2E2OA

Crystal structure of sulfolobus tokodaii hexokinase in complex with glucose
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
299
structure length
299
Chain Sequence
MMIIVGVDAGGTKTKAVAYDCEGNFIGEGSSGPGNYHNVGLTRAIENIKEAVKIAAKGEADVVGMGVAGLDSKFDWENFTPLASLIAPKVIIQHDGVIALFAETLGEPGVVVIAGTGSVVEGYNGKEFLRVGGRGWLLSDDGSAYWVGRKALRKVLKMMDGLENKTILYNKVLKTINVKDLDELVMWSYTSSCQIDLVASIAKAVDEAANEGDTVAMDILKQGAELLASQAVYLARKIGTNKVYLKGGMFRSNIYHKFFTLYLEKEGIISDLGKRSPEIGAVILAYKEVGCDIKKLISD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEXOKINASE
publication title Crystal structures of an ATP-dependent hexokinase with broad substrate specificity from the hyperthermophilic archaeon Sulfolobus tokodaii.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transferase
total genus 112
structure length 299
sequence length 299
ec nomenclature ec 2.7.1.1: Hexokinase.
pdb deposition date 2006-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2e2oA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2e2oA01
3DAWA 4BC5A 3MN7A 4MO4A 2QWRA 5AZJA 2P9PB 4JHDB 2A5XA 2GELA 5AQHA 4IWVA 3UKUB 1HPMA 4XH5A 3FZFA 5AQOA 1BU6O 2YHYA 4BR4A 4K25A 3H6EA 3ATUA 2FF3B 4BRIA 4H0VB 4XEIA 4PL7A 3FLCO 5JLFA 2E2PA 4I6MA 3VOVA 4ISGA 4FOEA 5BRDA 2P9KB 5BRHA 1HLUA 2E8AA 3WEEB 1DEJA 1NGFA 4BG9A 4BRKA 4MLEA 2ASOA 2UYTA 3WT0A 4B1VA 2I7PA 3LM9A 2ZF5O 1NGIA 5AQXA 1K8KB 3VETA 3CQYA 3ULEA 3C7NA 2YJFA 4O8KA 3KZBA 4FPBA 2QWLA 4BR5A 1HKCA 2QW9A 5JLHA 1QHAA 4DHYA 2A3ZA 3O4WA 4L3QA 4H5WA 2W41A 3A8YA 2QWPA 5FPDA 3SLCA 3CHWA 4E1JA 1G99A 4BR2A 4PKGA 2CH5A 3JXUA 1RDWX 1QQNA 1GLJO 2EWSA 3DXKB 3H45C 2E2QA 4BROA 1BG3A 4H03B 4H0XB 3VGLA 2QM1A 1LCUA 2IIRA 5EOYA 4BRDA 1DGKN 4CD3A 4BRGA 5AQWA 5AQLA 1C0FA 4IZ9A 3MN5A 4H5NA 4CZIA 1HKGA 2P9LA 3WXKA 1Z6RA 3VEYA 3O6WA 1SAZA 3TU5A 2FSNA 3DJCA 3HBTA 2Q31A 3C0BA 3MCPA 1XUPO 3A0IX 3VEVA 4B1ZA 1SZ2A 2CH6A 4FWMA 3QFPA 5AR0A 2FSJA 3DXMA 2AP1A 3U4LA 4BRAA 4A2BA 1E4FT 2GUPA 3CI5A 2GEMA 4EIAA 4ISEA 3VEXA 1OKJA 3FGUA 4GY2B 4K43A 3WUHA 4DCHA 3D7EO 4CZLA 3ZETA 5JICA 1RGIA 4BR0A 2FSKA 2Q0RA 2GWKA 1U2VB 3LDQA 1QQOA 3M1FA 2BUPA 4FO0A 3QDKA 3CJAA 1KAXA 4BVOA 5EX5A 1HX1A 2V51B 3EZWA 3H3NO 3CJ9A 5BPLA 2J4RA 4BC4A 3MN9A 4BR7A 4B1UB 5KPRA 3EO3A 3WXJA 1T6CA 3ZX2A 5ADXH 2YHWA 2YI1A 3O5BA 2IVNA 3GDQA 3IDHA 1YAGA 1GLBG 2E2OA 3FFKB 3MK6A 2QWMA 1X9JA 2Q1NA 2IVOA 3I8BA 2HOEA 3W0LA 2GTDA 1NGEA 3L6QA 4BGBA 2V52B 1XC3A 1S3XA 3SJHA 4CBXA 3QMLA 5AQTA 5F1XA 2W40A 1NWKA 1ATSA 5KQ8A 3R9PA 1GLDG 3FZKA 3WXLA 2A40A 1RFQA 4CZEA 1IG8A 1NM1A 2GWJA 1GLEG 3L4IA 4JD2B 1YUWA 2HMPA 5AQNA 1S22A 3MDQA 5FPMA 3GL1A 3O8MA 5AQMA 1T44A 2HF4A 3D2FA 3D2EB 4K42A 2D0PA 3CJBA 2D1KA 3SK3A 3CQXA 3WQTA 1HJOA 3VENA 4CZHA 5AQJA 3O80A 2E88A 2QWNA 3VGMA 3VGKA 4BRHA 1NGJA 1TYQA 2E20A 2ITMA 4H0TB 1GLLO 3P4IA 5AZJB 2P9IA 4CZGA 4FPAA 1WUAA 3A5NC 1QZ5A 4FL9A 1ATRA 3QB0A 4NB4A 4F9OA 4CBWA 3LM2A 4QS8A 5AFUH 3CJCA 1NGHA 1WOQA 1GLAG 3M6GA 4Z94A 3R8EA 1GLFO 3VEZA 4JN4A 2YJEA 1T6DA 2E1YA 3ZEUA 2V7YA 2QWQA 3I33A 4B1WB 1SQKA 2F9TA 1MWKA 3ATVA 1TUYA 4CJ7A 3AY9A 1H1VA 4I6MB 5EVZA 3UKRA 3ZX3A 3BF3A 3VF6A 5BR9A 3CERA 2WUSA 4O5FA 3HI0A 3ZX0A 4BR9A 4PKHA 3O08A 5F0XA 4A2AA 2P9UA 1NGBA 3ENHA 1BA0A 3ULEB 3CIPA 5AQKA 3C7NB 4YDUA 3LL3A 2IVPA 4BC2A 5BN8A 1MA9B 5EXWA 3MN6A 4EHTA 4FWNA 2D0OA 3QBXA 1JCGA 1GLCG 4CZJA 4BRLA 3ZEUB 3BEXA 4DQ8A 3HTVA 4BVPA 3FR0A 3DWLA 3UKRB 5LJWA 3A5OC 1QZ6A 4WQ5A 4IO8A 5BPMA 1CZAN 2BTFA 3QBWA 2FXUA 3FZLA 4JAXA 4RTFD 5FPNA 4FWKA 4M7YA 5ELZA 2Q97A 2D4WA 4WQ4A 3B8AX 2P9LB 1JCEA 3U9ZA 1ZBSA 4WYBA 4FSVA 3FE1A 3CETA 3CJ7A 1DKGD 4HWIA 5AQFA 3G25A 2KHOA 4QS7A 4RWTA 2ZGYA 4B1XB 1NGCA 4MO5A 3R6MA 3OHRA 3FZMA 3DXMB 3VESA 2ZGZA 3WXIA 2P9NA 3MMVA 5ADXA 5I9EB 2VCPA 5E84A 4M7XA 3VF4A 1V4TA 4IJNA 3ZETB 1NBWA 4H0PA 2P9PA 3A5MC 4JHDA 5KPZA 3UB5A 3CJ1A 1Z05A 4FWRA 3UKUA 3RSEA 2E1ZA 4FOIA 4EHUA 4NO7A 4FWOA 2FF6A 3O1WA 4YDUC 1LOTB 1MWMA 3EKSA 1BDGA 2NLXA 3QICA 2Q2RA 5TKYA 4BGAA 5CE3A 3KVGA 4GNIA 3U9DA 3JS6A 3W3DA 2V7ZA 4CD1A 1NMDA 3LDOA 4CZFA 5F2RA 2A6AA 5AQYA 3O1BA 5BPNA 4EAHD 3H1QA 2P9NB 4ISFA 4XH4A 2A42A 4CBUA 1QQMA 2CGLA 5BREA 2E2NA 4WQ5C 3ENOA 3VEOA 3WEEA 1X3MA 3LDPA 5KPTA 4AM7A 4BG8A 2AA4A 3F9MA 3FZHA 1J6ZA 1K8KA 5AQUA 4WQ4C 1V4SA 5AQSA 3RSEB 1XQSC 4K41A 1U6ZA 2ASPA 3BP8A 4IXCA 4B1YB 2Q0UA 4CI6A 3H3OB 3AARA 1ZC6A 4BRNA 3VF2A 3VEWA 1ZXOA 2I7NA 3S41A 2QXLA 3LDNA 5AQVA 3VPZA 5AFUA 5B8HA 4H0OA 1HUXA 3UE5A 3DXKA 5AQPA 3H1VX 3D2FB 1NGGA 1BWFO 4H5VA 1TUUA 1NGAA 1YXQA 4B9QA 5E26A 2PBDA 1IJJA 3GBTA 3KHYA 2OANA 1BO5O 1BUPA 2ASMA 4AM6A 1ESVA 4QS9A 4A61A 2P9SA 1TYQB 2CGJA 2NZTA 4BRFA 5FPEA 4JNEA 2P9IB 4J8FA 2YCHA 3HM8A 5AZIA 4H0YB 4BC3A 3WQUA 3EL2A 5LJVA 5AQZA 4BREA 3BUZB 2VYPA 1BA1A 2PAVA 4BRPA 2Q36A 3EN9A 4IJAA 1NGDA 3TPQA 3IUCA 2A41A 4KBOA 1YVNA 4HTLA 3BF1A 4C23A 1EQYA 1U2VA 4H5TA 3SMPA 2F9WA 2H3GX 2FLOA 3H46O 4MLHA 2HF3A 2ZWHA 4BRCA 1KAZA 2CGKA 1KXPA 3GG4A 3J8AA 2P9SB 4PL8A 3GE1A 1D4XA 2P9UB 4A62A 3U8XA 5AZIB 1Y64A 3SMSA 4RCHA 3A5LC 1BOTO 2QWOA 3IFRA 3L0QA 5JMVA 5AQRA 4BQZA 2VWBA 4M63C 3HZ6A 1NLVA 1JCFA 1Q18A 5BN9A 5AQGA 1ATNA 4CZKA 2NRHA 5BRFA 4Y0WA 3VERA 1E4GT 4H5RA 1C0GA 3LDLA 4FWLA 5EY4A 1HKBA 4FWSA 3M3ZA 2YHXA 4BQLA 3AAPA 5LY3A 1MDUB 3AAQA 4BRQA 1P8ZA 4BRMA 3GOIA 5KQDA 3HSCA 4JD2A 4PKIA 4XH1A 2DPNA 5AQQA 1X3NA 4EFHA 3D2EA 3IMXA 1KAYA 4LC9B 3ID8A 1R59O 4FWQA 5AQIA 2P9KA 4FWPA 4CZMA 3QFUA 4DB3A 3EKUA
