2E1MA

Crystal structure of l-glutamate oxidase from streptomyces sp. x-119-6
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
369
structure length
356
Chain Sequence
MTYEQLARELLLVGPAPTNEDLKLRYLDVLIDNGLNPPGPPKRILIVGAGIAGLVAGDLLTRAGHDVTILEANANRVGGRIKTFHAKKGEPSPFADPAQYAEAGAMRLPSFHPLTLALIDKLGLKRRLFFNVDIDPQTGNQDAPVPPVFYKSFKDGKTWTNGAPSPEFKEPDKRNHTWIRTNREQVRRAQYATDPSSINEGFHLTGCETRLTVSDMVNQALEPVRDYYSVKQDDGTRVNKPFKEWLAGWADVVRDFDGYSMGRFLREYAEFSDEAVEAIGTIENMTSRLHLAFFHSFLGRSDIDPRATYWEIEGGSRMLPETLAKDLRDQIVMGQRMVRLEYYDPGPAVAIQTVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of l-glutamate oxidase from Streptomyces sp. X-119-6
pubmed doi rcsb
source organism Streptomyces sp.
molecule tags Oxidoreductase
molecule keywords L-glutamate oxidase
total genus 88
structure length 356
sequence length 369
ec nomenclature ec 1.4.3.11: L-glutamate oxidase.
pdb deposition date 2006-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 2e1mA05
1.10.1200.190 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2e1mA03
3.30.160.490 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2e1mA04
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2e1mA02
4A7AA 3F8RA 2AQJA 3CN8A 3DJJA 1PBBA 4U8PA 3CPIG 4X4JA 4BK3A 4FK1A 3DK8A 3CNSA 5IPYA 3IHMA 1O5WA 5C3JA 5JCLA 2C76A 4Z2TA 5KWFA 2FJBA 3GWFA 4AT0A 1Z6LA 2IIDA 1EL9A 3AEAA 2XFUA 4J57A 2XCGA 1CJ4A 1DOBA 1Q1WA 4JY2A 5GSNA 2ZBWA 4JN9A 1D7LA 3RP8A 2JK6A 4CNKA 4H4WA 1E39A 3L1RA 2JB1A 3ZDNA 4J31A 5M10A 2Q6UA 3CGEA 2UZZA 2C3CA 2EQ8A 4NEWA 4K2XA 1MO9A 1GRBA 2TPRA 3ATRA 2VVMA 4HA6A 3IWAA 1JRXA 2C7GA 5BUKA 1O94A 2CFYA 1BGJA 1F3PA 1XHCA 2Y6QA 5BRTA 1O95A 4EQWA 4H2RA 1S2QA 1Q1RA 1HYUA 4H7UA 5U1OA 4YSZA 3NKSA 5LV9A 4Y4NA 4K5RA 1VDCA 1GSNA 2C70A 2NVKX 2IVEA 3NTDA 4AT2A 4J56A 1D5TA 3GMCA 2YLXA 2YR4A 4TM1A 2BA9A 2VOUA 1MXTA 2GEWA 2V3AA 3VRDB 4JNQA 4JNAA 4UDQA 4YTMA 3VR9A 3AB1A 1DNCA 1L9DA 1DJNA 1PBDA 3NG7X 2WU2A 1E1NA 3DA1A 2WPFA 3UTGA 2OLOA 3BHFA 3LZWA 3ISHA 4C3YA 2R9ZA 3UKQA 4FX9A 1GESA 3GYJA 4H4ZA 1CBOA 2JAEA 1DOCA 3UCLA 3NYCA 4JQ9A 2XFOA 3S61A 4H2QA 2YVGA 4HB9A 5CQFA 3I3LA 4LIIA 1F8WA 2BACA 2QCUA 3UKFA 3AXBA 3Q6JA 1F6MA 4EMJA 1K4QA 1CHUA 5FS8A 2YG7A 4RG3A 2GH5A 3FIMB 1JNRA 3V3NA 1JNZA 2GR1A 3AECA 2BXRA 1GTEA 4J34A 4BK1A 5L46A 4P9SA 1IJHA 2C65A 1GV4A 4TLZA 5IQ1A 2YLSA 2IVDA 4MJWA 1NENA 2B9YA 3G5RA 3FBSA 1M6IA 1YQZA 2ZZ0A 1FCDA 3GDPA 2WESA 1TDFA 1VQWA 3DJDA 5M0ZA 2WHDA 1PBEA 2XLPA 3AE5A 3RNMA 4CNJA 3EANA 3ATQA 2V5ZA 2Z5XA 4ICYA 2BK5A 4X9MA 2F5ZA 1ZMCA 1TDNA 2WP9A 1B4VA 4USQA 4YKFA 4D04A 2W0HA 1BF3A 3AE2A 3NRNA 4H4TA 5U25A 4EM4A 1GRHA 1ONFA 2WOIA 4A5LA 2E5VA 3P4SA 1DOEA 1E1MA 3AE1A 1KF6A 1LV0A 2XLRA 4K22A 5JCKA 1OJTA 2GB0A 4B66A 4Z43A 3P1WA 1NAAA 1IUVA 2B7SA 5J60A 2GR3A 4I58A 2BC1A 2BS2A 4A99A 2RGHA 2XVHA 2YR6A 3AE9A 4BV6A 1S3BA 4AP3A 5HY5A 1XANA 2XVFA 4C77A 1CJCA 4H4YA 3VRBA 2PYXA 4OPIA 3NK2X 5BVAA 4YT0A 4WCTA 2X99A 1JEHA 4CCRA 1GTHA 3H8LA 3VR8A 2B9WA 3PO7A 1IUTA 4Z26A 1VRQB 2XLTA 3ALJA 1GOSA 1B5QA 1FEBA 2BCPA 4B69A 1CJ2A 1ZP0A 4EMWA 3KKJA 2JBVA 4CRTA 2J3NA 2JB2A 3L8KA 4NTCA 2Z5YA 3C4NA 1KFYA 4LA1A 1GPEA 2Q7VA 3DGZA 2GRTA 3IC9A 4OCGA 3UTEA 2BYBA 3UOXA 4Z44A 3UKLA 4TM0A 4H50A 4IA6A 5KXJA 3UKAA 2GAGB 3LOVA 5EB5A 1JU2A 1W4XA 2I0ZA 4NZHA 2AAQA 1L0VA 3AD7B 3ABVA 3FG2P 3URHA 1OJAA 3Q9TA 1NEKA 3RP6A 2XLSA 1Y56A 4GUVA 1IUWA 1KSUA 3IF9A 2PHHA 3M13A 1GRAA 2WEUA 3NT6A 3NNEA 4J33A 3CPJG 3ADAB 1YQ4A 2RGJA 3E1TA 4KX6A 1IUSA 1Y0PA 1OJDA 2VVLA 3EAOA 4Y4LA 2Y6RA 3AE6A 5EOWA 2WOWA 3AYJA 4Z2UA 1JRZA 4YTPA 1UKVG 1PN0A 1TYTA 3CNJA 4OVIA 1ZOYA 2RABA 2C67A 3P4RA 4A6NB 4CY6A 3B6DA 4D03A 2XVEA 3AD9B 3UP4A 4DGKA 2OA1A 1TDOA 2RGOA 3NLCA 3CNTA 2YG6A 3NYEA 4Y4MA 4A6NA 3ZYXA 2FJEA 3DJEA 4H4VA 1PBCA 4WX1A 4UDPA 2WDVA 1H83A 5C2TA 2WU5A 4TM3A 3AEEA 2GR2A 1E1KA 1JOAA 2GVCA 3G5QA 4GR1A 1FOHA 2X50A 2X8HA 3QSMA 2V6OA 4U2TA 3SM8A 3C4AA 2GMHA 4O5QA 1EL5A 1SEZA 1PXAA 1TDEA 4B68A 4AP1A 2B7RA 1Q9IA 4UP3A 1BZLA 2JB3A 3NN0X 3CPHG 4EM3A 2X8CA 1YKJA 1GRGA 4U8NA 4YTNA 1LPFA 1GETA 1NHSA 4RG4A 1AOGA 4DSGA 1B37A 2CVJA 2XFNA 3KD9A 4OPCA 2YM2A 1PHHA 2FJAA 3D8XA 3GDNA 4PAAA 3KLJA 1QO8A 4XXGA 4Z2RA 2V60A 4H4RA 2B9XA 4IVOB 2JKCA 4Z24A 2YVFA 1H7XA 3NK0X 4U8OA 5IQ4A 4K8DA 1PXCA 1PS9A 3T37A 1EBDA 4I59A 1M64A 2DKHA 1N4UA 1GERA 3EF6A 2YLZA 4USRA 3BNUA 1BWCA 1OJ9A 3G5SA 3JSKA 5KOWA 2XFPA 2V61A 1GRTA 5FS9A 1V59A 2BCGG 1LJ1A 4NEVA 3KPFA 4EQRA 4J36A 1K0IA 3UP5A 4YKGA 4OPLA 3SFDA 1D4CA 3K7MX 3P4QA 5JCIA 2R46A 1DXLA 1ZY8A 2YG4A 3ICTA 2YVJA 4DNAA 4OPDA 3NYFA 4B65A 3QSEA 3DMEA 1K0JA 2GAHB 2R4EA 3COXA 1N4WA 4JY3A 3AE7A 1H6VA 3H4KA 3P9UA 4OPUA 3GRTA 4ZN0A 4C3XA 3QJ4A 4JDRA 4U8LA 1EL7A 5HXIA 1ZDLA 3AWIA 1BKWA 3LZXA 2H89A 4APNA 2WBAA 3F8PA 3P4PA 4B64A 4YSHA 3LXDA 2VRLA 4M52A 2GQWA 2R4JA 4YSYA 4BURA 2QAEA 4NTEA 3AD8B 4TLXA 4TM4A 3ALMA 3CTYA 2B76A 2C64A 1RYIA 4DSHA 4EIQA 2HQMA 3PVCA 2XFQA 4H2PA 4XWRA 1PJ5A 4GCMA 1LQUA 2VVLG 3V3OA 5TR3A 4RSLA 2WOVA 2APGA 2WDRA 3BI5A 2DKIA 2CDUA 2VQ7A 1JRYA 3DH9A 4H4PA 5J7XA 3UTHA 1PJ7A 1DJQA 2QA2A 4REKA 2C73A 5FS7A 3AEFA 4ZCCA 1NPXA 1REOA 1GT8A 2ZZBA 4H4UA 4EQSA 4UDRA 3EPTA 1L9EA 1PJ6A 3GD3A 3M0OA 4BJZA 2BK4A 3V76A 3I6DA 5EBKA 2BS3A 2Q0KA 2O9ZA 3PS9A 2XDOA 1L9CA 1S3EA 3GSIA 4CBQA 3VQRA 2C75A 4BK2A 2A89A 2WP6A 5ER0A 4B1BA 3NIXA 5KOXA 4N9XA 2A8XA 1LQTA 2H88A 3DGHA 1GREA 1IUUA 1N4VA 2Q0LA 1F8SA 2WETA 1ZX9A 4H4QA 2XVJA 3R9UA 5HHFA 1P2HA 2AR8A 4GF7A 3UKKA 4CY8A 1CL0A 3ALLA 2GQFA 3ITJA 2VZ2A 3GD4A 2GF3A 2YLWA 1ZOVA 3CGCA 1KDGA 2ZZCA 1ZK7A 3RHAA 5DBJA 3VRAA 2QA1A 3CIRA 2YM1A 1D4EA 3IHGA 5KVHA 1KSSA 3DJGX 2YR5A 3DK9A 2X8GA 4IA5A 1N1PA 3O0HA 3AEDA 1GXFA 3QFAA 4GDPA 4Z25A 4U2SA 3C96A 3K30A 2C72A 1D4DA 3CNPA 3AYIA 3NK1X 4PABA 4LU6A 1CF3A 3NH3X 5FMHA 4GRTA 1E7PA 1ZKQA 2CULA 1OJCA 2YG3A 4K5SA 2GV8A 1PDHA 1H84A 2EQ9A 3NTAA 1VG0A 1Y56B 2WPCA 2FJDA 2XLUA 4A65A 3AE3A 1NHRA 2WQYA 1X31B 5HYMA 3K7QX 4KPRA 3NHOX 3H8IA 1QLBA 1CJ3A 1K0LA 4YWOA 4IVMB 4U8MA 2E1MA 4E0VA 2YLRA 2WP5A 2YAUA 3NN6X 1KNPA 3UKPA 2FBWA 2GMJA 5BULA 1H86A 1H82A 2V3BA 2BABA 3GYIA 4OPTA 2OAMA 3FPZA 2OALA 3UKHA 1XPQA 5U63A 2WS3A 5KVIA 1MOKA 2TMDA 2WPEA 2BK3A 2WDQA 2EQ7A 1E6EA 5JCNA 3LB8A 3NGCX 1H7WA 1NG3A 3BHKA 3QVPA 4IV9A 4AOSA 2C3DA 2VRMA 2XVIA 2BXSA 1LVLA 1P2EA 1VG9A 2XYOA 4GDEA 1TYPA 3UOYA 3KA7A 5FS6A 3SFEA 1ZMDA 1FL2A 4U8KA 4B63A 3OC4A 4OPGA 1CC4A 3CGDA 1NDAA 2YLTA 2ARDA 1TRBA 3AEGA 4B67A 3D1CA 2R0PA 1D7YA 3AYLA 3WE0A 3REDA 3UTFA 3QVRA 1NHPA 3QSSA 3LADA 1ELIA 2YWLA 3UOVA 1CC2A 4EQXA 5KRQA 1H81A 1S2YA 3UOZA 3CGBA 5EB4A 4ECHA 1DODA 2BC0A 1EL8A 1PXBA 3BI2A 1PBFA 4X9NA 4A9WA 3GMBA 1NG4A 1B8SA 3BI4A 3F8DA 4XWZA 4H4SA 4U8IA 5CKUA 3AE4A 5GRTA 2NPXA 5JCMA 4FK1C 2GR0A 1F8RA 1GEUA 1RSGA 1XDIA 1E1LA 3RP7A 4U8JA 1COYA 1FECA 2C66A 3SGLA 1RP0A 2VQBA 3DK4A 4C74A 4YSXA 3FMWA 1TDKA 2A87A 3QFBA 3S5WA 4EMIA 4U2LA 3CNDA 1FEAA 1CC6A 2X3NA 4FDCB 4EIPA 3K7TA 1GNDA 1KNRA 2YQUA 3BNMA 1GRFA 3ICSA 3M12A 1YY5A 2EQ6A 3GRSA 4AOXA 1QJDA 1BGNA 3SQPA 4O5UA 3OZ2A 2OLNA 4C5OA 3AEBA 4NTDA 1NHQA 3II4A 3KU9A 1IUXA 2ACZA 2BS4A 4BJYA 2E4GA 4ADWA 2R0GA 1YQ3A 1LTXR 4J2WA 3GWDA 4CCQA 1GALA 4A79A 3HZLA 4K7ZA 3KVEA 4YXDA 4ZCDA 4H4XA 2R45A 3B3RA 3ICRA 2YG5A 4H2NA 2R0CA 3AE8A 3LJPA
chains in the Genus database with same CATH superfamily
3F8RA 3CN8A 4R2AA 2CTDA 1PBBA 2WBSA 4FK1A 3DK8A 3CNSA 5LMNE 2EN6A 1O5WA 5C3JA 1XMQE 3F6HA 4Z2TA 2I9IA 2UXCE 2XCGA 4CNKA 2EPNA 5M10A 2Q6UA 3CGEA 3CCVP 3MGEA 2EM3A 2EQ8A 4K2XA 1MO9A 1K8AQ 4HA6A 2M8PA 3T0KA 4II2A 5BRTA 3GKLC 1HNXE 3C6KA 2MY5A 1A43A 4J56A 2VOUA 2GEWA 3VRDB 3SZ0A 3AB1A 1L9DA 3SZFA 2VLPA 2JVAA 3NG7X 2EOQA 4XFZA 2WPFA 1VQKP 2EP3A 4L8NA 5AE3A 4C3YA 4FX9A 3DS2A 3GYJA 2JAEA 1IUQA 4H2QA 5KMPA 2BACA 3SZCA 2EMYA 3Q6JA 2GH5A 1IJHA 1GV4A 2YLSA 2IVDA 2B9YA 3FBSA 2DMIA 2Q8UA 1FCDA 2WESA 5M0ZA 3J7AG 1PBEA 4WSPA 4LF9E 4JI0E 3RNMA 2V5ZA 2J7JA 3G6EP 1TDNA 4USQA 3T1HE 2PEIA 4H4TA 3P4SA 2PNGA 1VQ8P 1KF6A 2XLRA 3K6QA 4BV6A 3AE9A 5HY5A 3BF2A 1F80D 2JGPA 1NCSA 3HYBA 2NO8A 3VRBA 4OPIA 4WCTA 1JEHA 1RO0A 5BS2A 2ENAA 2B9WA 1VQ7P 1VRQB 4ZYGA 1ZP0A 2LBSB 1N33E 2EOEA 4ZYDA 2OTJP 1UJZA 2LT7A 2JB2A 1BBOA 1AUMA 4LA1A 2Q7VA 2MVVA 5KXJA 2ONTA 5I4TG 1ZNVA 5EB5A 4NZHA 1L0VA 3FG2P 3LLHA 3URHA 2R1FA 2XLSA 2L22A 2VQFE 2DNWA 2EM0A 3G1IA 1X3OA 3M13A 1Q82Q 1GRAA 4J33A 3CPJG 1D1DA 3ADAB 1YQ4A 3E1TA 2YU5A 1IUSA 1PJTA 2VVLA 3L00A 2EQ0A 3EAOA 1E0HA 3AE6A 3U43A 3AYJA 2L6EA 5ADZA 1JRZA 4YTPA 2RABA 4CY6A 2FQ0A 4MRTC 4DV0E 1TDOA 4A6NA 5AC5A 3VYYA 3THNA 4WX1A 2WPTA 1H83A 5C2TA 3AEEA 3G5QA 4JNQA 4U2TA 2GVCA 1EKZA 3C4AA 1XNRE 2GMHA 3SYIA 1N8RQ 3BBGA 2BHVA 2PEJA 2KG6A 2UUCE 4B68A 4UP3A 2N98A 2A25A 4DV6E 1Z6MA 1GRGA 2RQLA 2L2NA 2YM2A 4DMIA 1KD1Q 1QO8A 4Z2RA 2CT1A 2NABA 2N3HA 2FQ2A 4IVOB 4Z24A 4TUIA 3T37A 1EBDA 1X48A 