2E1MA

Crystal structure of l-glutamate oxidase from streptomyces sp. x-119-6
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
369
structure length
356
Chain Sequence
b'MTYEQLARELLLVGPAPTNEDLKLRYLDVLIDNGLNPPGPPKRILIVGAGIAGLVAGDLLTRAGHDVTILEANANRVGGRIKTFHAKKGEPSPFADPAQYAEAGAMRLPSFHPLTLALIDKLGLKRRLFFNVDIDPQTGNQDAPVPPVFYKSFKDGKTWTNGAPSPEFKEPDKRNHTWIRTNREQVRRAQYATDPSSINEGFHLTGCETRLTVSDMVNQALEPVRDYYSVKQDDGTRVNKPFKEWLAGWADVVRDFDGYSMGRFLREYAEFSDEAVEAIGTIENMTSRLHLAFFHSFLGRSDIDPRATYWEIEGGSRMLPETLAKDLRDQIVMGQRMVRLEYYDPGPAVAIQTVPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-glutamate oxidase
publication title Structural characterization of l-glutamate oxidase from Streptomyces sp. X-119-6
pubmed doi rcsb
source organism Streptomyces sp.
molecule tags Oxidoreductase
total genus 88
structure length 356
sequence length 369
ec nomenclature ec 1.4.3.11: L-glutamate oxidase.
pdb deposition date 2006-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 2e1mA05
1.10.1200.190 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2e1mA03
3.30.160.490 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2e1mA04
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2e1mA02
1D4DA 1GT8A 1H7WA 2FJEA 3UKPA 4BURA 4EQRA 3LOVA 1Q1RA 2DKIA 3ATRA 5IQ4A 2FBWA 2X8CA 4B64A 1IUXA 2ZBWA 4IA5A 4PAAA 3GRSA 2WOVA 5FS7A 2V3AA 5JCMA 5LV9A 1O95A 5CKUA 5BRTA 2VQBA 1F8SA 3V76A 1JU2A 2BS2A 3IHMA 1D4CA 1RP0A 5HY5A 1DJQA 2WU2A 3ITJA 4JY3A 4GDPA 4AP1A 1FEBA 3NT6A 1H7XA 4J31A 3VR9A 1JNZA 3BI5A 2FJBA 1TRBA 2GV8A 4H2RA 2V5ZA 4YKFA 1NAAA 5KRQA 2C7GA 4C3XA 3D1CA 4TM1A 3ALLA 1MXTA 1DOBA 4B1BA 2EQ7A 4GR1A 5EB5A 2YLRA 1IUSA 3RP7A 2WOIA 2BK5A 2QA1A 2V3BA 2YG7A 1K0LA 1O5WA 2VQ7A 4B68A 3Q9TA 4BK3A 2GAHB 3CNSA 2XFUA 5KVIA 1BF3A 2BXSA 3C4AA 2H89A 2C72A 1B8SA 1ONFA 3IHGA 3LJPA 4NEVA 1YY5A 4Y4LA 1GSNA 2EQ8A 3M0OA 4JQ9A 1L0VA 3AE4A 4EIPA 2XLTA 4RG4A 5IQ1A 4H4PA 4K7ZA 4Z43A 4XWRA 3GWDA 4UDQA 4YSHA 4B69A 2ACZA 4AT0A 1GEUA 4O5QA 1GNDA 4TM3A 4YTMA 3KVEA 1VQWA 1GOSA 1NHRA 3EAOA 4P9SA 2F5ZA 2XLRA 3RP8A 1PBBA 3UTHA 2X99A 4Z25A 1TDFA 4KPRA 1PS9A 3P4PA 3K30A 4EIQA 4XWZA 4D04A 4GUVA 5IPYA 1B5QA 2Q0KA 2B7SA 3ATQA 4LA1A 5KVHA 2QAEA 3ALMA 4CNJA 4JN9A 2B9YA 3P4QA 2R46A 3AD8B 3REDA 1S3EA 1LJ1A 2WOWA 3RHAA 1E1LA 4U2TA 1TDNA 1CJ4A 3NKSA 1KNPA 1AOGA 2WP6A 4HA6A 5DBJA 1NHPA 3AEGA 3CNJA 5HHFA 3SFDA 4NTEA 1TDKA 1PJ5A 2RGJA 3BHFA 1BGJA 2XFQA 1FECA 2BACA 1GRGA 1N1PA 3ALJA 4H4SA 3UKLA 4ZCCA 3BNMA 3QVRA 2TMDA 2ZZCA 3FBSA 1IUUA 3PS9A 2WPFA 4U8KA 1S3BA 4CCQA 1OJAA 2BYBA 4LU6A 5FS6A 1PXCA 1H81A 1ELIA 2V61A 1GRHA 2GQFA 2XYOA 3KD9A 2VZ2A 3NYCA 2R0GA 4M52A 4U8MA 4K2XA 1QJDA 3NH3X 3DGZA 5U63A 3UKHA 3EPTA 4H2QA 1CC4A 4APNA 4NZHA 2C67A 2PHHA 2YVFA 4OPTA 4USRA 1D7LA 2I0ZA 4REKA 2J3NA 2R0CA 3I6DA 1ZKQA 2CVJA 4NEWA 3RP6A 4EMWA 3UTEA 1ZOVA 2QA2A 4H2PA 4Y4MA 3QVPA 2Z5YA 4H4VA 3AE2A 2WDVA 4GCMA 3FIMB 5JCKA 1XHCA 3NNEA 1PBCA 1JRZA 2YG3A 3AE3A 3DA1A 2GR2A 1CJ2A 1FCDA 2GAGB 2ARDA 3EF6A 4OPLA 1JRXA 2WP5A 1KF6A 2XCGA 3BI4A 4H4TA 4H4XA 4TM0A 1D7YA 3R9UA 1GESA 2BABA 5HXIA 1P2EA 1DODA 3BNUA 3NRNA 3GYIA 3H4KA 2JB3A 3AYJA 3K7TA 1DJNA 3H8IA 1ZK7A 2GMJA 1F8RA 3GWFA 4Z2RA 2WP9A 1S2QA 2X50A 3F8PA 1YQ4A 4ICYA 3KLJA 1LPFA 1KNRA 2CFYA 1K0JA 3P1WA 2YVGA 1SEZA 3QJ4A 3K7QX 3II4A 4YTPA 2Q6UA 1VDCA 2BXRA 2IIDA 4J2WA 4C74A 2WQYA 2NPXA 2YLTA 2YM1A 3ICTA 4J56A 4CBQA 1IUWA 1LQTA 4YSZA 5FS9A 1DXLA 2Y6QA 2BK3A 3AB1A 2YR5A 4IV9A 1YKJA 2GRTA 3QSSA 2BC1A 2VVLG 3M12A 1L9CA 4EM4A 1V59A 4X9NA 1O94A 4H2NA 3AWIA 1JEHA 2C3CA 4U8NA 2XVJA 1F6MA 3T37A 4J33A 3ZYXA 2A87A 4A9WA 2NVKX 3CPIG 1GERA 3LZWA 4EQWA 3ADAB 3M13A 1PJ7A 4H4YA 2BS4A 5C2TA 1HYUA 3FPZA 4EMIA 1OJCA 1PBFA 1Y56A 2YM2A 2W0HA 3HZLA 3AE8A 4X9MA 5BUKA 1JNRA 2B7RA 4ECHA 5C3JA 5HYMA 5EB4A 3UKKA 3QFBA 3CGEA 2GQWA 3LADA 5KOXA 2ZZ0A 3C96A 4YSXA 2X8GA 3B6DA 2YG6A 1Y56B 2YR4A 3ICSA 4H4UA 2YG4A 3VRDB 3KPFA 3UOXA 1CC6A 2R0PA 2BCGG 3AD7B 1E7PA 2C76A 1EL7A 2A89A 4O5UA 3UTFA 3CGBA 2C75A 2YQUA 3G5QA 1H82A 2GEWA 3ICRA 4Z44A 4GRTA 4LIIA 5GRTA 1ZX9A 4JY2A 1ZOYA 1F8WA 2JKCA 3AYIA 4J34A 2AR8A 2WDQA 1B37A 4JDRA 4U8LA 4UDPA 3NK1X 2C73A 2YWLA 2YAUA 1B4VA 3L1RA 1EL9A 1M64A 1PBDA 1GALA 1CBOA 3ISHA 4ADWA 2XFPA 3UP5A 4H4RA 1VRQB 4UDRA 3NYFA 2VOUA 3G5RA 2PYXA 3CGCA 3H8LA 1CJ3A 2WS3A 2C70A 1FL2A 4XXGA 4CY6A 4I59A 2JB2A 1JRYA 2YLXA 1OJ9A 2C66A 3AE9A 4J36A 4B65A 4EQSA 3NTDA 4GF7A 3DJDA 4YWOA 1UKVG 2WESA 3AEFA 1E39A 1TDEA 1N4UA 2WEUA 3CTYA 2GH5A 4CRTA 3VRBA 3QSMA 1Y0PA 4A99A 4C77A 4AOSA 4E0VA 2A8XA 2XVEA 3URHA 3CGDA 3GDPA 3LZXA 3NYEA 3EANA 1X31B 2RGOA 1ZDLA 2OA1A 3NN0X 3AE1A 3AE7A 3SM8A 1H84A 3V3OA 2XLPA 3AE6A 3V3NA 3GYJA 2IVDA 4BV6A 5U25A 1LQUA 4NTDA 5EBKA 4GDEA 3P4RA 1M6IA 2B9XA 5KOWA 3CN8A 5FMHA 3FG2P 1CHUA 2YVJA 3COXA 3LB8A 1BGNA 1NHSA 1H86A 2C3DA 3PVCA 3S5WA 3S61A 2CDUA 3GRTA 4J57A 2O9ZA 1DOEA 3JSKA 1GETA 4IA6A 1REOA 3GMCA 4H4ZA 2JBVA 4ZCDA 2YLZA 1NENA 3UTGA 4X4JA 2E5VA 2Y6RA 1E1MA 3P4SA 3RNMA 3IC9A 1PJ6A 4USQA 2UZZA 2YR6A 1N4VA 3B3RA 1IJHA 4FK1A 4C5OA 4DSHA 1ZY8A 5J7XA 3F8RA 4FDCB 4TLZA 2BCPA 1GTEA 1NG3A 3SGLA 4I58A 5U1OA 4Z26A 4Z2TA 3UOZA 3DK4A 3VR8A 2OLOA 2VVMA 3K7MX 4Z2UA 3UKQA 2WU5A 2BC0A 4K22A 1KDGA 3AD9B 1GRFA 4U8JA 4AT2A 1MOKA 3GSIA 4B66A 5KXJA 1H6VA 1LV0A 3GDNA 5CQFA 2EQ6A 3ZDNA 1N4WA 3Q6JA 4JNQA 3VRAA 4OPGA 2VRMA 1GREA 4K5SA 3ABVA 2OLNA 1FEAA 5BULA 3E1TA 1P2HA 1XDIA 1LTXR 2WBAA 3DGHA 4ZN0A 1GRTA 3F8DA 5JCLA 3OZ2A 2C65A 4RSLA 1ZMCA 2AQJA 2APGA 2R9ZA 4H7UA 3IWAA 4KX6A 1E6EA 1Q1WA 3NK2X 3QSEA 5BVAA 1IUTA 3LXDA 2GR3A 3NN6X 4N9XA 5M0ZA 4YKGA 1QLBA 2XDOA 1NHQA 4UP3A 2QCUA 2YLWA 2WPEA 3AEAA 3P9UA 1IUVA 1VG0A 2YLSA 2XLUA 3AE5A 4MJWA 4OPCA 4RG3A 5ER0A 2X3NA 2BK4A 1LVLA 2ZZBA 3CPHG 2V6OA 4FX9A 2GVCA 3CPJG 3BI2A 4Z24A 5J60A 3O0HA 3CNPA 4U8IA 1GTHA 4H4QA 3OC4A 1CJCA 4TLXA 2WPCA 4DSGA 4YTNA 1TDOA 4H50A 1CF3A 4U2LA 3AXBA 4YT0A 3AYLA 3NLCA 1QO8A 4CCRA 4BK1A 3DJGX 3DMEA 1OJDA 1GV4A 2GB0A 1GPEA 3SQPA 4A79A 3BHKA 1BWCA 5JCIA 4CNKA 1W4XA 4A6NA 4Y4NA 3UKFA 2GR1A 3KU9A 1GRBA 3NK0X 2JK6A 3SFEA 1KSUA 2RABA 2GR0A 5JCNA 2WDRA 3NIXA 4U8PA 3DK9A 1JOAA 2Q0LA 4EQXA 1PN0A 2XFNA 2RGHA 1H83A 4A6NB 1DOCA 1CC2A 2XVHA 1KFYA 3D8XA 5GSNA 3UOYA 2B9WA 1XPQA 4WX1A 4D03A 4DNAA 1E1NA 2E1MA 4JNAA 4A65A 4AOXA 2YG5A 1L9DA 4PABA 1RSGA 2JB1A 2DKHA 4OVIA 3PO7A 3G5SA 3UP4A 2FJAA 2HQMA 1Q9IA 2R4EA 2WETA 2H88A 2JAEA 3KA7A 4K8DA 1GXFA 1BKWA 1E1KA 3QFAA 3UOVA 4EMJA 3DH9A 3UKAA 1S2YA 4OPIA 2GMHA 2XLSA 1YQ3A 4OCGA 1YQZA 4YXDA 4A7AA 1NPXA 1D4EA 2V60A 2TPRA 4OPUA 4HB9A 1RYIA 2B76A 2FJDA 2BA9A 1EL8A 3GMBA 1CL0A 1PHHA 3NTAA 1NEKA 1TYTA 4BJYA 2C64A 1GRAA 1PDHA 1PXAA 3L8KA 4U2SA 1XANA 4A5LA 4AP3A 4B67A 3DJEA 3KKJA 4IVMB 2VVLA 3VQRA 4IVOB 1TYPA 1K4QA 1ZP0A 2R4JA 4C3YA 1VG9A 1PBEA 2WHDA 5KWFA 1BZLA 1D5TA 1FOHA 4OPDA 1DNCA 5L46A 3DJJA 1COYA 3IF9A 2CULA 2X8HA 2GF3A 5M10A 1EL5A 3NGCX 4TM4A 4WCTA 2R45A 3WE0A 2AAQA 1ZMDA 1NG4A 2OAMA 2EQ9A 4YSYA 2XVFA 1L9EA 4FK1C 3I3LA 4H4WA 2Q7VA 4B63A 3C4NA 3NHOX 1F3PA 2BS3A 2Z5XA 3GD3A 1PXBA 3CNTA 2E4GA 4DGKA 4EM3A 2IVEA 1OJTA 3AECA 1KSSA 5TR3A 4K5RA 4CY8A 1K0IA 4U8OA 5EOWA 3CIRA 3FMWA 2OALA 2XFOA 3AEEA 4BK2A 3GD4A 2XVIA 3NG7X 3DK8A 4NTCA 1EBDA 3UCLA 3AEDA 3CNDA 1MO9A 1Z6LA 2VRLA 3AEBA 1NDAA 5FS8A 4BJZA
chains in the Genus database with same CATH superfamily
4X66E 1YPNA 4BURA 2FVEA 3FIGA 4LF5E 3LOVA 5A69A 5IQ4A 2FBWA 2X8CA 4B64A 1IUXA 1NJIQ 2ZBWA 4IA5A 2LMLA 2RS6A 2WOVA 5FS7A 4BHCA 2LKIA 1M90Q 2LT7A 2VQBA 1F8SA 4GR2A 2N3HA 1D4CA 4JY3A 2EM2A 1FEBA 2ADRA 2ELYA 4J31A 2GV8A 2LRSA 2LOLA 1MXTA 4LFCE 1IQSA 5A6KA 1IUSA 5T6JA 3RP7A 2BK5A 2YG7A 3Q9TA 2GAHB 3CNSA 2GZGA 1BF3A 2L22A 2BXSA 4TUIA 2H89A 2VQFE 1B8SA 4Y4LA 2EN3A 3T31A 4RG4A 4XWRA 2KG9A 1A1KA 2N8XA 2EMZA 4AT0A 1GNDA 1IBLE 4GKKE 3CMMA 1WHQA 4LF6E 2KGCA 2X99A 4KPRA 2I13A 4JN9A 3P4QA 3REDA 1RNIA 4M0VA 1E1LA 4U2TA 1TDNA 3NKSA 3CCQP 3G28A 2EMAA 4NTEA 2JP9A 1BGJA 1FECA 1GRGA 3UKLA 4LF4E 4ZCCA 3QVRA 3FBSA 4B3RE 2WPFA 4U8KA 2JGPA 4LU6A 4F6NA 2CGQA 5FS6A 1PXCA 4O5QA 2ODRD 2V61A 1ELIA 4EQRA 4U8MA 1Z1BA 4LTYA 4G9KA 3DS3A 1PJTA 3UKHA 3EPTA 2ONTA 4GAPA 1NEIA 2XT1A 2YT4A 1ZOVA 2VSQA 4Y4MA 4G6GA 2Z5YA 4H4VA 2E72A 1JK1A 2WDVA 2JYLA 1JRZA 4DR7E 1K9MQ 2GR2A 2ARDA 1JRXA 4TM0A 5AC4A 4R03A 1EIAA 1DODA 4F6MA 2GPIA 2JB3A 3AYJA 3CMAP 1N32E 1DNYA 4X65E 2YPNA 2RPCA 1YQ4A 4ICYA 3CCJP 1KNRA 1LPFA 2CFYA 1K0JA 3P1WA 2WPTA 3QJ4A 3K7QX 2B7TA 2N98A 2EN8A 2YTGA 1VQNP 3HXLA 2YLTA 2LIWA 4J56A 2JU1A 4QNBA 5IT9C 1DXLA 2NUEA 5CFFE 3CCVP 1L9CA 3AWIA 3BIDA 2XVJA 1T38A 1L0HA 2BHVA 2Q8UA 3ZYXA 1TF3A 2EOXA 2NVKX 3CPIG 3LZWA 4EQWA 3M13A 1SFEA 4H4YA 5C2TA 3FPZA 4WXCA 1YYKA 1NQ4A 1JNRA 5EB4A 3UKKA 4AQYE 2V86A 2CSHA 2GYKA 2ZZ0A 5LMNE 4YSXA 3RMPA 4COPA 2YR4A 4X64E 2YG4A 3VRDB 3SYIA 1CC6A 4O5UA 1EL7A 2A89A 