chains in the Genus database with same CATH superfamily
2E6MA 3CCRN 1Q9XA 3HL8A 4F2SA 5AZJA 4OPKA 1Q8IA 2VWJA 5AQHA 4ZHRA 3SQ2A 3UKUB 4X64K 2LSNA 1OH8A 3FZFA 3HK2A 3MWPA 1BU6O 3OYEA 5KRTA 3RMCA 3NH0A 3H6EA 2FF3B 3OBWA 3R1XA 4PHTX 3CCSN 3V1OA 4NXNK 3HXMA 3M5RA 2NNWA 2OPQA 2E2PA 3C6TA 4ZTJA 3PY8A 4Y1DA 5BRHA 3WEEB 3C65A 3O9QA 3B6OA 3MWTA 4Q5VA 3WT0A 1VSEA 2I7PA 4CJPA 2ZF5O 4Z4EA 4KHQA 1WBDA 3ULEA 4DFKA 3OS1A 2YJFA 4O8KA 1P90A 4OKKA 3P1GA 2QW9A 2O8FA 3L4QA 2YHAA 3K59A 2QWPA 3AO4A 1FW6A 3DRRA 3MXIA 4LF6K 2CH5A 4E1NA 3E9PA 1UOCA 3DRPA 1HNWK 3DXKB 4OGCA 2E2QA 4CF9A 3TAQA 4H03B 4H0XB 3RMAA 4HCCA 1VQNN 2IIRA 5GAGP 1S1XA 5AQWA 3HP6A 3HOSA 2HW3A 4RW4A 4AHUA 1ZYQA 2FSNA 2O8DA 2ETJA 2HHWA 3TAFA 1QVGM 1XUPO 1R0AA 4LFBK 2CH6A 2Z1HA 1RDAA 4FWMA 3QEXA 3QFPA 5AR0A 1NU0A 3TSPA 4FK0A 5H1SQ 3OS0A 4DQSA 1M1KO 5KGXA 3WUHA 4GY2B 3THWA 3AGKA 2Q0RA 4CFBA 1N33K 2BGGA 1QQOA 3M1FA 2BUPA 3CC4N 3IKMA 1CXQA 4DU4A 4DFPA 3H3NO 3G10A 5BPLA 3DLHA 4AHTA 5LMNK 3MN9A 3SV3A 4CERA 3OYNA 3NGZA 4IG0A 3GDQA 1YAGA 1GLBG 4MFBA 3TTDA 3L2UA 1QSLA 4PA1A 3ITHA 4GVMA 2E5LK 1ITGA 2HHTA 3V9UA 3I8BA 4JKCA 2Z1GA 4BGBA 1XC3A 1X1PA 1XI1A 3VTHA 1TL3A 1NWKA 4BWMA 3FZKA 4BWJA 2D5RA 2A40A 3QERA 1EP4A 2GWJA 1GLEG 3S3OA 4B9SA 4JD2B 1YUWA 2HMPA 3MX2A 4CF2A 1LWFA 4FLUA 1T44A 2HF4A 5M1NA 3JYTA 3D2FA 1JJ2M 3K9JA 4EP5A 1G15A 3HRGA 2Q3SA 1W9HA 3VENA 4CZHA 5AQJA 3O80A 2QWNA 3IRXA 4M45A 3VGKA 4DTRA 3ZYYX 3PIOL 4DR4K 4H0TB 4CZGA 5FROA 1RT5A 3E9LA 4F9OA 3LM2A 1JL2A 3CJCA 3M6GA 4Z94A 2Y1IA 4RG8A 1CZBA 4B9MA 1TKDA 1T6DA 2E1YA 4NYFA 3ZEUA 3NDKA 4KHNA 4B1WB 4E7HA 4WFBL 3ATVA 2O4IA 4CF8A 5EVZA 3UKRA 1XHXA 3BF3A 2OPRA 3VF6A 3JSMA 4JI5K 1NOZA 3KK3A 4CGFA 3HI0A 3ZX0A 4LF4K 2IGIA 2P9UA 3ENHA 4KH5A 3V1RA 4YFUA 3CFRA 3LZIA 1JLFA 4AHCA 3C7NB 3TAGA 3HSTB 5BN8A 1L5UA 2D0OA 3QBXA 1JCGA 1HPZA 3HTVA 4DQ8A 1BGXT 1QHTA 3A2FA 2UU9K 4BDPA 4DG1A 1QZ6A 5GAHP 4H8KA 1YTAA 2FBVA 1YITN 4B9TA 1D9DA 2NRRA 2HHUA 4FLVA 1YTUA 4B9UA 3B8AX 3HVRA 2P9LB 3U9ZA 4O4GA 2G8HA 1S6QA 1ZBSA 4ILGB 4JKFA 5J2QA 4LF7K 3U6FA 3PO5A 2OCEA 2NRWA 3IS9A 2QTDA 4CEQA 2P5GA 2F8SA 4B1XB 3WXIA 3NBPA 4CJFA 3THVA 2WONA 3K0SA 3VF4A 1V4TA 4KPYA 2O8EB 3ZETB 4KRFA 4H0PA 4DWIA 2P9PA 4JHDA 5KPZA 1JLGA 4LFCK 4DR3K 4LH5A 3VQAA 3ZSVA 4YHHK 2E1ZA 3S3NA 1FKOA 3SBTA 3CFOA 5TKYA 1BHLA 5CE3A 2YNFA 3U9DA 3JS6A 4W5QA 4HUFA 1WAJA 4CJTA 5LMUK 4OLAA 4EAHD 3H1QA 4DV0K 3PX4A 1Z25A 1QQMA 4H4OA 1SUQA 5BREA 4JI3K 4WQ5C 2KLAA 4CK2A 3VQQA 1K73O 1RDDA 5GADP 3THXB 4Z4HA 4DSLA 2XHBA 1K8KA 1TGOA 4WQ4C 1V4SA 3NHGA 3RSEB 4CGIA 3SUPA 1I3AA 4CHNA 1XC9A 2ASPA 2HVHA 3H3OB 3G6EN 4LF8K 1ZXOA 2IDOA 3KWIA 3CPWM 3THYA 1A5VA 4DFMA 4DV6K 3AO1A 5C2DA 3VPZA 4U7BA 4H0OA 3H1VX 2BE2A 2X6SA 3P39A 3K5LA 1NGGA 1TV6A 1YXQA 1NGAA 3BZKA 4H4MA 1TK8A 2HB5A 3EZ5A 1XMOK 2ASMA 1ESVA 5M1KA 3OYMA 4CHOA 2CGJA 2NZTA 3AA5X 2NRXA 2HNZA 2P9IB 4J8FA 2RHKA 4J2EA 1C1BA 1DT9A 3WQUA 3CXCM 5AQZA 4CK3A 3D45A 4CHQA 4DR6K 4BREA 3VQ8A 1VRTA 3RTVA 4IJAA 5HBMA 3NH1A 1HR0K 3IUCA 1LWEA 4HTLA 3BF1A 1Y97A 3I0RA 4DQIA 3CF5L 4MLHA 4HTUA 4BRCA 1QS4A 2CGKA 3RMDA 3AVAA 1Y64A 3SMSA 4FCYA 4JKGA 1MU2A 5JMVA 3ZT4A 3NCIA 3V1QA 4CGDA 1JCFA 1OVQA 1Q18A 5BN9A 2VGMA 4CZKA 2NRHA 3C95A 1RT7A 5BRFA 2A1SA 4B3TK 4A59A 2W42A 3QEWA 3PIPL 4W5RA 2UUAK 4K8ZA 3L2VA 5EY4A 4JKAA 1T3VA 2YHXA 4BQLA 1SL2A 1NJZA 3AAQA 1EWRA 2PY5A 4BRMA 3GOIA 4HUGA 4PKIA 4I7FA 4Z4IA 3DI6A 1O1WA 3RRHA 3CCMN 2R7YA 1VSLA 1WB9A 3QEVA 3ISNC 5AQIA 3CCVN 4AHSA 1IKYA 1KQSM 4DB3A 2ZQBA 1CXUA 3T7ZA 2D0CA 2RF2A 4E7LA 1TAUA 2P5OA 4N5SA 4IWVA 4B9VA 4M3ZA 3ZT0A 3CG7A 4KI6A 1RT1A 3TR8A 1EKEA 4NXMK 2DY4A 3AVMA 5I3UA 1C0TA 1IG9A 4XEIA 4PL7A 5JLFA 4DR1K 3OJSA 4A57A 4I6MA 3VOVA 1RILA 4FOEA 4ISGA 1SL1A 2P9KB 4YNQA 2E8AA 3EE9A 2ASOA 4HHTA 4GKKK 3VQ7A 4JKEA 4ILJA 3AVCA 2IS3A 4B1VA 4FLZA 2HSTA 3VETA 2HNDA 2NRZA 3CQYA 1NK9A 4Y1CA 1VQ9N 1JLEA 4FPBA 2QWLA 4BR5A 1HKCA 1QHAA 4DHYA 3O4WA 2FBYA 4H5WA 4L3QA 3NVMA 3L8BA 3O4QA 4FJKA 5FPDA 3F9KA 3SLCA 1VQ6N 3CHWA 3ZT1A 4BR2A 4RW6A 5HP1A 3CCJN 1GLJO 3Q7BA 3QO9A 1N34K 4YOWA 1NKCA 1LCUA 4BRDA 1DGKN 4DV3K 4BRGA 4M42A 3I56N 4KFBA 5AQLA 4IZ9A 1NKEA 4CZIA 3J7AP 1DLOA 3WXKA 3VEYA 4KHUA 3HBTA 3MCPA 4OLBA 4CJRA 4IOAL 