3BIDA 2EMBA 1A1IA 2XFPA 2V61A 5FS9A 3MHHC 4JI3E 4Q35B 3ADLA 2BCGG 5KP8B 1XNQE 1LJ1A 3KPFA 4NEVA 3UP5A 4YKGA 3G29A 2EM8A 4OPDA 3EJEA 2GAHB 2R4EA 2JB0A 3COXA 1EH8A 4M0VA 3AE7A 2YWQA 2YSOA 2B7VA 5HXIA 2PEQA 2L92A 3CCJP 4APNA 4BC9A 3SX6A 3LXDA 2XZ0D 2YRMA 4M52A 2GQWA 2HHHE 4DR4E 4EIQA 2EOJA 2C64A 2MKNA 4XWRA 4BPFA 1LQUA 2VVLG 1DGCA 5TR3A 4RSLA 3BI5A 2DKIA 2CDUA 2VQ7A 3RMPA 3LMOA 4EQSA 2ZZBA 2CGQA 1AF8A 4RH8A 4UDRA 1L9EA 1PJ6A 3M0OA 3KPKA 3V76A 2DIXA 3GSIA 4CBQA 2A89A 5KOXA 1YSAC 2JBGA 1GREA 2LTRA 2Q0LA 1F8SA 2VLQA 2L3JA 1ZX9A 2M9AA 2XVJA 2NUFA 3ITJA 2VZ2A 3GD4A 3CGCA 1KDGA 3DS5A 2EMCA 4JI5E 3CIRA 2YM1A 5KVHA 1KSSA 1P47A 3DJGX 2LUQA 2L4BA 1N1PA 3F6GA 3LMLA 4GDPA 1YUIA 1Q86Q 1JJ2O 4N4RB 3NK1X 2YG3A 1RNIA 1H84A 2FV4B 2EMLA 2WPCA 4A65A 4M0IA 4LF8E 1X31B 1HNZE 2ENHA 2YRKA 3K7QX 1JK1A 4L5NC 4XFYA 1QLBA 2V89A 2B9DA 2EMKA 5A6JA 4B3SE 4PWVB 2YLRA 3G0VA 2V3BA 3THOB 3UKHA 5U63A 2WS3A 5KL3A 3MHSC 3CXCO 2EMHA 3LB8A 3NGCX 4NWZA 2MR7A 2VRMA 2XVIA 2K94A 2V86A 4GDEA 2JO0A 3KA7A 5FS6A 3J81C 2LOLA 4LFCE 4U8KA 4B63A 5KMQA 4B67A 2JYAA 3OW2O 1D7YA 2DGCA 1NHPA 3UOVA 2XV6A 5KRQA 1S2YA 3GZLA 3BI2A 2VE7C 4X9NA 4A9WA 3GMBA 5CKUA 2YTNA 2NPXA 1N34E 2E72A 1RSGA 2JOXA 2GLIA 5KNLA 2BB8A 3QFBA 4U2LA 3CNDA 1FEAA 1CC6A 4FDCB 4U0FA 2B3TB 4F9AB 2K4VA 1K30A 1VKUA 5CZDB 3SQPA 2M1SA 3OZ2A 3G71P 2EN4A 1ZAAC 2ACZA 2BS4A 1A1LA 2ADRA 4P78A 2RS7A 2IHR1 2R0GA 4J2WA 1LTXR 3CC7P 4CCQA 4G74A 2DMYA 1S72P 4YXDA 1VQPP 2R45A 3HTXA 4BBYA 2YG5A 4H2NA 3LJPA 4A7AA 3P05A 1ZR9A 3CPIG 1KQSO 2KGCA 1IBLE 2C76A 1YYOA 2L9FA 3L1RA 2JB1A 2MD9A 1N32E 2OARA 2FTXB 4COCA 2UZZA 2DB2A 2MF4A 1GRBA 2C7GA 1O94A 2L6MA 1F3PA 1SFEA 4BMJA 4EQWA 1X47A 5U1OA 4YSZA 3NKSA 3QG5C 4GKJE 4K5RA 1T39A 1VDCA 4PXHB 2NVKX 2IVEA 2HGHA 3GZMA 4DR1E 3GMCA 3T14A 2YLXA 3HYVA 3KWRA 4YTMA 4J8ZA 2WBTA 1DJNA 2GDYA 2VRDA 3DA1A 2EM5A 4JI7E 3DS0A 3BHFA 1UNKA 2V85A 2R9ZA 3G28A 2XFOA 2EFJA 5A6AA 4DR3E 3UKFA 3SY4A 4LIIA 2ROQA 1F8WA 2D9HA 1YI2P 4EMJA 4JI4E 2DSYA 1K4QA 1VQ9P 4RG3A 1BXIA 4AQYE 1JNRA 1JNZA 3CMMA 4R0MA 3AECA 1GTEA 4J34A 2C65A 2EHSA 3LRYA 1M6IA 2EN1A 3GDPA 4WPYA 1TDFA 4U0AA 1VQWA 3DJDA 4CNJA 1EOQA 4ICYA 2JU2A 1ZMCA 2WP9A 1B4VA 1BF3A 3AE2A 2GDWA 1DOEA 1E1MA 3AE1A 5JCKA 2GB0A 4Z43A 3P1WA 2KWLA 1NAAA 1IUVA 2BC1A 2GR3A 2RGHA 2XVHA 2YR6A 2PEKA 1XANA 1XMOE 3NK2X 3RG6C 4YT0A 1A1FA 2VLNA 2X99A 2L2KB 1A1GA 1DV5A 1IUTA 5AE2A 3ALJA 2XZ1C 2L33A 4B69A 4CRTA 2J3NA 3H09A 1X6FA 1GPEA 2UUBE 3J7Yp 3IC9A 2Z46A 4OCGA 2UU9E 4Z44A 2QEXP 4R8OA 5KL7A 3VK6A 4H50A 3UKAA 2GAGB 3LOVA 2KORA 5A69A 1JU2A 4WXCA 3ABVA 4F9CB 1Y56A 2K92A 4P7DA 4DUZE 4BS9A 5HVCA 3G4SP 3NT6A 3NNEA 2RGJA 1ZU1A 4GZNC 4R2PA 2Y6RA 3FIGA 5EOWA 1UKVG 4OVIA 1ZOYA 2KOUA 1UILA 3P4RA 4D03A 4WXDA 3IWCA 3AD9B 3UP4A 2OA1A 2RGOA 2WBUA 2YG6A 3CNTA 4Y4MA 5HGMA 2KOOA 2MC5A 3JU0A 2KGEA 4UDPA 5KL4A 1Q7YQ 2BUOA 2JYLA 1QU6A 1JOAA 3VHTB 1FOHA 5AC4A 2JU1A 2V6OA 5KMRA 2AVAA 1M1KQ 4O5QA 2VQEE 5BS1A 1SEZA 1PXAA 1TDEA 4AP1A 2EORA 2FVEA 1YKJA 4U0EA 1IQSA 4U8NA 1IMUA 2EPZA 1GETA 1YHQP 2YRHA 1AOGA 3KD9A 3CCQP 3D8XA 4PAAA 2EN8A 3VYXA 4XXGA 3IWDA 2V60A 3RG2A 1H7XA 3NK0X 1SR9A 1N4UA 2YLZA 4M2ZA 3HYWA 3BNUA 3GYXA 1BWCA 5KOWA 2EM7A 1KYQA 1PKPA 5A6BD 1V59A 2LJUA 4J36A 4O5GA 4LFBE 4OPLA 1FKAE 2R46A 2YG4A 2WCC3 4GAVA 4DNAA 4B65A 3QSEA 3DMEA 5BR8E 1K0JA 2VLOA 1N4WA 1PDAA 1YJWP 3H4KA 3DPHA 4ZN0A 3B5IA 4B64A 2WBAA 1HQBA 2R4JA 4BURA 2LTEA 3AD8B 1KC8Q 4TM4A 4TLXA 1RYIA 4PH1A 1IBME 3PVCA 2XFQA 1PJ5A 4G9KA 2JR1A 2AFDA 3V3OA 2WDRA 4U0BA 3DH9A 3UTHA 2YTPA 1DJQA 2QA2A 1QVFO 3AEFA 1NJIQ 4R2DA 3EPTA 4BJZA 3GD3A 2BK4A 2YU8A 2Q0KA 2LIUA 3PS9A 2XDOA 2MDGA 4DR6E 1STUA 4LFAE 3VQRA 4BK2A 1J5EE 3NIXA 1IBKE 4GR2A 4IZ6A 2EOHA 2FGGA 4LF4E 3H0DA 5F3WA 2WETA 4ZYHA 4H4QA 1AAYA 3R9UA 1CL0A 1QRJA 3ALLA 1K73Q 1PJSA 1A1HA 1T4OA 2YTEA 1ZOVA 2YTJA 3ADJA 2QA1A 2LTSA 2GZGA 2AFEA 1GTKA 2EE8A 2X8GA 1L4SA 4K0KE 3O0HA 2CSHA 4JI2E 1BB8A 1GXFA 4Z25A 3K30A 1WHQA 3CNPA 3AYIA 5FMHA 2LCEA 1ZKQA 1OJCA 2YPNA 4K5SA 5A2QC 2EPMX 1Y56B 2FJDA 3ZOQB 2EOYA 1AH5A 3AE3A 1NHRA 2WQYA 3CE7A 2G7HA 4KPRA 1IQOA 5A6KA 1K0LA 4YWOA 4IVMB 4HTGA 3DTJA 1KNPA 2GZIA 5AE1A 2BABA 3GYIA 4OPTA 2GYKA 4DV5E 1XPQA 5KVIA 2WPEA 1UBDC 2EQ7A 3C4BA 1HR0E 4JV5E 2BRAA 3QVPA 2BXSA 3BGHA 1LVLA 1TYPA 4O4KA 4R2QA 1FL2A 2ARDA 3AEGA 4XRQA 4X62E 3D1CA 4G6GA 3DJWA 5JPAA 3UTFA 3QVRA 4U0CA 3LADA 4U0DA 2EMWA 2GDXA 3UOZA 5EB4A 2L0QA 1QVGO 4ECHA 2EL4A 1DODA 2BC0A 1EL8A 1PXBA 4DV7E 1PBFA 3ADGA 2EOXA 5GRTA 3F8DA 4H4SA 4U8IA 3AE4A 4FK1C 1F8RA 1GEUA 2GR0A 1RP0A 4C74A 4YSXA 3S5WA 4EMIA 2LL8A 2EOFA 4EIPA 3HZQA 2VF1A 3K7TA 1GNDA 2LJHA 4QKOA 2EM9A 1DI2A 5EJDA 2EWLA 1BGNA 2OLNA 4GR6A 2AF8A 2L2MA 3AEBA 3KZYA 3KU9A 1IUXA 1RQ0A 4ADWA 2K7IA 1YQ3A 4A79A 3HZLA 3KVEA 4ZCDA 1N3GA 2EQ3A 3ICRA 1FR2A 2R0CA 4PH0A 2LPKA 2JY9A 3DJJA 4X4JA 4BK3A 3IHMA 5JCLA 5KWFA 2PEMA 3GWFA 1Z6LA 3AEAA 2XFUA 1DOBA 1Q1WA 5GSNA 2EL6A 2ZBWA 4JN9A 1YFHA 1D7LA 3RP8A 4H4WA 3ZDNA 3C4TA 1JRXA 5BUKA 2CFYA 2RS6A 1BGJA 1XHCA 2Y6QA 1EH7A 1S2QA 4F37A 1HYUA 4H7UA 5LV9A 2LKIA 4AT2A 4X66E 1I94E 5F2NA 1YZ9A 2BA9A 1MXTA 2V3AA 4UDQA 3VR9A 3TQMA 1DNCA 2YTDA 1TF6A 1PBDA 2WU2A 4DV2E 3T2YA 2B7TA 1G2DC 1YJNP 2OLOA 1K9MQ 2EMGA 3LZWA 4BCAA 2EL5A 1GESA 4H4ZA 3UCLA 3NYCA 4JQ9A 5CQFA 3AXBA 3C6MA 1KJKA 1CHUA 5FS8A 3CD6P 2YG7A 1L0HA 5CFFE 3CCRP 3FIMB 2GR1A 1EMVA 2OTLP 4WSGA 4BK1A 2YZTA 4P9SA 5IQ1A 2MC6A 4TLZA 2ZZ0A 2WHDA 2V83A 1VQ6P 3T2ZA 2LE2A 2BK5A 2F5ZA 4D04A 2W0HA 2CWOA 1MEYC 1ONFA 1X3CA 1AYIA 4A5LA 2E5VA 1VQLP 1LV0A 2PY8A 4HKGA 3G26A 4LF7E 5J60A 3OTOE 3G21A 3P1XA 1S3BA 4AP3A 3Q20A 4B3ME 3EPLA 2N6YA 5IT9C 4LF5E 4LTYA 1GTHA 2KG9A 3PO7A 5A6BA 4Z26A 5LMUE 1B5QA 1FEBA 2ODRD 4EMWA 3KKJA 4DV1E 2JBVA 3L8KA 4NTCA 3C4NA 1KFYA 2GRTA 1M74A 3DS4A 4DR7E 2KR5A 3CC2P 4NXNE 3Q9TA 4F9BB 1RC7A 1NEKA 3RP6A 4GUVA 2RSIA 3IF9A 3MSWA 2LV2A 3EJBA 2JQ4A 4BPGA 3DS3A 2EOIA 4M9VC 4Y4LA 2WOWA 1TYTA 1PN0A 3CNJA 4A6NB 2NA2A 3B6DA 2XVEA 2YSPA 3EPJA 1VQMP 1GPJA 1RMDA 2FJEA 3DJEA 4H4VA 1PBCA 2BBGA 2WDVA 2EMZA 2WU5A 4TM3A 2EMFA 1E1KA 4GR1A 2X50A 2K93A 5KL5A 2B7RA 4NZVA 1Q9IA 4XROA 3NN0X 4R2SA 2EN3A 2X8CA 2DLKA 4FK5C 4YTNA 4RG4A 1N36E 1HNWE 1B37A 4OPCA 3GDNA 2FJAA 3CCSP 3KLJA 1T4NA 2JAZA 4H2YC 2B9XA 4M30A 2JKCA 3HPSA 2YVFA 4DV3E 1PXCA 4I59A 3EF6A 2EPAA 1GERA 4USRA 1OJ9A 2KODA 1EIAA 3JSKA 4EQRA 1K0IA 4JI1E 2HJJA 1D4CA 3P4QA 5JCIA 2F8BA 1A1JA 1ZY8A 1X6HA 2HC5A 2YVJA 3NYFA 2CQ8A 3CCEP 2EMAA 4JY3A 1H6VA 3P9UA 4OPUA 3JAMC 3GRTA 4C3XA 3QJ4A 4JDRA 4U8LA 4O24A 1RO2A 2M8NA 1ZDLA 1BKWA 2H89A 3F8PA 4NHRA 2VRLA 1G2FC 4YSYA 2QAEA 2EN7A 4NTEA 3ALMA 3JTZA 3CMAP 2M7QA 4COPA 2EN2A 1GXHA 4H4PA 2MKDA 1PJ7A 4REKA 2C73A 5FS7A 4ZCCA 3H4EA 1NPXA 1REOA 4H4UA 1W2BO 5EBKA 2O9ZA 1L9CA 5LLQA 1E6JP 2EZ6A 5KL2A 2GZFA 2WP6A 3DF6A 2KHXA 5KL6A 2A8XA 2MR8A 2H36X 3DGHA 2M5RA 1IUUA 2N5HA 2ZM6E 4CA3A 2LUPB 5IXMB 2EHTA 4NNJA 5HHFA 2AR8A 1P2HA 4CY8A 2GQFA 2I13A 2CG5B 1EH6A 3J80C 2YLWA 2ELZA 1ZK7A 5DBJA 3VRAA 2JYGA 2YR5A 3DK9A 2N5IA 2EMXA 5LL6R 4U2SA 3B4QA 4UHPB 1D4DA 2VSQA 1PJQA 4PABA 3M99B 4LU6A 4DR5E 3NH3X 4GRTA 1E7PA 1JK2A 4NXME 2KGAA 2EQ9A 3NTAA 2JXPA 1VQ4P 2XLUA 2LMZA 2EM4A 1YUJA 3NHOX 3H8IA 2K0DX 3EJDA 4I8OA 3T31A 2E1MA 2WP5A 1X49A 1L0IA 2EPCA 5BULA 2GMJA 5KP6B 2KONA 2V88A 1MOKA 2TMDA 2LVHA 2WDQA 2BRYA 3H47A 4ZYEA 1E6EA 5JCNA 1UHZA 1BBGA 3BHKA 2FHSC 3EPHA 1TF3A 4AOSA 2GZEA 2C3DA 1GZ6A 2UXBE 2RSMA 1P2EA 1VG9A 5HV8A 2GPIA 3UOYA 1ZMBA 4BPHA 4F6NA 3SFEA 4B3RE 2EG5A 4GKKE 2EPKX 1FJGE 2R0PA 3AYLA 3WE0A 2K2QA 2L8TA 3QSSA 1YYKA 2C4CA 2YWLA 1O0WA 4R2RA 1H81A 2KOQA 4MLQA 1QNTA 4XFXA 2K0YA 2EPLX 3BI4A 2QNWA 1TN9A 1XDIA 1E1LA 3RP7A 4U8JA 1FECA 2C66A 3SGLA 1VHNA 2VQBA 1VQOP 4YHHE 3FMWA 3NTEA 2JPAA 3NY7B 4F54A 2YQUA 2RTXA 1GRFA 1YY5A 2EQ6A 4AOXA 4C5OA 1NHQA 3GJNA 4KZSA 2YTFA 2E4GA 3M1MA 4K7ZA 4H4XA 5HGLA 3E2DA 4NEOA 4F2JC 3EPKA 2AQJA 4G6HA 4U8PA 4DR2E 1ZBQA 4KHPE 5IPYA 4X65E 1ACPA 2FJBA 4AT0A 2EOOA 4X8WA 5KP7B 1ZBTA 2ERHA 2IIDA 1EL9A 4J57A 2V87A 1CJ4A 4JY2A 4II3A 2JK6A 1E39A 3CPWO 1LLMC 4J31A 1VQ5P 1A8OA 2C3CA 4NEWA 2EOSA 1T38A 2TPRA 4JI8E 3ATRA 2VVMA 3G1GA 3IWAA 2YTIA 2YTOA 1O95A 4H2RA 1Q1RA 2UUAE 4Y4NA 1GSNA 2C70A 3NTDA 2EPUA 1D5TA 5IV8B 2M8LA 2YR4A 4TM1A 3KZZA 1WHNA 4JNAA 2FQ1A 1J26A 2JOBA 1YPNA 1E1NA 2K5XA 3UTGA 1X5WA 3ISHA 3UKQA 3T1YE 1DQ3A 1CBOA 1DOCA 3UK3C 3SXIA 3S61A 1X6EA 2YVGA 1DNYA 4HB9A 3I3LA 2QCUA 2PRTA 1F6MA 3V3NA 2BXRA 3I56P 5L46A 2N6ZA 2N3GA 4JYAE 1NENA 4MJWA 3G5RA 4IS1C 1YQZA 2ODRC 2XLPA 3AE5A 3EANA 2M4IA 3ATQA 4X9MA 2Z5XA 4IJDA 4YKFA 2KGDA 3NRNA 5U25A 4EM4A 1GRHA 2WOIA 4K22A 5HGNA 1OJTA 4B66A 1HY8A 2B7SA 4I58A 2BS2A 2EPPA 4A99A 3CCUP 2XVFA 4C77A 1CJCA 4DV4E 4H4YA 3AUZA 4TUGA 2PYXA 5BVAA 2EPRA 2KW2A 5EW5E 2LIWA 4CCRA 3H8LA 2GHFA 3VR8A 3HXLA 2Z45A 2XLTA 1GOSA 2BCPA 2NUEA 1CJ2A 2DRPA 2Z5YA 2R76A 