4DR5E 1VQKP 3CGBA 2KOQA 2EN2A 1RMDA 1H82A 2GEWA 3GJNA 3ICRA 4GRTA 1F8WA 4J34A 4A5LA 4UDPA 1EL9A 5BS2A 2VRDA 2EN1A 3ISHA 4P7DA 1VRQB 1YYWA 2VOUA 2PYXA 3H8LA 2C70A 4XXGA 4CY6A 4I59A 3I55P 2YLXA 1HQBA 1LLMC 4B65A 3DJDA 4F9BB 2MY5A 1E39A 1TDEA 2BRAA 2EMKA 2WEUA 4CRTA 3QSMA 4A99A 2XXMA 2YU5A 3HYBA 2EN7A 3EANA 3NYEA 2OA1A 3SM8A 2DMIA 3AE7A 3V3OA 2KG6A 1MGTA 4YY3E 3AE6A 3LMOA 4H2XC 5CZDB 1IMUA 1M74A 4BV6A 2EPMX 5U25A 1LQUA 3C6MA 2JQ4A 2M9AA 3SZFA 1NHSA 3S5WA 5IWAE 3JSKA 4IA6A 2EP3A 3T2YA 4ZCDA 2Y6RA 2RSMA 1PJ6A 4WSGA 2UZZA 3IWCA 3B3RA 4DV0E 1NG3A 3SGLA 4I58A 3UOZA 2VVMA 3G6EP 3K7MX 4Z2UA 3QG5C 5IXMB 1QVFO 5KP6B 2BC0A 1KDGA 1GRFA 2EPAA 1MOKA 5KXJA 2LPKA 3Q6JA 4JNQA 3VRAA 1GREA 1B69A 4K5SA 4U0CA 5KL2A 1FEAA 3DGHA 2XV6A 3OZ2A 2C65A 3ADJA 2R9ZA 1DI2A 2RQLA 3IWAA 3QSEA 2RS7A 2GR3A 4N9XA 4BC9A 1F80D 2L2KB 1NHQA 2QCUA 2GZFA 2KGDA 2N50A 4RG3A 1QU6A 5IV8B 2V6OA 2EM8A 4JYAE 3THNA 4RHBB 3BGHA 4B3ME 4K0KE 2WPCA 1VQ5P 4H50A 1CF3A 1AYIA 4XROA 3AYLA 1X6HA 3IWBA 5LMUE 1GV4A 1GPEA 4A79A 4U0AA 4OOGC 4CNKA 1W4XA 4A6NA 1AF8A 5KMQA 4Y4NA 1JJ2O 4R2AA 4DV1E 1YHQP 2PENA 3CXCO 1Z6MA 2RABA 2GR0A 2EMIA 2CWOA 3NIXA 3DK9A 1PN0A 1DOCA 2YTQA 4ZYEA 1CC2A 2K0DX 4JI7E 4DNAA 1E1NA 2E1MA 4A65A 3GKLC 4PABA 1MZ8A 1RSGA 3G5SA 2DIXA 3EQ1A 3UP4A 2R4EA 2K94A 3SZ0A 2DLQA 1A1FA 4DR3E 3CMEP 1S2YA 4OCGA 4A7AA 1NPXA 2TPRA 2PEJA 4OPUA 1L4SA 4LF7E 2EPPA 2FJDA 1HY8A 1PHHA 2LUQA 1NEKA 1PDHA 1PXAA 3JAMC 4AP3A 4IVMB 2KG8A 3VQRA 2N5IA 4IVOB 2FQ1A 1BBOA 1ZP0A 2FTXB 3T1YE 1FOHA 3DJJA 3IF9A 1N8RQ 1QNTA 2KODA 4F9CB 3NGCX 1PDAA 5EW5E 3MHHC 2YTOA 2PNGA 2EOZA 4IJDA 1L9EA 2VLNA 2BS3A 4EM3A 5TR3A 3H0DA 5EOWA 2FQ0A 2OALA 4NTCA 3AEDA 1EH7A 3ATRA 2R76A 3NTEA 4F9AB 2ENAA 3GRSA 4PAAA 4KHPE 1O95A 1VQ6P 4HEIA 3AV0A 3IHMA 2EL5A 5HY5A 3NT6A 3VR9A 1IBKE 3T2ZA 1JNZA 2YTNA 5F2OA 1NAAA 5KRQA 2EN4A 2C7GA 3SXIA 4C3XA 3D1CA 4TM1A 2AFEA 4GR1A 2EHTA 1XMOE 1K73Q 2EE8A 2XFUA 4WPYA 2KORA 3LJPA 5LLQA 1QRJA 2EQ8A 1EH8A 4K7ZA 4Z43A 2M8PA 4UDQA 4B69A 3EPKA 4DR2E 4ZYDA 2CNRA 3KVEA 3CCEP 1NHRA 2VLQA 2B7VA 3UTHA 4JI0E 4EIQA 3K30A 4D04A 5IPYA 1B5QA 3ATQA 5KL7A 2QAEA 4CNJA 2R46A 1LJ1A 2PY8A 4DV2E 4Q28A 4JV5E 2JPAA 4O24A 1CJ4A 2WP6A 1M6NA 4F37A 3CNJA 1TDKA 1PJ5A 5BS1A 2I9IA 2LCEA 2BACA 3KWRA 1ZAAC 4X8WA 1A8OA 5DCKA 2KOOA 2MF4A 1VQ9P 2IHR1 1HNZE 2EPUA 1GRHA 4XFYA 3DGZA 5U63A 2L92A 4H2QA 1CC4A 4APNA 2C67A 2YVFA 2BB8A 4USRA 1D7LA 4REKA 1EH6A 3I6DA 1ZKQA 2CVJA 4NEWA 4EMWA 3VHTB 2AFDA 4H2PA 3QVPA 4GCMA 5JCKA 3G26A 4DV6E 3AE3A 3DA1A 4OPLA 2WP5A 4DR6E 3BI4A 4H4XA 3H47A 2OTJP 2UXBE 1GESA 3NRNA 2M4IA 3H8IA 2GMJA 1YJ9P 3GWFA 4Z2RA 1K30A 2JOBA 2K5XA 1UHZA 2YVGA 3IWDA 2YZTA 4YTPA 3II4A 4M0IA 2YU8A 2Q6UA 2BXRA 2IIDA 4J2WA 4CBQA 1LQTA 4YSZA 5FS9A 1YKJA 3TQMA 2GRTA 3QSSA 2BC1A 1KJKA 3M12A 4EM4A 5A6BD 1IBME 4X9NA 4H2NA 2EOOA 2JR1A 1JEHA 2C3CA 2M8LA 1F6MA 4GR6A 3T37A 4J33A 2EM5A 1GERA 4EMIA 1PBFA 1KD1Q 3M1MA 3HZLA 4R8OA 2KWLA 4ECHA 3LLHA 2R1FA 3QFBA 4ZYGA 2GQWA 3LADA 2LJHA 4H4UA 3VYYA 3KPFA 2EM6A 3AD7B 2BCGG 2EOQA 1EOQA 3G5QA 4GZNC 1XNRE 3EPLA 2V87A 1E6JP 2WDQA 2C73A 2CT1A 1PBDA 1M64A 1CBOA 2ROQA 4H4RA 1YYOA 4UDRA 1CJ3A 2JB2A 1JRYA 4EQSA 4R2DA 3NTDA 4GF7A 2EMGA 2DRPA 5HGOA 1K8AQ 2GH5A 3H4EA 1Q82Q 2EOIA 4C77A 4E0VA 3URHA 4XFXA 3GDPA 3LZXA 2RGOA 2QEXP 3B4QA 4DKKA 3GYJA 2JO0A 5A2QC 3GYXA 1KYQA 2EQ3A 1WHNA 4NXME 2B9XA 3JTZA 3RG6C 5KOWA 1CHUA 2N3GA 3UTGA 2C3DA 3PVCA 3S61A 2K7IA 2O9ZA 1DOEA 1YFHA 3GMCA 4H4ZA 5BR8E 2YLZA 4X4JA 2E5VA 3P4SA 2XZ1C 3I56P 4USQA 4FK1A 2VQEE 2NABA 3F8RA 4FDCB 2JYGA 5U1OA 4Z2TA 4O4KA 3VR8A 2HJJA 1A43A 2EPNA 2EMWA 2MVUA 2MR7A 2YRKA 4WX9A 3KZYA 4B66A 3HYVA 2LUPB 3GDNA 2EQ6A 1VQLP 3LMLA 2VRMA 1P2HA 1D1DA 2EPRA 5A6JA 5JCLA 4LF9E 4RSLA 5AASA 2AQJA 4KX6A 2MKNA 2LTRA 3LXDA 2AVAA 2L6MA 3NN6X 1KC8Q 2L8TA 1T39A 2GZEA 3P9UA 3ECRA 2XLUA 2K0XA 4R2PA 3AE5A 4OPCA 1M6EX 4PXHB 2KR5A 2BK4A 1LVLA 5HGNA 3CNPA 2LL8A 5TSEA 1YUJA 4H4QA 1CJCA 1IMPA 2L6EA 4DSGA 1TDOA 4J8ZA 4F2JC 2YTDA 2MDGA 2XZ0D 4NZVA 2LMZA 4U0DA 3DS0A 3DJGX 1OJDA 2GB0A 1X6EA 1BWCA 4DV5E 3UKFA 1AH5A 1ACPA 2GR1A 3KU9A 3T2KA 3NK0X 4WSPA 4U8PA 1JOAA 2Q0LA 2VLOA 2FGGA 3H09A 4BCAA 2JYAA 3UOYA 1KFYA 4H2WC 2JOXA 4BC7A 2EOEA 3P05A 1GXGA 4AOXA 1AUMA 1YUIA 2BRYA 2JB1A 2OTLP 4OVIA 4TUGA 2KGEA 2FJAA 1Q9IA 1BKWA 3UOVA 2YSOA 3QFAA 5ADZA 4O5GA 4DUYE 2ENCA 1XMQE 3HYXA 3G4SP 3CD6P 4R2CA 4II3A 2YTEA 4HB9A 1RYIA 2B76A 2FAEA 1VKUA 2EWLA 3EJDA 3KKJA 3HYWA 2R4JA 3ADLA 4C3YA 2EFJA 1PBEA 2WHDA 1UJZA 1BZLA 1D5TA 4OPDA 2AF8A 1DNCA 3G21A 1KQSO 3G29A 1EL5A 7CEIA 3NY7B 1WJPA 2J7JA 2FADA 2WBSA 2UUCE 1P47A 3I3LA 2FVFA 3GD3A 1OJTA 3EJEA 4HKGA 4DR1E 3CIRA 3AEEA 2XFOA 4BK2A 1HNWE 3T14A 4BBYA 3CNDA 2VRLA 1A1IA 1IUQA 1GT8A 2FJEA 3UKPA 2DKIA 2EPXA 5JCMA 5LV9A 5CKUA 5BRTA 3V76A 1JU2A 2BS2A 2YTIA 1RP0A 4PWVB 2WU2A 3ITJA 4GDPA 1H7XA 3CCUP 5AC5A 3BI5A 3CE7A 4H2RA 5KNLA 2V5ZA 1FR2A 1J26A 1A1LA 1WXRA 3ALLA 4R0MA 1DOBA 2EQ7A 4B1BA 2EHSA 5F2NA 4R2RA 5EB5A 2JWOA 2V3BA 2QA1A 4B68A 1K0LA 2YRHA 4BK3A 3OTOE 3Q20A 2V85A 2UUBE 2N6ZA 1N36E 2EPKX 4G6HA 4GAVA 2C72A 1ONFA 1DGCA 1GSNA 3M0OA 1L0VA 2EMFA 3AE4A 4EIPA 2XLTA 5IQ1A 1L0IA 1A1GA 1GEUA 2K92A 4TM3A 5FLXC 4YTMA 2V8QB 1X48A 4P9SA 3RP8A 2XLRA 1PBBA 2EPZA 4CA3A 4Z25A 3G0VA 3VK6A 3P4PA 3K6QA 4GUVA 2Q0KA 2B7SA 5KVHA 3ALMA 2EMCA 2B9YA 2EG5A 3AD8B 3RHAA 3SX6A 1ZR9A 4HA6A 2RGJA 4MLVA 4NEOA 2EQ0A 2VF1A 2M7QA 2DGYA 2TMDA 3HZQA 1IUUA 3PS9A 1Q81Q 5KMSA 1S3BA 4DMIA 1OJAA 2P9XA 3NYCA 2JU2A 2VZ2A 2R0GA 4M52A 1VQPP 3NH3X 4MRTC 2E5LE 4KZSA 5EJDA 4M2ZA 4NZHA 1F2IG 4L5NC 2PHHA 4OPTA 2I0ZA 5KMRA 3AUZA 2R0CA 3RP6A 3HQ1A 3UTEA 4UHPB 3AE2A 2QA4P 1VQ4P 2JVAA 2YG3A 2A25A 1CJ2A 3EF6A 2K2QA 1UBDC 2XCGA 3CC7P 5HGLA 3MHSC 4DR4E 2BABA 5HXIA 1P2EA 3BNUA 2YTJA 5F3WA 5KL3A 1DJNA 1ZK7A 1F8RA 1S2QA 2X50A 3KLJA 1OR5A 2LF4A 2DNWA 4Q35B 1VDCA 3KZZA 2MVVA 5KL4A 4C74A 2EPCA 2WQYA 3T0KA 1TN9A 2KOUA 4IV9A 2YR5A 3AB1A 2Z44A 4WYMA 2HHHE 4COCA 4R2EA 1O94A 3DTJA 3HPSA 3HTXA 4JI8E 2GZIA 4U8NA 1XNQE 3C4BA 2EL4A 4QKOA 2A87A 2FV4B 3ADAB 1PJ7A 2UXDE 3J80C 2W0HA 3MGEA 3AE8A 2VLPA 5BUKA 5C3JA 2LE2A 5HYMA 4M9VC 1HR0E 4DV3E 1BXIA 3C96A 3DS1A 2X8GA 2YG6A 1Y56B 3ICSA 1YITP 4KWYA 2R0PA 2HGHA 1GPJA 2C76A 4B3TE 2NUGA 2FQ2A 1G2FC 5GRTA 4LIIA 1ZX9A 1ZOYA 5DNYA 1J5EE 2JKCA 4JDRA 2AR8A 1B37A 2YAUA 1GALA 4DV4E 4ADWA 2XFPA 3P1XA 3UP5A 3G5RA 3CGCA 2LIUA 2KOSA 2WS3A 1FL2A 2PEMA 3AE9A 1OJ9A 2C66A 2V89A 2EPLX 2HC5A 2Z45A 1UKVG 3VRBA 3CTYA 1Y0PA 1VQ7P 1VQOP 2XVEA 4NHRA 3NN0X 3AE1A 1H84A 1HNXE 3CPWO 3WBHA 1RC7A 5KL6A 4DG9A 5EBKA 5AE2A 2UU9E 2LO3A 3CN8A 5FMHA 3FG2P 3CC2P 3LB8A 1BGNA 4J57A 2OARA 1GETA 2ZM6E 1NENA 1E1MA 3IC9A 2EMYA 1IMQA 1N4VA 5KP7B 4DSHA 1ZY8A 5J7XA 2EOFA 2LTSA 3VYXA 3OW2O 2PRTA 4NWZA 3J81C 4LFAE 3AD9B 4U8JA 4AT2A 2M8NA 4H2YC 4BPGA 2EQ1A 3ZDNA 3CC4P 1AAYA 2WBUA 1XDIA 1LTXR 2D9HA 2WBAA 1ZMBA 3F8DA 2ERHA 1UILA 1ZMCA 2F8BA 2JAZA 1E6EA 4GEQB 4I8OA 1Q1WA 3NK2X 5BVAA 4JI5E 4X9JA 4YKGA 1UNKA 1GQEA 2N5HA 1Q7YQ 1E0HA 4UP3A 2QNWA 5HGMA 2EMBA 3AEAA 1IUVA 1VG0A 4XRQA 2YLSA 1X3CA 2YTFA 4MJWA 5ER0A 2X3NA 3CPHG 3KPKA 3BI2A 3CPJG 5F2KA 4Z24A 5J60A 3O0HA 4U8IA 1GTHA 2YTPA 3THOB 4TLXA 3F6HA 3EPJA 3AXBA 4YT0A 2WZOA 3F6GA 1X49A 3NLCA 1QO8A 4BK1A 2YRMA 3DMEA 4ZYHA 4DUZE 2DMYA 2LJUA 3HPZA 1GRBA 2JK6A 3SFEA 1KSUA 2XFNA 2LV2A 2V88A 1XPQA 3SZCA 4JNAA 2GLIA 2YG5A 1L9DA 1Q86Q 2WETA 4BHBA 3KA7A 1E1KA 1RO2A 2BUOA 3DH9A 4OPIA 4JI2E 2XLSA 1YQ3A 4YXDA 1D4EA 2EM3A 2BA9A 3GMBA 1RQ0A 4BPFA 4B67A 1XANA 2EOMA 1A1HA 2RSIA 2PEOA 4U0BA 2RTXA 1VG9A 5KWFA 5L46A 1COYA 2X8HA 2ENHA 2WCC3 4TM4A 3SY4A 3CCLP 5AE1A 2R45A 3WE0A 1ZMDA 2L2NA 2EOSA 1NG4A 2KOPA 4MLQA 2EQ9A 3G1GA 2EMHA 4YSYA 2XVFA 4FK1C 4B63A 4H4WA 3NHOX 1F3PA 1PXBA 3CNTA 1X5WA 4DGKA 3G1IA 2M5RA 1K0IA 4U8OA 2K93A 3FMWA 1VHNA 2UUAE 3ZOQB 2JXPA 3DK8A 1N3GA 1EBDA 3UCLA 2GHFA 5FS8A 4BJZA 5AE3A 1T4OA 1D4DA 2L9FA 1H7WA 1DV5A 1Q1RA 2H36X 2V3AA 2PEQA 1GZ6A 4JI1E 2EL6A 1BAJA 3T1HE 3G71P 1DJQA 4AP1A 2C4CA 2MKDA 2FJBA 4GKJE 1TRBA 1S72P 3C4TA 4YKFA 2UXCE 3GZLA 1YJWP 2YLRA 2L2MA 2YSPA 2LTEA 2WOIA 1X3OA 2VQ7A 1O5WA 5KVIA 3C4AA 2JBGA 1GTKA 3IHGA 4NEVA 1ZBQA 1YY5A 3CCMP 4JQ9A 3CCRP 4H4PA 3GWDA 3MSWA 4YSHA 2ACZA 2MDRA 1NCSA 1I94E 1VQWA 1GOSA 2VE7C 3EAOA 2F5ZA 2N6YA 1TDFA 1PS9A 4G73A 4XWZA 4L8NA 4LA1A 2EM9A 1S3EA 2EM4A 2WOWA 1CEIA 4WFTA 3JU0A 2NUFA 1AOGA 1KNPA 4B3SE 5DBJA 4JI4E 2EOHA 2B3TB 1NHPA 3AEGA 5HHFA 3SFDA 1G2DC 5HV8A 3BHFA 2XFQA 2Z46A 1VQMP 3ALJA 1N1PA 4H4SA 4WXDA 3BNMA 2ZZCA 2JB0A 1PJQA 4BS9A 4CCQA 2BYBA 1H81A 3KD9A 2XYOA 2GQFA 4K2XA 1QJDA 2K4VA 3DF6A 2LVHA 1PKPA 1SR9A 2J3NA 2QA2A 1KLPA 2KGAA 3BBGA 3FIMB 1XHCA 3DS2A 3NNEA 1PBCA 2GAGB 1FCDA 4XFZA 1KF6A 4H4TA 3E2DA 2EM7A 1D7YA 3R9UA 4N4RB 2K0YA 4YHHE 1FJGE 3GYIA 3H4KA 3K7TA 2WP9A 3F8PA 4IPYA 3ADGA 4DV7E 3OMLA 4U0FA 2FHSC 1SEZA 3RG2A 3LRYA 