1TK5A 4DUZK 3HVTA 3T1AA 4RW8A 1S9EA 2GUPA 3MXJA 3RR7A 3AVKA 4EIAA 4ISEA 3FGUA 4O0IA 2GX9A 1T8EA 4YORA 4FJ7A 3DRSA 1KVCA 1RGIA 5JICA 3LANA 2GWKA 2VG7A 3TSQA 3KLIA 4OKJA 4I9LA 3O3GA 2O8CB 4FO0A 3K9KA 3CJAA 3SAFA 1N36K 3CJ9A 3DLBA 4CE9A 2J4RA 4M3UA 4BC4A 4BR7A 4B1UB 4F3TA 3WXJA 3OYKA 1T6CA 4C8LA 3ZX2A 5ADXH 3O3HA 4B9NA 3IDHA 1RBTA 2E2OA 3P31A 4K8XA 4E7KA 3FFKB 2QWMA 4PWDA 1NK8A 3THWB 2IVOA 3ASMA 3W0LA 2I5JA 1UWBA 3SJHA 1CLQA 2D0AA 4AHVA 5F1XA 4NCAA 4KTWA 4DTNA 5FDLA 3OYLA 2WBNA 3TABA 5KQ8A 3R9PA 1K6YA 2P1JA 4IEIA 4W5TA 3B6PA 2WOMA 1RFQA 2GUIA 2OTJN 3L4IA 3NF6A 4WF9L 4J2DA 5AQNA 2BANA 3GL1A 5AQMA 1KRPA 3CJBA 2D1KA 4CJSA 2KZZA 4F2RA 1RT6A 1NJYA 4BRHA 1TYQA 2E20A 2ITMA 3O9SA 1GLLO 2XRIA 3CCLN 3P4IA 2QKBA 1WUAA 4GV3A 4CEOA 4FL9A 4JKHA 4CBWA 4JRQA 5AFUH 1NGHA 3RR8A 5EU7A 4B3MK 2YJEA 1N8RO 4OVLA 1HNIA 3K58A 4CIEA 3QEPA 1SQKA 2F9TA 3AY9A 3O9TA 3E1YA 1HJRA 5HRNA 3CERA 3BY5A 3EY1A 1KVBA 4BR9A 4PKHA 2KTQA 4A2AA 1X9MA 5DMRA 3SUOA 1BA0A 2KW4A 3CIPA 4KTZA 5AQKA 1IH7A 4YDUA 3LL3A 3MX5A 4BC2A 3LPUA 3QNOA 1WSIA 4EHTA 4FWNA 3K57A 4CZJA 2YKMA 4CK1A 4LF9K 5CZ1A 3ZEUB 4DTXA 3UKRB 1VQLN 3CC2N 4HVJA 3I8DA 4DTJA 2BTFA 3QBWA 4RTFD 4FJ5A 1HMVA 4FWKA 1J54A 3ZSQA 3TTCA 3SAHA 2ZJPL 1NNEA 1JCEA 1D9FA 4Z4CA 4WYBA 4L8RB 3FE1A 4KHPK 4E1MA 3SPYA 3L3VA 4KO0A 5TKWA 4HWIA 4CFCA 4RWTA 2ZGYA 3VA0A 4MO5A 3OHRA 1BL3A 3DXMB 3VESA 2ZGZA 4Q0BA 1KCFA 2HNYA 4W5NA 5ADXA 1U48A 5E84A 3PV8A 3KLFA 3RVCA 3ZSWA 4IJNA 3T1YK 3T3FA 3O9UA 3K2PA 4DS4A 1BISA 3J80O 3SAGA 3CM6A 4FWRA 3UKUA 3OYDA 4DSJA 4DR5K 4WFNL 4EHUA 2W6LA 3O1WA 1BCMA 1BDGA 4R79A 4BGAA 2G8WA 1KFDA 3HM9A 4BE2A 1VQMN 4IFYA 5M1FA 4IKFA 4E0DA 1NMDA 1O13A 4CZFA 3CQ8A 2YNHA 5F2RA 4CHZA 2OYQA 4CJQA 5AQYA 5BPNA 4J2AA 3SPZA 4ISFA 2BH1A 5HL7L 3TI0A 4DR2K 4LD0A 2E2NA 3AVIA 4DR7K 3ENOA 3WEEA 3AVGA 1NMNA 4AM7A 4BG8A 4FXDA 3F9MA 5AQUA 3QIOA 1XNRK 4FLYA 5IT9O 4YY3K 3SV4A 4OX9K 4K41A 2YX6A 4QAGA 2VWKA 5KTQA 3HP9A 4CI6A 3SUNA 4W5OA 3H08A 2G8FA 4UQGA 1RDUA 1Z26A 1TL1A 3BZCA 4DTOA 3OYHA 4JI2K 5AFUA 1HUXA 3UE5A 3DXKA 4FZZA 3OYAA 4BDZA 3E9OA 3TARA 1BWFO 3NF7A 4H5VA 4RW9A 1TUUA 4B9QA 2G8VA 3GBTA 2OANA 3G0ZA 4BE0A 1BI4A 4M3TA 2VGNA 1X9WA 3I55N 5FPEA 2ITGA 2ZE2A 3WNHA 4CESA 3HM8A 5AZIA 3AVLA 3KD1E 4YOXA 1BA1A 2ZM6K 1VSJA 3KJVA 4DS5A 1YT3A 1NGDA 2A41A 1IBKK 5IWAK 1EETA 1HQUA 1IKVA 3ALYA 3AVHA 3LDSA 1VSKA 2YNIA 2F9WA 3SMPA 5AJ3K 2PYJA 3H46O 1FKPA 1KAZA 1ASVA 1KXPA 3AA4A 1BQMA 3GE1A 3ZT2A 4RCHA 5E41A 2UUCK 5AQRA 4HUEA 1YHQN 1VHXA 1RDBA 1SKSA 4BQZA 3AA2A 4NLCA 2VWBA 4FJ9A 4M63C 1JXBA 4DV5K 3OYBA 3OVNA 4Y0WA 3VERA 5JVGL 3CCEN 3LDLA 4FWLA 5C24A 1VQ4N 5FRNA 4IDHA 4V19S 2JGUA 5C25A 3AO2A 5CY4A 4JD2A 4X65K 3CC7N 4EZ9A 4FLXA 5C0YA 1F21A 3TAEA 3K5NA 3WNFA 3EEQA 1KAYA 4QOZB 4LC9B 3VA3A 1JL1A 3NMUA 4A5BA 4IOXA 4FWPA 4CZMA 4CJ5A 1L3TA 3QFUA 3V6DA 3DAWA 1C0UA 4BC5A 3MN7A 4CEEA 4KAZA 2QWRA 3KD5E 2A5XA 2GELA 2HMIA 4FJNA 2WC9A 2YHYA 1D5AA 4BR4A 5K14A 1C6VA 3LP0A 4BRIA 1KVAA 1JLCA 3AVFA 4H0VB 3AVBA 1NJIO 4CHYA 3FLCO 5BRDA 4IDKA 2F8TA 4BRKA 1DEJA 1NGFA 4BG9A 3V9WA 1REVA 2UYTA 2VQFK 4X66K 1CZ9A 3SBGA 3LM9A 4JS4A 1Q9YA 2IC3A 2QEXN 3C7NA 1X9SA 4I9QA 4CVNE 5JLHA 2O8BB 4OO1J 2A3ZA 3S3MA 5M1OA 4CGHA 3A8YA 4GV6A 1M90O 4E3SA 4CJKA 5HLFA 4ELVA 4CECA 4FJMA 4PKGA 3JXUA 2DFFA 1QSSA 4JI0K 3J7ZO 3H45C 3KK2A 4BROA 1BG3A 3VGLA 3SCXA 2QM1A 2JWKA 1YJWN 4O44A 3MN5A 3OYIA 3UIQA 4JYAK 2P9LA 1LWCA 1NK5A 3MEEA 3O6WA 2KQ2A 4JI1K 4FVUA 2PZSA 1KLNA 4MQ3A 4FW2A 5JVHL 2RE2A 4AILC 4DMNA 4B1ZA 1SZ2A 1U45A 2DFHA 2IOCA 4BRAA 4A2BA 1E4FT 4KH4A 1QVFM 1RTJA 2GEMA 5FLXO 3KK1A 1OKJA 4FJJA 4DCHA 2HBLA 2O8EA 4CZLA 3ZETA 3DM2A 5M1QA 4FJIA 4GMJB 4GVEA 4BR0A 5BR8K 1U2VB 3LDQA 1WLJA 1D8YA 3VQBA 3LP1A 1S1TA 2HBKA 1KAXA 4CJVA 4BVOA 3TTFA 5EX5A 4C1NI 4CW7B 3KWGA 3BDPA 5KPRA 2HHHK 4FZXC 1RBSA 4I2PA 5GAEP 3C6UA 2D0BA 1KFSA 2IVNA 4WCEL 3RWUA 4O55A 4KHSA 4OPJA 4FM2A 1N5YA 1OH6A 3MK6A 3ZSYA 2F4VK 3HO1A 2G8UA 1IV0A 3HPHA 1RCHA 1Q82O 5C10A 1VSIA 1NGEA 3L6QA 2IAJA 3SUQA 3QMLA 2FBXA 5AQTA 5DM7L 3VQ4A 5DK5A 4C1NK 1ATSA 4G1QA 2F96A 1GLDG 4FJHA 3LWMA 1S1WA 4IFEA 1EX4A 4B3OA 2P51A 1KSPA 4CZEA 1NM1A 4JI8K 3PX6A 5J1EA 3OJUA 1S22A 1VSHA 1ZBHA 5KI6A 1U4BA 3O8MA 1IKWA 3P38A 1VAZA 3EYZA 2XO7A 1NG9A 3D2EB 4K42A 4BY9C 2PFUA 3DLGA 3QETA 4U67L 3SK3A 3OYJA 3CM5A 3CQXA 4ZTFA 4K0KK 4MDBA 1KD1O 3O3FA 2E88A 3SQ1A 4M3XA 3OTOK 1RTDA 2UXBK 1TKTA 2P9IA 3HYFA 5AZJB 1Q7YO 1C1CA 2UXDK 1ATRA 4JI7K 4CHPA 4JS5A 1TK0A 4Z4GA 1WOQA 1GLAG 3QINA 1J9AA 1B9DA 3VEZA 3C6AA 3PUFA 1KC8O 2V7YA 1FXXA 4DF4A 1OH7A 3I33A 1HYVA 3P83D 4ID1A 3J7YP 1MWKA 3VQ9A 1TUYA 4CJ7A 1H1VA 3SQ4A 3ZX3A 3OYGA 4MDAA 5BR9A 4CJEA 5HRPA 1YF5L 1RBUA 3O08A 5F0XA 5C2FA 4LSLA 1NGBA 4CF0A 3D0PA 4N56A 3ULEB 4FYDA 4AHRA 3LAKA 5C12A 3PLAA 2IVPA 1MA9B 4DSKA 2O4GA 2O8FB 5EXWA 2KFNA 3MN6A 5CYQA 5FRMA 