3DGZA 5F2KA 3UTEA 2BYBA 3UOXA 1NEIA 1IMQA 2LO3A 4TM0A 3UKLA 4DKKA 2EMIA 4IA6A 2WZOA 1W4XA 2DGYA 2JP9A 2I0ZA 2AAQA 3AD7B 1OJAA 2MVUA 2PENA 1IUWA 1KSUA 2PHHA 4R2EA 2WEUA 1IMPA 4QNBA 4KX6A 1Y0PA 1OJDA 4Z2UA 2XT1A 1WRJA 2EQ1A 2C67A 2EM6A 2EIAA 4DGKA 3NLCA 3NYEA 3ZYXA 4OOGC 2YTQA 2GR2A 3QSMA 2X8HA 3SM8A 2FVAA 1EL5A 2ENCA 1BZLA 2JB3A 3CPHG 4EM3A 1Z1BA 1LPFA 1NHSA 4DSGA 2CVJA 2XFNA 3T2KA 2CPNA 4WYQB 1PHHA 2JWOA 5T6JA 5F2OA 4H4RA 4O43A 4U8OA 5IQ4A 4K8DA 1PS9A 4H2WC 1M64A 2DKHA 3SZWA 3AV0A 4G73A 3G5SA 1GRTA 4H2XC 4HEIA 2QA4P 3SFDA 4Q28A 3K7MX 4BHBA 3ICTA 1DXLA 3CCLP 1GQEA 5HGOA 3CMEP 4LF6E 2ELYA 1EL7A 1OR5A 3AWIA 2UXDE 3LZXA 4YSHA 3P4PA 4BHCA 3CC4P 2V8QB 4F6MA 4WX9A 4DSHA 3CTYA 2B76A 2HQMA 4H2PA 4GCMA 1M6EX 3IWBA 2WOVA 1VQNP 2APGA 2MDRA 1JRYA 4KWYA 5J7XA 1GT8A 1T8KA 3I6DA 2BS3A 4LU9A 1S3EA 2C75A 5ER0A 4WYMA 4B1BA 5IWAE 4N9XA 2GZJA 1LQTA 2N8XA 2H88A 1N4VA 2LRSA 1MGTA 1WXRA 2KOPA 4GF7A 2YT4A 3UKKA 1CEIA 2FACA 2PEOA 4DUYE 2GF3A 3RHAA 2ZZCA 2EM2A 3HQ1A 4OX9E 1D4EA 3IHGA 4IA5A 1M90Q 3AEDA 3QFAA 1UN6B 5FLXC 3C96A 2KG8A 2C72A 2P9XA 2EPOA 2Z44A 2EJ4A 2L3CA 1T4LB 1CF3A 2N50A 2CULA 3CCMP 2GV8A 1PDHA 4IPYA 1VG0A 2EPXA 2LF4A 3HYXA 1B69A 3WBHA 4R2CA 4R03A 5HYMA 1NQ4A 2K0XA 5KMSA 5AASA 1F2IG 1MZ8A 3ADIA 1CJ3A 4RHBB 4U8MA 4E0VA 2YAUA 3NN6X 3UKPA 2FBWA 1H86A 1H82A 2OAMA 3FPZA 2OALA 4WFTA 2NUGA 2BK3A 1BAJA 3I55P 1GXGA 7CEIA 1H7WA 1NG3A 4IV9A 2LMLA 2X2BA 2XYOA 1Q81Q 1ZMDA 1YITP 3OC4A 4OPGA 1CC4A 3CGDA 1NDAA 2YLTA 1TRBA 2KOSA 4X64E 2F4VE 4BC7A 3REDA 2FADA 3DS1A 1ELIA 1CC2A 4EQXA 3CGBA 3VRLC 5DNYA 2RPCA 1B8SA 3HPZA 1NG4A 4XWZA 5JCMA 2EOMA 5TSEA 4X9JA 2CNRA 4MLVA 2DLQA 4JI6E 1COYA 1M6NA 1KLPA 3DK4A 1TDKA 3EQ1A 2A87A 4GAPA 2X3NA 3ECRA 1A1KA 1KNRA 4YY3E 1YYWA 1YIJP 3BNMA 2FVFA 2YTGA 2FAEA 3ICSA 3M12A 4GEQB 3GRSA 1QJDA 4O5UA 4NTDA 4DG9A 3II4A 5DCKA 4B3TE 4BJYA 3OMLA 2E5LE 3GWDA 1GALA 2EOZA 2XXMA 1YJ9P 3B3RA 3AE8A 1WJPA
chains in the Genus database with same CATH topology
3F8RA 3CN8A 1PBBA 4FK1A 3DK8A 3CNSA 5LMNE 5C3JA 1O5WA 1XMQE 3F6HA 4Z2TA 2UXCE 2XCGA 4CNKA 5M10A 2Q6UA 3CGEA 3CCVP 3MGEA 2EQ8A 4K2XA 1MO9A 1K8AQ 4HA6A 2M8PA 3T0KA 4II2A 5BRTA 1HNXE 1A43A 4J56A 2VOUA 2GEWA 3VRDB 3SZ0A 3AB1A 1L9DA 3SZFA 2JVAA 3NG7X 4XFZA 2WPFA 1VQKP 4L8NA 5AE3A 4C3YA 4FX9A 3DS2A 3GYJA 2JAEA 1IUQA 4H2QA 5KMPA 2BACA 3SZCA 3Q6JA 2GH5A 1IJHA 1GV4A 2YLSA 2IVDA 2B9YA 3FBSA 1FCDA 2WESA 5M0ZA 3J7AG 1PBEA 4WSPA 4LF9E 4JI0E 3RNMA 2V5ZA 3G6EP 1TDNA 4USQA 3T1HE 2PEIA 4H4TA 3P4SA 1VQ8P 1KF6A 2XLRA 3K6QA 4BV6A 3AE9A 5HY5A 3HYBA 3VRBA 4OPIA 4WCTA 1JEHA 1RO0A 5BS2A 2B9WA 1VQ7P 1VRQB 1ZP0A 2LBSB 1N33E 2OTJP 2JB2A 1AUMA 4LA1A 2Q7VA 5KXJA 2ONTA 5I4TG 5EB5A 4NZHA 1L0VA 3FG2P 3URHA 3LLHA 2XLSA 2VQFE 3G1IA 3M13A 1Q82Q 1GRAA 4J33A 3CPJG 1D1DA 3ADAB 1YQ4A 3E1TA 1IUSA 2VVLA 3EAOA 3AE6A 3AYJA 2L6EA 5ADZA 1JRZA 4YTPA 2RABA 4CY6A 4DV0E 4A6NA 1TDOA 3VYYA 4WX1A 1H83A 5C2TA 3AEEA 4JNQA 3G5QA 4U2TA 2GVCA 1EKZA 3C4AA 1XNRE 2GMHA 3SYIA 1N8RQ 2BHVA 2PEJA 2UUCE 4B68A 4UP3A 4DV6E 1GRGA 2L2NA 2YM2A 4DMIA 1KD1Q 1QO8A 4Z2RA 2N3HA 4IVOB 4Z24A 4TUIA 3T37A 1EBDA 1X48A 2XFPA 2V61A 5FS9A 4JI3E 3ADLA 2BCGG 1XNQE 1LJ1A 3KPFA 4NEVA 3UP5A 4YKGA 3G29A 4OPDA 2GAHB 2R4EA 3COXA 4M0VA 3AE7A 2B7VA 5HXIA 2PEQA 2L92A 3CCJP 4APNA 4BC9A 3SX6A 3LXDA 4M52A 2GQWA 2HHHE 4DR4E 4EIQA 2C64A 4XWRA 1LQUA 2VVLG 5TR3A 4RSLA 3BI5A 2DKIA 2CDUA 2VQ7A 3RMPA 4EQSA 2ZZBA 4UDRA 1L9EA 1PJ6A 3M0OA 3KPKA 3V76A 2DIXA 3GSIA 4CBQA 2A89A 5KOXA 1GREA 2LTRA 2Q0LA 1F8SA 2L3JA 1ZX9A 2XVJA 2NUFA 3ITJA 2VZ2A 3GD4A 3CGCA 1KDGA 3DS5A 4JI5E 3CIRA 2YM1A 5KVHA 1KSSA 3DJGX 2LUQA 1N1PA 3F6GA 3LMLA 4GDPA 1Q86Q 1JJ2O 3NK1X 2YG3A 1RNIA 1H84A 2FV4B 2WPCA 4A65A 4M0IA 4LF8E 1X31B 1HNZE 3K7QX 4L5NC 4XFYA 2V89A 1QLBA 2B9DA 4B3SE 2YLRA 3G0VA 2V3BA 3UKHA 5U63A 2WS3A 3CXCO 3LB8A 3NGCX 4NWZA 2VRMA 2XVIA 2V86A 4GDEA 2JO0A 3KA7A 5FS6A 3J81C 4LFCE 4U8KA 4B63A 5KMQA 4B67A 3OW2O 1D7YA 1NHPA 3UOVA 2XV6A 5KRQA 1S2YA 3BI2A 2VE7C 4X9NA 4A9WA 3GMBA 5CKUA 2NPXA 1N34E 1RSGA 2JOXA 5KNLA 3QFBA 4U2LA 3CNDA 1FEAA 1CC6A 4FDCB 4U0FA 2B3TB 4F9AB 2K4VA 1K30A 3SQPA 2M1SA 3OZ2A 3G71P 2ACZA 2BS4A 4P78A 2RS7A 2IHR1 2R0GA 4J2WA 1LTXR 3CC7P 4CCQA 4G74A 2DMYA 1S72P 4YXDA 1VQPP 2R45A 3HTXA 4BBYA 2YG5A 4H2NA 3LJPA 4A7AA 3P05A 3CPIG 1KQSO 1IBLE 2C76A 1YYOA 3L1RA 2JB1A 1N32E 2OARA 2FTXB 4COCA 2UZZA 2DB2A 1GRBA 2C7GA 1O94A 2L6MA 1F3PA 4BMJA 4EQWA 1X47A 5U1OA 4YSZA 3NKSA 4GKJE 4K5RA 1VDCA 2NVKX 2IVEA 4DR1E 3GMCA 3T14A 2YLXA 3HYVA 3KWRA 4YTMA 4J8ZA 1DJNA 3DA1A 4JI7E 3DS0A 3BHFA 2V85A 2R9ZA 3G28A 2XFOA 2EFJA 4DR3E 3UKFA 3SY4A 4LIIA 1F8WA 1YI2P 4EMJA 4JI4E 2DSYA 1K4QA 1VQ9P 4RG3A 4AQYE 1JNRA 1JNZA 3CMMA 3AECA 1GTEA 4J34A 2C65A 3LRYA 1M6IA 3GDPA 4WPYA 1TDFA 4U0AA 1VQWA 3DJDA 4CNJA 1EOQA 4ICYA 1ZMCA 2WP9A 1B4VA 1BF3A 3AE2A 1DOEA 1E1MA 3AE1A 5JCKA 2GB0A 4Z43A 3P1WA 1NAAA 1IUVA 2BC1A 2GR3A 2RGHA 2XVHA 2YR6A 2PEKA 1XANA 1XMOE 3NK2X 3RG6C 4YT0A 2X99A 2L2KB 1IUTA 5AE2A 3ALJA 2L33A 4B69A 4CRTA 2J3NA 3H09A 1GPEA 2UUBE 3J7Yp 3IC9A 2Z46A 4OCGA 2UU9E 4Z44A 2QEXP 4R8OA 4H50A 3VK6A 3UKAA 2GAGB 3LOVA 1JU2A 3ABVA 4F9CB 1Y56A 4P7DA 4DUZE 4BS9A 3G4SP 3NT6A 3NNEA 2RGJA 2Y6RA 3FIGA 5EOWA 1UKVG 4OVIA 1ZOYA 2KOUA 1UILA 3P4RA 4D03A 3IWCA 3AD9B 3UP4A 2OA1A 2RGOA 3CNTA 2YG6A 4Y4MA 5HGMA 2MC5A 3JU0A 4UDPA 1Q7YQ 2BUOA 2JYLA 1QU6A 1JOAA 1FOHA 2V6OA 5KMRA 1M1KQ 4O5QA 2VQEE 5BS1A 1SEZA 1PXAA 1TDEA 4AP1A 1YKJA 4U0EA 4U8NA 1GETA 1YHQP 1AOGA 3KD9A 3CCQP 3D8XA 4PAAA 3VYXA 4XXGA 3IWDA 2V60A 1H7XA 3NK0X 1SR9A 1N4UA 2YLZA 4M2ZA 3HYWA 3BNUA 3GYXA 1BWCA 5KOWA 1PKPA 1V59A 4J36A 4LFBE 4OPLA 1FKAE 2R46A 2YG4A 4GAVA 4DNAA 4B65A 3QSEA 3DMEA 5BR8E 1K0JA 1N4WA 1YJWP 3H4KA 3DPHA 4ZN0A 3B5IA 4B64A 2WBAA 2R4JA 4BURA 3AD8B 4TLXA 4TM4A 1KC8Q 1RYIA 4PH1A 1IBME 3PVCA 2XFQA 1PJ5A 4G9KA 2JR1A 3V3OA 4U0BA 2WDRA 3DH9A 3UTHA 1DJQA 2QA2A 1QVFO 3AEFA 1NJIQ 3EPTA 4BJZA 3GD3A 2BK4A 2Q0KA 3PS9A 2XDOA 4DR6E 1STUA 4LFAE 3VQRA 4BK2A 1J5EE 3NIXA 1IBKE 4GR2A 2FGGA 4LF4E 3H0DA 5F3WA 2WETA 4H4QA 3R9UA 1QRJA 1CL0A 3ALLA 1K73Q 1T4OA 1ZOVA 3ADJA 2QA1A 2LTSA 2X8GA 4K0KE 3O0HA 4JI2E 1GXFA 4Z25A 3K30A 1WHQA 3CNPA 3AYIA 5FMHA 1ZKQA 1OJCA 4K5SA 5A2QC 1Y56B 2FJDA 3ZOQB 3AE3A 1NHRA 2WQYA 2G7HA 4KPRA 1K0LA 4YWOA 4IVMB 3DTJA 1KNPA 5AE1A 2BABA 3GYIA 4OPTA 4DV5E 1XPQA 5KVIA 2WPEA 2EQ7A 3C4BA 1HR0E 4JV5E 2BRAA 3QVPA 2BXSA 1LVLA 1TYPA 1FL2A 2ARDA 3AEGA 4XRQA 4X62E 3D1CA 4G6GA 3DJWA 5JPAA 3UTFA 3QVRA 4U0CA 3LADA 4U0DA 3UOZA 5EB4A 1QVGO 4ECHA 1DODA 2BC0A 1EL8A 1PXBA 4DV7E 1PBFA 3ADGA 5GRTA 3F8DA 4H4SA 4U8IA 3AE4A 4FK1C 1F8RA 1GEUA 2GR0A 1RP0A 4C74A 4YSXA 3S5WA 4EMIA 4EIPA 3HZQA 2VF1A 3K7TA 1GNDA 2LJHA 1DI2A 2EWLA 1BGNA 2OLNA 4GR6A 2L2MA 3AEBA 3KU9A 1IUXA 1RQ0A 4ADWA 1YQ3A 4A79A 3HZLA 3KVEA 4ZCDA 3ICRA 2R0CA 4PH0A 2JY9A 3DJJA 4X4JA 4BK3A 3IHMA 5JCLA 5KWFA 2PEMA 3GWFA 1Z6LA 3AEAA 2XFUA 1DOBA 1Q1WA 5GSNA 2ZBWA 4JN9A 1D7LA 3RP8A 4H4WA 3ZDNA 3C4TA 1JRXA 5BUKA 2CFYA 2RS6A 1BGJA 1XHCA 2Y6QA 1S2QA 1HYUA 4H7UA 5LV9A 4AT2A 4X66E 1I94E 5F2NA 1YZ9A 2BA9A 1MXTA 2V3AA 4UDQA 3VR9A 1DNCA 1PBDA 2WU2A 4DV2E 3T2YA 2B7TA 2OLOA 1YJNP 1K9MQ 3LZWA 4BCAA 1GESA 4H4ZA 3UCLA 3NYCA 4JQ9A 5CQFA 3AXBA 1CHUA 5FS8A 3CD6P 2YG7A 5CFFE 3FIMB 3CCRP 2GR1A 2OTLP 4BK1A 2YZTA 4P9SA 5IQ1A 2MC6A 4TLZA 2ZZ0A 2WHDA 2V83A 1VQ6P 3T2ZA 2LE2A 2BK5A 2F5ZA 4D04A 2W0HA 2CWOA 1ONFA 4A5LA 2E5VA 1VQLP 1LV0A 2PY8A 3G26A 4LF7E 5J60A 3OTOE 3G21A 3P1XA 1S3BA 4AP3A 3Q20A 4B3ME 5IT9C 4LF5E 4LTYA 1GTHA 3PO7A 4Z26A 5LMUE 1B5QA 1FEBA 2ODRD 4EMWA 3KKJA 4DV1E 2JBVA 3L8KA 4NTCA 3C4NA 1KFYA 2GRTA 1M74A 3DS4A 4DR7E 3CC2P 4NXNE 3Q9TA 4F9BB 1RC7A 1NEKA 3RP6A 4GUVA 3IF9A 3MSWA 3DS3A 4Y4LA 2WOWA 1TYTA 1PN0A 3CNJA 4A6NB 2NA2A 3B6DA 2XVEA 1VQMP 2FJEA 3DJEA 4H4VA 1PBCA 2WDVA 2WU5A 4TM3A 1E1KA 4GR1A 2X50A 2B7RA 1Q9IA 4XROA 3NN0X 2X8CA 4YTNA 4RG4A 1N36E 1HNWE 1B37A 4OPCA 3GDNA 2FJAA 3CCSP 3KLJA 1T4NA 2B9XA 4M30A 2JKCA 3HPSA 2YVFA 4DV3E 1PXCA 4I59A 3EF6A 1GERA 4USRA 1OJ9A 2KODA 1EIAA 3JSKA 4EQRA 1K0IA 4JI1E 1D4CA 3P4QA 5JCIA 2F8BA 1ZY8A 2YVJA 3NYFA 3CCEP 4JY3A 1H6VA 3P9UA 4OPUA 3JAMC 3GRTA 4C3XA 3QJ4A 4JDRA 4U8LA 1ZDLA 1RO2A 2M8NA 1BKWA 2H89A 3F8PA 2VRLA 4YSYA 2QAEA 4NTEA 3ALMA 3JTZA 3CMAP 2M7QA 4COPA 4H4PA 1PJ7A 4REKA 2C73A 5FS7A 4ZCCA 3H4EA 1NPXA 1REOA 4H4UA 1W2BO 5EBKA 2O9ZA 1L9CA 1E6JP 2EZ6A 2WP6A 3DF6A 2KHXA 2A8XA 2H36X 3DGHA 1IUUA 2ZM6E 2LUPB 4NNJA 5HHFA 1P2HA 2AR8A 4CY8A 2GQFA 3J80C 2YLWA 1ZK7A 5DBJA 3VRAA 2JYGA 2YR5A 3DK9A 5LL6R 4U2SA 1D4DA 4PABA 4LU6A 4DR5E 3NH3X 4GRTA 1E7PA 4NXME 2EQ9A 3NTAA 1VQ4P 2XLUA 2LMZA 3NHOX 3H8IA 4I8OA 3T31A 2E1MA 2WP5A 1X49A 5BULA 2GMJA 2KONA 2V88A 1MOKA 2TMDA 2WDQA 2BRYA 3H47A 1E6EA 5JCNA 1UHZA 3BHKA 4AOSA 2C3DA 1GZ6A 2UXBE 2RSMA 1P2EA 1VG9A 3UOYA 1ZMBA 3SFEA 4B3RE 2EG5A 4GKKE 1FJGE 2R0PA 3AYLA 3WE0A 