2YWQA 3SZWA 4R2QA 3DPHA 1GXHA 2NPXA 2YM1A 3ICTA 2KHXA 1IUWA 1UN6B 2Y6QA 2EM0A 2BK3A 2VVLG 1V59A 3U43A 2EZ6A 4WYQB 1RO0A 3M99B 1IQOA 3UK3C 2EMXA 2NO8A 4A9WA 4G74A 3EJBA 2BS4A 1HYUA 1OJCA 1Y56A 2YM2A 4X9MA 2B7RA 5A6BA 2LBSB 4F54A 3CGEA 5KOXA 3B6DA 3UOXA 3DJWA 2KONA 1E7PA 2DB2A 3UTFA 2C75A 4JI6E 2YQUA 2KW2A 4Z44A 3C6KA 1WRJA 4HTGA 4JY2A 2EOYA 3UKAA 2NA2A 3AYIA 2L3JA 4LU9A 4U8LA 2GDYA 3NK1X 2YWLA 3L1RA 1B4VA 4M30A 3NYFA 4U0EA 4O43A 4J36A 2MR8A 1X6FA 2L33A 4YWOA 2WESA 3AEFA 1N4UA 2EJ4A 1YSAC 4AOSA 2A8XA 2EN6A 3CGDA 5LL6R 1X31B 1ZDLA 2XLPA 3V3NA 2IVDA 4NTDA 1N34E 2MC5A 2L0QA 3P4RA 1M6IA 4GDEA 2X2BA 2CQ8A 4R2SA 4X62E 2YVJA 3COXA 2L4BA 1H86A 2ELZA 2CDUA 3GRTA 1REOA 1A1JA 2JBVA 1T8KA 2ODRC 3BF2A 5A6AA 3RNMA 2MD9A 2YR6A 1YI2P 1IJHA 4C5OA 2FVAA 1EKZA 1ZBTA 1EMVA 1BB8A 4IS1C 2F4VE 4TLZA 2BCPA 1GTEA 4NNJA 4Z26A 2L3CA 4NXNE 3DK4A 2V83A 2OLOA 4PH1A 2M1SA 4PH0A 3EPHA 1PJSA 3UKQA 2WU5A 4K22A 1N33E 4IZ6A 3J7Yp 3GSIA 2PEKA 1MEYC 1H6VA 1LV0A 2CTDA 5KL5A 5CQFA 1N4WA 4OPGA 2DSYA 3ABVA 2OLNA 3DS4A 5BULA 3E1TA 4ZN0A 1GRTA 4FK5C 1STUA 2APGA 4H7UA 4OX9E 2EORA 1IUTA 1T4LB 1ZNVA 1X47A 1TF6A 5M0ZA 1QLBA 2XDOA 2YLWA 2CG5B 2WPEA 4LFBE 2EOJA 5KP8B 2MC6A 2ZZBA 4FX9A 2GVCA 3OC4A 4YTNA 5JPAA 1JK2A 4U2LA 1ZU1A 5I4TG 1T4NA 4CCRA 3SQPA 2DGCA 3BHKA 5JCIA 3J7AG 2EPOA 1VQ8P 4BPHA 2B9DA 5JCNA 2WDRA 4EQXA 1W2BO 4II2A 2RGHA 2PEIA 1H83A 4A6NB 2XVHA 3D8XA 5GSNA 2B9WA 2DLKA 4WX1A 4D03A 5HVCA 2GDWA 2CPNA 1O0WA 5KMPA 2DKHA 3ADIA 3PO7A 3L00A 2HQMA 2H88A 2JAEA 4EMJA 4K8DA 1GXFA 2EIAA 4BMJA 2GMHA 2WBTA 4JI3E 1DQ3A 1YQZA 2V60A 1FKAE 2GDXA 4LF8E 1EL8A 1CL0A 3NTAA 1TYTA 2EMLA 2C64A 1GRAA 3L8KA 4U2SA 4BJYA 4RH8A 3DJEA 1YIJP 2VVLA 1TYPA 1K4QA 1QVGO 2CULA 2GF3A 2GZJA 5M10A 3B5IA 4WCTA 1M1KQ 2AAQA 2JY9A 1YZ9A 2OAMA 2BBGA 3GZMA 1YJNP 2Q7VA 3C4NA 2Z5XA 3VRLC 2E4GA 2IVEA 3DS5A 3AECA 1KSSA 4K5RA 4P78A 4CY8A 2G7HA 1BBGA 3GD4A 2XVIA 3NG7X 2FACA 1MO9A 1Z6LA 3AEBA 1NDAA 3CCSP
chains in the Genus database with same CATH topology
4X66E 4BURA 4LF5E 3FIGA 3LOVA 5IQ4A 2FBWA 2X8CA 4B64A 1IUXA 1NJIQ 2ZBWA 4IA5A 2RS6A 2WOVA 5FS7A 1M90Q 2VQBA 1F8SA 4GR2A 2N3HA 1D4CA 4JY3A 1FEBA 4J31A 2GV8A 2LRSA 1MXTA 4LFCE 1IUSA 5T6JA 3RP7A 2BK5A 2YG7A 3Q9TA 2GAHB 3CNSA 1BF3A 2BXSA 4TUIA 2H89A 2VQFE 1B8SA 4Y4LA 3T31A 4RG4A 4XWRA 4AT0A 1GNDA 1IBLE 4GKKE 3CMMA 1WHQA 4LF6E 2X99A 4KPRA 4JN9A 3P4QA 3REDA 1RNIA 4M0VA 1E1LA 4U2TA 1TDNA 3NKSA 3CCQP 3G28A 4NTEA 1BGJA 1FECA 1GRGA 3UKLA 4LF4E 4ZCCA 3QVRA 3FBSA 4B3RE 2WPFA 4U8KA 4LU6A 5FS6A 1PXCA 4O5QA 2ODRD 2V61A 1ELIA 4EQRA 4U8MA 4LTYA 4G9KA 3DS3A 3UKHA 3EPTA 4GAPA 2XT1A 2YT4A 1ZOVA 4Y4MA 4G6GA 2Z5YA 4H4VA 2WDVA 2JYLA 1JRZA 4DR7E 1K9MQ 2GR2A 2ARDA 1JRXA 4TM0A 4R03A 1EIAA 1DODA 2JB3A 3AYJA 3CMAP 1N32E 4X65E 1YQ4A 4ICYA 3CCJP 1KNRA 1LPFA 2CFYA 1K0JA 3P1WA 3QJ4A 3K7QX 2B7TA 1VQNP 3HXLA 2YLTA 4J56A 4QNBA 5IT9C 1DXLA 2NUEA 5CFFE 3CCVP 1L9CA 3AWIA 2XVJA 2BHVA 3ZYXA 2NVKX 3CPIG 3LZWA 4EQWA 3M13A 4H4YA 5C2TA 3FPZA 1YYKA 1JNRA 5EB4A 3UKKA 4AQYE 2V86A 2ZZ0A 5LMNE 4YSXA 3RMPA 4COPA 2YR4A 4X64E 2YG4A 3VRDB 3SYIA 1CC6A 4O5UA 1EL7A 2A89A 4DR5E 1VQKP 3CGBA 1H82A 2GEWA 3ICRA 4GRTA 1F8WA 4J34A 4A5LA 4UDPA 1EL9A 5BS2A 3ISHA 4P7DA 1VRQB 1YYWA 2VOUA 2PYXA 3H8LA 2C70A 4XXGA 4CY6A 4I59A 3I55P 2YLXA 4B65A 3DJDA 4F9BB 1E39A 1TDEA 2BRAA 2WEUA 4CRTA 3QSMA 4A99A 2XXMA 3HYBA 3NYEA 3EANA 2OA1A 3SM8A 3AE7A 3V3OA 4YY3E 3AE6A 1M74A 4BV6A 5U25A 1LQUA 3SZFA 1NHSA 3S5WA 5IWAE 3JSKA 4IA6A 3T2YA 4ZCDA 2Y6RA 2RSMA 1PJ6A 2UZZA 3IWCA 3B3RA 4DV0E 1NG3A 3SGLA 4I58A 3UOZA 2VVMA 3G6EP 3K7MX 4Z2UA 1QVFO 2BC0A 1KDGA 1GRFA 1MOKA 5KXJA 3Q6JA 4JNQA 3VRAA 1GREA 4K5SA 4U0CA 1FEAA 3DGHA 2XV6A 3OZ2A 2C65A 3ADJA 2R9ZA 1DI2A 3IWAA 3QSEA 2RS7A 2GR3A 4N9XA 4BC9A 2L2KB 1NHQA 2QCUA 4RG3A 1QU6A 2V6OA 4JYAE 4B3ME 4K0KE 2WPCA 1VQ5P 4H50A 1CF3A 4XROA 3AYLA 3IWBA 5LMUE 1GV4A 1GPEA 4A79A 4U0AA 4OOGC 4CNKA 1W4XA 4A6NA 5KMQA 4Y4NA 1JJ2O 4DV1E 1YHQP 2PENA 3CXCO 2RABA 2GR0A 2CWOA 3NIXA 3DK9A 1PN0A 1DOCA 1CC2A 4JI7E 4DNAA 1E1NA 2E1MA 4A65A 4PABA 1RSGA 3G5SA 2DIXA 3UP4A 2R4EA 3SZ0A 4DR3E 3CMEP 1S2YA 4OCGA 4A7AA 1NPXA 2TPRA 2PEJA 4OPUA 4LF7E 2FJDA 1PHHA 2LUQA 1NEKA 1PDHA 1PXAA 3JAMC 4AP3A 4IVMB 3VQRA 4IVOB 1ZP0A 2FTXB 3T1YE 1FOHA 3DJJA 3IF9A 1N8RQ 2KODA 4F9CB 3NGCX 1L9EA 2BS3A 4EM3A 5TR3A 3H0DA 5EOWA 2OALA 4NTCA 3AEDA 3ATRA 3NTEA 4F9AB 4PAAA 3GRSA 4KHPE 1O95A 1VQ6P 3AV0A 3IHMA 5HY5A 3NT6A 3VR9A 1IBKE 3T2ZA 1JNZA 5F2OA 1NAAA 5KRQA 2C7GA 3SXIA 4C3XA 3D1CA 4TM1A 4GR1A 1XMOE 1K73Q 2XFUA 4WPYA 3LJPA 1QRJA 2EQ8A 4K7ZA 4Z43A 2M8PA 4UDQA 4B69A 4DR2E 3KVEA 3CCEP 1NHRA 2B7VA 3UTHA 4JI0E 4EIQA 3K30A 4D04A 5IPYA 1B5QA 3ATQA 2QAEA 4CNJA 2R46A 1LJ1A 2PY8A 4DV2E 4Q28A 4JV5E 1CJ4A 2WP6A 1M6NA 3CNJA 1TDKA 1PJ5A 5BS1A 3KWRA 2BACA 4X8WA 1A8OA 5DCKA 1VQ9P 2IHR1 1HNZE 1GRHA 4XFYA 3DGZA 5U63A 2L92A 4H2QA 3CCSP 1CC4A 4APNA 2C67A 2YVFA 4USRA 1D7LA 4REKA 3I6DA 1ZKQA 2CVJA 4NEWA 4EMWA 4H2PA 3QVPA 4GCMA 5JCKA 3G26A 4DV6E 3AE3A 3DA1A 4OPLA 2WP5A 4DR6E 3BI4A 4H4XA 3H47A 2OTJP 2UXBE 1GESA 3NRNA 2M4IA 3H8IA 2GMJA 1YJ9P 3GWFA 4Z2RA 1K30A 2JOBA 1UHZA 2YVGA 3IWDA 2YZTA 4YTPA 3II4A 4M0IA 2Q6UA 2BXRA 2IIDA 4J2WA 4CBQA 1LQTA 4YSZA 5FS9A 1YKJA 2GRTA 3QSSA 2BC1A 3M12A 4EM4A 1IBME 4X9NA 4H2NA 2JR1A 1JEHA 2C3CA 2M8LA 1F6MA 4GR6A 3T37A 4J33A 1GERA 4EMIA 1PBFA 1KD1Q 3M1MA 3HZLA 4R8OA 4ECHA 3LLHA 3QFBA 2GQWA 3LADA 2LJHA 4H4UA 3VYYA 3KPFA 3AD7B 2BCGG 1EOQA 3G5QA 1XNRE 2V87A 1E6JP 2WDQA 2C73A 1M64A 1PBDA 1CBOA 4H4RA 1YYOA 4UDRA 1CJ3A 2JB2A 1JRYA 4EQSA 3NTDA 4GF7A 5HGOA 1K8AQ 2GH5A 3H4EA 1Q82Q 4C77A 4E0VA 3URHA 4XFXA 3GDPA 3LZXA 2RGOA 2QEXP 4DKKA 3GYJA 2JO0A 5A2QC 3GYXA 1WHNA 4NXME 3JTZA 2B9XA 3RG6C 5KOWA 1CHUA 2N3GA 3UTGA 2C3DA 3PVCA 3S61A 2O9ZA 1DOEA 3GMCA 4H4ZA 5BR8E 2YLZA 4X4JA 2E5VA 3P4SA 3I56P 4USQA 4FK1A 2VQEE 3F8RA 4FDCB 2JYGA 5U1OA 4Z2TA 3VR8A 1A43A 4B66A 3HYVA 2LUPB 3GDNA 2EQ6A 1VQLP 3LMLA 2VRMA 1P2HA 1D1DA 5JCLA 4LF9E 4RSLA 5AASA 2AQJA 4KX6A 2LTRA 3LXDA 2L6MA 3NN6X 1KC8Q 2L8TA 3P9UA 2XLUA 3AE5A 4OPCA 1M6EX 2BK4A 1LVLA 5HGNA 3CNPA 4H4QA 1CJCA 2L6EA 4DSGA 1TDOA 4J8ZA 2LMZA 4U0DA 3DS0A 3DJGX 1OJDA 2GB0A 1BWCA 4DV5E 3UKFA 2GR1A 3KU9A 3T2KA 3NK0X 4WSPA 4U8PA 1JOAA 2Q0LA 2FGGA 3H09A 4BCAA 3UOYA 1KFYA 2JOXA 4BC7A 3P05A 4AOXA 1AUMA 2BRYA 2JB1A 2OTLP 4OVIA 4TUGA 2FJAA 1Q9IA 1BKWA 3UOVA 3QFAA 5ADZA 4DUYE 1XMQE 3HYXA 3G4SP 3CD6P 4II3A 4HB9A 1RYIA 2B76A 2EWLA 3KKJA 3HYWA 2R4JA 3ADLA 4C3YA 2EFJA 1PBEA 2WHDA 1BZLA 1D5TA 4OPDA 1DNCA 3G21A 1KQSO 3G29A 1EL5A 2UUCE 3I3LA 3GD3A 1OJTA 4DR1E 3CIRA 3AEEA 2XFOA 4BK2A 1HNWE 3T14A 4BBYA 3CNDA 2VRLA 1IUQA 1GT8A 2FJEA 3UKPA 2DKIA 5JCMA 5LV9A 5CKUA 5BRTA 3V76A 1JU2A 2BS2A 1RP0A 2WU2A 3ITJA 4GDPA 1H7XA 3CCUP 3BI5A 5KNLA 4H2RA 2V5ZA 1J26A 1WXRA 3ALLA 1DOBA 4B1BA 2EQ7A 5F2NA 5EB5A 2JWOA 2V3BA 2QA1A 4B68A 1K0LA 4BK3A 3OTOE 3Q20A 2V85A 2UUBE 1N36E 4G6HA 4GAVA 2C72A 1ONFA 1GSNA 3M0OA 1L0VA 3AE4A 4EIPA 2XLTA 5IQ1A 1GEUA 4TM3A 5FLXC 4YTMA 2V8QB 1X48A 4P9SA 3RP8A 2XLRA 1PBBA 4Z25A 3G0VA 3VK6A 3P4PA 3K6QA 4GUVA 2Q0KA 2B7SA 5KVHA 3ALMA 2B9YA 2EG5A 3AD8B 3RHAA 3SX6A 4HA6A 2RGJA 2VF1A 2M7QA 2DGYA 2TMDA 3HZQA 1IUUA 3PS9A 1Q81Q 5KMSA 1S3BA 4DMIA 1OJAA 2P9XA 3NYCA 2VZ2A 2R0GA 4M52A 1VQPP 3NH3X 2E5LE 4KZSA 4M2ZA 4NZHA 4L5NC 2PHHA 4OPTA 2I0ZA 5KMRA 3AUZA 2R0CA 3RP6A 3HQ1A 3UTEA 3AE2A 2QA4P 1VQ4P 2JVAA 2YG3A 1CJ2A 3EF6A 2XCGA 3CC7P 5HGLA 4DR4E 2BABA 5HXIA 1P2EA 3BNUA 5F3WA 1DJNA 1ZK7A 1F8RA 1S2QA 2X50A 3KLJA 2LF4A 1VDCA 4C74A 2WQYA 3T0KA 2KOUA 3AB1A 2YR5A 4IV9A 2Z44A 4WYMA 2HHHE 4COCA 1O94A 3DTJA 3HPSA 3HTXA 4JI8E 4U8NA 1XNQE 3C4BA 2A87A 2FV4B 3ADAB 1PJ7A 2UXDE 3J80C 2W0HA 3MGEA 3AE8A 5BUKA 5C3JA 2LE2A 5HYMA 1HR0E 4DV3E 3C96A 3DS1A 2X8GA 2YG6A 1Y56B 3ICSA 1YITP 2R0PA 2C76A 4B3TE 2NUGA 5GRTA 4LIIA 1ZX9A 1ZOYA 5DNYA 1J5EE 2JKCA 4JDRA 2AR8A 1B37A 2YAUA 1GALA 4DV4E 4ADWA 2XFPA 3P1XA 3UP5A 3G5RA 3CGCA 2WS3A 1FL2A 2PEMA 3AE9A 1OJ9A 2C66A 2V89A 2Z45A 1UKVG 3VRBA 3CTYA 1Y0PA 1VQ7P 1VQOP 2XVEA 3NN0X 3AE1A 1H84A 1HNXE 3CPWO 3WBHA 1RC7A 5EBKA 5AE2A 2UU9E 3CN8A 5FMHA 3FG2P 3CC2P 3LB8A 1BGNA 4J57A 2OARA 1GETA 2ZM6E 1NENA 1E1MA 3IC9A 1N4VA 4DSHA 1ZY8A 5J7XA 2LTSA 3VYXA 3OW2O 4NWZA 3J81C 4LFAE 3AD9B 4U8JA 4AT2A 2M8NA 3ZDNA 3CC4P 1XDIA 1LTXR 2WBAA 1ZMBA 3F8DA 1UILA 1ZMCA 2F8BA 1E6EA 4GEQB 4I8OA 1Q1WA 3NK2X 5BVAA 4JI5E 4YKGA 1GQEA 1Q7YQ 4UP3A 5HGMA 3AEAA 1IUVA 1VG0A 4XRQA 2YLSA 4MJWA 5ER0A 2X3NA 3CPHG 3KPKA 3BI2A 3CPJG 5F2KA 4Z24A 5J60A 3O0HA 4U8IA 1GTHA 4TLXA 3F6HA 3AXBA 4YT0A 2WZOA 3F6GA 1X49A 3NLCA 1QO8A 4BK1A 3DMEA 4DUZE 2DMYA 3HPZA 1GRBA 2JK6A 3SFEA 1KSUA 2XFNA 2V88A 1XPQA 3SZCA 4JNAA 2YG5A 1L9DA 1Q86Q 2WETA 3KA7A 1RO2A 1E1KA 2BUOA 3DH9A 4OPIA 4JI2E 2XLSA 1YQ3A 4YXDA 1D4EA 2BA9A 3GMBA 1RQ0A 4B67A 1XANA 2PEOA 4U0BA 2RTXA 1VG9A 5KWFA 5L46A 1COYA 2X8HA 