3DLEA 3M8QA 4BVPA 3FR0A 3VQCA 4E7IA 5LJWA 3KIOA 3A5OC 2EHGA 1JLAA 4FVMA 4O5BA 2FXUA 5T7BA 1HNVA 5DM6L 4GV9A 4QCLA 2GV9A 1LW0A 2WFBA 4M7YA 3LP3A 1VQ8N 2Q97A 4CGGA 3MCAB 4O8UA 2B5JA 2O8DB 3CETA 3CJ7A 2ZD1A 1DKGD 1VQKN 3V9XA 5SWMA 1NKBA 3QEIA 1NGCA 3R6MA 3NGIA 2ATQA 3FZMA 1SV5A 3E01A 2P9NA 3ZSZA 4M7XA 4CEDA 4J2BA 4FJXA 3SNNA 1OH5A 4KKOA 1I94K 3TANA 2A1RA 3CJ1A 4FK4A 3WXMB 1SL0A 1VSFA 4FWOA 2FF6A 2RKIA 4NO7A 4YDUC 1LOTB 1MWMA 3EKSA 1S72N 2NLXA 3QICA 2Q2RA 2HBMA 4E19A 3KVGA 1BIZA 3W3DA 3SJJA 2V7ZA 1L3SA 1ZBIA 2A6AA 3IG1A 4DSEA 1TKZA 2A42A 2X6NA 2CGLA 2X78A 3VEOA 5J2MA 3C6HA 1ASWA 5KPTA 2QK9A 2AA4A 3FZHA 1J6ZA 2NRVA 1J53A 1ZBFA 4KHYA 1XQSC 3RMBA 3P5JA 1WN7A 5C15A 4XIUA 3NE6A 3SZ2A 4M3YA 2OZSA 2Q0UA 3PSFA 2XY5A 1K9MO 3VF2A 1S5JA 3VEWA 2ZJRL 3DMJA 3S41A 1J5OA 2QXLA 1DTTA 1RDCA 5HROA 5AQVA 4FM0A 5B8HA 2DFEA 1T7PA 3F73A 3D2FB 4DF8A 3ZT3A 1HYSA 1IJJA 2NUBA 3I0SA 1BO5O 3N4QA 1BUPA 3V81A 4AM6A 4DU1A 4IBNA 4QS9A 5J2NA 1U49A 4A61A 2P9SA 1C1AA 1T05A 2DTUA 2YCHA 4DUYK 1XHZA 5HOOA 4KH6A 3BUZB 2VYPA 4M3WA 2PAVA 4BRPA 4NCGA 3EN9A 2E4LA 3TPQA 4OGEA 3M8PA 3MECA 4C23A 1SKRA 1EQYA 4H5TA 4FLWA 2H3GX 4DTUA 2O8CA 1QQCA 1BI4B 4JEPA 4KHWA 3GG4A 3VQDA 3V9SA 3QIPA 1D4XA 4CJUA 2P9UB 5AZIB 3DLKA 3AA3A 4DV4K 1BOTO 2QWOA 3IFRA 4DLGA 2XY6A 4IG3A 1EWQA 1IKXA 3L0QA 4KB0A 5C42A 3HZ6A 1NLVA 3C94A 4CJWA 1ATNA 3ZSRA 1BIUA 2UXCK 3KKRA 3AV9A 4BACA 4H5RA 3TWHA 4IEEA 4FWSA 3AAPA 1KLMA 4BRQA 1EXQA 1QE1A 1TKXA 3LPTA 5HRSA 3KLHA 1P8ZA 4NLBA 3NF8A 5KQDA 4B8AB 3HSCA 4KV8A 4XH1A 5AQQA 1YIJN 3AO5A 1JLQA 4EFHA 4FJGA 2QA4N 4G9ZA 3IMXA 2OA8A 3ID8A 2X74A 4EP4A 3VQ5A 4FWQA 1WBBA 2FC0A 4JK9A 3EKUA 2HVIA 4N41A 4MO4A 2P9PB 4JHDB 3CCQN 3M8RA 4C8OA 3R3LA 1N6QA 4CEZA 1HPMA 1U04A 4XH5A 2E6LA 1T03A 2RPIA 4N76A 5AQOA 4CEFA 4DSFA 4K25A 3ATUA 2VQEK 4Z4FA 3OBYA 2YKNA 4JKBA 3VMFB 5M1PA 4CEAA 1RTHA 1VQ5N 1RBRA 1NK0A 4C8MA 1HLUA 1Q86O 1VQ7N 4MLEA 2XY8A 4IOCL 5AQXA 1NGIA 1I39A 1W2BM 1K8KB 3AGRA 5SZTA 4IO9L 3KZBA 1VRUA 3SI6A 5CR4A 3L2WA 3IAYA 4ICLA 1U47A 2W41A 4DV1K 4JK7A 4JI4K 4PUOA 4F4KA 3THYB 1XMQK 1N32K 4CCHA 2BDPA 4E1JA 1G99A 2W6KA 5GIPA 1RDWX 1QQNA 1W7AA 2EWSA 2Z1JA 5CZ2A 3MEGA 5EOYA 4CD3A 4DTMA 4Z0UA 1B9FA 3ZLJA 5A2QO 1C0FA 3HOTA 3EE8A 4EZ6A 4H5NA 1HKGA 1Z6RA 3TU5A 1SAZA 3DJCA 2Q31A 3C0BA 5GINA 1UA0A 1TVRA 1GOAA 3A0IX 2QI2A 3VEVA 3PO4A 2FSJA 1IBMK 3DXMA 2AP1A 4FJLA 4JLHA 3U4LA 1VK0A 1RT2A 2VG6A 3DOKA 3CMAN 3CI5A 3VEXA 4K43A 4CFAA 3D7EO 3M8SA 2F7TA 4CGJA 4ID5A 3OY9A 3U3YA 2FSKA 2OPPA 3CCUN 3KTQA 3VQ6A 2OTLN 3QDKA 4DQRA 4ILHA 5LL6Z 4R5PA 3L2RA 1HX1A 2V51B 3SQ0A 1A5XA 3EZWA 1NK7A 3LALA 5JS1A 3OA9A 4RW7A 3EO3A 1GOCA 4JKGB 2YHWA 3VTIA 1GOBA 1VQPN 2YI1A 3O5BA 3Q7CA 3V9ZA 1J5EK 1X9JA 2Q1NA 1E3MA 2HOEA 2GTDA 2NRTA 2V52B 1S3XA 4CBXA 4CEBA 4DSIA 1L3VA 4CF1A 2W40A 3ZCMA 4AQYK 3OW2M 3ENBA 2G8IA 4OJRA 3WXLA 2Z1IA 3O9RA 2QXFA 1IG8A 2B4JA 1UA1A 3K5MA 4CJ3A 1UAXA 1ZBUA 3MDQA 5FPMA 1VQON 4WFAL 1WSGA 4BE1A 2D0PA 3DOLA 4A5AA 3WQTA 1HJOA 3VGMA 3LWLA 2KKZA 3OYCA 1NGJA 5CHIA 4OPHA 3ZSOA 2JWLA 4FPAA 1SS6A 3A5NC 1QZ5A 4PQUA 3QB0A 3AVNA 4NB4A 3V4IA 1W0HA 4QS8A 1S1VA 4UY8O 3R8EA 5J2PA 1GLFO 1WSFA 4JN4A 4M41A 4JI6K 4B08A 1WSEA 3NGYA 3NH2A 4OPAA 3K5OA 3CYMA 3LP2A 2QWQA 3CD6N 3QLHA 4M3RA 4I6MB 2Y1JA 4B9LA 4JKDA 4CJLA 1HQEA 4F3OA 1S1UA 2AJQA 2WUSA 4O5FA 3TAPA 3DLLL 3G71N 4LH4A 1L3UA 4LSNA 2XY7A 3NAEA 3ULDA 1WNSA 4DTSA 4KTQA 4ELUA 2HHVA 1VSDA 4JK8A 2G8KA 1C0MA 1FJGK 1GLCG 4BRLA 1A5WA 5HRRA 3BEXA 4C8NA 4CIFA 1QSYA 3F5TA 3DWLA 5KRSA 5CYMA 3PX0A 4WQ5A 4IO8A 5BPMA 1CZAN 3O4NA 4HCBA 4KB1A 3FZLA 4JAXA 3NVKA 5FPNA 4C8KA 3KK7A 5ELZA 2D4WA 4WQ4A 4CJ4A 1NOYA 3J81O 3MEDA 2UUBK 4FSVA 4I2QA 3U3GA 2FBTA 4GW6A 5AQFA 3VQPA 3G25A 2KHOA 4QS7A 1W97L 1LV5A 4WE1A 4OKEA 1NJWA 2OZMA 3HPOA 3ID6A 3MMVA 2HHQA 5I9EB 1IBLK 2VCPA 3G4SN 1DTQA 3AO3A 3NF9A 3TSUA 3THXA 1NBWA 3T69A 2HHXA 2YNGA 4LF5K 4FZYA 3A5MC 5MLCQ 3UB5A 3S9HA 3DYAA 1Z05A 4YOYA 3RSEA 3VQEA 4FOIA 1YVUA 4F8RA 4TSXA 1ASUA 4DV7K 1JKHA 3HPGA 4YOUA 4B3RK 4GNIA 4DU3A 4DFJA 3MXMA 3CMEN 3E66A 4CD1A 3HJFA 3LDOA 5I42A 4DQQA 4NCBA 4B8CA 3O1BA 1ILYA 2P9NB 4XH4A 4CBUA 3T1HK 4NYNA 1X3MA 3LDPA 3RRGA 1RNHA 1TAQA 1VSMA 2EX3A 3HT3A 1WAFA 1NK4A 3L2QA 1S6PA 4DKWA 4DTPA 4KREA 3CPEA 5AQSA 1RT3A 2GBZA 1U6ZA 1JLBA 4B1YB 3BP8A 4IXCA 3NFAA 4BDYA 2O8BA 3AARA 3CFPA 1ZC6A 4JV5K 4BRNA 3FFIA 4JRPA 3JAMO 1LAWA 2I7NA 1LW2A 1HNZK 3LDNA 1HRHA 3ZSXA 4DLEA 4E89A 5AQPA 5D3GA 1RTIA 3KLEA 1Q81O 3OYFA 1XWLA 1RT4A 4FM1A 5E26A 2PBDA 3KHYA 1JXEA 4PY5A 2B6AA 2HHSA 4FJ8A 5JS2A 4YOTA 3VN5A 3L3UA 1HYZA 1TYQB 4B3SK 4BRFA 4JNEA 3QNNA 4FK2A 4IFVA 4H0YB 1FK9A 4BC3A 4CIGA 3F2KA 3EL2A 5LJVA 1BCOA 2Q36A 2RN2A 4O0JA 5KGWA 1LAVA 4FW1A 4X62K 1EO1A 4KBOA 1YVNA 3WNGA 2JLEA 2YHBA 3LAMA 1U2VA 2FLOA 2HF3A 2ZWHA 1QTMA 3TAMA 1HNXK 1KTQA 3N4PA 2OPSA 3WNEA 1RBVA 2P9SB 3J8AA 4PL8A 2WTUA 3DLRA 2HBJA 1BQNA 1S9GA 4A62A 3KKSA 1XNQK 3U8XA 1NJXA 3A5LC 2KZMA 3AVJA 1IO2A 4DQPA 4CFDA 3D6RA 4LY7A 4FLTA 2ZJQL 4AH9A 3LZJA 1OVYA 5AQGA 3PSIA 2PYLA 2QKKA 3QESA 1E4GT 3T19A 3MAQA 1WSJA 4N47A 1C0GA 1HKBA 3M3ZA 1SKWA 5LY3A 1MDUB 1ZBLA 5GIOA 3BGRA 3SYZA 4KI4A 4DV2K 1YJ9N 4LFAK 4GKJK 3KLGA 1K8AO 4AF1A 2DPNA 2KFZA 4ELTA 1X3NA 1WSHA 1YJNN 3D2EA 2VG5A 2YV0X 1R59O 3OS2A 1NK6A 2P9KA 4YOVA 4E7JA 1B92A 1YI2N