2L8TA 3QSSA 1YYKA 2C4CA 2YWLA 1O0WA 1H81A 4XFXA 3BI4A 1XDIA 1E1LA 3RP7A 4U8JA 1FECA 2C66A 3SGLA 2VQBA 1VQOP 4YHHE 3FMWA 3NTEA 4F54A 2YQUA 2RTXA 1GRFA 1YY5A 2EQ6A 4AOXA 4C5OA 1NHQA 4KZSA 2E4GA 3M1MA 4K7ZA 4H4XA 5HGLA 3E2DA 2AQJA 4G6HA 4U8PA 4DR2E 1ZBQA 4KHPE 5IPYA 4X65E 2FJBA 4AT0A 4X8WA 1ZBTA 2IIDA 1EL9A 4J57A 2V87A 1CJ4A 4JY2A 4II3A 2JK6A 1E39A 3CPWO 4J31A 1VQ5P 1A8OA 2C3CA 4NEWA 3ATRA 2TPRA 4JI8E 2VVMA 3G1GA 3IWAA 1O95A 4H2RA 1Q1RA 2UUAE 4Y4NA 1GSNA 2C70A 3NTDA 1D5TA 2YR4A 2M8LA 4TM1A 1WHNA 4JNAA 1J26A 2JOBA 1E1NA 3UTGA 3ISHA 3UKQA 3T1YE 1DQ3A 1CBOA 1DOCA 3SXIA 3S61A 2YVGA 4HB9A 3I3LA 2QCUA 1F6MA 3V3NA 2BXRA 3I56P 5L46A 2N3GA 4JYAE 1NENA 4MJWA 3G5RA 1YQZA 2ODRC 2XLPA 3AE5A 3EANA 2M4IA 3ATQA 4X9MA 2Z5XA 4YKFA 3NRNA 5U25A 4EM4A 1GRHA 2WOIA 4K22A 5HGNA 1OJTA 4B66A 2B7SA 4I58A 2BS2A 4A99A 3CCUP 2XVFA 4C77A 1CJCA 4DV4E 4H4YA 3AUZA 4TUGA 2PYXA 5BVAA 4CCRA 3H8LA 3VR8A 3HXLA 2Z45A 2XLTA 1GOSA 2BCPA 2NUEA 1CJ2A 2Z5YA 3DGZA 5F2KA 3UTEA 2BYBA 3UOXA 3UKLA 4TM0A 4DKKA 4IA6A 2WZOA 1W4XA 2DGYA 2I0ZA 2AAQA 3AD7B 1OJAA 2PENA 1IUWA 1KSUA 2PHHA 2WEUA 4QNBA 4KX6A 1Y0PA 1OJDA 4Z2UA 2XT1A 2C67A 2EIAA 4DGKA 3NLCA 3NYEA 3ZYXA 4OOGC 2GR2A 3QSMA 2X8HA 3SM8A 1EL5A 1BZLA 2JB3A 3CPHG 4EM3A 1LPFA 1NHSA 4DSGA 2CVJA 2XFNA 3T2KA 2CPNA 4WYQB 1PHHA 2JWOA 5T6JA 5F2OA 4H4RA 4U8OA 5IQ4A 4K8DA 1PS9A 1M64A 2DKHA 3SZWA 3AV0A 4G73A 3G5SA 1GRTA 2QA4P 3SFDA 4Q28A 3K7MX 3ICTA 1DXLA 3CCLP 1GQEA 5HGOA 3CMEP 4LF6E 1EL7A 3AWIA 2UXDE 3LZXA 4YSHA 3P4PA 3CC4P 2V8QB 4DSHA 3CTYA 2B76A 2HQMA 4H2PA 4GCMA 1M6EX 3IWBA 2WOVA 1VQNP 2APGA 2MDRA 1JRYA 5J7XA 1GT8A 3I6DA 2BS3A 4LU9A 1S3EA 2C75A 5ER0A 4WYMA 4B1BA 5IWAE 4N9XA 1LQTA 2H88A 1N4VA 2LRSA 4GF7A 1WXRA 3UKKA 2YT4A 2PEOA 4DUYE 2GF3A 3RHAA 2ZZCA 3HQ1A 4OX9E 1D4EA 3IHGA 4IA5A 1M90Q 3AEDA 3QFAA 5FLXC 3C96A 2C72A 2P9XA 2Z44A 2L3CA 1T4LB 1CF3A 2CULA 3CCMP 2GV8A 1PDHA 4IPYA 1VG0A 2LF4A 3HYXA 3WBHA 5HYMA 4R03A 5KMSA 5AASA 3ADIA 1CJ3A 4U8MA 4E0VA 2YAUA 3NN6X 3UKPA 2FBWA 1H86A 1H82A 2OAMA 3FPZA 2OALA 4WFTA 2NUGA 2BK3A 1BAJA 3I55P 1H7WA 1NG3A 4IV9A 2XYOA 1Q81Q 1ZMDA 1YITP 3OC4A 4OPGA 1CC4A 3CGDA 1NDAA 2YLTA 1TRBA 4X64E 2F4VE 4BC7A 3REDA 3DS1A 1ELIA 1CC2A 4EQXA 3CGBA 3VRLC 5DNYA 1NG4A 1B8SA 3HPZA 5JCMA 4XWZA 4JI6E 1COYA 1M6NA 3DK4A 1TDKA 2A87A 4GAPA 2X3NA 1KNRA 4YY3E 1YYWA 1YIJP 3BNMA 3ICSA 3M12A 4GEQB 3GRSA 1QJDA 4O5UA 4NTDA 3II4A 5DCKA 4B3TE 4BJYA 3OMLA 2E5LE 3GWDA 1GALA 2XXMA 1YJ9P 3B3RA 3AE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A7A A;  3F8R A;  2AQJ A;  3CN8 A;  3DJJ A;  1PBB A;  4U8P A;  3CPI G;  4X4J A;  4BK3 A;  4FK1 A;  3DK8 A;  3CNS A;  5IPY A;  3IHM A;  1O5W A;  5C3J A;  5JCL A;  2C76 A;  4Z2T A;  5KWF A;  2FJB A;  3GWF A;  4AT0 A;  1Z6L A;  2IID A;  1EL9 A;  3AEA A;  2XFU A;  4J57 A;  2XCG A;  1CJ4 A;  1DOB A;  1Q1W A;  4JY2 A;  5GSN A;  2ZBW A;  4JN9 A;  1D7L A;  3RP8 A;  2JK6 A;  4CNK A;  4H4W A;  1E39 A;  3L1R A;  2JB1 A;  3ZDN A;  4J31 A;  5M10 A;  2Q6U A;  3CGE A;  2UZZ A;  2C3C A;  2EQ8 A;  4NEW A;  4K2X A;  1MO9 A;  1GRB A;  2TPR A;  3ATR A;  2VVM A;  4HA6 A;  3IWA A;  1JRX A;  2C7G A;  5BUK A;  1O94 A;  2CFY A;  1BGJ A;  1F3P A;  1XHC A;  2Y6Q A;  5BRT A;  1O95 A;  4EQW A;  4H2R A;  1S2Q A;  1Q1R A;  1HYU A;  4H7U A;  5U1O A;  4YSZ A;  3NKS A;  5LV9 A;  4Y4N A;  4K5R A;  1VDC A;  1GSN A;  2C70 A;  2NVK X;  2IVE A;  3NTD A;  4AT2 A;  4J56 A;  1D5T A;  3GMC A;  2YLX A;  2YR4 A;  4TM1 A;  2BA9 A;  2VOU A;  1MXT A;  2GEW A;  2V3A A;  3VRD B;  4JNQ A;  4JNA A;  4UDQ A;  4YTM A;  3VR9 A;  3AB1 A;  1DNC A;  1L9D A;  1DJN A;  1PBD A;  3NG7 X;  2WU2 A;  1E1N A;  3DA1 A;  2WPF A;  3UTG A;  2OLO A;  3BHF A;  3LZW A;  3ISH A;  4C3Y A;  2R9Z A;  3UKQ A;  4FX9 A;  1GES A;  3GYJ A;  4H4Z A;  1CBO A;  2JAE A;  1DOC A;  3UCL A;  3NYC A;  4JQ9 A;  2XFO A;  3S61 A;  4H2Q A;  2YVG A;  4HB9 A;  5CQF A;  3I3L A;  4LII A;  1F8W A;  2BAC A;  2QCU A;  3UKF A;  3AXB A;  3Q6J A;  1F6M A;  4EMJ A;  1K4Q A;  1CHU A;  5FS8 A;  2YG7 A;  4RG3 A;  2GH5 A;  3FIM B;  1JNR A;  3V3N A;  1JNZ A;  2GR1 A;  3AEC A;  2BXR A;  1GTE A;  4J34 A;  4BK1 A;  5L46 A;  4P9S A;  1IJH A;  2C65 A;  1GV4 A;  4TLZ A;  5IQ1 A;  2YLS A;  2IVD A;  4MJW A;  1NEN A;  2B9Y A;  3G5R A;  3FBS A;  1M6I A;  1YQZ A;  2ZZ0 A;  1FCD A;  3GDP A;  2WES A;  1TDF A;  1VQW A;  3DJD A;  5M0Z A;  2WHD A;  1PBE A;  2XLP A;  3AE5 A;  3RNM A;  4CNJ A;  3EAN A;  3ATQ A;  2V5Z A;  2Z5X A;  4ICY A;  2BK5 A;  4X9M A;  2F5Z A;  1ZMC A;  1TDN A;  2WP9 A;  1B4V A;  4USQ A;  4YKF A;  4D04 A;  2W0H A;  1BF3 A;  3AE2 A;  3NRN A;  4H4T A;  5U25 A;  4EM4 A;  1GRH A;  1ONF A;  2WOI A;  4A5L A;  2E5V A;  3P4S A;  1DOE A;  1E1M A;  3AE1 A;  1KF6 A;  1LV0 A;  2XLR A;  4K22 A;  5JCK A;  1OJT A;  2GB0 A;  4B66 A;  4Z43 A;  3P1W A;  1NAA A;  1IUV A;  2B7S A;  5J60 A;  2GR3 A;  4I58 A;  2BC1 A;  2BS2 A;  4A99 A;  2RGH A;  2XVH A;  2YR6 A;  3AE9 A;  4BV6 A;  1S3B A;  4AP3 A;  5HY5 A;  1XAN A;  2XVF A;  4C77 A;  1CJC A;  4H4Y A;  3VRB A;  2PYX A;  4OPI A;  3NK2 X;  5BVA A;  4YT0 A;  4WCT A;  2X99 A;  1JEH A;  4CCR A;  1GTH A;  3H8L A;  3VR8 A;  2B9W A;  3PO7 A;  1IUT A;  4Z26 A;  1VRQ B;  2XLT A;  3ALJ A;  1GOS A;  1B5Q A;  1FEB A;  2BCP A;  4B69 A;  1CJ2 A;  1ZP0 A;  4EMW A;  3KKJ A;  2JBV A;  4CRT A;  2J3N A;  2JB2 A;  3L8K A;  4NTC A;  2Z5Y A;  3C4N A;  1KFY A;  4LA1 A;  1GPE A;  2Q7V A;  3DGZ A;  2GRT A;  3IC9 A;  4OCG A;  3UTE A;  2BYB A;  3UOX A;  4Z44 A;  3UKL A;  4TM0 A;  4H50 A;  4IA6 A;  5KXJ A;  3UKA A;  2GAG B;  3LOV A;  5EB5 A;  1JU2 A;  1W4X A;  2I0Z A;  4NZH A;  2AAQ A;  1L0V A;  3AD7 B;  3ABV A;  3FG2 P;  3URH A;  1OJA A;  3Q9T A;  1NEK A;  3RP6 A;  2XLS A;  1Y56 A;  4GUV A;  1IUW A;  1KSU A;  3IF9 A;  2PHH A;  3M13 A;  1GRA A;  2WEU A;  3NT6 A;  3NNE A;  4J33 A;  3CPJ G;  3ADA B;  1YQ4 A;  2RGJ A;  3E1T A;  4KX6 A;  1IUS A;  1Y0P A;  1OJD A;  2VVL A;  3EAO A;  4Y4L A;  2Y6R A;  3AE6 A;  5EOW A;  2WOW A;  3AYJ A;  4Z2U A;  1JRZ A;  4YTP A;  1UKV G;  1PN0 A;  1TYT A;  3CNJ A;  4OVI A;  1ZOY A;  2RAB A;  2C67 A;  3P4R A;  4A6N B;  4CY6 A;  3B6D A;  4D03 A;  2XVE A;  3AD9 B;  3UP4 A;  4DGK A;  2OA1 A;  1TDO A;  2RGO A;  3NLC A;  3CNT A;  2YG6 A;  3NYE A;  4Y4M A;  4A6N A;  3ZYX A;  2FJE A;  3DJE A;  4H4V A;  1PBC A;  4WX1 A;  4UDP A;  2WDV A;  1H83 A;  5C2T A;  2WU5 A;  4TM3 A;  3AEE A;  2GR2 A;  1E1K A;  1JOA A;  2GVC A;  3G5Q A;  4GR1 A;  1FOH A;  2X50 A;  2X8H A;  3QSM A;  2V6O A;  4U2T A;  3SM8 A;  3C4A A;  2GMH A;  4O5Q A;  1EL5 A;  1SEZ A;  1PXA A;  1TDE A;  4B68 A;  4AP1 A;  2B7R A;  1Q9I A;  4UP3 A;  1BZL A;  2JB3 A;  3NN0 X;  3CPH G;  4EM3 A;  2X8C A;  1YKJ A;  1GRG A;  4U8N A;  4YTN A;  1LPF A;  1GET A;  1NHS A;  4RG4 A;  1AOG A;  4DSG A;  1B37 A;  2CVJ A;  2XFN A;  3KD9 A;  4OPC A;  2YM2 A;  1PHH A;  2FJA A;  3D8X A;  3GDN A;  4PAA A;  3KLJ A;  1QO8 A;  4XXG A;  4Z2R A;  2V60 A;  4H4R A;  2B9X A;  4IVO B;  2JKC A;  4Z24 A;  2YVF A;  1H7X A;  3NK0 X;  4U8O A;  5IQ4 A;  4K8D A;  1PXC A;  1PS9 A;  3T37 A;  1EBD A;  4I59 A;  1M64 A;  2DKH A;  1N4U A;  1GER A;  3EF6 A;  2YLZ A;  4USR A;  3BNU A;  1BWC A;  1OJ9 A;  3G5S A;  3JSK A;  5KOW A;  2XFP A;  2V61 A;  1GRT A;  5FS9 A;  1V59 A;  2BCG G;  1LJ1 A;  4NEV A;  3KPF A;  4EQR A;  4J36 A;  1K0I A;  3UP5 A;  4YKG A;  4OPL A;  3SFD A;  1D4C A;  3K7M X;  3P4Q A;  5JCI A;  2R46 A;  1DXL A;  1ZY8 A;  2YG4 A;  3ICT A;  2YVJ A;  4DNA A;  4OPD A;  3NYF A;  4B65 A;  3QSE A;  3DME A;  1K0J A;  2GAH B;  2R4E A;  3COX A;  1N4W A;  4JY3 A;  3AE7 A;  1H6V A;  3H4K A;  3P9U A;  4OPU A;  3GRT A;  4ZN0 A;  4C3X A;  3QJ4 A;  4JDR A;  4U8L A;  1EL7 A;  5HXI A;  1ZDL A;  3AWI A;  1BKW A;  3LZX A;  2H89 A;  4APN A;  2WBA A;  3F8P A;  3P4P A;  4B64 A;  4YSH A;  3LXD A;  2VRL A;  4M52 A;  2GQW A;  2R4J A;  4YSY A;  4BUR A;  2QAE A;  4NTE A;  3AD8 B;  4TLX A;  4TM4 A;  3ALM A;  3CTY A;  2B76 A;  2C64 A;  1RYI A;  4DSH A;  4EIQ A;  2HQM A;  3PVC A;  2XFQ A;  4H2P A;  4XWR A;  1PJ5 A;  4GCM A;  1LQU A;  2VVL G;  3V3O A;  5TR3 A;  4RSL A;  2WOV A;  2APG A;  2WDR A;  3BI5 A;  2DKI A;  2CDU A;  2VQ7 A;  1JRY A;  3DH9 A;  4H4P A;  5J7X A;  3UTH A;  1PJ7 A;  1DJQ A;  2QA2 A;  4REK A;  2C73 A;  5FS7 A;  3AEF A;  4ZCC A;  1NPX A;  1REO A;  1GT8 A;  2ZZB A;  4H4U A;  4EQS A;  4UDR A;  3EPT A;  1L9E A;  1PJ6 A;  3GD3 A;  3M0O A;  4BJZ A;  2BK4 A;  3V76 A;  3I6D A;  5EBK A;  2BS3 A;  2Q0K A;  2O9Z A;  3PS9 A;  2XDO A;  1L9C A;  1S3E A;  3GSI A;  4CBQ A;  3VQR A;  2C75 A;  4BK2 A;  2A89 A;  2WP6 A;  5ER0 A;  4B1B A;  3NIX A;  5KOX A;  4N9X A;  2A8X A;  1LQT A;  2H88 A;  3DGH A;  1GRE A;  1IUU A;  1N4V A;  2Q0L A;  1F8S A;  2WET A;  