4TM4A 3SY4A 3CCLP 5AE1A 2R45A 3WE0A 2L2NA 1ZMDA 1NG4A 2EQ9A 3G1GA 4YSYA 2XVFA 4FK1C 4B63A 4H4WA 3NHOX 1F3PA 1PXBA 3CNTA 4DGKA 3G1IA 1K0IA 4U8OA 3FMWA 2UUAE 3ZOQB 3DK8A 1EBDA 3UCLA 5FS8A 4BJZA 5AE3A 1T4OA 1D4DA 1H7WA 1Q1RA 2H36X 2V3AA 2PEQA 1GZ6A 4JI1E 1BAJA 3T1HE 3G71P 1DJQA 4AP1A 2C4CA 2FJBA 4GKJE 1TRBA 1S72P 3C4TA 4YKFA 2UXCE 1YJWP 2YLRA 2L2MA 2WOIA 2VQ7A 1O5WA 5KVIA 3C4AA 3IHGA 4NEVA 1ZBQA 1YY5A 3CCMP 4JQ9A 3CCRP 4H4PA 3GWDA 3MSWA 4YSHA 2ACZA 2MDRA 1I94E 1VQWA 1GOSA 2VE7C 3EAOA 2F5ZA 1TDFA 1PS9A 4G73A 4XWZA 4L8NA 4LA1A 1S3EA 2WOWA 4WFTA 3JU0A 2NUFA 1AOGA 1KNPA 4B3SE 5DBJA 4JI4E 2B3TB 1NHPA 3AEGA 5HHFA 3SFDA 3BHFA 2XFQA 3ALJA 2Z46A 1VQMP 1N1PA 4H4SA 3BNMA 2ZZCA 4BS9A 4CCQA 2BYBA 1H81A 3KD9A 2XYOA 2GQFA 4K2XA 1QJDA 2K4VA 3DF6A 1PKPA 1SR9A 2J3NA 2QA2A 3FIMB 1XHCA 3DS2A 3NNEA 1PBCA 2GAGB 1FCDA 4XFZA 1KF6A 4H4TA 3E2DA 1D7YA 3R9UA 1FJGE 4YHHE 3GYIA 3H4KA 3K7TA 2WP9A 3F8PA 4IPYA 3ADGA 4DV7E 3OMLA 4U0FA 1SEZA 3LRYA 3SZWA 3DPHA 2NPXA 2YM1A 3ICTA 2KHXA 1IUWA 2Y6QA 2BK3A 2VVLG 1V59A 2EZ6A 4WYQB 1RO0A 4A9WA 4G74A 2BS4A 1HYUA 1OJCA 1Y56A 2YM2A 4X9MA 2B7RA 2LBSB 4F54A 3CGEA 5KOXA 3B6DA 3UOXA 3DJWA 2KONA 1E7PA 2DB2A 3UTFA 2C75A 4JI6E 2YQUA 4Z44A 4JY2A 3UKAA 2NA2A 3AYIA 2L3JA 4LU9A 4U8LA 3NK1X 2YWLA 3L1RA 1B4VA 4M30A 3NYFA 4U0EA 4J36A 2L33A 4YWOA 2WESA 3AEFA 1N4UA 4AOSA 2A8XA 3CGDA 5LL6R 1X31B 1ZDLA 2XLPA 3V3NA 2IVDA 4NTDA 1N34E 2MC5A 3P4RA 4GDEA 1M6IA 4X62E 2YVJA 3COXA 1H86A 2CDUA 3GRTA 1REOA 2JBVA 2ODRC 3RNMA 2YR6A 1YI2P 1IJHA 4C5OA 1EKZA 1ZBTA 2F4VE 4TLZA 2BCPA 1GTEA 4NNJA 4Z26A 2L3CA 4NXNE 3DK4A 2V83A 2OLOA 4PH1A 2M1SA 4PH0A 3UKQA 2WU5A 4K22A 1N33E 3J7Yp 3GSIA 2PEKA 1H6VA 1LV0A 5CQFA 1N4WA 4OPGA 2DSYA 3ABVA 2OLNA 3DS4A 5BULA 3E1TA 4ZN0A 1GRTA 1STUA 2APGA 4H7UA 4OX9E 1IUTA 1T4LB 1X47A 5M0ZA 1QLBA 2XDOA 2YLWA 2WPEA 4LFBE 2MC6A 2ZZBA 4FX9A 2GVCA 3OC4A 4YTNA 5JPAA 4U2LA 5I4TG 1T4NA 4CCRA 3SQPA 3BHKA 5JCIA 3J7AG 1VQ8P 2B9DA 5JCNA 2WDRA 4EQXA 1W2BO 4II2A 2RGHA 2PEIA 1H83A 4A6NB 2XVHA 3D8XA 5GSNA 2B9WA 4WX1A 4D03A 2CPNA 1O0WA 5KMPA 2DKHA 3ADIA 3PO7A 2HQMA 2H88A 2JAEA 4EMJA 4K8DA 1GXFA 2EIAA 4BMJA 2GMHA 4JI3E 1DQ3A 1YQZA 2V60A 1FKAE 4LF8E 1EL8A 1CL0A 3NTAA 1TYTA 4BJYA 2C64A 1GRAA 3L8KA 4U2SA 3DJEA 1YIJP 2VVLA 1TYPA 1K4QA 1QVGO 2CULA 2GF3A 5M10A 3B5IA 4WCTA 1M1KQ 2AAQA 2JY9A 1YZ9A 2OAMA 1YJNP 2Q7VA 3C4NA 2Z5XA 3VRLC 2E4GA 2IVEA 3DS5A 3AECA 1KSSA 4K5RA 4P78A 4CY8A 2G7HA 3GD4A 2XVIA 3NG7X 1MO9A 1Z6LA 3AEBA 1NDAA 2ONTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D4D A;  1GT8 A;  1H7W A;  2FJE A;  3UKP A;  4BUR A;  4EQR A;  3LOV A;  1Q1R A;  2DKI A;  3ATR A;  5IQ4 A;  2FBW A;  2X8C A;  4B64 A;  1IUX A;  2ZBW A;  4IA5 A;  4PAA A;  3GRS A;  2WOV A;  5FS7 A;  2V3A A;  5JCM A;  5LV9 A;  1O95 A;  5CKU A;  5BRT A;  2VQB A;  1F8S A;  3V76 A;  1JU2 A;  2BS2 A;  3IHM A;  1D4C A;  1RP0 A;  5HY5 A;  1DJQ A;  2WU2 A;  3ITJ A;  4JY3 A;  4GDP A;  4AP1 A;  1FEB A;  3NT6 A;  1H7X A;  4J31 A;  3VR9 A;  1JNZ A;  3BI5 A;  2FJB A;  1TRB A;  2GV8 A;  4H2R A;  2V5Z A;  4YKF A;  1NAA A;  5KRQ A;  2C7G A;  4C3X A;  3D1C A;  4TM1 A;  3ALL A;  1MXT A;  1DOB A;  4B1B A;  2EQ7 A;  4GR1 A;  5EB5 A;  2YLR A;  1IUS A;  3RP7 A;  2WOI A;  2BK5 A;  2QA1 A;  2V3B A;  2YG7 A;  1K0L A;  1O5W A;  2VQ7 A;  4B68 A;  3Q9T A;  4BK3 A;  2GAH B;  3CNS A;  2XFU A;  5KVI A;  1BF3 A;  2BXS A;  3C4A A;  2H89 A;  2C72 A;  1B8S A;  1ONF A;  3IHG A;  3LJP A;  4NEV A;  1YY5 A;  4Y4L A;  1GSN A;  2EQ8 A;  3M0O A;  4JQ9 A;  1L0V A;  3AE4 A;  4EIP A;  2XLT A;  4RG4 A;  5IQ1 A;  4H4P A;  4K7Z A;  4Z43 A;  4XWR A;  3GWD A;  4UDQ A;  4YSH A;  4B69 A;  2ACZ A;  4AT0 A;  1GEU A;  4O5Q A;  1GND A;  4TM3 A;  4YTM A;  3KVE A;  1VQW A;  1GOS A;  1NHR A;  3EAO A;  4P9S A;  2F5Z A;  2XLR A;  3RP8 A;  1PBB A;  3UTH A;  2X99 A;  4Z25 A;  1TDF A;  4KPR A;  1PS9 A;  3P4P A;  3K30 A;  4EIQ A;  4XWZ A;  4D04 A;  4GUV A;  5IPY A;  1B5Q A;  2Q0K A;  2B7S A;  3ATQ A;  4LA1 A;  5KVH A;  2QAE A;  3ALM A;  4CNJ A;  4JN9 A;  2B9Y A;  3P4Q A;  2R46 A;  3AD8 B;  3RED A;  1S3E A;  1LJ1 A;  2WOW A;  3RHA A;  1E1L A;  4U2T A;  1TDN A;  1CJ4 A;  3NKS A;  1KNP A;  1AOG A;  2WP6 A;  4HA6 A;  5DBJ A;  1NHP A;  3AEG A;  3CNJ A;  5HHF A;  3SFD A;  4NTE A;  1TDK A;  1PJ5 A;  2RGJ A;  3BHF A;  1BGJ A;  2XFQ A;  1FEC A;  2BAC A;  1GRG A;  1N1P A;  3ALJ A;  4H4S A;  3UKL A;  4ZCC A;  3BNM A;  3QVR A;  2TMD A;  2ZZC A;  3FBS A;  1IUU A;  3PS9 A;  2WPF A;  4U8K A;  1S3B A;  4CCQ A;  1OJA A;  2BYB A;  4LU6 A;  5FS6 A;  1PXC A;  1H81 A;  1ELI A;  2V61 A;  1GRH A;  2GQF A;  2XYO A;  3KD9 A;  2VZ2 A;  3NYC A;  2R0G A;  4M52 A;  4U8M A;  4K2X A;  1QJD A;  3NH3 X;  3DGZ A;  5U63 A;  3UKH A;  3EPT A;  4H2Q A;  1CC4 A;  4APN A;  4NZH A;  2C67 A;  2PHH A;  2YVF A;  4OPT A;  4USR A;  1D7L A;  2I0Z A;  4REK A;  2J3N A;  2R0C A;  3I6D A;  1ZKQ A;  2CVJ A;  4NEW A;  3RP6 A;  4EMW A;  3UTE A;  1ZOV A;  2QA2 A;  4H2P A;  4Y4M A;  3QVP A;  2Z5Y A;  4H4V A;  3AE2 A;  2WDV A;  4GCM A;  3FIM B;  5JCK A;  1XHC A;  3NNE A;  1PBC A;  1JRZ A;  2YG3 A;  3AE3 A;  3DA1 A;  2GR2 A;  1CJ2 A;  1FCD A;  2GAG B;  2ARD A;  3EF6 A;  4OPL A;  1JRX A;  2WP5 A;  1KF6 A;  2XCG A;  3BI4 A;  4H4T A;  4H4X A;  4TM0 A;  1D7Y A;  3R9U A;  1GES A;  2BAB A;  5HXI A;  1P2E A;  1DOD A;  3BNU A;  3NRN A;  3GYI A;  3H4K A;  2JB3 A;  3AYJ A;  3K7T A;  1DJN A;  3H8I A;  1ZK7 A;  2GMJ A;  1F8R A;  3GWF A;  4Z2R A;  2WP9 A;  1S2Q A;  2X50 A;  3F8P A;  1YQ4 A;  4ICY A;  3KLJ A;  1LPF A;  1KNR A;  2CFY A;  1K0J A;  3P1W A;  2YVG A;  1SEZ A;  3QJ4 A;  3K7Q X;  3II4 A;  4YTP A;  2Q6U A;  1VDC A;  2BXR A;  2IID A;  4J2W A;  4C74 A;  2WQY A;  2NPX A;  2YLT A;  2YM1 A;  3ICT A;  4J56 A;  4CBQ A;  1IUW A;  1LQT A;  4YSZ A;  5FS9 A;  1DXL A;  2Y6Q A;  2BK3 A;  3AB1 A;  2YR5 A;  4IV9 A;  1YKJ A;  2GRT A;  3QSS A;  2BC1 A;  2VVL G;  3M12 A;  1L9C A;  4EM4 A;  1V59 A;  4X9N A;  1O94 A;  4H2N A;  3AWI A;  1JEH A;  2C3C A;  4U8N A;  2XVJ A;  1F6M A;  3T37 A;  4J33 A;  3ZYX A;  2A87 A;  4A9W A;  2NVK X;  3CPI G;  1GER A;  3LZW A;  4EQW A;  3ADA B;  3M13 A;  1PJ7 A;  4H4Y A;  2BS4 A;  5C2T A;  1HYU A;  3FPZ A;  4EMI A;  1OJC A;  1PBF A;  1Y56 A;  2YM2 A;  2W0H A;  3HZL A;  3AE8 A;  4X9M A;  5BUK A;  1JNR A;  2B7R A;  4ECH A;  5C3J A;  5HYM A;  5EB4 A;  3UKK A;  3QFB A;  3CGE A;  2GQW A;  3LAD A;  5KOX A;  2ZZ0 A;  3C96 A;  4YSX A;  2X8G A;  3B6D A;  2YG6 A;  1Y56 B;  2YR4 A;  3ICS A;  4H4U A;  2YG4 A;  3VRD B;  3KPF A;  3UOX A;  1CC6 A;  2R0P A;  2BCG G;  3AD7 B;  1E7P A;  2C76 A;  1EL7 A;  2A89 A;  4O5U A;  3UTF A;  3CGB A;  2C75 A;  2YQU A;  3G5Q A;  1H82 A;  2GEW A;  3ICR A;  4Z44 A;  4GRT A;  4LII A;  5GRT A;  1ZX9 A;  4JY2 A;  1ZOY A;  1F8W A;  2JKC A;  3AYI A;  4J34 A;  2AR8 A;  2WDQ A;  1B37 A;  4JDR A;  4U8L A;  4UDP A;  3NK1 X;  2C73 A;  2YWL A;  2YAU A;  1B4V A;  3L1R A;  1EL9 A;  1M64 A;  1PBD A;  1GAL A;  1CBO A;  3ISH A;  4ADW A;  2XFP A;  3UP5 A;  4H4R A;  1VRQ B;  4UDR A;  3NYF A;  2VOU A;  3G5R A;  2PYX A;  3CGC A;  3H8L A;  1CJ3 A;  2WS3 A;  2C70 A;  1FL2 A;  4XXG A;  4CY6 A;  4I59 A;  2JB2 A;  1JRY A;  2YLX A;  1OJ9 A;  2C66 A;  3AE9 A;  4J36 A;  4B65 A;  4EQS A;  3NTD A;  4GF7 A;  3DJD A;  4YWO A;  1UKV G;  2WES A;  3AEF A;  1E39 A;  1TDE A;  1N4U A;  2WEU A;  3CTY A;  2GH5 A;  4CRT A;  3VRB A;  3QSM A;  1Y0P A;  4A99 A;  4C77 A;  4AOS A;  4E0V A;  2A8X A;  2XVE A;  3URH A;  3CGD A;  3GDP A;  3LZX A;  3NYE A;  3EAN A;  1X31 B;  2RGO A;  1ZDL A;  2OA1 A;  3NN0 X;  3AE1 A;  3AE7 A;  3SM8 A;  1H84 A;  3V3O A;  2XLP A;  3AE6 A;  3V3N A;  3GYJ A;  2IVD A;  4BV6 A;  5U25 A;  1LQU A;  4NTD A;  5EBK A;  4GDE A;  3P4R A;  1M6I A;  2B9X A;  5KOW A;  3CN8 A;  5FMH A;  3FG2 P;  1CHU A;  2YVJ A;  3COX A;  3LB8 A;  1BGN A;  1NHS A;  1H86 A;  2C3D A;  3PVC A;  3S5W A;  3S61 A;  2CDU A;  3GRT A;  4J57 A;  2O9Z A;  1DOE A;  3JSK A;  1GET A;  4IA6 A;  1REO A;  3GMC A;  4H4Z A;  2JBV A;  4ZCD A;  2YLZ A;  1NEN A;  3UTG A;  4X4J A;  2E5V A;  2Y6R A;  1E1M A;  3P4S A;  3RNM A;  3IC9 A;  1PJ6 A;  4USQ A;  2UZZ A;  2YR6 A;  1N4V A;  3B3R A;  1IJH A;  4FK1 A;  4C5O A;  4DSH A;  1ZY8 A;  5J7X A;  3F8R A;  4FDC B;  4TLZ A;  2BCP A;  1GTE A;  1NG3 A;  3SGL A;  4I58 A;  5U1O A;  4Z26 A;  4Z2T A;  3UOZ A;  3DK4 A;  3VR8 A;  2OLO A;  2VVM A;  3K7M X;  4Z2U A;  3UKQ A;  2WU5 A;  2BC0 A;  4K22 A;  1KDG A;  3AD9 B;  1GRF A;  4U8J A;  4AT2 A;  1MOK A;  3GSI A;  4B66 A;  5KXJ A;  1H6V A;  1LV0 A;  3GDN A;  5CQF A;  2EQ6 A;  3ZDN A;  1N4W A;  3Q6J A;  4JNQ A;  3VRA A;  4OPG A;  2VRM A;  1GRE A;  4K5S A;  3ABV A;  2OLN A;  1FEA A;  5BUL A;  3E1T A;  1P2H A;  1XDI A;  1LTX R;  2WBA