P;  3UOV A;  4Q28 A;  2B7S A;  3GSI A;  2WU5 A;  2RAB A;  1D7L A;  1N4V A;  2OTL P;  2FTX B;  4A9W A;  2GVC A;  2V89 A;  5TR3 A;  1LQU A;  3KA7 A;  2R46 A;  3AE5 A;  1PDH A;  4XWZ A;  2CVJ A;  1O95 A;  4HA6 A;  1ZKQ A;  3ZDN A;  2RS7 A;  2M8P A;  2VQF E;  4LF4 E;  3H8I A;  5HGO A;  1BAJ A;  2UUA E;  4HB9 A;  2R45 A;  3EAN A;  1J26 A;  2PEO A;  2XVH A;  2XT1 A;  1GEU A;  2GR3 A;  4FK1 C;  1N32 E;  1B5Q A;  2YLX A;  2HHH E;  4C5O A;  1ZMB A;  3DJD A;  3G6E P;  1LQT A;  4DV6 E;  3NYE A;  4GRT A;  3SGL A;  2XVF A;  2UUB E;  4J8Z A;  1E1L A;  2KHX A;  3BNU A;  4U8I A;  4CBQ A;  4JI7 E;  1REO A;  4DUY E;  2Z46 A;  2R0P A;  1YI2 P;  2Q0L A;  4U8P A;  4DV7 E;  3SZW A;  4BC9 A;  2GR2 A;  1M74 A;  2E5V A;  1PBD A;  3NNE A;  5C2T A;  5AE3 A;  3M1M A;  1E6J P;  5IQ4 A;  2BYB A;  5FS7 A;  3UKL A;  1JRZ A;  3AD7 B;  4Z26 A;  3DA1 A;  3JTZ A;  3UOX A;  2YVG A;  2LE2 A;  1RNI A;  2RGJ A;  3BI4 A;  3VQR A;  1EBD A;  3H4E A;  1IUU A;  4IA6 A;  3IWB A;  4JY3 A;  1GTH A;  2E1M A;  2BUO A;  1SEZ A;  5U63 A;  4ECH A;  2OAM A;  4A79 A;  4YY3 E;  2YLR A;  2L33 A;  4NXN E;  2H89 A;  4M2Z A;  2YG6 A;  1VQ6 P;  2WES A;  3CNJ A;  4EQX A;  2DIX A;  3KWR A;  5J7X A;  4E0V A;  4P9S A;  1YKJ A;  3F6G A;  1M1K Q;  1GER A;  2BA9 A;  1KQS O;  2EFJ A;  2ODR D;  3V3N A;  2EZ6 A;  1YQ4 A;  3DF6 A;  4IVM B;  2GR0 A;  3R9U A;  3VYX A;  1NPX A;  1VQL P;  5EB5 A;  1TDE A;  3UKH A;  4C3Y A;  1PJ5 A;  2VVM A;  3ALJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...