1ZX9 A;  4H4Q A;  2XVJ A;  3R9U A;  5HHF A;  1P2H A;  2AR8 A;  4GF7 A;  3UKK A;  4CY8 A;  1CL0 A;  3ALL A;  2GQF A;  3ITJ A;  2VZ2 A;  3GD4 A;  2GF3 A;  2YLW A;  1ZOV A;  3CGC A;  1KDG A;  2ZZC A;  1ZK7 A;  3RHA A;  5DBJ A;  3VRA A;  2QA1 A;  3CIR A;  2YM1 A;  1D4E A;  3IHG A;  5KVH A;  1KSS A;  3DJG X;  2YR5 A;  3DK9 A;  2X8G A;  4IA5 A;  1N1P A;  3O0H A;  3AED A;  1GXF A;  3QFA A;  4GDP A;  4Z25 A;  4U2S A;  3C96 A;  3K30 A;  2C72 A;  1D4D A;  3CNP A;  3AYI A;  3NK1 X;  4PAB A;  4LU6 A;  1CF3 A;  3NH3 X;  5FMH A;  4GRT A;  1E7P A;  1ZKQ A;  2CUL A;  1OJC A;  2YG3 A;  4K5S A;  2GV8 A;  1PDH A;  1H84 A;  2EQ9 A;  3NTA A;  1VG0 A;  1Y56 B;  2WPC A;  2FJD A;  2XLU A;  4A65 A;  3AE3 A;  1NHR A;  2WQY A;  1X31 B;  5HYM A;  3K7Q X;  4KPR A;  3NHO X;  3H8I A;  1QLB A;  1CJ3 A;  1K0L A;  4YWO A;  4IVM B;  4U8M A;  2E1M A;  4E0V A;  2YLR A;  2WP5 A;  2YAU A;  3NN6 X;  1KNP A;  3UKP A;  2FBW A;  2GMJ A;  5BUL A;  1H86 A;  1H82 A;  2V3B A;  2BAB A;  3GYI A;  4OPT A;  2OAM A;  3FPZ A;  2OAL A;  3UKH A;  1XPQ A;  5U63 A;  2WS3 A;  5KVI A;  1MOK A;  2TMD A;  2WPE A;  2BK3 A;  2WDQ A;  2EQ7 A;  1E6E A;  5JCN A;  3LB8 A;  3NGC X;  1H7W A;  1NG3 A;  3BHK A;  3QVP A;  4IV9 A;  4AOS A;  2C3D A;  2VRM A;  2XVI A;  2BXS A;  1LVL A;  1P2E A;  1VG9 A;  2XYO A;  4GDE A;  1TYP A;  3UOY A;  3KA7 A;  5FS6 A;  3SFE A;  1ZMD A;  1FL2 A;  4U8K A;  4B63 A;  3OC4 A;  4OPG A;  1CC4 A;  3CGD A;  1NDA A;  2YLT A;  2ARD A;  1TRB A;  3AEG A;  4B67 A;  3D1C A;  2R0P A;  1D7Y A;  3AYL A;  3WE0 A;  3RED A;  3UTF A;  3QVR A;  1NHP A;  3QSS A;  3LAD A;  1ELI A;  2YWL A;  3UOV A;  1CC2 A;  4EQX A;  5KRQ A;  1H81 A;  1S2Y A;  3UOZ A;  3CGB A;  5EB4 A;  4ECH A;  1DOD A;  2BC0 A;  1EL8 A;  1PXB A;  3BI2 A;  1PBF A;  4X9N A;  4A9W A;  3GMB A;  1NG4 A;  1B8S A;  3BI4 A;  3F8D A;  4XWZ A;  4H4S A;  4U8I A;  5CKU A;  3AE4 A;  5GRT A;  2NPX A;  5JCM A;  4FK1 C;  2GR0 A;  1F8R A;  1GEU A;  1RSG A;  1XDI A;  1E1L A;  3RP7 A;  4U8J A;  1COY A;  1FEC A;  2C66 A;  3SGL A;  1RP0 A;  2VQB A;  3DK4 A;  4C74 A;  4YSX A;  3FMW A;  1TDK A;  2A87 A;  3QFB A;  3S5W A;  4EMI A;  4U2L A;  3CND A;  1FEA A;  1CC6 A;  2X3N A;  4FDC B;  4EIP A;  3K7T A;  1GND A;  1KNR A;  2YQU A;  3BNM A;  1GRF A;  3ICS A;  3M12 A;  1YY5 A;  2EQ6 A;  3GRS A;  4AOX A;  1QJD A;  1BGN A;  3SQP A;  4O5U A;  3OZ2 A;  2OLN A;  4C5O A;  3AEB A;  4NTD A;  1NHQ A;  3II4 A;  3KU9 A;  1IUX A;  2ACZ A;  2BS4 A;  4BJY A;  2E4G A;  4ADW A;  2R0G A;  1YQ3 A;  1LTX R;  4J2W A;  3GWD A;  4CCQ A;  1GAL A;  4A79 A;  3HZL A;  4K7Z A;  3KVE A;  4YXD A;  4ZCD A;  4H4X A;  2R45 A;  3B3R A;  3ICR A;  2YG5 A;  4H2N A;  2R0C A;  3AE8 A;  3LJP A; 
#chains in the Genus database with same CATH topology
 3F8R A;  3CN8 A;  4R2A A;  2CTD A;  1PBB A;  2WBS A;  4FK1 A;  3DK8 A;  3CNS A;  5LMN E;  2EN6 A;  1O5W A;  5C3J A;  1XMQ E;  3F6H A;  4Z2T A;  2I9I A;  2UXC E;  2XCG A;  4CNK A;  2EPN A;  5M10 A;  2Q6U A;  3CGE A;  3CCV P;  3MGE A;  2EM3 A;  2EQ8 A;  4K2X A;  1MO9 A;  1K8A Q;  4HA6 A;  2M8P A;  3T0K A;  4II2 A;  5BRT A;  3GKL C;  1HNX E;  3C6K A;  2MY5 A;  1A43 A;  4J56 A;  2VOU A;  2GEW A;  3VRD B;  3SZ0 A;  3AB1 A;  1L9D A;  3SZF A;  2VLP A;  2JVA A;  3NG7 X;  2EOQ A;  4XFZ A;  2WPF A;  1VQK P;  2EP3 A;  4L8N A;  5AE3 A;  4C3Y A;  4FX9 A;  3DS2 A;  3GYJ A;  2JAE A;  1IUQ A;  4H2Q A;  5KMP A;  2BAC A;  3SZC A;  2EMY A;  3Q6J A;  2GH5 A;  1IJH A;  1GV4 A;  2YLS A;  2IVD A;  2B9Y A;  3FBS A;  2DMI A;  2Q8U A;  1FCD A;  2WES A;  5M0Z A;  3J7A G;  1PBE A;  4WSP A;  4LF9 E;  4JI0 E;  3RNM A;  2V5Z A;  2J7J A;  3G6E P;  1TDN A;  4USQ A;  3T1H E;  2PEI A;  4H4T A;  3P4S A;  2PNG A;  1VQ8 P;  1KF6 A;  2XLR A;  3K6Q A;  4BV6 A;  3AE9 A;  5HY5 A;  3BF2 A;  1F80 D;  2JGP A;  1NCS A;  3HYB A;  2NO8 A;  3VRB A;  4OPI A;  4WCT A;  1JEH A;  1RO0 A;  5BS2 A;  2ENA A;  2B9W A;  1VQ7 P;  1VRQ B;  4ZYG A;  1ZP0 A;  2LBS B;  1N33 E;  2EOE A;  4ZYD A;  2OTJ P;  1UJZ A;  2LT7 A;  2JB2 A;  1BBO A;  1AUM A;  4LA1 A;  2Q7V A;  2MVV A;  5KXJ A;  2ONT A;  5I4T G;  1ZNV A;  5EB5 A;  4NZH A;  1L0V A;  3FG2 P;  3LLH A;  3URH A;  2R1F A;  2XLS A;  2L22 A;  2VQF E;  2DNW A;  2EM0 A;  3G1I A;  1X3O A;  3M13 A;  1Q82 Q;  1GRA A;  4J33 A;  3CPJ G;  1D1D A;  3ADA B;  1YQ4 A;  3E1T A;  2YU5 A;  1IUS A;  1PJT A;  2VVL A;  3L00 A;  2EQ0 A;  3EAO A;  1E0H A;  3AE6 A;  3U43 A;  3AYJ A;  2L6E A;  5ADZ A;  1JRZ A;  4YTP A;  2RAB A;  4CY6 A;  2FQ0 A;  4MRT C;  4DV0 E;  1TDO A;  4A6N A;  5AC5 A;  3VYY A;  3THN A;  4WX1 A;  2WPT A;  1H83 A;  5C2T A;  3AEE A;  3G5Q A;  4JNQ A;  4U2T A;  2GVC A;  1EKZ A;  3C4A A;  1XNR E;  2GMH A;  3SYI A;  1N8R Q;  3BBG A;  2BHV A;  2PEJ A;  2KG6 A;  2UUC E;  4B68 A;  4UP3 A;  2N98 A;  2A25 A;  4DV6 E;  1Z6M A;  1GRG A;  2RQL A;  2L2N A;  2YM2 A;  4DMI A;  1KD1 Q;  1QO8 A;  4Z2R A;  2CT1 A;  2NAB A;  2N3H A;  2FQ2 A;  4IVO B;  4Z24 A;  4TUI A;  3T37 A;  1EBD A;  1X48 A;  3BID A;  2EMB A;  1A1I A;  2XFP A;  2V61 A;  5FS9 A;  3MHH C;  4JI3 E;  4Q35 B;  3ADL A;  2BCG G;  5KP8 B;  1XNQ E;  1LJ1 A;  3KPF A;  4NEV A;  3UP5 A;  4YKG A;  3G29 A;  2EM8 A;  4OPD A;  3EJE A;  2GAH B;  2R4E A;  2JB0 A;  3COX A;  1EH8 A;  4M0V A;  3AE7 A;  2YWQ A;  2YSO A;  2B7V A;  5HXI A;  2PEQ A;  2L92 A;  3CCJ P;  4APN A;  4BC9 A;  3SX6 A;  3LXD A;  2XZ0 D;  2YRM A;  4M52 A;  2GQW A;  2HHH E;  4DR4 E;  4EIQ A;  2EOJ A;  2C64 A;  2MKN A;  4XWR A;  4BPF A;  1LQU A;  2VVL G;  1DGC A;  5TR3 A;  4RSL A;  3BI5 A;  2DKI A;  2CDU A;  2VQ7 A;  3RMP A;  3LMO A;  4EQS A;  2ZZB A;  2CGQ A;  1AF8 A;  4RH8 A;  4UDR A;  1L9E A;  1PJ6 A;  3M0O A;  3KPK A;  3V76 A;  2DIX A;  3GSI A;  4CBQ A;  2A89 A;  5KOX A;  1YSA C;  2JBG A;  1GRE A;  2LTR A;  2Q0L A;  1F8S A;  2VLQ A;  2L3J A;  1ZX9 A;  2M9A A;  2XVJ A;  2NUF A;  3ITJ A;  2VZ2 A;  3GD4 A;  3CGC A;  1KDG A;  3DS5 A;  2EMC A;  4JI5 E;  3CIR A;  2YM1 A;  5KVH A;  1KSS A;  1P47 A;  3DJG X;  2LUQ A;  2L4B A;  1N1P A;  3F6G A;  3LML A;  4GDP A;  1YUI A;  1Q86 Q;  1JJ2 O;  4N4R B;  3NK1 X;  2YG3 A;  1RNI A;  1H84 A;  2FV4 B;  2EML A;  2WPC A;  4A65 A;  4M0I A;  4LF8 E;  1X31 B;  1HNZ E;  2ENH A;  2YRK A;  3K7Q X;  1JK1 A;  4L5N C;  4XFY A;  1QLB A;  2V89 A;  2B9D A;  2EMK A;  5A6J A;  4B3S E;  4PWV B;  2YLR A;  3G0V A;  2V3B A;  3THO B;  3UKH A;  5U63 A;  2WS3 A;  5KL3 A;  3MHS C;  3CXC O;  2EMH A;  3LB8 A;  3NGC X;  4NWZ A;  2MR7 A;  2VRM A;  2XVI A;  2K94 A;  2V86 A;  4GDE A;  2JO0 A;  3KA7 A;  5FS6 A;  3J81 C;  2LOL A;  4LFC E;  4U8K A;  4B63 A;  5KMQ A;  4B67 A;  2JYA A;  3OW2 O;  1D7Y A;  2DGC A;  1NHP A;  3UOV A;  2XV6 A;  5KRQ A;  1S2Y A;  3GZL A;  3BI2 A;  2VE7 C;  4X9N A;  4A9W A;  3GMB A;  5CKU A;  2YTN A;  2NPX A;  1N34 E;  2E72 A;  1RSG A;  2JOX A;  2GLI A;  5KNL A;  2BB8 A;  3QFB A;  4U2L A;  3CND A;  1FEA A;  1CC6 A;  4FDC B;  4U0F A;  2B3T B;  4F9A B;  2K4V A;  1K30 A;  1VKU A;  5CZD B;  3SQP A;  2M1S A;  3OZ2 A;  3G71 P;  2EN4 A;  1ZAA C;  2ACZ A;  2BS4 A;  1A1L A;  2ADR A;  4P78 A;  2RS7 A;  2IHR 1;  2R0G A;  4J2W A;  1LTX R;  3CC7 P;  4CCQ A;  4G74 A;  2DMY A;  1S72 P;  4YXD A;  1VQP P;  2R45 A;  3HTX A;  4BBY A;  2YG5 A;  4H2N A;  3LJP A;  4A7A A;  3P05 A;  1ZR9 A;  3CPI G;  1KQS O;  2KGC A;  1IBL E;  2C76 A;  1YYO A;  2L9F A;  3L1R A;  2JB1 A;  2MD9 A;  1N32 E;  2OAR A;  2FTX B;  4COC A;  2UZZ A;  2DB2 A;  2MF4 A;  1GRB A;  2C7G A;  1O94 A;  2L6M A;  1F3P A;  1SFE A;  4BMJ A;  4EQW A;  1X47 A;  5U1O A;  4YSZ A;  3NKS A;  3QG5 C;  4GKJ E;  4K5R A;  1T39 A;  1VDC A;  4PXH B;  2NVK X;  2IVE A;  2HGH A;  3GZM A;  4DR1 E;  3GMC A;  3T14 A;  2YLX A;  3HYV A;  3KWR A;  4YTM A;  4J8Z A;  2WBT A;  1DJN A;  2GDY A;  2VRD A;  3DA1 A;  2EM5 A;  4JI7 E;  3DS0 A;  3BHF A;  1UNK A;  2V85 A;  2R9Z A;  3G28 A;  2XFO A;  2EFJ A;  5A6A A;  4DR3 E;  3UKF A;  3SY4 A;  4LII A;  2ROQ A;  1F8W A;  2D9H A;  1YI2 P;  4EMJ A;  4JI4 E;  2DSY A;  1K4Q A;  1VQ9 P;  4RG3 A;  1BXI A;  4AQY E;  1JNR A;  1JNZ A;  3CMM A;  4R0M A;  3AEC A;  1GTE A;  4J34 A;  2C65 A;  2EHS A;  3LRY A;  1M6I A;  2EN1 A;  3GDP A;  4WPY A;  1TDF A;  4U0A A;  1VQW A;  3DJD A;  4CNJ A;  1EOQ A;  4ICY A;  2JU2 A;  1ZMC A;  2WP9 A;  1B4V A;  1BF3 A;  3AE2 A;  2GDW A;  1DOE A;  1E1M A;  3AE1 A;  5JCK A;  2GB0 A;  4Z43 A;  3P1W A;  2KWL A;  1NAA A;  1IUV A;  2BC1 A;  2GR3 A;  2RGH A;  2XVH A;  2YR6 A;  2PEK A;  1XAN A;  1XMO E;  3NK2 X;  3RG6 C;  4YT0 A;  1A1F A;  2VLN A;  2X99 A;  2L2K B;  1A1G A;  1DV5 A;  1IUT A;  5AE2 A;  3ALJ A;  2XZ1 C;  2L33 A;  4B69 A;  4CRT A;  2J3N A;  3H09 A;  1X6F A;  1GPE A;  2UUB E;  3J7Y p;  3IC9 A;  2Z46 A;  4OCG