A;  3DGH A;  4ZN0 A;  1GRT A;  3F8D A;  5JCL A;  3OZ2 A;  2C65 A;  4RSL A;  1ZMC A;  2AQJ A;  2APG A;  2R9Z A;  4H7U A;  3IWA A;  4KX6 A;  1E6E A;  1Q1W A;  3NK2 X;  3QSE A;  5BVA A;  1IUT A;  3LXD A;  2GR3 A;  3NN6 X;  4N9X A;  5M0Z A;  4YKG A;  1QLB A;  2XDO A;  1NHQ A;  4UP3 A;  2QCU A;  2YLW A;  2WPE A;  3AEA A;  3P9U A;  1IUV A;  1VG0 A;  2YLS A;  2XLU A;  3AE5 A;  4MJW A;  4OPC A;  4RG3 A;  5ER0 A;  2X3N A;  2BK4 A;  1LVL A;  2ZZB A;  3CPH G;  2V6O A;  4FX9 A;  2GVC A;  3CPJ G;  3BI2 A;  4Z24 A;  5J60 A;  3O0H A;  3CNP A;  4U8I A;  1GTH A;  4H4Q A;  3OC4 A;  1CJC A;  4TLX A;  2WPC A;  4DSG A;  4YTN A;  1TDO A;  4H50 A;  1CF3 A;  4U2L A;  3AXB A;  4YT0 A;  3AYL A;  3NLC A;  1QO8 A;  4CCR A;  4BK1 A;  3DJG X;  3DME A;  1OJD A;  1GV4 A;  2GB0 A;  1GPE A;  3SQP A;  4A79 A;  3BHK A;  1BWC A;  5JCI A;  4CNK A;  1W4X A;  4A6N A;  4Y4N A;  3UKF A;  2GR1 A;  3KU9 A;  1GRB A;  3NK0 X;  2JK6 A;  3SFE A;  1KSU A;  2RAB A;  2GR0 A;  5JCN A;  2WDR A;  3NIX A;  4U8P A;  3DK9 A;  1JOA A;  2Q0L A;  4EQX A;  1PN0 A;  2XFN A;  2RGH A;  1H83 A;  4A6N B;  1DOC A;  1CC2 A;  2XVH A;  1KFY A;  3D8X A;  5GSN A;  3UOY A;  2B9W A;  1XPQ A;  4WX1 A;  4D03 A;  4DNA A;  1E1N A;  2E1M A;  4JNA A;  4A65 A;  4AOX A;  2YG5 A;  1L9D A;  4PAB A;  1RSG A;  2JB1 A;  2DKH A;  4OVI A;  3PO7 A;  3G5S A;  3UP4 A;  2FJA A;  2HQM A;  1Q9I A;  2R4E A;  2WET A;  2H88 A;  2JAE A;  3KA7 A;  4K8D A;  1GXF A;  1BKW A;  1E1K A;  3QFA A;  3UOV A;  4EMJ A;  3DH9 A;  3UKA A;  1S2Y A;  4OPI A;  2GMH A;  2XLS A;  1YQ3 A;  4OCG A;  1YQZ A;  4YXD A;  4A7A A;  1NPX A;  1D4E A;  2V60 A;  2TPR A;  4OPU A;  4HB9 A;  1RYI A;  2B76 A;  2FJD A;  2BA9 A;  1EL8 A;  3GMB A;  1CL0 A;  1PHH A;  3NTA A;  1NEK A;  1TYT A;  4BJY A;  2C64 A;  1GRA A;  1PDH A;  1PXA A;  3L8K A;  4U2S A;  1XAN A;  4A5L A;  4AP3 A;  4B67 A;  3DJE A;  3KKJ A;  4IVM B;  2VVL A;  3VQR A;  4IVO B;  1TYP A;  1K4Q A;  1ZP0 A;  2R4J A;  4C3Y A;  1VG9 A;  1PBE A;  2WHD A;  5KWF A;  1BZL A;  1D5T A;  1FOH A;  4OPD A;  1DNC A;  5L46 A;  3DJJ A;  1COY A;  3IF9 A;  2CUL A;  2X8H A;  2GF3 A;  5M10 A;  1EL5 A;  3NGC X;  4TM4 A;  4WCT A;  2R45 A;  3WE0 A;  2AAQ A;  1ZMD A;  1NG4 A;  2OAM A;  2EQ9 A;  4YSY A;  2XVF A;  1L9E A;  4FK1 C;  3I3L A;  4H4W A;  2Q7V A;  4B63 A;  3C4N A;  3NHO X;  1F3P A;  2BS3 A;  2Z5X A;  3GD3 A;  1PXB A;  3CNT A;  2E4G A;  4DGK A;  4EM3 A;  2IVE A;  1OJT A;  3AEC A;  1KSS A;  5TR3 A;  4K5R A;  4CY8 A;  1K0I A;  4U8O A;  5EOW A;  3CIR A;  3FMW A;  2OAL A;  2XFO A;  3AEE A;  4BK2 A;  3GD4 A;  2XVI A;  3NG7 X;  3DK8 A;  4NTC A;  1EBD A;  3UCL A;  3AED A;  3CND A;  1MO9 A;  1Z6L A;  2VRL A;  3AEB A;  1NDA A;  5FS8 A;  4BJZ A; 
#chains in the Genus database with same CATH topology
 4X66 E;  1YPN A;  4BUR A;  2FVE A;  3FIG A;  4LF5 E;  3LOV A;  5A69 A;  5IQ4 A;  2FBW A;  2X8C A;  4B64 A;  1IUX A;  1NJI Q;  2ZBW A;  4IA5 A;  2LML A;  2RS6 A;  2WOV A;  5FS7 A;  4BHC A;  2LKI A;  1M90 Q;  2LT7 A;  2VQB A;  1F8S A;  4GR2 A;  2N3H A;  1D4C A;  4JY3 A;  2EM2 A;  1FEB A;  2ADR A;  2ELY A;  4J31 A;  2GV8 A;  2LRS A;  2LOL A;  1MXT A;  4LFC E;  1IQS A;  5A6K A;  1IUS A;  5T6J A;  3RP7 A;  2BK5 A;  2YG7 A;  3Q9T A;  2GAH B;  3CNS A;  2GZG A;  1BF3 A;  2L22 A;  2BXS A;  4TUI A;  2H89 A;  2VQF E;  1B8S A;  4Y4L A;  2EN3 A;  3T31 A;  4RG4 A;  4XWR A;  2KG9 A;  1A1K A;  2N8X A;  2EMZ A;  4AT0 A;  1GND A;  1IBL E;  4GKK E;  3CMM A;  1WHQ A;  4LF6 E;  2KGC A;  2X99 A;  4KPR A;  2I13 A;  4JN9 A;  3P4Q A;  3RED A;  1RNI A;  4M0V A;  1E1L A;  4U2T A;  1TDN A;  3NKS A;  3CCQ P;  3G28 A;  2EMA A;  4NTE A;  2JP9 A;  1BGJ A;  1FEC A;  1GRG A;  3UKL A;  4LF4 E;  4ZCC A;  3QVR A;  3FBS A;  4B3R E;  2WPF A;  4U8K A;  2JGP A;  4LU6 A;  4F6N A;  2CGQ A;  5FS6 A;  1PXC A;  4O5Q A;  2ODR D;  2V61 A;  1ELI A;  4EQR A;  4U8M A;  1Z1B A;  4LTY A;  4G9K A;  3DS3 A;  1PJT A;  3UKH A;  3EPT A;  2ONT A;  4GAP A;  1NEI A;  2XT1 A;  2YT4 A;  1ZOV A;  2VSQ A;  4Y4M A;  4G6G A;  2Z5Y A;  4H4V A;  2E72 A;  1JK1 A;  2WDV A;  2JYL A;  1JRZ A;  4DR7 E;  1K9M Q;  2GR2 A;  2ARD A;  1JRX A;  4TM0 A;  5AC4 A;  4R03 A;  1EIA A;  1DOD A;  4F6M A;  2GPI A;  2JB3 A;  3AYJ A;  3CMA P;  1N32 E;  1DNY A;  4X65 E;  2YPN A;  2RPC A;  1YQ4 A;  4ICY A;  3CCJ P;  1KNR A;  1LPF A;  2CFY A;  1K0J A;  3P1W A;  2WPT A;  3QJ4 A;  3K7Q X;  2B7T A;  2N98 A;  2EN8 A;  2YTG A;  1VQN P;  3HXL A;  2YLT A;  2LIW A;  4J56 A;  2JU1 A;  4QNB A;  5IT9 C;  1DXL A;  2NUE A;  5CFF E;  3CCV P;  1L9C A;  3AWI A;  3BID A;  2XVJ A;  1T38 A;  1L0H A;  2BHV A;  2Q8U A;  3ZYX A;  1TF3 A;  2EOX A;  2NVK X;  3CPI G;  3LZW A;  4EQW A;  3M13 A;  1SFE A;  4H4Y A;  5C2T A;  3FPZ A;  4WXC A;  1YYK A;  1NQ4 A;  1JNR A;  5EB4 A;  3UKK A;  4AQY E;  2V86 A;  2CSH A;  2GYK A;  2ZZ0 A;  5LMN E;  4YSX A;  3RMP A;  4COP A;  2YR4 A;  4X64 E;  2YG4 A;  3VRD B;  3SYI A;  1CC6 A;  4O5U A;  1EL7 A;  2A89 A;  4DR5 E;  1VQK P;  3CGB A;  2KOQ A;  2EN2 A;  1RMD A;  1H82 A;  2GEW A;  3GJN A;  3ICR A;  4GRT A;  1F8W A;  4J34 A;  4A5L A;  4UDP A;  1EL9 A;  5BS2 A;  2VRD A;  2EN1 A;  3ISH A;  4P7D A;  1VRQ B;  1YYW A;  2VOU A;  2PYX A;  3H8L A;  2C70 A;  4XXG A;  4CY6 A;  4I59 A;  3I55 P;  2YLX A;  1HQB A;  1LLM C;  4B65 A;  3DJD A;  4F9B B;  2MY5 A;  1E39 A;  1TDE A;  2BRA A;  2EMK A;  2WEU A;  4CRT A;  3QSM A;  4A99 A;  2XXM A;  2YU5 A;  3HYB A;  2EN7 A;  3EAN A;  3NYE A;  2OA1 A;  3SM8 A;  2DMI A;  3AE7 A;  3V3O A;  2KG6 A;  1MGT A;  4YY3 E;  3AE6 A;  3LMO A;  4H2X C;  5CZD B;  1IMU A;  1M74 A;  4BV6 A;  2EPM X;  5U25 A;  1LQU A;  3C6M A;  2JQ4 A;  2M9A A;  3SZF A;  1NHS A;  3S5W A;  5IWA E;  3JSK A;  4IA6 A;  2EP3 A;  3T2Y A;  4ZCD A;  2Y6R A;  2RSM A;  1PJ6 A;  4WSG A;  2UZZ A;  3IWC A;  3B3R A;  4DV0 E;  1NG3 A;  3SGL A;  4I58 A;  3UOZ A;  2VVM A;  3G6E P;  3K7M X;  4Z2U A;  3QG5 C;  5IXM B;  1QVF O;  5KP6 B;  2BC0 A;  1KDG A;  1GRF A;  2EPA A;  1MOK A;  5KXJ A;  2LPK A;  3Q6J A;  4JNQ A;  3VRA A;  1GRE A;  1B69 A;  4K5S A;  4U0C A;  5KL2 A;  1FEA A;  3DGH A;  2XV6 A;  3OZ2 A;  2C65 A;  3ADJ A;  2R9Z A;  1DI2 A;  2RQL A;  3IWA A;  3QSE A;  2RS7 A;  2GR3 A;  4N9X A;  4BC9 A;  1F80 D;  2L2K B;  1NHQ A;  2QCU A;  2GZF A;  2KGD A;  2N50 A;  4RG3 A;  1QU6 A;  5IV8 B;  2V6O A;  2EM8 A;  4JYA E;  3THN A;  4RHB B;  3BGH A;  4B3M E;  4K0K E;  2WPC A;  1VQ5 P;  4H50 A;  1CF3 A;  1AYI A;  4XRO A;  3AYL A;  1X6H A;  3IWB A;  5LMU E;  1GV4 A;  1GPE A;  4A79 A;  4U0A A;  4OOG C;  4CNK A;  1W4X A;  4A6N A;  1AF8 A;  5KMQ A;  4Y4N A;  1JJ2 O;  4R2A A;  4DV1 E;  1YHQ P;  2PEN A;  3CXC O;  1Z6M A;  2RAB A;  2GR0 A;  2EMI A;  2CWO A;  3NIX A;  3DK9 A;  1PN0 A;  1DOC A;  2YTQ A;  4ZYE A;  1CC2 A;  2K0D X;  4JI7 E;  4DNA A;  1E1N A;  2E1M A;  4A65 A;  3GKL C;  4PAB A;  1MZ8 A;  1RSG A;  3G5S A;  2DIX A;  3EQ1 A;  3UP4 A;  2R4E A;  2K94 A;  3SZ0 A;  2DLQ A;  1A1F A;  4DR3 E;  3CME P;  1S2Y A;  4OCG A;  4A7A A;  1NPX A;  2TPR A;  2PEJ A;  4OPU A;  1L4S A;  4LF7 E;  2EPP A;  2FJD A;  1HY8 A;  1PHH A;  2LUQ A;  1NEK A;  1PDH A;  1PXA A;  3JAM C;  4AP3 A;  4IVM B;  2KG8 A;  3VQR A;  2N5I A;  4IVO B;  2FQ1 A;  1BBO A;  1ZP0 A;  2FTX B;  3T1Y E;  1FOH A;  3DJJ A;  3IF9 A;  1N8R Q;  1QNT A;  2KOD A;  4F9C B;  3NGC X;  1PDA A;  5EW5 E;  3MHH C;  2YTO A;  2PNG A;  2EOZ A;  4IJD A;  1L9E A;  2VLN A;  2BS3 A;  4EM3 A;  5TR3 A;  3H0D A;  5EOW A;  2FQ0 A;  2OAL A;  4NTC A;  3AED A;  1EH7 A;  3ATR A;  2R76 A;  3NTE A;  4F9A B;  2ENA A;  3GRS A;  4PAA A;  4KHP E;  1O95 A;  1VQ6 P;  4HEI A;  3AV0 A;  3IHM A;  2EL5 A;  5HY5 A;  3NT6 A;  3VR9 A;  1IBK E;  3T2Z A;  1JNZ A;  2YTN A;  5F2O A;  1NAA A;  5KRQ A;  2EN4 A;  2C7G A;  3SXI A;  4C3X A;  3D1C A;  4TM1 A;  2AFE A;  4GR1 A;  2EHT A;  1XMO E;  1K73 Q;  2EE8 A;  2XFU A;  4WPY A;  2KOR A;  3LJP A;  5LLQ A;  1QRJ A;  2EQ8 A;  1EH8 A;  4K7Z A;  4Z43 A;  2M8P A;  4UDQ A;  4B69 A;  3EPK A;  4DR2 E;  4ZYD A;  2CNR A;  3KVE A;  3CCE P;  1NHR A;  2VLQ A;  2B7V A;  3UTH A;  4JI0 E;  4EIQ A;  3K30 A;  4D04 A;  5IPY A;  1B5Q A;  3ATQ A;  5KL7 A;  2QAE A;  4CNJ A;  2R46 A;  1LJ1 A;  2PY8 A;  4DV2 E;  4Q28 A;  4JV5 E;  2JPA A;  4O24 A;  1CJ4 A;  2WP6 A;  1M6N A;  4F37 A;  3CNJ A;  1TDK A;  1PJ5 A;  5BS1 A;  2I9I A;  2LCE A;  2BAC A;  3KWR A;  1ZAA C;  4X8W A;  1A8O A;  5DCK A;  2KOO A;  2MF4 A;  1VQ9 P;  2IHR 1;  1HNZ E;  2EPU A;  1GRH A;  4XFY A;  3DGZ A;  5U63 A;  2L92 A;  4H2Q A;  1CC4 A;  4APN A;  2C67 A;  2YVF A;  2BB8 A;  4USR A;  1D7L A;  4REK A;  1EH6 A;  3I6D A;  1ZKQ A;  2CVJ A;  4NEW A;  4EMW A;  3VHT B;  2AFD A;  4H2P A;  3QVP A;  4GCM A;  5JCK A;  3G26 A;  