chains in the Genus database with same CATH topology
3DAWA 4BC5A 3MN7A 3CCRN 3T7ZA 4MO4A 2QWRA 5AZJA 2P9PB 4JHDB 3CCQN 2A5XA 2GELA 5AQHA 3R3LA 4IWVA 3UKUB 1HPMA 2WC9A 4XH5A 3FZFA 5AQOA 3MWPA 1BU6O 2YHYA 4BR4A 4K25A 3H6EA 3ATUA 2FF3B 3OBWA 3R1XA 3OBYA 4BRIA 4PHTX 3CCSN 4JKBA 3VMFB 4H0VB 4XEIA 5M1PA 4PL7A 1NJIO 3FLCO 5JLFA 3M5RA 2NNWA 1VQ5N 2E2PA 4A57A 4I6MA 3VOVA 4ISGA 4FOEA 5BRDA 2P9KB 5BRHA 1HLUA 2E8AA 3C65A 1DEJA 1NGFA 3WEEB 4BG9A 4BRKA 3EE9A 2ASOA 3O9QA 4MLEA 3MWTA 2UYTA 3WT0A 4JKEA 4ILJA 4B1VA 2I7PA 3SBGA 3LM9A 2ZF5O 1NGIA 5AQXA 4IOCL 1W2BM 1K8KB 2HSTA 3VETA 2NRZA 3AGRA 3CQYA 3ULEA 2QEXN 3C7NA 4IO9L 1VQ9N 2YJFA 4O8KA 3KZBA 4FPBA 1P90A 2QWLA 4BR5A 1HKCA 2QW9A 5JLHA 3L4QA 5CR4A 1QHAA 4DHYA 4OO1J 2A3ZA 3O4WA 4L3QA 4H5WA 5M1OA 2W41A 3A8YA 4GV6A 3NVMA 4JK7A 1M90O 2QWPA 5FPDA 3SLCA 1VQ6N 3CHWA 4E1JA 1G99A 4BR2A 4PKGA 2CH5A 3JXUA 1RDWX 3E9PA 5GIPA 1QQNA 3CCJN 1GLJO 2EWSA 3Q7BA 3DXKB 3H45C 2E2QA 3J7ZO 4BROA 1BG3A 4H03B 4H0XB 4YOWA 3VGLA 2QM1A 1LCUA 1VQNN 2IIRA 5EOYA 4BRDA 1DGKN 2JWKA 4CD3A 4BRGA 5AQWA 5GAGP 1YJWN 3I56N 5AQLA 1C0FA 4IZ9A 3EE8A 3HOSA 3MN5A 4H5NA 4CZIA 3HOTA 1HKGA 2P9LA 3WXKA 1Z6RA 3VEYA 3O6WA 1SAZA 3TU5A 2FSNA 3DJCA 3HBTA 2Q31A 3C0BA 3MCPA 4FVUA 5GINA 5JVHL 2RE2A 1XUPO 1QVGM 3A0IX 2QI2A 3VEVA 4IOAL 4B1ZA 1SZ2A 2CH6A 4FWMA 3QFPA 5AR0A 2FSJA 3DXMA 2AP1A 3TSPA 3U4LA 4BRAA 4A2BA 5H1SQ 1E4FT 2GUPA 1M1KO 3CMAN 3CI5A 4KH4A 1QVFM 2GEMA 4EIAA 4ISEA 3VEXA 1OKJA 3FGUA 4GY2B 4K43A 3WUHA 4DCHA 2GX9A 2HBLA 3D7EO 4YORA 2F7TA 4CZLA 3ZETA 5M1QA 4GVEA 1RGIA 4BR0A 5JICA 2FSKA 2Q0RA 3AGKA 2GWKA 1U2VB 3TSQA 3CCUN 3LDQA 1QQOA 3M1FA 2BUPA 4FO0A 3K9KA 3CC4N 3IKMA 2OTLN 3QDKA 2HBKA 4ILHA 3CJAA 1KAXA 3SAFA 4BVOA 3TTFA 5EX5A 1HX1A 2V51B 3EZWA 3H3NO 3CJ9A 4C1NI 5BPLA 2J4RA 3KWGA 4BC4A 3MN9A 3OA9A 4BR7A 4B1UB 5KPRA 3EO3A 3WXJA 1T6CA 4JKGB 3ZX2A 5GAEP 2YHWA 3VTIA 5ADXH 1VQPN 2YI1A 3O5BA 3Q7CA 2IVNA 3GDQA 3IDHA 4WCEL 1YAGA 1GLBG 2E2OA 3P31A 3FFKB 3MK6A 2QWMA 3TTDA 1X9JA 2Q1NA 2IVOA 3I8BA 4JKCA 1Q82O 2HOEA 5C10A 3W0LA 2GTDA 1NGEA 3L6QA 4BGBA 2NRTA 1XC3A 1S3XA 2V52B 3SJHA 4CBXA 3QMLA 5AQTA 5F1XA 5DM7L 3VTHA 2W40A 4C1NK 2WBNA 1NWKA 1ATSA 5KQ8A 3OW2M 3R9PA 1GLDG 3ENBA 3FZKA 3WXLA 3O9RA 4IEIA 4IFEA 2A40A 1RFQA 4CZEA 1IG8A 1NM1A 2OTJN 2GWJA 1GLEG 3L4IA 4JD2B 4WF9L 1YUWA 2HMPA 5AQNA 1S22A 3MDQA 3MX2A 5FPMA 3GL1A 3O8MA 5AQMA 1T44A 2HF4A 5M1NA 1VQON 3P38A 1VAZA 4WFAL 3D2FA 3D2EB 4K42A 4BY9C 2PFUA 2D0PA 1JJ2M 3K9JA 4A5AA 3CJBA 2D1KA 4U67L 3HRGA 3SK3A 3CQXA 3WQTA 4MDBA 1HJOA 3VENA 4CZHA 1KD1O 5AQJA 3O80A 2E88A 2QWNA 3VGMA 3VGKA 2KKZA 4BRHA 1NGJA 1TYQA 2E20A 3ZYYX 5CHIA 3PIOL 2ITMA 4OPHA 4H0TB 3O9SA 1GLLO 3CCLN 3P4IA 5AZJB 2P9IA 2JWLA 4CZGA 4FPAA 1Q7YO 1SS6A 1WUAA 3A5NC 4GV3A 3E9LA 1QZ5A 4FL9A 4JKHA 1ATRA 3QB0A 4NB4A 4F9OA 4CBWA 3LM2A 4QS8A 5AFUH 1NGHA 1WOQA 1GLAG 3CJCA 3M6GA 4Z94A 1Q86O 4UY8O 3R8EA 1GLFO 3VEZA 4JN4A 3C6AA 2YJEA 1N8RO 1T6DA 2E1YA 3ZEUA 4OPAA 1KC8O 2V7YA 3CD6N 2QWQA 3I33A 4B1WB 1SQKA 2F9TA 4WFBL 1MWKA 3ATVA 1TUYA 4CJ7A 3AY9A 1H1VA 3E1YA 3O9TA 4I6MB 5EVZA 3UKRA 3ZX3A 4MDAA 3BF3A 3VF6A 4JKDA 5BR9A 3CERA 2WUSA 4O5FA 3HI0A 1YF5L 3ZX0A 4BR9A 4PKHA 3DLLL 3G71N 3O08A 5F0XA 5C2FA 4A2AA 2P9UA 1NGBA 3ENHA 4KH5A 1BA0A 3ULEB 3CIPA 5AQKA 3C7NB 4YDUA 3LL3A 5C12A 3PLAA 2IVPA 3MX5A 4BC2A 5BN8A 1MA9B 5EXWA 3MN6A 4JK8A 4EHTA 4FWNA 2D0OA 3QBXA 1JCGA 1GLCG 4CZJA 4BRLA 3ZEUB 3BEXA 4DQ8A 3HTVA 4BVPA 3FR0A 3F5TA 3DWLA 3UKRB 5LJWA 1VQLN 3A5OC 1QZ6A 4WQ5A 3CC2N 4IO8A 5BPMA 1CZAN 5GAHP 2BTFA 3QBWA 2FXUA 3FZLA 4JAXA 4GV9A 4RTFD 5DM6L 5FPNA 1YITN 3NVKA 4FWKA 2NRRA 2WFBA 3KK7A 4M7YA 3TTCA 1VQ8N 5ELZA 2Q97A 2D4WA 3SAHA 4WQ4A 2ZJPL 3B8AX 2P9LB 1JCEA 3U9ZA 3MCAB 4O8UA 1ZBSA 4ILGB 4JKFA 4WYBA 4FSVA 3FE1A 3CETA 3CJ7A 2NRWA 5TKWA 2QTDA 1DKGD 4HWIA 5AQFA 3G25A 1VQKN 2KHOA 4QS7A 4RWTA 2ZGYA 1W97L 4B1XB 1NGCA 4MO5A 3R6MA 3OHRA 3FZMA 3DXMB 3VESA 2ZGZA 3WXIA 2P9NA 3ID6A 3MMVA 5ADXA 5I9EB 2VCPA 5E84A 3G4SN 3RVCA 4M7XA 3VF4A 1V4TA 4IJNA 3ZETB 3TSUA 1NBWA 3T69A 3O9UA 4H0PA 2P9PA 3A5MC 4JHDA 5KPZA 5MLCQ 3UB5A 3SAGA 3CJ1A 1Z05A 4FWRA 4YOYA 3UKUA 3RSEA 3WXMB 2E1ZA 4WFNL 4FOIA 4EHUA 4NO7A 4FWOA 2FF6A 3O1WA 4YDUC 1LOTB 3SBTA 1MWMA 3EKSA 1BDGA 1S72N 2NLXA 3QICA 2Q2RA 4R79A 2HBMA 5TKYA 4YOUA 4BGAA 5CE3A 3KVGA 4GNIA 3U9DA 1VQMN 3CMEN 3JS6A 5M1FA 3W3DA 2V7ZA 3E66A 4CD1A 1NMDA 