A;  2UU9 E;  4Z44 A;  2QEX P;  4R8O A;  5KL7 A;  3VK6 A;  4H50 A;  3UKA A;  2GAG B;  3LOV A;  2KOR A;  5A69 A;  1JU2 A;  4WXC A;  3ABV A;  4F9C B;  1Y56 A;  2K92 A;  4P7D A;  4DUZ E;  4BS9 A;  5HVC A;  3G4S P;  3NT6 A;  3NNE A;  2RGJ A;  1ZU1 A;  4GZN C;  4R2P A;  2Y6R A;  3FIG A;  5EOW A;  1UKV G;  4OVI A;  1ZOY A;  2KOU A;  1UIL A;  3P4R A;  4D03 A;  4WXD A;  3IWC A;  3AD9 B;  3UP4 A;  2OA1 A;  2RGO A;  2WBU A;  2YG6 A;  3CNT A;  4Y4M A;  5HGM A;  2KOO A;  2MC5 A;  3JU0 A;  2KGE A;  4UDP A;  5KL4 A;  1Q7Y Q;  2BUO A;  2JYL A;  1QU6 A;  1JOA A;  3VHT B;  1FOH A;  5AC4 A;  2JU1 A;  2V6O A;  5KMR A;  2AVA A;  1M1K Q;  4O5Q A;  2VQE E;  5BS1 A;  1SEZ A;  1PXA A;  1TDE A;  4AP1 A;  2EOR A;  2FVE A;  1YKJ A;  4U0E A;  1IQS A;  4U8N A;  1IMU A;  2EPZ A;  1GET A;  1YHQ P;  2YRH A;  1AOG A;  3KD9 A;  3CCQ P;  3D8X A;  4PAA A;  2EN8 A;  3VYX A;  4XXG A;  3IWD A;  2V60 A;  3RG2 A;  1H7X A;  3NK0 X;  1SR9 A;  1N4U A;  2YLZ A;  4M2Z A;  3HYW A;  3BNU A;  3GYX A;  1BWC A;  5KOW A;  2EM7 A;  1KYQ A;  1PKP A;  5A6B D;  1V59 A;  2LJU A;  4J36 A;  4O5G A;  4LFB E;  4OPL A;  1FKA E;  2R46 A;  2YG4 A;  2WCC 3;  4GAV A;  4DNA A;  4B65 A;  3QSE A;  3DME A;  5BR8 E;  1K0J A;  2VLO A;  1N4W A;  1PDA A;  1YJW P;  3H4K A;  3DPH A;  4ZN0 A;  3B5I A;  4B64 A;  2WBA A;  1HQB A;  2R4J A;  4BUR A;  2LTE A;  3AD8 B;  1KC8 Q;  4TM4 A;  4TLX A;  1RYI A;  4PH1 A;  1IBM E;  3PVC A;  2XFQ A;  1PJ5 A;  4G9K A;  2JR1 A;  2AFD A;  3V3O A;  2WDR A;  4U0B A;  3DH9 A;  3UTH A;  2YTP A;  1DJQ A;  2QA2 A;  1QVF O;  3AEF A;  1NJI Q;  4R2D A;  3EPT A;  4BJZ A;  3GD3 A;  2BK4 A;  2YU8 A;  2Q0K A;  2LIU A;  3PS9 A;  2XDO A;  2MDG A;  4DR6 E;  1STU A;  4LFA E;  3VQR A;  4BK2 A;  1J5E E;  3NIX A;  1IBK E;  4GR2 A;  4IZ6 A;  2EOH A;  2FGG A;  4LF4 E;  3H0D A;  5F3W A;  2WET A;  4ZYH A;  4H4Q A;  1AAY A;  3R9U A;  1CL0 A;  1QRJ A;  3ALL A;  1K73 Q;  1PJS A;  1A1H A;  1T4O A;  2YTE A;  1ZOV A;  2YTJ A;  3ADJ A;  2QA1 A;  2LTS A;  2GZG A;  2AFE A;  1GTK A;  2EE8 A;  2X8G A;  1L4S A;  4K0K E;  3O0H A;  2CSH A;  4JI2 E;  1BB8 A;  1GXF A;  4Z25 A;  3K30 A;  1WHQ A;  3CNP A;  3AYI A;  5FMH A;  2LCE A;  1ZKQ A;  1OJC A;  2YPN A;  4K5S A;  5A2Q C;  2EPM X;  1Y56 B;  2FJD A;  3ZOQ B;  2EOY A;  1AH5 A;  3AE3 A;  1NHR A;  2WQY A;  3CE7 A;  2G7H A;  4KPR A;  1IQO A;  5A6K A;  1K0L A;  4YWO A;  4IVM B;  4HTG A;  3DTJ A;  1KNP A;  2GZI A;  5AE1 A;  2BAB A;  3GYI A;  4OPT A;  2GYK A;  4DV5 E;  1XPQ A;  5KVI A;  2WPE A;  1UBD C;  2EQ7 A;  3C4B A;  1HR0 E;  4JV5 E;  2BRA A;  3QVP A;  2BXS A;  3BGH A;  1LVL A;  1TYP A;  4O4K A;  4R2Q A;  1FL2 A;  2ARD A;  3AEG A;  4XRQ A;  4X62 E;  3D1C A;  4G6G A;  3DJW A;  5JPA A;  3UTF A;  3QVR A;  4U0C A;  3LAD A;  4U0D A;  2EMW A;  2GDX A;  3UOZ A;  5EB4 A;  2L0Q A;  1QVG O;  4ECH A;  2EL4 A;  1DOD A;  2BC0 A;  1EL8 A;  1PXB A;  4DV7 E;  1PBF A;  3ADG A;  2EOX A;  5GRT A;  3F8D A;  4H4S A;  4U8I A;  3AE4 A;  4FK1 C;  1F8R A;  1GEU A;  2GR0 A;  1RP0 A;  4C74 A;  4YSX A;  3S5W A;  4EMI A;  2LL8 A;  2EOF A;  4EIP A;  3HZQ A;  2VF1 A;  3K7T A;  1GND A;  2LJH A;  4QKO A;  2EM9 A;  1DI2 A;  5EJD A;  2EWL A;  1BGN A;  2OLN A;  4GR6 A;  2AF8 A;  2L2M A;  3AEB A;  3KZY A;  3KU9 A;  1IUX A;  1RQ0 A;  4ADW A;  2K7I A;  1YQ3 A;  4A79 A;  3HZL A;  3KVE A;  4ZCD A;  1N3G A;  2EQ3 A;  3ICR A;  1FR2 A;  2R0C A;  4PH0 A;  2LPK A;  2JY9 A;  3DJJ A;  4X4J A;  4BK3 A;  3IHM A;  5JCL A;  5KWF A;  2PEM A;  3GWF A;  1Z6L A;  3AEA A;  2XFU A;  1DOB A;  1Q1W A;  5GSN A;  2EL6 A;  2ZBW A;  4JN9 A;  1YFH A;  1D7L A;  3RP8 A;  4H4W A;  3ZDN A;  3C4T A;  1JRX A;  5BUK A;  2CFY A;  2RS6 A;  1BGJ A;  1XHC A;  2Y6Q A;  1EH7 A;  1S2Q A;  4F37 A;  1HYU A;  4H7U A;  5LV9 A;  2LKI A;  4AT2 A;  4X66 E;  1I94 E;  5F2N A;  1YZ9 A;  2BA9 A;  1MXT A;  2V3A A;  4UDQ A;  3VR9 A;  3TQM A;  1DNC A;  2YTD A;  1TF6 A;  1PBD A;  2WU2 A;  4DV2 E;  3T2Y A;  2B7T A;  1G2D C;  1YJN P;  2OLO A;  1K9M Q;  2EMG A;  3LZW A;  4BCA A;  2EL5 A;  1GES A;  4H4Z A;  3UCL A;  3NYC A;  4JQ9 A;  5CQF A;  3AXB A;  3C6M A;  1KJK A;  1CHU A;  5FS8 A;  3CD6 P;  2YG7 A;  1L0H A;  5CFF E;  3CCR P;  3FIM B;  2GR1 A;  1EMV A;  2OTL P;  4WSG A;  4BK1 A;  2YZT A;  4P9S A;  5IQ1 A;  2MC6 A;  4TLZ A;  2ZZ0 A;  2WHD A;  2V83 A;  1VQ6 P;  3T2Z A;  2LE2 A;  2BK5 A;  2F5Z A;  4D04 A;  2W0H A;  2CWO A;  1MEY C;  1ONF A;  1X3C A;  1AYI A;  4A5L A;  2E5V A;  1VQL P;  1LV0 A;  2PY8 A;  4HKG A;  3G26 A;  4LF7 E;  5J60 A;  3OTO E;  3G21 A;  3P1X A;  1S3B A;  4AP3 A;  3Q20 A;  4B3M E;  3EPL A;  2N6Y A;  5IT9 C;  4LF5 E;  4LTY A;  1GTH A;  2KG9 A;  3PO7 A;  5A6B A;  4Z26 A;  5LMU E;  1B5Q A;  1FEB A;  2ODR D;  4EMW A;  3KKJ A;  4DV1 E;  2JBV A;  3L8K A;  4NTC A;  3C4N A;  1KFY A;  2GRT A;  1M74 A;  3DS4 A;  4DR7 E;  2KR5 A;  3CC2 P;  4NXN E;  3Q9T A;  4F9B B;  1RC7 A;  1NEK A;  3RP6 A;  4GUV A;  2RSI A;  3IF9 A;  3MSW A;  2LV2 A;  3EJB A;  2JQ4 A;  4BPG A;  3DS3 A;  2EOI A;  4M9V C;  4Y4L A;  2WOW A;  1TYT A;  1PN0 A;  3CNJ A;  4A6N B;  2NA2 A;  3B6D A;  2XVE A;  2YSP A;  3EPJ A;  1VQM P;  1GPJ A;  1RMD A;  2FJE A;  3DJE A;  4H4V A;  1PBC A;  2BBG A;  2WDV A;  2EMZ A;  2WU5 A;  4TM3 A;  2EMF A;  1E1K A;  4GR1 A;  2X50 A;  2K93 A;  5KL5 A;  2B7R A;  4NZV A;  1Q9I A;  4XRO A;  3NN0 X;  4R2S A;  2EN3 A;  2X8C A;  2DLK A;  4FK5 C;  4YTN A;  4RG4 A;  1N36 E;  1HNW E;  1B37 A;  4OPC A;  3GDN A;  2FJA A;  3CCS P;  3KLJ A;  1T4N A;  2JAZ A;  4H2Y C;  2B9X A;  4M30 A;  2JKC A;  3HPS A;  2YVF A;  4DV3 E;  1PXC A;  4I59 A;  3EF6 A;  2EPA A;  1GER A;  4USR A;  1OJ9 A;  2KOD A;  1EIA A;  3JSK A;  4EQR A;  1K0I A;  4JI1 E;  2HJJ A;  1D4C A;  3P4Q A;  5JCI A;  2F8B A;  1A1J A;  1ZY8 A;  1X6H A;  2HC5 A;  2YVJ A;  3NYF A;  2CQ8 A;  3CCE P;  2EMA A;  4JY3 A;  1H6V A;  3P9U A;  4OPU A;  3JAM C;  3GRT A;  4C3X A;  3QJ4 A;  4JDR A;  4U8L A;  4O24 A;  1RO2 A;  2M8N A;  1ZDL A;  1BKW A;  2H89 A;  3F8P A;  4NHR A;  2VRL A;  1G2F C;  4YSY A;  2QAE A;  2EN7 A;  4NTE A;  3ALM A;  3JTZ A;  3CMA P;  2M7Q A;  4COP A;  2EN2 A;  1GXH A;  4H4P A;  2MKD A;  1PJ7 A;  4REK A;  2C73 A;  5FS7 A;  4ZCC A;  3H4E A;  1NPX A;  1REO A;  4H4U A;  1W2B O;  5EBK A;  2O9Z A;  1L9C A;  5LLQ A;  1E6J P;  2EZ6 A;  5KL2 A;  2GZF A;  2WP6 A;  3DF6 A;  2KHX A;  5KL6 A;  2A8X A;  2MR8 A;  2H36 X;  3DGH A;  2M5R A;  1IUU A;  2N5H A;  2ZM6 E;  4CA3 A;  2LUP B;  5IXM B;  2EHT A;  4NNJ A;  5HHF A;  2AR8 A;  1P2H A;  4CY8 A;  2GQF A;  2I13 A;  2CG5 B;  1EH6 A;  3J80 C;  2YLW A;  2ELZ A;  1ZK7 A;  5DBJ A;  3VRA A;  2JYG A;  2YR5 A;  3DK9 A;  2N5I A;  2EMX A;  5LL6 R;  4U2S A;  3B4Q A;  4UHP B;  1D4D A;  2VSQ A;  1PJQ A;  4PAB A;  3M99 B;  4LU6 A;  4DR5 E;  3NH3 X;  4GRT A;  1E7P A;  1JK2 A;  4NXM E;  2KGA A;  2EQ9 A;  3NTA A;  2JXP A;  1VQ4 P;  2XLU A;  2LMZ A;  2EM4 A;  1YUJ A;  3NHO X;  3H8I A;  2K0D X;  3EJD A;  4I8O A;  3T31 A;  2E1M A;  2WP5 A;  1X49 A;  1L0I A;  2EPC A;  5BUL A;  2GMJ A;  5KP6 B;  2KON A;  2V88 A;  1MOK A;  2TMD A;  2LVH A;  2WDQ A;  2BRY A;  3H47 A;  4ZYE A;  1E6E A;  5JCN A;  1UHZ A;  1BBG A;  3BHK A;  2FHS C;  3EPH A;  1TF3 A;  4AOS A;  2GZE A;  2C3D A;  1GZ6 A;  2UXB E;  2RSM A;  1P2E A;  1VG9 A;  5HV8 A;  2GPI A;  3UOY A;  1ZMB A;  4BPH A;  4F6N A;  3SFE A;  4B3R E;  2EG5 A;  4GKK E;  2EPK X;  1FJG E;  2R0P A;  3AYL A;  3WE0 A;  2K2Q A;  2L8T A;  3QSS A;  1YYK A;  2C4C A;  2YWL A;  1O0W A;  4R2R A;  1H81 A;  2KOQ A;  4MLQ A;  1QNT A;  4XFX A;  2K0Y A;  2EPL X;  3BI4 A;  2QNW A;  1TN9 A;  1XDI A;  1E1L A;  3RP7 A;  4U8J A;  1FEC A;  2C66 A;  3SGL A;  1VHN A;  2VQB A;  1VQO P;  4YHH E;  3FMW A;  3NTE A;  2JPA A;  3NY7 B;  4F54 A;  2YQU A;  2RTX A;  1GRF A;  1YY5 A;  2EQ6 A;  4AOX A;  4C5O A;  1NHQ A;  3GJN A;  4KZS A;  2YTF A;  2E4G A;  3M1M A;  4K7Z A;  4H4X A;  5HGL A;  3E2D A;  4NEO A;  4F2J C;  3EPK A;  2AQJ A;  4G6H A;  4U8P A;  4DR2 E;  1ZBQ A;  4KHP E;  5IPY A;  4X65 E;  1ACP A;  2FJB A;  4AT0 A;  2EOO A;  4X8W A;  5KP7 B;  1ZBT A;  2ERH A;  2IID A;  1EL9 A;  4J57 A;  2V87 A;  1CJ4 A;  4JY2 A;  4II3 A;  2JK6 A;  1E39 A;  3CPW O;  1LLM C;  4J31 A;  1VQ5 P;  1A8O A;  2C3C A;  4NEW A;  2EOS A;  1T38 A;  2TPR A;  4JI8 E;  3ATR A;  2VVM A;  3G1G A;  3IWA A;  2YTI A;  2YTO A;  1O95 A;  4H2R A;  1Q1R A;  2UUA E;  4Y4N A;  1GSN A;  2C70 A;  3NTD A;  2EPU A;  1D5T A;  5IV8 B;  2M8L A;  2YR4 A;  4TM1 A;  3KZZ A;  1WHN A;  4JNA A;  2FQ1 A;  1J26 A;  2JOB A;  1YPN A;  1E1N A;  2K5X A;  3UTG A;  1X5W A;  3ISH A;  3UKQ A;  3T1Y E;  1DQ3 A;  1CBO A;  1DOC A;  3UK3 C;  3SXI A;  3S61 A;  1X6E A;  2YVG A;  1DNY A;  4HB9 A;  3I3L A;  2QCU A;  