4DV6 E;  3AE3 A;  3DA1 A;  4OPL A;  2WP5 A;  4DR6 E;  3BI4 A;  4H4X A;  3H47 A;  2OTJ P;  2UXB E;  1GES A;  3NRN A;  2M4I A;  3H8I A;  2GMJ A;  1YJ9 P;  3GWF A;  4Z2R A;  1K30 A;  2JOB A;  2K5X A;  1UHZ A;  2YVG A;  3IWD A;  2YZT A;  4YTP A;  3II4 A;  4M0I A;  2YU8 A;  2Q6U A;  2BXR A;  2IID A;  4J2W A;  4CBQ A;  1LQT A;  4YSZ A;  5FS9 A;  1YKJ A;  3TQM A;  2GRT A;  3QSS A;  2BC1 A;  1KJK A;  3M12 A;  4EM4 A;  5A6B D;  1IBM E;  4X9N A;  4H2N A;  2EOO A;  2JR1 A;  1JEH A;  2C3C A;  2M8L A;  1F6M A;  4GR6 A;  3T37 A;  4J33 A;  2EM5 A;  1GER A;  4EMI A;  1PBF A;  1KD1 Q;  3M1M A;  3HZL A;  4R8O A;  2KWL A;  4ECH A;  3LLH A;  2R1F A;  3QFB A;  4ZYG A;  2GQW A;  3LAD A;  2LJH A;  4H4U A;  3VYY A;  3KPF A;  2EM6 A;  3AD7 B;  2BCG G;  2EOQ A;  1EOQ A;  3G5Q A;  4GZN C;  1XNR E;  3EPL A;  2V87 A;  1E6J P;  2WDQ A;  2C73 A;  2CT1 A;  1PBD A;  1M64 A;  1CBO A;  2ROQ A;  4H4R A;  1YYO A;  4UDR A;  1CJ3 A;  2JB2 A;  1JRY A;  4EQS A;  4R2D A;  3NTD A;  4GF7 A;  2EMG A;  2DRP A;  5HGO A;  1K8A Q;  2GH5 A;  3H4E A;  1Q82 Q;  2EOI A;  4C77 A;  4E0V A;  3URH A;  4XFX A;  3GDP A;  3LZX A;  2RGO A;  2QEX P;  3B4Q A;  4DKK A;  3GYJ A;  2JO0 A;  5A2Q C;  3GYX A;  1KYQ A;  2EQ3 A;  1WHN A;  4NXM E;  2B9X A;  3JTZ A;  3RG6 C;  5KOW A;  1CHU A;  2N3G A;  3UTG A;  2C3D A;  3PVC A;  3S61 A;  2K7I A;  2O9Z A;  1DOE A;  1YFH A;  3GMC A;  4H4Z A;  5BR8 E;  2YLZ A;  4X4J A;  2E5V A;  3P4S A;  2XZ1 C;  3I56 P;  4USQ A;  4FK1 A;  2VQE E;  2NAB A;  3F8R A;  4FDC B;  2JYG A;  5U1O A;  4Z2T A;  4O4K A;  3VR8 A;  2HJJ A;  1A43 A;  2EPN A;  2EMW A;  2MVU A;  2MR7 A;  2YRK A;  4WX9 A;  3KZY A;  4B66 A;  3HYV A;  2LUP B;  3GDN A;  2EQ6 A;  1VQL P;  3LML A;  2VRM A;  1P2H A;  1D1D A;  2EPR A;  5A6J A;  5JCL A;  4LF9 E;  4RSL A;  5AAS A;  2AQJ A;  4KX6 A;  2MKN A;  2LTR A;  3LXD A;  2AVA A;  2L6M A;  3NN6 X;  1KC8 Q;  2L8T A;  1T39 A;  2GZE A;  3P9U A;  3ECR A;  2XLU A;  2K0X A;  4R2P A;  3AE5 A;  4OPC A;  1M6E X;  4PXH B;  2KR5 A;  2BK4 A;  1LVL A;  5HGN A;  3CNP A;  2LL8 A;  5TSE A;  1YUJ A;  4H4Q A;  1CJC A;  1IMP A;  2L6E A;  4DSG A;  1TDO A;  4J8Z A;  4F2J C;  2YTD A;  2MDG A;  2XZ0 D;  4NZV A;  2LMZ A;  4U0D A;  3DS0 A;  3DJG X;  1OJD A;  2GB0 A;  1X6E A;  1BWC A;  4DV5 E;  3UKF A;  1AH5 A;  1ACP A;  2GR1 A;  3KU9 A;  3T2K A;  3NK0 X;  4WSP A;  4U8P A;  1JOA A;  2Q0L A;  2VLO A;  2FGG A;  3H09 A;  4BCA A;  2JYA A;  3UOY A;  1KFY A;  4H2W C;  2JOX A;  4BC7 A;  2EOE A;  3P05 A;  1GXG A;  4AOX A;  1AUM A;  1YUI A;  2BRY A;  2JB1 A;  2OTL P;  4OVI A;  4TUG A;  2KGE A;  2FJA A;  1Q9I A;  1BKW A;  3UOV A;  2YSO A;  3QFA A;  5ADZ A;  4O5G A;  4DUY E;  2ENC A;  1XMQ E;  3HYX A;  3G4S P;  3CD6 P;  4R2C A;  4II3 A;  2YTE A;  4HB9 A;  1RYI A;  2B76 A;  2FAE A;  1VKU A;  2EWL A;  3EJD A;  3KKJ A;  3HYW A;  2R4J A;  3ADL A;  4C3Y A;  2EFJ A;  1PBE A;  2WHD A;  1UJZ A;  1BZL A;  1D5T A;  4OPD A;  2AF8 A;  1DNC A;  3G21 A;  1KQS O;  3G29 A;  1EL5 A;  7CEI A;  3NY7 B;  1WJP A;  2J7J A;  2FAD A;  2WBS A;  2UUC E;  1P47 A;  3I3L A;  2FVF A;  3GD3 A;  1OJT A;  3EJE A;  4HKG A;  4DR1 E;  3CIR A;  3AEE A;  2XFO A;  4BK2 A;  1HNW E;  3T14 A;  4BBY A;  3CND A;  2VRL A;  1A1I A;  1IUQ A;  1GT8 A;  2FJE A;  3UKP A;  2DKI A;  2EPX A;  5JCM A;  5LV9 A;  5CKU A;  5BRT A;  3V76 A;  1JU2 A;  2BS2 A;  2YTI A;  1RP0 A;  4PWV B;  2WU2 A;  3ITJ A;  4GDP A;  1H7X A;  3CCU P;  5AC5 A;  3BI5 A;  3CE7 A;  4H2R A;  5KNL A;  2V5Z A;  1FR2 A;  1J26 A;  1A1L A;  1WXR A;  3ALL A;  4R0M A;  1DOB A;  2EQ7 A;  4B1B A;  2EHS A;  5F2N A;  4R2R A;  5EB5 A;  2JWO A;  2V3B A;  2QA1 A;  4B68 A;  1K0L A;  2YRH A;  4BK3 A;  3OTO E;  3Q20 A;  2V85 A;  2UUB E;  2N6Z A;  1N36 E;  2EPK X;  4G6H A;  4GAV A;  2C72 A;  1ONF A;  1DGC A;  1GSN A;  3M0O A;  1L0V A;  2EMF A;  3AE4 A;  4EIP A;  2XLT A;  5IQ1 A;  1L0I A;  1A1G A;  1GEU A;  2K92 A;  4TM3 A;  5FLX C;  4YTM A;  2V8Q B;  1X48 A;  4P9S A;  3RP8 A;  2XLR A;  1PBB A;  2EPZ A;  4CA3 A;  4Z25 A;  3G0V A;  3VK6 A;  3P4P A;  3K6Q A;  4GUV A;  2Q0K A;  2B7S A;  5KVH A;  3ALM A;  2EMC A;  2B9Y A;  2EG5 A;  3AD8 B;  3RHA A;  3SX6 A;  1ZR9 A;  4HA6 A;  2RGJ A;  4MLV A;  4NEO A;  2EQ0 A;  2VF1 A;  2M7Q A;  2DGY A;  2TMD A;  3HZQ A;  1IUU A;  3PS9 A;  1Q81 Q;  5KMS A;  1S3B A;  4DMI A;  1OJA A;  2P9X A;  3NYC A;  2JU2 A;  2VZ2 A;  2R0G A;  4M52 A;  1VQP P;  3NH3 X;  4MRT C;  2E5L E;  4KZS A;  5EJD A;  4M2Z A;  4NZH A;  1F2I G;  4L5N C;  2PHH A;  4OPT A;  2I0Z A;  5KMR A;  3AUZ A;  2R0C A;  3RP6 A;  3HQ1 A;  3UTE A;  4UHP B;  3AE2 A;  2QA4 P;  1VQ4 P;  2JVA A;  2YG3 A;  2A25 A;  1CJ2 A;  3EF6 A;  2K2Q A;  1UBD C;  2XCG A;  3CC7 P;  5HGL A;  3MHS C;  4DR4 E;  2BAB A;  5HXI A;  1P2E A;  3BNU A;  2YTJ A;  5F3W A;  5KL3 A;  1DJN A;  1ZK7 A;  1F8R A;  1S2Q A;  2X50 A;  3KLJ A;  1OR5 A;  2LF4 A;  2DNW A;  4Q35 B;  1VDC A;  3KZZ A;  2MVV A;  5KL4 A;  4C74 A;  2EPC A;  2WQY A;  3T0K A;  1TN9 A;  2KOU A;  4IV9 A;  2YR5 A;  3AB1 A;  2Z44 A;  4WYM A;  2HHH E;  4COC A;  4R2E A;  1O94 A;  3DTJ A;  3HPS A;  3HTX A;  4JI8 E;  2GZI A;  4U8N A;  1XNQ E;  3C4B A;  2EL4 A;  4QKO A;  2A87 A;  2FV4 B;  3ADA B;  1PJ7 A;  2UXD E;  3J80 C;  2W0H A;  3MGE A;  3AE8 A;  2VLP A;  5BUK A;  5C3J A;  2LE2 A;  5HYM A;  4M9V C;  1HR0 E;  4DV3 E;  1BXI A;  3C96 A;  3DS1 A;  2X8G A;  2YG6 A;  1Y56 B;  3ICS A;  1YIT P;  4KWY A;  2R0P A;  2HGH A;  1GPJ A;  2C76 A;  4B3T E;  2NUG A;  2FQ2 A;  1G2F C;  5GRT A;  4LII A;  1ZX9 A;  1ZOY A;  5DNY A;  1J5E E;  2JKC A;  4JDR A;  2AR8 A;  1B37 A;  2YAU A;  1GAL A;  4DV4 E;  4ADW A;  2XFP A;  3P1X A;  3UP5 A;  3G5R A;  3CGC A;  2LIU A;  2KOS A;  2WS3 A;  1FL2 A;  2PEM A;  3AE9 A;  1OJ9 A;  2C66 A;  2V89 A;  2EPL X;  2HC5 A;  2Z45 A;  1UKV G;  3VRB A;  3CTY A;  1Y0P A;  1VQ7 P;  1VQO P;  2XVE A;  4NHR A;  3NN0 X;  3AE1 A;  1H84 A;  1HNX E;  3CPW O;  3WBH A;  1RC7 A;  5KL6 A;  4DG9 A;  5EBK A;  5AE2 A;  2UU9 E;  2LO3 A;  3CN8 A;  5FMH A;  3FG2 P;  3CC2 P;  3LB8 A;  1BGN A;  4J57 A;  2OAR A;  1GET A;  2ZM6 E;  1NEN A;  1E1M A;  3IC9 A;  2EMY A;  1IMQ A;  1N4V A;  5KP7 B;  4DSH A;  1ZY8 A;  5J7X A;  2EOF A;  2LTS A;  3VYX A;  3OW2 O;  2PRT A;  4NWZ A;  3J81 C;  4LFA E;  3AD9 B;  4U8J A;  4AT2 A;  2M8N A;  4H2Y C;  4BPG A;  2EQ1 A;  3ZDN A;  3CC4 P;  1AAY A;  2WBU A;  1XDI A;  1LTX R;  2D9H A;  2WBA A;  1ZMB A;  3F8D A;  2ERH A;  1UIL A;  1ZMC A;  2F8B A;  2JAZ A;  1E6E A;  4GEQ B;  4I8O A;  1Q1W A;  3NK2 X;  5BVA A;  4JI5 E;  4X9J A;  4YKG A;  1UNK A;  1GQE A;  2N5H A;  1Q7Y Q;  1E0H A;  4UP3 A;  2QNW A;  5HGM A;  2EMB A;  3AEA A;  1IUV A;  1VG0 A;  4XRQ A;  2YLS A;  1X3C A;  2YTF A;  4MJW A;  5ER0 A;  2X3N A;  3CPH G;  3KPK A;  3BI2 A;  3CPJ G;  5F2K A;  4Z24 A;  5J60 A;  3O0H A;  4U8I A;  1GTH A;  2YTP A;  3THO B;  4TLX A;  3F6H A;  3EPJ A;  3AXB A;  4YT0 A;  2WZO A;  3F6G A;  1X49 A;  3NLC A;  1QO8 A;  4BK1 A;  2YRM A;  3DME A;  4ZYH A;  4DUZ E;  2DMY A;  2LJU A;  3HPZ A;  1GRB A;  2JK6 A;  3SFE A;  1KSU A;  2XFN A;  2LV2 A;  2V88 A;  1XPQ A;  3SZC A;  4JNA A;  2GLI A;  2YG5 A;  1L9D A;  1Q86 Q;  2WET A;  4BHB A;  3KA7 A;  1E1K A;  1RO2 A;  2BUO A;  3DH9 A;  4OPI A;  4JI2 E;  2XLS A;  1YQ3 A;  4YXD A;  1D4E A;  2EM3 A;  2BA9 A;  3GMB A;  1RQ0 A;  4BPF A;  4B67 A;  1XAN A;  2EOM A;  1A1H A;  2RSI A;  2PEO A;  4U0B A;  2RTX A;  1VG9 A;  5KWF A;  5L46 A;  1COY A;  2X8H A;  2ENH A;  2WCC 3;  4TM4 A;  3SY4 A;  3CCL P;  5AE1 A;  2R45 A;  3WE0 A;  1ZMD A;  2L2N A;  2EOS A;  1NG4 A;  2KOP A;  4MLQ A;  2EQ9 A;  3G1G A;  2EMH A;  4YSY A;  2XVF A;  4FK1 C;  4B63 A;  4H4W A;  3NHO X;  1F3P A;  1PXB A;  3CNT A;  1X5W A;  4DGK A;  3G1I A;  2M5R A;  1K0I A;  4U8O A;  2K93 A;  3FMW A;  1VHN A;  2UUA E;  3ZOQ B;  2JXP A;  3DK8 A;  1N3G A;  1EBD A;  3UCL A;  2GHF A;  5FS8 A;  4BJZ A;  5AE3 A;  1T4O A;  1D4D A;  2L9F A;  1H7W A;  1DV5 A;  1Q1R A;  2H36 X;  2V3A A;  2PEQ A;  1GZ6 A;  4JI1 E;  2EL6 A;  1BAJ A;  3T1H E;  3G71 P;  1DJQ A;  4AP1 A;  2C4C A;  2MKD A;  2FJB A;  4GKJ E;  1TRB A;  1S72 P;  3C4T A;  4YKF A;  2UXC E;  3GZL A;  1YJW P;  2YLR A;  2L2M A;  2YSP A;  2LTE A;  2WOI A;  1X3O A;  2VQ7 A;  1O5W A;  5KVI A;  3C4A A;  2JBG A;  1GTK A;  3IHG A;  4NEV A;  1ZBQ A;  1YY5 A;  3CCM P;  4JQ9 A;  3CCR P;  4H4P A;  3GWD A;  3MSW A;  4YSH A;  2ACZ A;  2MDR A;  1NCS A;  1I94 E;  1VQW A;  1GOS A;  2VE7 C;  3EAO A;  2F5Z A;  2N6Y A;  1TDF A;  1PS9 A;  4G73 A;  4XWZ A;  4L8N A;  4LA1 A;  2EM9 A;  1S3E A;  2EM4 A;  2WOW A;  1CEI A;  4WFT A;  3JU0 A;  2NUF A;  1AOG A;  1KNP A;  4B3S E;  5DBJ A;  4JI4 E;  2EOH A;  2B3T B;  1NHP A;  3AEG A;  5HHF A;  3SFD A;  