1O13A 3LDOA 4CZFA 5F2RA 2A6AA 5AQYA 3O1BA 5BPNA 1ILYA 4EAHD 3H1QA 2P9NB 4ISFA 4XH4A 2A42A 4CBUA 2BH1A 5HL7L 1QQMA 2CGLA 5BREA 2E2NA 4WQ5C 3ENOA 2KLAA 3VEOA 3C6HA 3WEEA 1K73O 1X3MA 3LDPA 5KPTA 5GADP 4AM7A 4BG8A 2AA4A 3F9MA 3FZHA 1J6ZA 2NRVA 1K8KA 5AQUA 4DKWA 4WQ4C 1V4SA 3CPEA 5AQSA 3RSEB 1XQSC 4K41A 2YX6A 5C15A 1U6ZA 2ASPA 3BP8A 4IXCA 4B1YB 2Q0UA 4CI6A 3H3OB 3AARA 1ZC6A 1K9MO 4BRNA 3VF2A 3VEWA 3G6EN 2ZJRL 1ZXOA 1RDUA 2I7NA 3KWIA 3CPWM 3S41A 2QXLA 3LDNA 5C2DA 5AQVA 3VPZA 5AFUA 5B8HA 4H0OA 4U7BA 1HUXA 3UE5A 3DXKA 5AQPA 3H1VX 3P39A 1Q81O 3D2FB 3E9OA 1NGGA 1BWFO 4H5VA 1TUUA 1NGAA 1YXQA 4B9QA 5E26A 2PBDA 1IJJA 3GBTA 3KHYA 2OANA 1BO5O 3N4QA 1BUPA 2ASMA 4AM6A 1ESVA 4QS9A 2VGNA 5M1KA 4YOTA 4A61A 2P9SA 3I55N 1TYQB 2CGJA 2NZTA 4BRFA 5FPEA 2NRXA 4JNEA 2P9IB 4J8FA 2RHKA 2YCHA 3HM8A 5AZIA 4H0YB 4BC3A 1DT9A 3WQUA 3F2KA 1VQ7N 3EL2A 5LJVA 3CXCM 5HOOA 4KH6A 5AQZA 4YOXA 4BREA 3BUZB 2VYPA 1BA1A 2PAVA 4BRPA 2Q36A 3EN9A 4IJAA 1NGDA 3TPQA 3IUCA 2A41A 1EO1A 4KBOA 1YVNA 4HTLA 3BF1A 4C23A 1EQYA 1U2VA 4H5TA 3SMPA 2F9WA 2H3GX 2FLOA 3H46O 3CF5L 4MLHA 2HF3A 2ZWHA 4BRCA 1KAZA 4JEPA 2CGKA 3N4PA 1KXPA 3GG4A 3J8AA 2P9SB 4PL8A 3GE1A 1D4XA 2HBJA 2P9UB 4A62A 3U8XA 5AZIB 1Y64A 3SMSA 4JKGA 4RCHA 3A5LC 1BOTO 2QWOA 3IFRA 3L0QA 5JMVA 3D6RA 5AQRA 2ZJQL 1YHQN 4BQZA 4NLCA 2VWBA 1OVYA 3HZ6A 4M63C 1NLVA 1JCFA 1Q18A 5BN9A 2VGMA 1ATNA 5AQGA 4CZKA 2NRHA 5BRFA 4A59A 4Y0WA 3VERA 1E4GT 5JVGL 3PIPL 3CCEN 4H5RA 1C0GA 3LDLA 4FWLA 4IEEA 5EY4A 4JKAA 1T3VA 1HKBA 1VQ4N 4FWSA 3M3ZA 2YHXA 4BQLA 3AAPA 5LY3A 1MDUB 3AAQA 4BRQA 4IDHA 5GIOA 1YJ9N 1P8ZA 4BRMA 3GOIA 4NLBA 1K8AO 5KQDA 4AF1A 3HSCA 4JD2A 3CC7N 4PKIA 4XH1A 2DPNA 5AQQA 1YIJN 1X3NA 5C0YA 3CCMN 4EFHA 1YJNN 3D2EA 2QA4N 4G9ZA 3IMXA 1KAYA 4LC9B 3ID8A 1R59O 3NMUA 4FWQA 5AQIA 4A5BA 2P9KA 4IOXA 3CCVN 4FWPA 4YOVA 4CZMA 1KQSM 4JK9A 3QFUA 4DB3A 1YI2N 3EKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DAW A;  4BC5 A;  3MN7 A;  4MO4 A;  2QWR A;  5AZJ A;  2P9P B;  4JHD B;  2A5X A;  2GEL A;  5AQH A;  4IWV A;  3UKU B;  1HPM A;  4XH5 A;  3FZF A;  5AQO A;  1BU6 O;  2YHY A;  4BR4 A;  4K25 A;  3H6E A;  3ATU A;  2FF3 B;  4BRI A;  4H0V B;  4XEI A;  4PL7 A;  3FLC O;  5JLF A;  2E2P A;  4I6M A;  3VOV A;  4ISG A;  4FOE A;  5BRD A;  2P9K B;  5BRH A;  1HLU A;  2E8A A;  3WEE B;  1DEJ A;  1NGF A;  4BG9 A;  4BRK A;  4MLE A;  2ASO A;  2UYT A;  3WT0 A;  4B1V A;  2I7P A;  3LM9 A;  2ZF5 O;  1NGI A;  5AQX A;  1K8K B;  3VET A;  3CQY A;  3ULE A;  3C7N A;  2YJF A;  4O8K A;  3KZB A;  4FPB A;  2QWL A;  4BR5 A;  1HKC A;  2QW9 A;  5JLH A;  1QHA A;  4DHY A;  2A3Z A;  3O4W A;  4L3Q A;  4H5W A;  2W41 A;  3A8Y A;  2QWP A;  5FPD A;  3SLC A;  3CHW A;  4E1J A;  1G99 A;  4BR2 A;  4PKG A;  2CH5 A;  3JXU A;  1RDW X;  1QQN A;  1GLJ O;  2EWS A;  3DXK B;  3H45 C;  2E2Q A;  4BRO A;  1BG3 A;  4H03 B;  4H0X B;  3VGL A;  2QM1 A;  1LCU A;  2IIR A;  5EOY A;  4BRD A;  1DGK N;  4CD3 A;  4BRG A;  5AQW A;  5AQL A;  1C0F A;  4IZ9 A;  3MN5 A;  4H5N A;  4CZI A;  1HKG A;  2P9L A;  3WXK A;  1Z6R A;  3VEY A;  3O6W A;  1SAZ A;  3TU5 A;  2FSN A;  3DJC A;  3HBT A;  2Q31 A;  3C0B A;  3MCP A;  1XUP O;  3A0I X;  3VEV A;  4B1Z A;  1SZ2 A;  2CH6 A;  4FWM A;  3QFP A;  5AR0 A;  2FSJ A;  3DXM A;  2AP1 A;  3U4L A;  4BRA A;  4A2B A;  1E4F T;  2GUP A;  3CI5 A;  2GEM A;  4EIA A;  4ISE A;  3VEX A;  1OKJ A;  3FGU A;  4GY2 B;  4K43 A;  3WUH A;  4DCH A;  3D7E O;  4CZL A;  3ZET A;  5JIC A;  1RGI A;  4BR0 A;  2FSK A;  2Q0R A;  2GWK A;  1U2V B;  3LDQ A;  1QQO A;  3M1F A;  2BUP A;  4FO0 A;  3QDK A;  3CJA A;  1KAX A;  4BVO A;  5EX5 A;  1HX1 A;  2V51 B;  3EZW A;  3H3N O;  3CJ9 A;  5BPL A;  2J4R A;  4BC4 A;  3MN9 A;  4BR7 A;  4B1U B;  5KPR A;  3EO3 A;  3WXJ A;  1T6C A;  3ZX2 A;  5ADX H;  2YHW A;  2YI1 A;  3O5B A;  2IVN A;  3GDQ A;  3IDH A;  1YAG A;  1GLB G;  2E2O A;  3FFK B;  3MK6 A;  2QWM A;  1X9J A;  2Q1N A;  2IVO A;  3I8B A;  2HOE A;  3W0L A;  2GTD A;  1NGE A;  3L6Q A;  4BGB A;  2V52 B;  1XC3 A;  1S3X A;  3SJH A;  4CBX A;  3QML A;  5AQT A;  5F1X A;  2W40 A;  1NWK A;  1ATS A;  5KQ8 A;  3R9P A;  1GLD G;  3FZK A;  3WXL A;  2A40 A;  1RFQ A;  4CZE A;  1IG8 A;  1NM1 A;  2GWJ A;  1GLE G;  3L4I A;  4JD2 B;  1YUW A;  2HMP A;  5AQN A;  1S22 A;  3MDQ A;  5FPM A;  3GL1 A;  3O8M A;  5AQM A;  1T44 A;  2HF4 A;  3D2F A;  3D2E B;  4K42 A;  2D0P A;  3CJB A;  2D1K A;  3SK3 A;  3CQX A;  3WQT A;  1HJO A;  3VEN A;  4CZH A;  5AQJ A;  3O80 A;  2E88 A;  2QWN A;  3VGM A;  3VGK A;  4BRH A;  1NGJ A;  1TYQ A;  2E20 A;  2ITM A;  4H0T B;  1GLL O;  3P4I A;  5AZJ B;  2P9I A;  4CZG A;  4FPA A;  1WUA A;  3A5N C;  1QZ5 A;  4FL9 A;  1ATR A;  3QB0 A;  4NB4 A;  4F9O A;  4CBW A;  3LM2 A;  4QS8 A;  5AFU H;  3CJC A;  1NGH A;  1WOQ A;  1GLA G;  3M6G A;  4Z94 A;  