2PRT A;  1F6M A;  3V3N A;  2BXR A;  3I56 P;  5L46 A;  2N6Z A;  2N3G A;  4JYA E;  1NEN A;  4MJW A;  3G5R A;  4IS1 C;  1YQZ A;  2ODR C;  2XLP A;  3AE5 A;  3EAN A;  2M4I A;  3ATQ A;  4X9M A;  2Z5X A;  4IJD A;  4YKF A;  2KGD A;  3NRN A;  5U25 A;  4EM4 A;  1GRH A;  2WOI A;  4K22 A;  5HGN A;  1OJT A;  4B66 A;  1HY8 A;  2B7S A;  4I58 A;  2BS2 A;  2EPP A;  4A99 A;  3CCU P;  2XVF A;  4C77 A;  1CJC A;  4DV4 E;  4H4Y A;  3AUZ A;  4TUG A;  2PYX A;  5BVA A;  2EPR A;  2KW2 A;  5EW5 E;  2LIW A;  4CCR A;  3H8L A;  2GHF A;  3VR8 A;  3HXL A;  2Z45 A;  2XLT A;  1GOS A;  2BCP A;  2NUE A;  1CJ2 A;  2DRP A;  2Z5Y A;  2R76 A;  3DGZ A;  5F2K A;  3UTE A;  2BYB A;  3UOX A;  1NEI A;  1IMQ A;  2LO3 A;  4TM0 A;  3UKL A;  4DKK A;  2EMI A;  4IA6 A;  2WZO A;  1W4X A;  2DGY A;  2JP9 A;  2I0Z A;  2AAQ A;  3AD7 B;  1OJA A;  2MVU A;  2PEN A;  1IUW A;  1KSU A;  2PHH A;  4R2E A;  2WEU A;  1IMP A;  4QNB A;  4KX6 A;  1Y0P A;  1OJD A;  4Z2U A;  2XT1 A;  1WRJ A;  2EQ1 A;  2C67 A;  2EM6 A;  2EIA A;  4DGK A;  3NLC A;  3NYE A;  3ZYX A;  4OOG C;  2YTQ A;  2GR2 A;  3QSM A;  2X8H A;  3SM8 A;  2FVA A;  1EL5 A;  2ENC A;  1BZL A;  2JB3 A;  3CPH G;  4EM3 A;  1Z1B A;  1LPF A;  1NHS A;  4DSG A;  2CVJ A;  2XFN A;  3T2K A;  2CPN A;  4WYQ B;  1PHH A;  2JWO A;  5T6J A;  5F2O A;  4H4R A;  4O43 A;  4U8O A;  5IQ4 A;  4K8D A;  1PS9 A;  4H2W C;  1M64 A;  2DKH A;  3SZW A;  3AV0 A;  4G73 A;  3G5S A;  1GRT A;  4H2X C;  4HEI A;  2QA4 P;  3SFD A;  4Q28 A;  3K7M X;  4BHB A;  3ICT A;  1DXL A;  3CCL P;  1GQE A;  5HGO A;  3CME P;  4LF6 E;  2ELY A;  1EL7 A;  1OR5 A;  3AWI A;  2UXD E;  3LZX A;  4YSH A;  3P4P A;  4BHC A;  3CC4 P;  2V8Q B;  4F6M A;  4WX9 A;  4DSH A;  3CTY A;  2B76 A;  2HQM A;  4H2P A;  4GCM A;  1M6E X;  3IWB A;  2WOV A;  1VQN P;  2APG A;  2MDR A;  1JRY A;  4KWY A;  5J7X A;  1GT8 A;  1T8K A;  3I6D A;  2BS3 A;  4LU9 A;  1S3E A;  2C75 A;  5ER0 A;  4WYM A;  4B1B A;  5IWA E;  4N9X A;  2GZJ A;  1LQT A;  2N8X A;  2H88 A;  1N4V A;  2LRS A;  1MGT A;  1WXR A;  2KOP A;  4GF7 A;  2YT4 A;  3UKK A;  1CEI A;  2FAC A;  2PEO A;  4DUY E;  2GF3 A;  3RHA A;  2ZZC A;  2EM2 A;  3HQ1 A;  4OX9 E;  1D4E A;  3IHG A;  4IA5 A;  1M90 Q;  3AED A;  3QFA A;  1UN6 B;  5FLX C;  3C96 A;  2KG8 A;  2C72 A;  2P9X A;  2EPO A;  2Z44 A;  2EJ4 A;  2L3C A;  1T4L B;  1CF3 A;  2N50 A;  2CUL A;  3CCM P;  2GV8 A;  1PDH A;  4IPY A;  1VG0 A;  2EPX A;  2LF4 A;  3HYX A;  1B69 A;  3WBH A;  4R2C A;  4R03 A;  5HYM A;  1NQ4 A;  2K0X A;  5KMS A;  5AAS A;  1F2I G;  1MZ8 A;  3ADI A;  1CJ3 A;  4RHB B;  4U8M A;  4E0V A;  2YAU A;  3NN6 X;  3UKP A;  2FBW A;  1H86 A;  1H82 A;  2OAM A;  3FPZ A;  2OAL A;  4WFT A;  2NUG A;  2BK3 A;  1BAJ A;  3I55 P;  1GXG A;  7CEI A;  1H7W A;  1NG3 A;  4IV9 A;  2LML A;  2X2B A;  2XYO A;  1Q81 Q;  1ZMD A;  1YIT P;  3OC4 A;  4OPG A;  1CC4 A;  3CGD A;  1NDA A;  2YLT A;  1TRB A;  2KOS A;  4X64 E;  2F4V E;  4BC7 A;  3RED A;  2FAD A;  3DS1 A;  1ELI A;  1CC2 A;  4EQX A;  3CGB A;  3VRL C;  5DNY A;  2RPC A;  1B8S A;  3HPZ A;  1NG4 A;  4XWZ A;  5JCM A;  2EOM A;  5TSE A;  4X9J A;  2CNR A;  4MLV A;  2DLQ A;  4JI6 E;  1COY A;  1M6N A;  1KLP A;  3DK4 A;  1TDK A;  3EQ1 A;  2A87 A;  4GAP A;  2X3N A;  3ECR A;  1A1K A;  1KNR A;  4YY3 E;  1YYW A;  1YIJ P;  3BNM A;  2FVF A;  2YTG A;  2FAE A;  3ICS A;  3M12 A;  4GEQ B;  3GRS A;  1QJD A;  4O5U A;  4NTD A;  4DG9 A;  3II4 A;  5DCK A;  4B3T E;  4BJY A;  3OML A;  2E5L E;  3GWD A;  1GAL A;  2EOZ A;  2XXM A;  1YJ9 P;  3B3R A;  3AE8 A;  1WJP A; 
#chains in the Genus database with same CATH homology
 3F8R A;  3CN8 A;  1PBB A;  4FK1 A;  3DK8 A;  3CNS A;  5LMN E;  5C3J A;  1O5W A;  1XMQ E;  3F6H A;  4Z2T A;  2UXC E;  2XCG A;  4CNK A;  5M10 A;  2Q6U A;  3CGE A;  3CCV P;  3MGE A;  2EQ8 A;  4K2X A;  1MO9 A;  1K8A Q;  4HA6 A;  2M8P A;  3T0K A;  4II2 A;  5BRT A;  1HNX E;  1A43 A;  4J56 A;  2VOU A;  2GEW A;  3VRD B;  3SZ0 A;  3AB1 A;  1L9D A;  3SZF A;  2JVA A;  3NG7 X;  4XFZ A;  2WPF A;  1VQK P;  4L8N A;  5AE3 A;  4C3Y A;  4FX9 A;  3DS2 A;  3GYJ A;  2JAE A;  1IUQ A;  4H2Q A;  5KMP A;  2BAC A;  3SZC A;  3Q6J A;  2GH5 A;  1IJH A;  1GV4 A;  2YLS A;  2IVD A;  2B9Y A;  3FBS A;  1FCD A;  2WES A;  5M0Z A;  3J7A G;  1PBE A;  4WSP A;  4LF9 E;  4JI0 E;  3RNM A;  2V5Z A;  3G6E P;  1TDN A;  4USQ A;  3T1H E;  2PEI A;  4H4T A;  3P4S A;  1VQ8 P;  1KF6 A;  2XLR A;  3K6Q A;  4BV6 A;  3AE9 A;  5HY5 A;  3HYB A;  3VRB A;  4OPI A;  4WCT A;  1JEH A;  1RO0 A;  5BS2 A;  2B9W A;  1VQ7 P;  1VRQ B;  1ZP0 A;  2LBS B;  1N33 E;  2OTJ P;  2JB2 A;  1AUM A;  4LA1 A;  2Q7V A;  5KXJ A;  2ONT A;  5I4T G;  5EB5 A;  4NZH A;  1L0V A;  3FG2 P;  3URH A;  3LLH A;  2XLS A;  2VQF E;  3G1I A;  3M13 A;  1Q82 Q;  1GRA A;  4J33 A;  3CPJ G;  1D1D A;  3ADA B;  1YQ4 A;  3E1T A;  1IUS A;  2VVL A;  3EAO A;  3AE6 A;  3AYJ A;  2L6E A;  5ADZ A;  1JRZ A;  4YTP A;  2RAB A;  4CY6 A;  4DV0 E;  4A6N A;  1TDO A;  3VYY A;  4WX1 A;  1H83 A;  5C2T A;  3AEE A;  4JNQ A;  3G5Q A;  4U2T A;  2GVC A;  1EKZ A;  3C4A A;  1XNR E;  2GMH A;  3SYI A;  1N8R Q;  2BHV A;  2PEJ A;  2UUC E;  4B68 A;  4UP3 A;  4DV6 E;  1GRG A;  2L2N A;  2YM2 A;  4DMI A;  1KD1 Q;  1QO8 A;  4Z2R A;  2N3H A;  4IVO B;  4Z24 A;  4TUI A;  3T37 A;  1EBD A;  1X48 A;  2XFP A;  2V61 A;  5FS9 A;  4JI3 E;  3ADL A;  2BCG G;  1XNQ E;  1LJ1 A;  3KPF A;  4NEV A;  3UP5 A;  4YKG A;  3G29 A;  4OPD A;  2GAH B;  2R4E A;  3COX A;  4M0V A;  3AE7 A;  2B7V A;  5HXI A;  2PEQ A;  2L92 A;  3CCJ P;  4APN A;  4BC9 A;  3SX6 A;  3LXD A;  4M52 A;  2GQW A;  2HHH E;  4DR4 E;  4EIQ A;  2C64 A;  4XWR A;  1LQU A;  2VVL G;  5TR3 A;  4RSL A;  3BI5 A;  2DKI A;  2CDU A;  2VQ7 A;  3RMP A;  4EQS A;  2ZZB A;  4UDR A;  1L9E A;  1PJ6 A;  3M0O A;  3KPK A;  3V76 A;  2DIX A;  3GSI A;  4CBQ A;  2A89 A;  5KOX A;  1GRE A;  2LTR A;  2Q0L A;  1F8S A;  2L3J A;  1ZX9 A;  2XVJ A;  2NUF A;  3ITJ A;  2VZ2 A;  3GD4 A;  3CGC A;  1KDG A;  3DS5 A;  4JI5 E;  3CIR A;  2YM1 A;  5KVH A;  1KSS A;  3DJG X;  2LUQ A;  1N1P A;  3F6G A;  3LML A;  4GDP A;  1Q86 Q;  1JJ2 O;  3NK1 X;  2YG3 A;  1RNI A;  1H84 A;  2FV4 B;  2WPC A;  4A65 A;  4M0I A;  4LF8 E;  1X31 B;  1HNZ E;  3K7Q X;  4L5N C;  4XFY A;  2V89 A;  1QLB A;  2B9D A;  4B3S E;  2YLR A;  3G0V A;  2V3B A;  3UKH A;  5U63 A;  2WS3 A;  3CXC O;  3LB8 A;  3NGC X;  4NWZ A;  2VRM A;  2XVI A;  2V86 A;  4GDE A;  2JO0 A;  3KA7 A;  5FS6 A;  3J81 C;  4LFC E;  4U8K A;  4B63 A;  5KMQ A;  4B67 A;  3OW2 O;  1D7Y A;  1NHP A;  3UOV A;  2XV6 A;  5KRQ A;  1S2Y A;  3BI2 A;  2VE7 C;  4X9N A;  4A9W A;  3GMB A;  5CKU A;  2NPX A;  1N34 E;  1RSG A;  2JOX A;  5KNL A;  3QFB A;  4U2L A;  3CND A;  1FEA A;  1CC6 A;  4FDC B;  4U0F A;  2B3T B;  4F9A B;  2K4V A;  1K30 A;  3SQP A;  2M1S A;  3OZ2 A;  3G71 P;  2ACZ A;  2BS4 A;  4P78 A;  2RS7 A;  2IHR 1;  2R0G A;  4J2W A;  1LTX R;  3CC7 P;  4CCQ A;  4G74 A;  2DMY A;  1S72 P;  4YXD A;  1VQP P;  2R45 A;  3HTX A;  4BBY A;  2YG5 A;  4H2N A;  3LJP A;  4A7A A;  3P05 A;  3CPI G;  1KQS O;  1IBL E;  2C76 A;  1YYO A;  3L1R A;  2JB1 A;  1N32 E;  2OAR A;  2FTX B;  4COC A;  2UZZ A;  2DB2 A;  1GRB A;  2C7G A;  1O94 A;  2L6M A;  1F3P A;  4BMJ A;  4EQW A;  1X47 A;  5U1O A;  4YSZ A;  3NKS A;  4GKJ E;  4K5R A;  1VDC A;  2NVK X;  2IVE A;  4DR1 E;  3GMC A;  3T14 A;  2YLX A;  3HYV A;  3KWR A;  4YTM A;  4J8Z A;  1DJN A;  3DA1 A;  4JI7 E;  3DS0 A;  3BHF A;  2V85 A;  2R9Z A;  3G28 A;  2XFO A;  2EFJ A;  4DR3 E;  3UKF A;  3SY4 A;  4LII A;  1F8W A;  1YI2 P;  4EMJ A;  4JI4 E;  2DSY A;  1K4Q A;  1VQ9 P;  4RG3 A;  4AQY E;  1JNR A;  1JNZ A;  3CMM A;  3AEC A;  1GTE A;  4J34 A;  2C65 A;  3LRY A;  1M6I A;  3GDP A;  4WPY A;  1TDF A;  4U0A A;  1VQW A;  3DJD A;  4CNJ A;  1EOQ A;  4ICY A;  1ZMC A;  2WP9 A;  1B4V A;  1BF3 A;  3AE2 A;  1DOE A;  1E1M A;  3AE1 A;  5JCK A;  2GB0 A;  4Z43 A;  3P1W A;  1NAA A;  1IUV A;  2BC1 A;  2GR3 A;  2RGH A;  2XVH A;  2YR6 A;  2PEK A;  1XAN A;  1XMO E;  3NK2 X;  3RG6 C;  4YT0 A;  2X99 A;  2L2K B;  1IUT A;  5AE2 A;  3ALJ A;  2L33 A;  4B69 A;  4CRT A;  2J3N A;  3H09 A;  1GPE A;  2UUB E;  3J7Y p;  3IC9 A;  2Z46 A;  4OCG A;  2UU9 E;  4Z44 A;  2QEX P;  4R8O A;  4H50 A;  3VK6 A;  3UKA A;  2GAG B;  3LOV A;  1JU2 A;  3ABV A;  4F9C B;  1Y56 A;  4P7D A;  4DUZ E;  4BS9 A;  3G4S P;  3NT6 A;  3NNE A;  2RGJ A;  2Y6R A;  3FIG A;  5EOW A;  1UKV G;  4OVI A;  1ZOY A;  2KOU A;  1UIL A;  3P4R A;  4D03 A;  3IWC A;  3AD9 B;  3UP4 A;  2OA1 A;  2RGO A;  3CNT A;  2YG6 A;  4Y4M A;  5HGM A;  2MC5 A;  3JU0 A;  4UDP A;  1Q7Y Q;  2BUO A;  2JYL A;  1QU6 A;  1JOA A;  1FOH A;  2V6O A;  5KMR A;  1M1K Q;  4O5Q A;  2VQE E;  5BS1 A;  1SEZ A;  1PXA A;  1TDE A;  4AP1 A;  1YKJ A;  4U0E A;  4U8N A;  1GET A;  