1G2D C;  5HV8 A;  3BHF A;  2XFQ A;  2Z46 A;  1VQM P;  3ALJ A;  1N1P A;  4H4S A;  4WXD A;  3BNM A;  2ZZC A;  2JB0 A;  1PJQ A;  4BS9 A;  4CCQ A;  2BYB A;  1H81 A;  3KD9 A;  2XYO A;  2GQF A;  4K2X A;  1QJD A;  2K4V A;  3DF6 A;  2LVH A;  1PKP A;  1SR9 A;  2J3N A;  2QA2 A;  1KLP A;  2KGA A;  3BBG A;  3FIM B;  1XHC A;  3DS2 A;  3NNE A;  1PBC A;  2GAG B;  1FCD A;  4XFZ A;  1KF6 A;  4H4T A;  3E2D A;  2EM7 A;  1D7Y A;  3R9U A;  4N4R B;  2K0Y A;  4YHH E;  1FJG E;  3GYI A;  3H4K A;  3K7T A;  2WP9 A;  3F8P A;  4IPY A;  3ADG A;  4DV7 E;  3OML A;  4U0F A;  2FHS C;  1SEZ A;  3RG2 A;  3LRY A;  2YWQ A;  3SZW A;  4R2Q A;  3DPH A;  1GXH A;  2NPX A;  2YM1 A;  3ICT A;  2KHX A;  1IUW A;  1UN6 B;  2Y6Q A;  2EM0 A;  2BK3 A;  2VVL G;  1V59 A;  3U43 A;  2EZ6 A;  4WYQ B;  1RO0 A;  3M99 B;  1IQO A;  3UK3 C;  2EMX A;  2NO8 A;  4A9W A;  4G74 A;  3EJB A;  2BS4 A;  1HYU A;  1OJC A;  1Y56 A;  2YM2 A;  4X9M A;  2B7R A;  5A6B A;  2LBS B;  4F54 A;  3CGE A;  5KOX A;  3B6D A;  3UOX A;  3DJW A;  2KON A;  1E7P A;  2DB2 A;  3UTF A;  2C75 A;  4JI6 E;  2YQU A;  2KW2 A;  4Z44 A;  3C6K A;  1WRJ A;  4HTG A;  4JY2 A;  2EOY A;  3UKA A;  2NA2 A;  3AYI A;  2L3J A;  4LU9 A;  4U8L A;  2GDY A;  3NK1 X;  2YWL A;  3L1R A;  1B4V A;  4M30 A;  3NYF A;  4U0E A;  4O43 A;  4J36 A;  2MR8 A;  1X6F A;  2L33 A;  4YWO A;  2WES A;  3AEF A;  1N4U A;  2EJ4 A;  1YSA C;  4AOS A;  2A8X A;  2EN6 A;  3CGD A;  5LL6 R;  1X31 B;  1ZDL A;  2XLP A;  3V3N A;  2IVD A;  4NTD A;  1N34 E;  2MC5 A;  2L0Q A;  3P4R A;  1M6I A;  4GDE A;  2X2B A;  2CQ8 A;  4R2S A;  4X62 E;  2YVJ A;  3COX A;  2L4B A;  1H86 A;  2ELZ A;  2CDU A;  3GRT A;  1REO A;  1A1J A;  2JBV A;  1T8K A;  2ODR C;  3BF2 A;  5A6A A;  3RNM A;  2MD9 A;  2YR6 A;  1YI2 P;  1IJH A;  4C5O A;  2FVA A;  1EKZ A;  1ZBT A;  1EMV A;  1BB8 A;  4IS1 C;  2F4V E;  4TLZ A;  2BCP A;  1GTE A;  4NNJ A;  4Z26 A;  2L3C A;  4NXN E;  3DK4 A;  2V83 A;  2OLO A;  4PH1 A;  2M1S A;  4PH0 A;  3EPH A;  1PJS A;  3UKQ A;  2WU5 A;  4K22 A;  1N33 E;  4IZ6 A;  3J7Y p;  3GSI A;  2PEK A;  1MEY C;  1H6V A;  1LV0 A;  2CTD A;  5KL5 A;  5CQF A;  1N4W A;  4OPG A;  2DSY A;  3ABV A;  2OLN A;  3DS4 A;  5BUL A;  3E1T A;  4ZN0 A;  1GRT A;  4FK5 C;  1STU A;  2APG A;  4H7U A;  4OX9 E;  2EOR A;  1IUT A;  1T4L B;  1ZNV A;  1X47 A;  1TF6 A;  5M0Z A;  1QLB A;  2XDO A;  2YLW A;  2CG5 B;  2WPE A;  4LFB E;  2EOJ A;  5KP8 B;  2MC6 A;  2ZZB A;  4FX9 A;  2GVC A;  3OC4 A;  4YTN A;  5JPA A;  1JK2 A;  4U2L A;  1ZU1 A;  5I4T G;  1T4N A;  4CCR A;  3SQP A;  2DGC A;  3BHK A;  5JCI A;  3J7A G;  2EPO A;  1VQ8 P;  4BPH A;  2B9D A;  5JCN A;  2WDR A;  4EQX A;  1W2B O;  4II2 A;  2RGH A;  2PEI A;  1H83 A;  4A6N B;  2XVH A;  3D8X A;  5GSN A;  2B9W A;  2DLK A;  4WX1 A;  4D03 A;  5HVC A;  2GDW A;  2CPN A;  1O0W A;  5KMP A;  2DKH A;  3ADI A;  3PO7 A;  3L00 A;  2HQM A;  2H88 A;  2JAE A;  4EMJ A;  4K8D A;  1GXF A;  2EIA A;  4BMJ A;  2GMH A;  2WBT A;  4JI3 E;  1DQ3 A;  1YQZ A;  2V60 A;  1FKA E;  2GDX A;  4LF8 E;  1EL8 A;  1CL0 A;  3NTA A;  1TYT A;  2EML A;  2C64 A;  1GRA A;  3L8K A;  4U2S A;  4BJY A;  4RH8 A;  3DJE A;  1YIJ P;  2VVL A;  1TYP A;  1K4Q A;  1QVG O;  2CUL A;  2GF3 A;  2GZJ A;  5M10 A;  3B5I A;  4WCT A;  1M1K Q;  2AAQ A;  2JY9 A;  1YZ9 A;  2OAM A;  2BBG A;  3GZM A;  1YJN P;  2Q7V A;  3C4N A;  2Z5X A;  3VRL C;  2E4G A;  2IVE A;  3DS5 A;  3AEC A;  1KSS A;  4K5R A;  4P78 A;  4CY8 A;  2G7H A;  1BBG A;  3GD4 A;  2XVI A;  3NG7 X;  2FAC A;  1MO9 A;  1Z6L A;  3AEB A;  1NDA A;  3CCS P; 
#chains in the Genus database with same CATH homology
 4X66 E;  4BUR A;  4LF5 E;  3FIG A;  3LOV A;  5IQ4 A;  2FBW A;  2X8C A;  4B64 A;  1IUX A;  1NJI Q;  2ZBW A;  4IA5 A;  2RS6 A;  2WOV A;  5FS7 A;  1M90 Q;  2VQB A;  1F8S A;  4GR2 A;  2N3H A;  1D4C A;  4JY3 A;  1FEB A;  4J31 A;  2GV8 A;  2LRS A;  1MXT A;  4LFC E;  1IUS A;  5T6J A;  3RP7 A;  2BK5 A;  2YG7 A;  3Q9T A;  2GAH B;  3CNS A;  1BF3 A;  2BXS A;  4TUI A;  2H89 A;  2VQF E;  1B8S A;  4Y4L A;  3T31 A;  4RG4 A;  4XWR A;  4AT0 A;  1GND A;  1IBL E;  4GKK E;  3CMM A;  1WHQ A;  4LF6 E;  2X99 A;  4KPR A;  4JN9 A;  3P4Q A;  3RED A;  1RNI A;  4M0V A;  1E1L A;  4U2T A;  1TDN A;  3NKS A;  3CCQ P;  3G28 A;  4NTE A;  1BGJ A;  1FEC A;  1GRG A;  3UKL A;  4LF4 E;  4ZCC A;  3QVR A;  3FBS A;  4B3R E;  2WPF A;  4U8K A;  4LU6 A;  5FS6 A;  1PXC A;  4O5Q A;  2ODR D;  2V61 A;  1ELI A;  4EQR A;  4U8M A;  4LTY A;  4G9K A;  3DS3 A;  3UKH A;  3EPT A;  4GAP A;  2XT1 A;  2YT4 A;  1ZOV A;  4Y4M A;  4G6G A;  2Z5Y A;  4H4V A;  2WDV A;  2JYL A;  1JRZ A;  4DR7 E;  1K9M Q;  2GR2 A;  2ARD A;  1JRX A;  4TM0 A;  4R03 A;  1EIA A;  1DOD A;  2JB3 A;  3AYJ A;  3CMA P;  1N32 E;  4X65 E;  1YQ4 A;  4ICY A;  3CCJ P;  1KNR A;  1LPF A;  2CFY A;  1K0J A;  3P1W A;  3QJ4 A;  3K7Q X;  2B7T A;  1VQN P;  3HXL A;  2YLT A;  4J56 A;  4QNB A;  5IT9 C;  1DXL A;  2NUE A;  5CFF E;  3CCV P;  1L9C A;  3AWI A;  2XVJ A;  2BHV A;  3ZYX A;  2NVK X;  3CPI G;  3LZW A;  4EQW A;  3M13 A;  4H4Y A;  5C2T A;  3FPZ A;  1YYK A;  1JNR A;  5EB4 A;  3UKK A;  4AQY E;  2V86 A;  2ZZ0 A;  5LMN E;  4YSX A;  3RMP A;  4COP A;  2YR4 A;  4X64 E;  2YG4 A;  3VRD B;  3SYI A;  1CC6 A;  4O5U A;  1EL7 A;  2A89 A;  4DR5 E;  1VQK P;  3CGB A;  1H82 A;  2GEW A;  3ICR A;  4GRT A;  1F8W A;  4J34 A;  4A5L A;  4UDP A;  1EL9 A;  5BS2 A;  3ISH A;  4P7D A;  1VRQ B;  1YYW A;  2VOU A;  2PYX A;  3H8L A;  2C70 A;  4XXG A;  4CY6 A;  4I59 A;  3I55 P;  2YLX A;  4B65 A;  3DJD A;  4F9B B;  1E39 A;  1TDE A;  2BRA A;  2WEU A;  4CRT A;  3QSM A;  4A99 A;  2XXM A;  3HYB A;  3NYE A;  3EAN A;  2OA1 A;  3SM8 A;  3AE7 A;  3V3O A;  4YY3 E;  3AE6 A;  1M74 A;  4BV6 A;  5U25 A;  1LQU A;  3SZF A;  1NHS A;  3S5W A;  5IWA E;  3JSK A;  4IA6 A;  3T2Y A;  4ZCD A;  2Y6R A;  2RSM A;  1PJ6 A;  2UZZ A;  3IWC A;  3B3R A;  4DV0 E;  1NG3 A;  3SGL A;  4I58 A;  3UOZ A;  2VVM A;  3G6E P;  3K7M X;  4Z2U A;  1QVF O;  2BC0 A;  1KDG A;  1GRF A;  1MOK A;  5KXJ A;  3Q6J A;  4JNQ A;  3VRA A;  1GRE A;  4K5S A;  4U0C A;  1FEA A;  3DGH A;  2XV6 A;  3OZ2 A;  2C65 A;  3ADJ A;  2R9Z A;  1DI2 A;  3IWA A;  3QSE A;  2RS7 A;  2GR3 A;  4N9X A;  4BC9 A;  2L2K B;  1NHQ A;  2QCU A;  4RG3 A;  1QU6 A;  2V6O A;  4JYA E;  4B3M E;  4K0K E;  2WPC A;  1VQ5 P;  4H50 A;  1CF3 A;  4XRO A;  3AYL A;  3IWB A;  5LMU E;  1GV4 A;  1GPE A;  4A79 A;  4U0A A;  4OOG C;  4CNK A;  1W4X A;  4A6N A;  5KMQ A;  4Y4N A;  1JJ2 O;  4DV1 E;  1YHQ P;  2PEN A;  3CXC O;  2RAB A;  2GR0 A;  2CWO A;  3NIX A;  3DK9 A;  1PN0 A;  1DOC A;  1CC2 A;  4JI7 E;  4DNA A;  1E1N A;  2E1M A;  4A65 A;  4PAB A;  1RSG A;  3G5S A;  2DIX A;  3UP4 A;  2R4E A;  3SZ0 A;  4DR3 E;  3CME P;  1S2Y A;  4OCG A;  4A7A A;  1NPX A;  2TPR A;  2PEJ A;  4OPU A;  4LF7 E;  2FJD A;  1PHH A;  2LUQ A;  1NEK A;  1PDH A;  1PXA A;  3JAM C;  4AP3 A;  4IVM B;  3VQR A;  4IVO B;  1ZP0 A;  2FTX B;  3T1Y E;  1FOH A;  3DJJ A;  3IF9 A;  1N8R Q;  2KOD A;  4F9C B;  3NGC X;  1L9E A;  2BS3 A;  4EM3 A;  5TR3 A;  3H0D A;  5EOW A;  2OAL A;  4NTC A;  3AED A;  3ATR A;  3NTE A;  4F9A B;  4PAA A;  3GRS A;  4KHP E;  1O95 A;  1VQ6 P;  3AV0 A;  3IHM A;  5HY5 A;  3NT6 A;  3VR9 A;  1IBK E;  3T2Z A;  1JNZ A;  5F2O A;  1NAA A;  5KRQ A;  2C7G A;  3SXI A;  4C3X A;  3D1C A;  4TM1 A;  4GR1 A;  1XMO E;  1K73 Q;  2XFU A;  4WPY A;  3LJP A;  1QRJ A;  2EQ8 A;  4K7Z A;  4Z43 A;  2M8P A;  4UDQ A;  4B69 A;  4DR2 E;  3KVE A;  3CCE P;  1NHR A;  2B7V A;  3UTH A;  4JI0 E;  4EIQ A;  3K30 A;  4D04 A;  5IPY A;  1B5Q A;  3ATQ A;  2QAE A;  4CNJ A;  2R46 A;  1LJ1 A;  2PY8 A;  4DV2 E;  4Q28 A;  4JV5 E;  1CJ4 A;  2WP6 A;  1M6N A;  3CNJ A;  1TDK A;  1PJ5 A;  5BS1 A;  3KWR A;  2BAC A;  4X8W A;  1A8O A;  5DCK A;  1VQ9 P;  2IHR 1;  1HNZ E;  1GRH A;  4XFY A;  3DGZ A;  5U63 A;  2L92 A;  4H2Q A;  3CCS P;  1CC4 A;  4APN A;  2C67 A;  2YVF A;  4USR A;  1D7L A;  4REK A;  3I6D A;  1ZKQ A;  2CVJ A;  4NEW A;  4EMW A;  4H2P A;  3QVP A;  4GCM A;  5JCK A;  3G26 A;  4DV6 E;  3AE3 A;  3DA1 A;  4OPL A;  2WP5 A;  4DR6 E;  3BI4 A;  4H4X A;  3H47 A;  2OTJ P;  2UXB E;  1GES A;  3NRN A;  2M4I A;  3H8I A;  2GMJ A;  1YJ9 P;  3GWF A;  4Z2R A;  1K30 A;  2JOB A;  1UHZ A;  2YVG A;  3IWD A;  2YZT A;  4YTP A;  3II4 A;  4M0I A;  2Q6U A;  2BXR A;  2IID A;  4J2W A;  4CBQ A;  1LQT A;  4YSZ A;  5FS9 A;  1YKJ A;  2GRT A;  3QSS A;  2BC1 A;  3M12 A;  4EM4 A;  1IBM E;  4X9N A;  4H2N A;  2JR1 A;  1JEH A;  2C3C A;  2M8L A;  1F6M A;  4GR6 A;  3T37 A;  4J33 A;  1GER A;  4EMI A;  1PBF A;  1KD1 Q;  3M1M A;  3HZL A;  4R8O A;  4ECH A;  3LLH A;  3QFB A;  2GQW A;  3LAD A;  2LJH A;  4H4U A;  3VYY A;  3KPF A;  3AD7 B;  2BCG G;  1EOQ A;  3G5Q A;  1XNR E;  2V87 A;  1E6J P;  2WDQ A;  2C73 A;  