3R8E A;  1GLF O;  3VEZ A;  4JN4 A;  2YJE A;  1T6D A;  2E1Y A;  3ZEU A;  2V7Y A;  2QWQ A;  3I33 A;  4B1W B;  1SQK A;  2F9T A;  1MWK A;  3ATV A;  1TUY A;  4CJ7 A;  3AY9 A;  1H1V A;  4I6M B;  5EVZ A;  3UKR A;  3ZX3 A;  3BF3 A;  3VF6 A;  5BR9 A;  3CER A;  2WUS A;  4O5F A;  3HI0 A;  3ZX0 A;  4BR9 A;  4PKH A;  3O08 A;  5F0X A;  4A2A A;  2P9U A;  1NGB A;  3ENH A;  1BA0 A;  3ULE B;  3CIP A;  5AQK A;  3C7N B;  4YDU A;  3LL3 A;  2IVP A;  4BC2 A;  5BN8 A;  1MA9 B;  5EXW A;  3MN6 A;  4EHT A;  4FWN A;  2D0O A;  3QBX A;  1JCG A;  1GLC G;  4CZJ A;  4BRL A;  3ZEU B;  3BEX A;  4DQ8 A;  3HTV A;  4BVP A;  3FR0 A;  3DWL A;  3UKR B;  5LJW A;  3A5O C;  1QZ6 A;  4WQ5 A;  4IO8 A;  5BPM A;  1CZA N;  2BTF A;  3QBW A;  2FXU A;  3FZL A;  4JAX A;  4RTF D;  5FPN A;  4FWK A;  4M7Y A;  5ELZ A;  2Q97 A;  2D4W A;  4WQ4 A;  3B8A X;  2P9L B;  1JCE A;  3U9Z A;  1ZBS A;  4WYB A;  4FSV A;  3FE1 A;  3CET A;  3CJ7 A;  1DKG D;  4HWI A;  5AQF A;  3G25 A;  2KHO A;  4QS7 A;  4RWT A;  2ZGY A;  4B1X B;  1NGC A;  4MO5 A;  3R6M A;  3OHR A;  3FZM A;  3DXM B;  3VES A;  2ZGZ A;  3WXI A;  2P9N A;  3MMV A;  5ADX A;  5I9E B;  2VCP A;  5E84 A;  4M7X A;  3VF4 A;  1V4T A;  4IJN A;  3ZET B;  1NBW A;  4H0P A;  2P9P A;  3A5M C;  4JHD A;  5KPZ A;  3UB5 A;  3CJ1 A;  1Z05 A;  4FWR A;  3UKU A;  3RSE A;  2E1Z A;  4FOI A;  4EHU A;  4NO7 A;  4FWO A;  2FF6 A;  3O1W A;  4YDU C;  1LOT B;  1MWM A;  3EKS A;  1BDG A;  2NLX A;  3QIC A;  2Q2R A;  5TKY A;  4BGA A;  5CE3 A;  3KVG A;  4GNI A;  3U9D A;  3JS6 A;  3W3D A;  2V7Z A;  4CD1 A;  1NMD A;  3LDO A;  4CZF A;  5F2R A;  2A6A A;  5AQY A;  3O1B A;  5BPN A;  4EAH D;  3H1Q A;  2P9N B;  4ISF A;  4XH4 A;  2A42 A;  4CBU A;  1QQM A;  2CGL A;  5BRE A;  2E2N A;  4WQ5 C;  3ENO A;  3VEO A;  3WEE A;  1X3M A;  3LDP A;  5KPT A;  4AM7 A;  4BG8 A;  2AA4 A;  3F9M A;  3FZH A;  1J6Z A;  1K8K A;  5AQU A;  4WQ4 C;  1V4S A;  5AQS A;  3RSE B;  1XQS C;  4K41 A;  1U6Z A;  2ASP A;  3BP8 A;  4IXC A;  4B1Y B;  2Q0U A;  4CI6 A;  3H3O B;  3AAR A;  1ZC6 A;  4BRN A;  3VF2 A;  3VEW A;  1ZXO A;  2I7N A;  3S41 A;  2QXL A;  3LDN A;  5AQV A;  3VPZ A;  5AFU A;  5B8H A;  4H0O A;  1HUX A;  3UE5 A;  3DXK A;  5AQP A;  3H1V X;  3D2F B;  1NGG A;  1BWF O;  4H5V A;  1TUU A;  1NGA A;  1YXQ A;  4B9Q A;  5E26 A;  2PBD A;  1IJJ A;  3GBT A;  3KHY A;  2OAN A;  1BO5 O;  1BUP A;  2ASM A;  4AM6 A;  1ESV A;  4QS9 A;  4A61 A;  2P9S A;  1TYQ B;  2CGJ A;  2NZT A;  4BRF A;  5FPE A;  4JNE A;  2P9I B;  4J8F A;  2YCH A;  3HM8 A;  5AZI A;  4H0Y B;  4BC3 A;  3WQU A;  3EL2 A;  5LJV A;  5AQZ A;  4BRE A;  3BUZ B;  2VYP A;  1BA1 A;  2PAV A;  4BRP A;  2Q36 A;  3EN9 A;  4IJA A;  1NGD A;  3TPQ A;  3IUC A;  2A41 A;  4KBO A;  1YVN A;  4HTL A;  3BF1 A;  4C23 A;  1EQY A;  1U2V A;  4H5T A;  3SMP A;  2F9W A;  2H3G X;  2FLO A;  3H46 O;  4MLH A;  2HF3 A;  2ZWH A;  4BRC A;  1KAZ A;  2CGK A;  1KXP A;  3GG4 A;  3J8A A;  2P9S B;  4PL8 A;  3GE1 A;  1D4X A;  2P9U B;  4A62 A;  3U8X A;  5AZI B;  1Y64 A;  3SMS A;  4RCH A;  3A5L C;  1BOT O;  2QWO A;  3IFR A;  3L0Q A;  5JMV A;  5AQR A;  4BQZ A;  2VWB A;  4M63 C;  3HZ6 A;  1NLV A;  1JCF A;  1Q18 A;  5BN9 A;  5AQG A;  1ATN A;  4CZK A;  2NRH A;  5BRF A;  4Y0W A;  3VER A;  1E4G T;  4H5R A;  1C0G A;  3LDL A;  4FWL A;  5EY4 A;  1HKB A;  4FWS A;  3M3Z A;  2YHX A;  4BQL A;  3AAP A;  5LY3 A;  1MDU B;  3AAQ A;  4BRQ A;  1P8Z A;  4BRM A;  3GOI A;  5KQD A;  3HSC A;  4JD2 A;  4PKI A;  4XH1 A;  2DPN A;  5AQQ A;  1X3N A;  4EFH A;  3D2E A;  3IMX A;  1KAY A;  4LC9 B;  3ID8 A;  1R59 O;  4FWQ A;  5AQI A;  2P9K A;  4FWP A;  4CZM A;  3QFU A;  4DB3 A;  3EKU A; 
#chains in the Genus database with same CATH topology
 2E6M A;  3CCR N;  1Q9X A;  3HL8 A;  4F2S A;  5AZJ A;  4OPK A;  1Q8I A;  2VWJ A;  5AQH A;  4ZHR A;  3SQ2 A;  3UKU B;  4X64 K;  2LSN A;  1OH8 A;  3FZF A;  3HK2 A;  3MWP A;  1BU6 O;  3OYE A;  5KRT A;  3RMC A;  3NH0 A;  3H6E A;  2FF3 B;  3OBW A;  3R1X A;  4PHT X;  3CCS N;  3V1O A;  4NXN K;  3HXM A;  3M5R A;  2NNW A;  2OPQ A;  2E2P A;  3C6T A;  4ZTJ A;  3PY8 A;  4Y1D A;  5BRH A;  3WEE B;  3C65 A;  3O9Q A;  3B6O A;  3MWT A;  4Q5V A;  3WT0 A;  1VSE A;  2I7P A;  4CJP A;  2ZF5 O;  4Z4E A;  4KHQ A;  1WBD A;  3ULE A;  4DFK A;  3OS1 A;  2YJF A;  4O8K A;  1P90 A;  4OKK A;  3P1G A;  2QW9 A;  2O8F A;  3L4Q A;  2YHA A;  3K59 A;  2QWP A;  3AO4 A;  1FW6 A;  3DRR A;  3MXI A;  4LF6 K;  2CH5 A;  4E1N A;  3E9P A;  1UOC A;  3DRP A;  1HNW K;  3DXK B;  4OGC A;  2E2Q A;  4CF9 A;  3TAQ A;  4H03 B;  4H0X B;  3RMA A;  4HCC A;  1VQN N;  2IIR A;  5GAG P;  1S1X A;  5AQW A;  3HP6 A;  3HOS A;  2HW3 A;  4RW4 A;  4AHU A;  1ZYQ A;  2FSN A;  2O8D A;  2ETJ A;  2HHW A;  3TAF A;  1QVG M;  1XUP O;  1R0A A;  4LFB K;  2CH6 A;  2Z1H A;  1RDA A;  4FWM