1YHQ P;  1AOG A;  3KD9 A;  3CCQ P;  3D8X A;  4PAA A;  3VYX A;  4XXG A;  3IWD A;  2V60 A;  1H7X A;  3NK0 X;  1SR9 A;  1N4U A;  2YLZ A;  4M2Z A;  3HYW A;  3BNU A;  3GYX A;  1BWC A;  5KOW A;  1PKP A;  1V59 A;  4J36 A;  4LFB E;  4OPL A;  1FKA E;  2R46 A;  2YG4 A;  4GAV A;  4DNA A;  4B65 A;  3QSE A;  3DME A;  5BR8 E;  1K0J A;  1N4W A;  1YJW P;  3H4K A;  3DPH A;  4ZN0 A;  3B5I A;  4B64 A;  2WBA A;  2R4J A;  4BUR A;  3AD8 B;  4TLX A;  4TM4 A;  1KC8 Q;  1RYI A;  4PH1 A;  1IBM E;  3PVC A;  2XFQ A;  1PJ5 A;  4G9K A;  2JR1 A;  3V3O A;  4U0B A;  2WDR A;  3DH9 A;  3UTH A;  1DJQ A;  2QA2 A;  1QVF O;  3AEF A;  1NJI Q;  3EPT A;  4BJZ A;  3GD3 A;  2BK4 A;  2Q0K A;  3PS9 A;  2XDO A;  4DR6 E;  1STU A;  4LFA E;  3VQR A;  4BK2 A;  1J5E E;  3NIX A;  1IBK E;  4GR2 A;  2FGG A;  4LF4 E;  3H0D A;  5F3W A;  2WET A;  4H4Q A;  3R9U A;  1QRJ A;  1CL0 A;  3ALL A;  1K73 Q;  1T4O A;  1ZOV A;  3ADJ A;  2QA1 A;  2LTS A;  2X8G A;  4K0K E;  3O0H A;  4JI2 E;  1GXF A;  4Z25 A;  3K30 A;  1WHQ A;  3CNP A;  3AYI A;  5FMH A;  1ZKQ A;  1OJC A;  4K5S A;  5A2Q C;  1Y56 B;  2FJD A;  3ZOQ B;  3AE3 A;  1NHR A;  2WQY A;  2G7H A;  4KPR A;  1K0L A;  4YWO A;  4IVM B;  3DTJ A;  1KNP A;  5AE1 A;  2BAB A;  3GYI A;  4OPT A;  4DV5 E;  1XPQ A;  5KVI A;  2WPE A;  2EQ7 A;  3C4B A;  1HR0 E;  4JV5 E;  2BRA A;  3QVP A;  2BXS A;  1LVL A;  1TYP A;  1FL2 A;  2ARD A;  3AEG A;  4XRQ A;  4X62 E;  3D1C A;  4G6G A;  3DJW A;  5JPA A;  3UTF A;  3QVR A;  4U0C A;  3LAD A;  4U0D A;  3UOZ A;  5EB4 A;  1QVG O;  4ECH A;  1DOD A;  2BC0 A;  1EL8 A;  1PXB A;  4DV7 E;  1PBF A;  3ADG A;  5GRT A;  3F8D A;  4H4S A;  4U8I A;  3AE4 A;  4FK1 C;  1F8R A;  1GEU A;  2GR0 A;  1RP0 A;  4C74 A;  4YSX A;  3S5W A;  4EMI A;  4EIP A;  3HZQ A;  2VF1 A;  3K7T A;  1GND A;  2LJH A;  1DI2 A;  2EWL A;  1BGN A;  2OLN A;  4GR6 A;  2L2M A;  3AEB A;  3KU9 A;  1IUX A;  1RQ0 A;  4ADW A;  1YQ3 A;  4A79 A;  3HZL A;  3KVE A;  4ZCD A;  3ICR A;  2R0C A;  4PH0 A;  2JY9 A;  3DJJ A;  4X4J A;  4BK3 A;  3IHM A;  5JCL A;  5KWF A;  2PEM A;  3GWF A;  1Z6L A;  3AEA A;  2XFU A;  1DOB A;  1Q1W A;  5GSN A;  2ZBW A;  4JN9 A;  1D7L A;  3RP8 A;  4H4W A;  3ZDN A;  3C4T A;  1JRX A;  5BUK A;  2CFY A;  2RS6 A;  1BGJ A;  1XHC A;  2Y6Q A;  1S2Q A;  1HYU A;  4H7U A;  5LV9 A;  4AT2 A;  4X66 E;  1I94 E;  5F2N A;  1YZ9 A;  2BA9 A;  1MXT A;  2V3A A;  4UDQ A;  3VR9 A;  1DNC A;  1PBD A;  2WU2 A;  4DV2 E;  3T2Y A;  2B7T A;  2OLO A;  1YJN P;  1K9M Q;  3LZW A;  4BCA A;  1GES A;  4H4Z A;  3UCL A;  3NYC A;  4JQ9 A;  5CQF A;  3AXB A;  1CHU A;  5FS8 A;  3CD6 P;  2YG7 A;  5CFF E;  3FIM B;  3CCR P;  2GR1 A;  2OTL P;  4BK1 A;  2YZT A;  4P9S A;  5IQ1 A;  2MC6 A;  4TLZ A;  2ZZ0 A;  2WHD A;  2V83 A;  1VQ6 P;  3T2Z A;  2LE2 A;  2BK5 A;  2F5Z A;  4D04 A;  2W0H A;  2CWO A;  1ONF A;  4A5L A;  2E5V A;  1VQL P;  1LV0 A;  2PY8 A;  3G26 A;  4LF7 E;  5J60 A;  3OTO E;  3G21 A;  3P1X A;  1S3B A;  4AP3 A;  3Q20 A;  4B3M E;  5IT9 C;  4LF5 E;  4LTY A;  1GTH A;  3PO7 A;  4Z26 A;  5LMU E;  1B5Q A;  1FEB A;  2ODR D;  4EMW A;  3KKJ A;  4DV1 E;  2JBV A;  3L8K A;  4NTC A;  3C4N A;  1KFY A;  2GRT A;  1M74 A;  3DS4 A;  4DR7 E;  3CC2 P;  4NXN E;  3Q9T A;  4F9B B;  1RC7 A;  1NEK A;  3RP6 A;  4GUV A;  3IF9 A;  3MSW A;  3DS3 A;  4Y4L A;  2WOW A;  1TYT A;  1PN0 A;  3CNJ A;  4A6N B;  2NA2 A;  3B6D A;  2XVE A;  1VQM P;  2FJE A;  3DJE A;  4H4V A;  1PBC A;  2WDV A;  2WU5 A;  4TM3 A;  1E1K A;  4GR1 A;  2X50 A;  2B7R A;  1Q9I A;  4XRO A;  3NN0 X;  2X8C A;  4YTN A;  4RG4 A;  1N36 E;  1HNW E;  1B37 A;  4OPC A;  3GDN A;  2FJA A;  3CCS P;  3KLJ A;  1T4N A;  2B9X A;  4M30 A;  2JKC A;  3HPS A;  2YVF A;  4DV3 E;  1PXC A;  4I59 A;  3EF6 A;  1GER A;  4USR A;  1OJ9 A;  2KOD A;  1EIA A;  3JSK A;  4EQR A;  1K0I A;  4JI1 E;  1D4C A;  3P4Q A;  5JCI A;  2F8B A;  1ZY8 A;  2YVJ A;  3NYF A;  3CCE P;  4JY3 A;  1H6V A;  3P9U A;  4OPU A;  3JAM C;  3GRT A;  4C3X A;  3QJ4 A;  4JDR A;  4U8L A;  1ZDL A;  1RO2 A;  2M8N A;  1BKW A;  2H89 A;  3F8P A;  2VRL A;  4YSY A;  2QAE A;  4NTE A;  3ALM A;  3JTZ A;  3CMA P;  2M7Q A;  4COP A;  4H4P A;  1PJ7 A;  4REK A;  2C73 A;  5FS7 A;  4ZCC A;  3H4E A;  1NPX A;  1REO A;  4H4U A;  1W2B O;  5EBK A;  2O9Z A;  1L9C A;  1E6J P;  2EZ6 A;  2WP6 A;  3DF6 A;  2KHX A;  2A8X A;  2H36 X;  3DGH A;  1IUU A;  2ZM6 E;  2LUP B;  4NNJ A;  5HHF A;  1P2H A;  2AR8 A;  4CY8 A;  2GQF A;  3J80 C;  2YLW A;  1ZK7 A;  5DBJ A;  3VRA A;  2JYG A;  2YR5 A;  3DK9 A;  5LL6 R;  4U2S A;  1D4D A;  4PAB A;  4LU6 A;  4DR5 E;  3NH3 X;  4GRT A;  1E7P A;  4NXM E;  2EQ9 A;  3NTA A;  1VQ4 P;  2XLU A;  2LMZ A;  3NHO X;  3H8I A;  4I8O A;  3T31 A;  2E1M A;  2WP5 A;  1X49 A;  5BUL A;  2GMJ A;  2KON A;  2V88 A;  1MOK A;  2TMD A;  2WDQ A;  2BRY A;  3H47 A;  1E6E A;  5JCN A;  1UHZ A;  3BHK A;  4AOS A;  2C3D A;  1GZ6 A;  2UXB E;  2RSM A;  1P2E A;  1VG9 A;  3UOY A;  1ZMB A;  3SFE A;  4B3R E;  2EG5 A;  4GKK E;  1FJG E;  2R0P A;  3AYL A;  3WE0 A;  2L8T A;  3QSS A;  1YYK A;  2C4C A;  2YWL A;  1O0W A;  1H81 A;  4XFX A;  3BI4 A;  1XDI A;  1E1L A;  3RP7 A;  4U8J A;  1FEC A;  2C66 A;  3SGL A;  2VQB A;  1VQO P;  4YHH E;  3FMW A;  3NTE A;  4F54 A;  2YQU A;  2RTX A;  1GRF A;  1YY5 A;  2EQ6 A;  4AOX A;  4C5O A;  1NHQ A;  4KZS A;  2E4G A;  3M1M A;  4K7Z A;  4H4X A;  5HGL A;  3E2D A;  2AQJ A;  4G6H A;  4U8P A;  4DR2 E;  1ZBQ A;  4KHP E;  5IPY A;  4X65 E;  2FJB A;  4AT0 A;  4X8W A;  1ZBT A;  2IID A;  1EL9 A;  4J57 A;  2V87 A;  1CJ4 A;  4JY2 A;  4II3 A;  2JK6 A;  1E39 A;  3CPW O;  4J31 A;  1VQ5 P;  1A8O A;  2C3C A;  4NEW A;  3ATR A;  2TPR A;  4JI8 E;  2VVM A;  3G1G A;  3IWA A;  1O95 A;  4H2R A;  1Q1R A;  2UUA E;  4Y4N A;  1GSN A;  2C70 A;  3NTD A;  1D5T A;  2YR4 A;  2M8L A;  4TM1 A;  1WHN A;  4JNA A;  1J26 A;  2JOB A;  1E1N A;  3UTG A;  3ISH A;  3UKQ A;  3T1Y E;  1DQ3 A;  1CBO A;  1DOC A;  3SXI A;  3S61 A;  2YVG A;  4HB9 A;  3I3L A;  2QCU A;  1F6M A;  3V3N A;  2BXR A;  3I56 P;  5L46 A;  2N3G A;  4JYA E;  1NEN A;  4MJW A;  3G5R A;  1YQZ A;  2ODR C;  2XLP A;  3AE5 A;  3EAN A;  2M4I A;  3ATQ A;  4X9M A;  2Z5X A;  4YKF A;  3NRN A;  5U25 A;  4EM4 A;  1GRH A;  2WOI A;  4K22 A;  5HGN A;  1OJT A;  4B66 A;  2B7S A;  4I58 A;  2BS2 A;  4A99 A;  3CCU P;  2XVF A;  4C77 A;  1CJC A;  4DV4 E;  4H4Y A;  3AUZ A;  4TUG A;  2PYX A;  5BVA A;  4CCR A;  3H8L A;  3VR8 A;  3HXL A;  2Z45 A;  2XLT A;  1GOS A;  2BCP A;  2NUE A;  1CJ2 A;  2Z5Y A;  3DGZ A;  5F2K A;  3UTE A;  2BYB A;  3UOX A;  3UKL A;  4TM0 A;  4DKK A;  4IA6 A;  2WZO A;  1W4X A;  2DGY A;  2I0Z A;  2AAQ A;  3AD7 B;  1OJA A;  2PEN A;  1IUW A;  1KSU A;  2PHH A;  2WEU A;  4QNB A;  4KX6 A;  1Y0P A;  1OJD A;  4Z2U A;  2XT1 A;  2C67 A;  2EIA A;  4DGK A;  3NLC A;  3NYE A;  3ZYX A;  4OOG C;  2GR2 A;  3QSM A;  2X8H A;  3SM8 A;  1EL5 A;  1BZL A;  2JB3 A;  3CPH G;  4EM3 A;  1LPF A;  1NHS A;  4DSG A;  2CVJ A;  2XFN A;  3T2K A;  2CPN A;  4WYQ B;  1PHH A;  2JWO A;  5T6J A;  5F2O A;  4H4R A;  4U8O A;  5IQ4 A;  4K8D A;  1PS9 A;  1M64 A;  2DKH A;  3SZW A;  3AV0 A;  4G73 A;  3G5S A;  1GRT A;  2QA4 P;  3SFD A;  4Q28 A;  3K7M X;  3ICT A;  1DXL A;  3CCL P;  1GQE A;  5HGO A;  3CME P;  4LF6 E;  1EL7 A;  3AWI A;  2UXD E;  3LZX A;  4YSH A;  3P4P A;  3CC4 P;  2V8Q B;  4DSH A;  3CTY A;  2B76 A;  2HQM A;  4H2P A;  4GCM A;  1M6E X;  3IWB A;  2WOV A;  1VQN P;  2APG A;  2MDR A;  1JRY A;  5J7X A;  1GT8 A;  3I6D A;  2BS3 A;  4LU9 A;  1S3E A;  2C75 A;  5ER0 A;  4WYM A;  4B1B A;  5IWA E;  4N9X A;  1LQT A;  2H88 A;  1N4V A;  2LRS A;  4GF7 A;  1WXR A;  3UKK A;  2YT4 A;  2PEO A;  4DUY E;  2GF3 A;  3RHA A;  2ZZC A;  3HQ1 A;  4OX9 E;  1D4E A;  3IHG A;  4IA5 A;  1M90 Q;  3AED A;  3QFA A;  5FLX C;  3C96 A;  2C72 A;  2P9X A;  2Z44 A;  2L3C A;  1T4L B;  1CF3 A;  2CUL A;  3CCM P;  2GV8 A;  1PDH A;  4IPY A;  1VG0 A;  2LF4 A;  3HYX A;  3WBH A;  5HYM A;  4R03 A;  5KMS A;  5AAS A;  3ADI A;  1CJ3 A;  4U8M A;  4E0V A;  2YAU A;  3NN6 X;  3UKP A;  2FBW A;  1H86 A;  1H82 A;  2OAM A;  3FPZ A;  2OAL A;  4WFT A;  2NUG A;  2BK3 A;  1BAJ A;  3I55 P;  1H7W A;  1NG3 A;  4IV9 A;  2XYO A;  1Q81 Q;  1ZMD A;  1YIT P;  3OC4 A;  4OPG A;  1CC4 A;  3CGD A;  1NDA A;  2YLT A;  1TRB A;  4X64 E;  2F4V E;  4BC7 A;  3RED A;  3DS1 A;  1ELI A;  1CC2 A;  4EQX A;  3CGB A;  3VRL C;  5DNY A;  1NG4 A;  1B8S A;  3HPZ A;  5JCM A;  4XWZ A;  4JI6 E;  1COY A;  1M6N A;  3DK4 A;  1TDK A;  2A87 A;  4GAP A;  2X3N A;  1KNR A;  4YY3 E;  1YYW A;  1YIJ P;  3BNM A;  3ICS A;  3M12 A;  4GEQ B;  3GRS A;  1QJD A;  4O5U A;  4NTD A;  3II4 A;  5DCK A;  4B3T E;  4BJY A;  3OML A;  2E5L E;  3GWD A;  1GAL A;  2XXM A;  1YJ9 P;  3B3R A;  3AE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...