1M64 A;  1PBD A;  1CBO A;  4H4R A;  1YYO A;  4UDR A;  1CJ3 A;  2JB2 A;  1JRY A;  4EQS A;  3NTD A;  4GF7 A;  5HGO A;  1K8A Q;  2GH5 A;  3H4E A;  1Q82 Q;  4C77 A;  4E0V A;  3URH A;  4XFX A;  3GDP A;  3LZX A;  2RGO A;  2QEX P;  4DKK A;  3GYJ A;  2JO0 A;  5A2Q C;  3GYX A;  1WHN A;  4NXM E;  3JTZ A;  2B9X A;  3RG6 C;  5KOW A;  1CHU A;  2N3G A;  3UTG A;  2C3D A;  3PVC A;  3S61 A;  2O9Z A;  1DOE A;  3GMC A;  4H4Z A;  5BR8 E;  2YLZ A;  4X4J A;  2E5V A;  3P4S A;  3I56 P;  4USQ A;  4FK1 A;  2VQE E;  3F8R A;  4FDC B;  2JYG A;  5U1O A;  4Z2T A;  3VR8 A;  1A43 A;  4B66 A;  3HYV A;  2LUP B;  3GDN A;  2EQ6 A;  1VQL P;  3LML A;  2VRM A;  1P2H A;  1D1D A;  5JCL A;  4LF9 E;  4RSL A;  5AAS A;  2AQJ A;  4KX6 A;  2LTR A;  3LXD A;  2L6M A;  3NN6 X;  1KC8 Q;  2L8T A;  3P9U A;  2XLU A;  3AE5 A;  4OPC A;  1M6E X;  2BK4 A;  1LVL A;  5HGN A;  3CNP A;  4H4Q A;  1CJC A;  2L6E A;  4DSG A;  1TDO A;  4J8Z A;  2LMZ A;  4U0D A;  3DS0 A;  3DJG X;  1OJD A;  2GB0 A;  1BWC A;  4DV5 E;  3UKF A;  2GR1 A;  3KU9 A;  3T2K A;  3NK0 X;  4WSP A;  4U8P A;  1JOA A;  2Q0L A;  2FGG A;  3H09 A;  4BCA A;  3UOY A;  1KFY A;  2JOX A;  4BC7 A;  3P05 A;  4AOX A;  1AUM A;  2BRY A;  2JB1 A;  2OTL P;  4OVI A;  4TUG A;  2FJA A;  1Q9I A;  1BKW A;  3UOV A;  3QFA A;  5ADZ A;  4DUY E;  1XMQ E;  3HYX A;  3G4S P;  3CD6 P;  4II3 A;  4HB9 A;  1RYI A;  2B76 A;  2EWL A;  3KKJ A;  3HYW A;  2R4J A;  3ADL A;  4C3Y A;  2EFJ A;  1PBE A;  2WHD A;  1BZL A;  1D5T A;  4OPD A;  1DNC A;  3G21 A;  1KQS O;  3G29 A;  1EL5 A;  2UUC E;  3I3L A;  3GD3 A;  1OJT A;  4DR1 E;  3CIR A;  3AEE A;  2XFO A;  4BK2 A;  1HNW E;  3T14 A;  4BBY A;  3CND A;  2VRL A;  1IUQ A;  1GT8 A;  2FJE A;  3UKP A;  2DKI A;  5JCM A;  5LV9 A;  5CKU A;  5BRT A;  3V76 A;  1JU2 A;  2BS2 A;  1RP0 A;  2WU2 A;  3ITJ A;  4GDP A;  1H7X A;  3CCU P;  3BI5 A;  5KNL A;  4H2R A;  2V5Z A;  1J26 A;  1WXR A;  3ALL A;  1DOB A;  4B1B A;  2EQ7 A;  5F2N A;  5EB5 A;  2JWO A;  2V3B A;  2QA1 A;  4B68 A;  1K0L A;  4BK3 A;  3OTO E;  3Q20 A;  2V85 A;  2UUB E;  1N36 E;  4G6H A;  4GAV A;  2C72 A;  1ONF A;  1GSN A;  3M0O A;  1L0V A;  3AE4 A;  4EIP A;  2XLT A;  5IQ1 A;  1GEU A;  4TM3 A;  5FLX C;  4YTM A;  2V8Q B;  1X48 A;  4P9S A;  3RP8 A;  2XLR A;  1PBB A;  4Z25 A;  3G0V A;  3VK6 A;  3P4P A;  3K6Q A;  4GUV A;  2Q0K A;  2B7S A;  5KVH A;  3ALM A;  2B9Y A;  2EG5 A;  3AD8 B;  3RHA A;  3SX6 A;  4HA6 A;  2RGJ A;  2VF1 A;  2M7Q A;  2DGY A;  2TMD A;  3HZQ A;  1IUU A;  3PS9 A;  1Q81 Q;  5KMS A;  1S3B A;  4DMI A;  1OJA A;  2P9X A;  3NYC A;  2VZ2 A;  2R0G A;  4M52 A;  1VQP P;  3NH3 X;  2E5L E;  4KZS A;  4M2Z A;  4NZH A;  4L5N C;  2PHH A;  4OPT A;  2I0Z A;  5KMR A;  3AUZ A;  2R0C A;  3RP6 A;  3HQ1 A;  3UTE A;  3AE2 A;  2QA4 P;  1VQ4 P;  2JVA A;  2YG3 A;  1CJ2 A;  3EF6 A;  2XCG A;  3CC7 P;  5HGL A;  4DR4 E;  2BAB A;  5HXI A;  1P2E A;  3BNU A;  5F3W A;  1DJN A;  1ZK7 A;  1F8R A;  1S2Q A;  2X50 A;  3KLJ A;  2LF4 A;  1VDC A;  4C74 A;  2WQY A;  3T0K A;  2KOU A;  3AB1 A;  2YR5 A;  4IV9 A;  2Z44 A;  4WYM A;  2HHH E;  4COC A;  1O94 A;  3DTJ A;  3HPS A;  3HTX A;  4JI8 E;  4U8N A;  1XNQ E;  3C4B A;  2A87 A;  2FV4 B;  3ADA B;  1PJ7 A;  2UXD E;  3J80 C;  2W0H A;  3MGE A;  3AE8 A;  5BUK A;  5C3J A;  2LE2 A;  5HYM A;  1HR0 E;  4DV3 E;  3C96 A;  3DS1 A;  2X8G A;  2YG6 A;  1Y56 B;  3ICS A;  1YIT P;  2R0P A;  2C76 A;  4B3T E;  2NUG A;  5GRT A;  4LII A;  1ZX9 A;  1ZOY A;  5DNY A;  1J5E E;  2JKC A;  4JDR A;  2AR8 A;  1B37 A;  2YAU A;  1GAL A;  4DV4 E;  4ADW A;  2XFP A;  3P1X A;  3UP5 A;  3G5R A;  3CGC A;  2WS3 A;  1FL2 A;  2PEM A;  3AE9 A;  1OJ9 A;  2C66 A;  2V89 A;  2Z45 A;  1UKV G;  3VRB A;  3CTY A;  1Y0P A;  1VQ7 P;  1VQO P;  2XVE A;  3NN0 X;  3AE1 A;  1H84 A;  1HNX E;  3CPW O;  3WBH A;  1RC7 A;  5EBK A;  5AE2 A;  2UU9 E;  3CN8 A;  5FMH A;  3FG2 P;  3CC2 P;  3LB8 A;  1BGN A;  4J57 A;  2OAR A;  1GET A;  2ZM6 E;  1NEN A;  1E1M A;  3IC9 A;  1N4V A;  4DSH A;  1ZY8 A;  5J7X A;  2LTS A;  3VYX A;  3OW2 O;  4NWZ A;  3J81 C;  4LFA E;  3AD9 B;  4U8J A;  4AT2 A;  2M8N A;  3ZDN A;  3CC4 P;  1XDI A;  1LTX R;  2WBA A;  1ZMB A;  3F8D A;  1UIL A;  1ZMC A;  2F8B A;  1E6E A;  4GEQ B;  4I8O A;  1Q1W A;  3NK2 X;  5BVA A;  4JI5 E;  4YKG A;  1GQE A;  1Q7Y Q;  4UP3 A;  5HGM A;  3AEA A;  1IUV A;  1VG0 A;  4XRQ A;  2YLS A;  4MJW A;  5ER0 A;  2X3N A;  3CPH G;  3KPK A;  3BI2 A;  3CPJ G;  5F2K A;  4Z24 A;  5J60 A;  3O0H A;  4U8I A;  1GTH A;  4TLX A;  3F6H A;  3AXB A;  4YT0 A;  2WZO A;  3F6G A;  1X49 A;  3NLC A;  1QO8 A;  4BK1 A;  3DME A;  4DUZ E;  2DMY A;  3HPZ A;  1GRB A;  2JK6 A;  3SFE A;  1KSU A;  2XFN A;  2V88 A;  1XPQ A;  3SZC A;  4JNA A;  2YG5 A;  1L9D A;  1Q86 Q;  2WET A;  3KA7 A;  1RO2 A;  1E1K A;  2BUO A;  3DH9 A;  4OPI A;  4JI2 E;  2XLS A;  1YQ3 A;  4YXD A;  1D4E A;  2BA9 A;  3GMB A;  1RQ0 A;  4B67 A;  1XAN A;  2PEO A;  4U0B A;  2RTX A;  1VG9 A;  5KWF A;  5L46 A;  1COY A;  2X8H A;  4TM4 A;  3SY4 A;  3CCL P;  5AE1 A;  2R45 A;  3WE0 A;  2L2N A;  1ZMD A;  1NG4 A;  2EQ9 A;  3G1G A;  4YSY A;  2XVF A;  4FK1 C;  4B63 A;  4H4W A;  3NHO X;  1F3P A;  1PXB A;  3CNT A;  4DGK A;  3G1I A;  1K0I A;  4U8O A;  3FMW A;  2UUA E;  3ZOQ B;  3DK8 A;  1EBD A;  3UCL A;  5FS8 A;  4BJZ A;  5AE3 A;  1T4O A;  1D4D A;  1H7W A;  1Q1R A;  2H36 X;  2V3A A;  2PEQ A;  1GZ6 A;  4JI1 E;  1BAJ A;  3T1H E;  3G71 P;  1DJQ A;  4AP1 A;  2C4C A;  2FJB A;  4GKJ E;  1TRB A;  1S72 P;  3C4T A;  4YKF A;  2UXC E;  1YJW P;  2YLR A;  2L2M A;  2WOI A;  2VQ7 A;  1O5W A;  5KVI A;  3C4A A;  3IHG A;  4NEV A;  1ZBQ A;  1YY5 A;  3CCM P;  4JQ9 A;  3CCR P;  4H4P A;  3GWD A;  3MSW A;  4YSH A;  2ACZ A;  2MDR A;  1I94 E;  1VQW A;  1GOS A;  2VE7 C;  3EAO A;  2F5Z A;  1TDF A;  1PS9 A;  4G73 A;  4XWZ A;  4L8N A;  4LA1 A;  1S3E A;  2WOW A;  4WFT A;  3JU0 A;  2NUF A;  1AOG A;  1KNP A;  4B3S E;  5DBJ A;  4JI4 E;  2B3T B;  1NHP A;  3AEG A;  5HHF A;  3SFD A;  3BHF A;  2XFQ A;  3ALJ A;  2Z46 A;  1VQM P;  1N1P A;  4H4S A;  3BNM A;  2ZZC A;  4BS9 A;  4CCQ A;  2BYB A;  1H81 A;  3KD9 A;  2XYO A;  2GQF A;  4K2X A;  1QJD A;  2K4V A;  3DF6 A;  1PKP A;  1SR9 A;  2J3N A;  2QA2 A;  3FIM B;  1XHC A;  3DS2 A;  3NNE A;  1PBC A;  2GAG B;  1FCD A;  4XFZ A;  1KF6 A;  4H4T A;  3E2D A;  1D7Y A;  3R9U A;  1FJG E;  4YHH E;  3GYI A;  3H4K A;  3K7T A;  2WP9 A;  3F8P A;  4IPY A;  3ADG A;  4DV7 E;  3OML A;  4U0F A;  1SEZ A;  3LRY A;  3SZW A;  3DPH A;  2NPX A;  2YM1 A;  3ICT A;  2KHX A;  1IUW A;  2Y6Q A;  2BK3 A;  2VVL G;  1V59 A;  2EZ6 A;  4WYQ B;  1RO0 A;  4A9W A;  4G74 A;  2BS4 A;  1HYU A;  1OJC A;  1Y56 A;  2YM2 A;  4X9M A;  2B7R A;  2LBS B;  4F54 A;  3CGE A;  5KOX A;  3B6D A;  3UOX A;  3DJW A;  2KON A;  1E7P A;  2DB2 A;  3UTF A;  2C75 A;  4JI6 E;  2YQU A;  4Z44 A;  4JY2 A;  3UKA A;  2NA2 A;  3AYI A;  2L3J A;  4LU9 A;  4U8L A;  3NK1 X;  2YWL A;  3L1R A;  1B4V A;  4M30 A;  3NYF A;  4U0E A;  4J36 A;  2L33 A;  4YWO A;  2WES A;  3AEF A;  1N4U A;  4AOS A;  2A8X A;  3CGD A;  5LL6 R;  1X31 B;  1ZDL A;  2XLP A;  3V3N A;  2IVD A;  4NTD A;  1N34 E;  2MC5 A;  3P4R A;  4GDE A;  1M6I A;  4X62 E;  2YVJ A;  3COX A;  1H86 A;  2CDU A;  3GRT A;  1REO A;  2JBV A;  2ODR C;  3RNM A;  2YR6 A;  1YI2 P;  1IJH A;  4C5O A;  1EKZ A;  1ZBT A;  2F4V E;  4TLZ A;  2BCP A;  1GTE A;  4NNJ A;  4Z26 A;  2L3C A;  4NXN E;  3DK4 A;  2V83 A;  2OLO A;  4PH1 A;  2M1S A;  4PH0 A;  3UKQ A;  2WU5 A;  4K22 A;  1N33 E;  3J7Y p;  3GSI A;  2PEK A;  1H6V A;  1LV0 A;  5CQF A;  1N4W A;  4OPG A;  2DSY A;  3ABV A;  2OLN A;  3DS4 A;  5BUL A;  3E1T A;  4ZN0 A;  1GRT A;  1STU A;  2APG A;  4H7U A;  4OX9 E;  1IUT A;  1T4L B;  1X47 A;  5M0Z A;  1QLB A;  2XDO A;  2YLW A;  2WPE A;  4LFB E;  2MC6 A;  2ZZB A;  4FX9 A;  2GVC A;  3OC4 A;  4YTN A;  5JPA A;  4U2L A;  5I4T G;  1T4N A;  4CCR A;  3SQP A;  3BHK A;  5JCI A;  3J7A G;  1VQ8 P;  2B9D A;  5JCN A;  2WDR A;  4EQX A;  1W2B O;  4II2 A;  2RGH A;  2PEI A;  1H83 A;  4A6N B;  2XVH A;  3D8X A;  5GSN A;  2B9W A;  4WX1 A;  4D03 A;  2CPN A;  1O0W A;  5KMP A;  2DKH A;  3ADI A;  3PO7 A;  2HQM A;  2H88 A;  2JAE A;  4EMJ A;  4K8D A;  1GXF A;  2EIA A;  4BMJ A;  2GMH A;  4JI3 E;  1DQ3 A;  1YQZ A;  2V60 A;  1FKA E;  4LF8 E;  1EL8 A;  1CL0 A;  3NTA A;  1TYT A;  4BJY A;  2C64 A;  1GRA A;  3L8K A;  4U2S A;  3DJE A;  1YIJ P;  2VVL A;  1TYP A;  1K4Q A;  1QVG O;  2CUL A;  2GF3 A;  5M10 A;  3B5I A;  4WCT A;  1M1K Q;  2AAQ A;  2JY9 A;  1YZ9 A;  2OAM A;  1YJN P;  2Q7V A;  3C4N A;  2Z5X A;  3VRL C;  2E4G A;  2IVE A;  3DS5 A;  3AEC A;  1KSS A;  4K5R A;  4P78 A;  4CY8 A;  2G7H A;  3GD4 A;  2XVI A;  3NG7 X;  1MO9 A;  1Z6L A;  3AEB A;  1NDA A;  2ONT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...