A;  3QEX A;  3QFP A;  5AR0 A;  1NU0 A;  3TSP A;  4FK0 A;  5H1S Q;  3OS0 A;  4DQS A;  1M1K O;  5KGX A;  3WUH A;  4GY2 B;  3THW A;  3AGK A;  2Q0R A;  4CFB A;  1N33 K;  2BGG A;  1QQO A;  3M1F A;  2BUP A;  3CC4 N;  3IKM A;  1CXQ A;  4DU4 A;  4DFP A;  3H3N O;  3G10 A;  5BPL A;  3DLH A;  4AHT A;  5LMN K;  3MN9 A;  3SV3 A;  4CER A;  3OYN A;  3NGZ A;  4IG0 A;  3GDQ A;  1YAG A;  1GLB G;  4MFB A;  3TTD A;  3L2U A;  1QSL A;  4PA1 A;  3ITH A;  4GVM A;  2E5L K;  1ITG A;  2HHT A;  3V9U A;  3I8B A;  4JKC A;  2Z1G A;  4BGB A;  1XC3 A;  1X1P A;  1XI1 A;  3VTH A;  1TL3 A;  1NWK A;  4BWM A;  3FZK A;  4BWJ A;  2D5R A;  2A40 A;  3QER A;  1EP4 A;  2GWJ A;  1GLE G;  3S3O A;  4B9S A;  4JD2 B;  1YUW A;  2HMP A;  3MX2 A;  4CF2 A;  1LWF A;  4FLU A;  1T44 A;  2HF4 A;  5M1N A;  3JYT A;  3D2F A;  1JJ2 M;  3K9J A;  4EP5 A;  1G15 A;  3HRG A;  2Q3S A;  1W9H A;  3VEN A;  4CZH A;  5AQJ A;  3O80 A;  2QWN A;  3IRX A;  4M45 A;  3VGK A;  4DTR A;  3ZYY X;  3PIO L;  4DR4 K;  4H0T B;  4CZG A;  5FRO A;  1RT5 A;  3E9L A;  4F9O A;  3LM2 A;  1JL2 A;  3CJC A;  3M6G A;  4Z94 A;  2Y1I A;  4RG8 A;  1CZB A;  4B9M A;  1TKD A;  1T6D A;  2E1Y A;  4NYF A;  3ZEU A;  3NDK A;  4KHN A;  4B1W B;  4E7H A;  4WFB L;  3ATV A;  2O4I A;  4CF8 A;  5EVZ A;  3UKR A;  1XHX A;  3BF3 A;  2OPR A;  3VF6 A;  3JSM A;  4JI5 K;  1NOZ A;  3KK3 A;  4CGF A;  3HI0 A;  3ZX0 A;  4LF4 K;  2IGI A;  2P9U A;  3ENH A;  4KH5 A;  3V1R A;  4YFU A;  3CFR A;  3LZI A;  1JLF A;  4AHC A;  3C7N B;  3TAG A;  3HST B;  5BN8 A;  1L5U A;  2D0O A;  3QBX A;  1JCG A;  1HPZ A;  3HTV A;  4DQ8 A;  1BGX T;  1QHT A;  3A2F A;  2UU9 K;  4BDP A;  4DG1 A;  1QZ6 A;  5GAH P;  4H8K A;  1YTA A;  2FBV A;  1YIT N;  4B9T A;  1D9D A;  2NRR A;  2HHU A;  4FLV A;  1YTU A;  4B9U A;  3B8A X;  3HVR A;  2P9L B;  3U9Z A;  4O4G A;  2G8H A;  1S6Q A;  1ZBS A;  4ILG B;  4JKF A;  5J2Q A;  4LF7 K;  3U6F A;  3PO5 A;  2OCE A;  2NRW A;  3IS9 A;  2QTD A;  4CEQ A;  2P5G A;  2F8S A;  4B1X B;  3WXI A;  3NBP A;  4CJF A;  3THV A;  2WON A;  3K0S A;  3VF4 A;  1V4T A;  4KPY A;  2O8E B;  3ZET B;  4KRF A;  4H0P A;  4DWI A;  2P9P A;  4JHD A;  5KPZ A;  1JLG A;  4LFC K;  4DR3 K;  4LH5 A;  3VQA A;  3ZSV A;  4YHH K;  2E1Z A;  3S3N A;  1FKO A;  3SBT A;  3CFO A;  5TKY A;  1BHL A;  5CE3 A;  2YNF A;  3U9D A;  3JS6 A;  4W5Q A;  4HUF A;  1WAJ A;  4CJT A;  5LMU K;  4OLA A;  4EAH D;  3H1Q A;  4DV0 K;  3PX4 A;  1Z25 A;  1QQM A;  4H4O A;  1SUQ A;  5BRE A;  4JI3 K;  4WQ5 C;  2KLA A;  4CK2 A;  3VQQ A;  1K73 O;  1RDD A;  5GAD P;  3THX B;  4Z4H A;  4DSL A;  2XHB A;  1K8K A;  1TGO A;  4WQ4 C;  1V4S A;  3NHG A;  3RSE B;  4CGI A;  3SUP A;  1I3A A;  4CHN A;  1XC9 A;  2ASP A;  2HVH A;  3H3O B;  3G6E N;  4LF8 K;  1ZXO A;  2IDO A;  3KWI A;  3CPW M;  3THY A;  1A5V A;  4DFM A;  4DV6 K;  3AO1 A;  5C2D A;  3VPZ A;  4U7B A;  4H0O A;  3H1V X;  2BE2 A;  2X6S A;  3P39 A;  3K5L A;  1NGG A;  1TV6 A;  1YXQ A;  1NGA A;  3BZK A;  4H4M A;  1TK8 A;  2HB5 A;  3EZ5 A;  1XMO K;  2ASM A;  1ESV A;  5M1K A;  3OYM A;  4CHO A;  2CGJ A;  2NZT A;  3AA5 X;  2NRX A;  2HNZ A;  2P9I B;  4J8F A;  2RHK A;  4J2E A;  1C1B A;  1DT9 A;  3WQU A;  3CXC M;  5AQZ A;  4CK3 A;  3D45 A;  4CHQ A;  4DR6 K;  4BRE A;  3VQ8 A;  1VRT A;  3RTV A;  4IJA A;  5HBM A;  3NH1 A;  1HR0 K;  3IUC A;  1LWE A;  4HTL A;  3BF1 A;  1Y97 A;  3I0R A;  4DQI A;  3CF5 L;  4MLH A;  4HTU A;  4BRC A;  1QS4 A;  2CGK A;  3RMD A;  3AVA A;  1Y64 A;  3SMS A;  4FCY A;  4JKG A;  1MU2 A;  5JMV A;  3ZT4 A;  3NCI A;  3V1Q A;  4CGD A;  1JCF A;  1OVQ A;  1Q18 A;  5BN9 A;  2VGM A;  4CZK A;  2NRH A;  3C95 A;  1RT7 A;  5BRF A;  2A1S A;  4B3T K;  4A59 A;  2W42 A;  3QEW A;  3PIP L;  4W5R A;  2UUA K;  4K8Z A;  3L2V A;  5EY4 A;  4JKA A;  1T3V A;  2YHX A;  4BQL A;  1SL2 A;  1NJZ A;  3AAQ A;  1EWR A;  2PY5 A;  4BRM A;  3GOI A;  4HUG A;  4PKI A;  4I7F A;  4Z4I A;  3DI6 A;  1O1W A;  3RRH A;  3CCM N;  2R7Y A;  1VSL A;  1WB9 A;  3QEV A;  3ISN C;  5AQI A;  3CCV N;  4AHS A;  1IKY A;  1KQS M;  4DB3 A;  2ZQB A;  1CXU A;  3T7Z A;  2D0C A;  2RF2 A;  4E7L A;  1TAU A;  2P5O A;  4N5S A;  4IWV A;  4B9V A;  4M3Z A;  3ZT0 A;  3CG7 A;  4KI6 A;  1RT1 A;  3TR8 A;  1EKE A;  4NXM K;  2DY4 A;  3AVM A;  5I3U A;  1C0T A;  1IG9 A;  4XEI A;  4PL7 A;  5JLF A;  4DR1 K;  3OJS A;  4A57 A;  4I6M A;  3VOV A;  1RIL A;  4FOE A;  4ISG A;  1SL1 A;  2P9K B;  4YNQ A;  2E8A A;  3EE9 A;  2ASO A;  4HHT A;  4GKK K;  3VQ7 A;  4JKE A;  4ILJ A;  3AVC A;  2IS3 A;  4B1V A;  4FLZ A;  2HST A;  3VET A;  2HND A;  2NRZ A;  3CQY A;  1NK9 A;  4Y1C A;  1VQ9 N;  1JLE A;  4FPB A;  2QWL A;  4BR5 A;  1HKC A;  1QHA A;  4DHY A;  3O4W A;  2FBY A;  4H5W A;  4L3Q A;  3NVM A;  3L8B A;  3O4Q A;  4FJK A;  5FPD A;  3F9K A;  3SLC A;  1VQ6 N;  3CHW A;  3ZT1 A;  4BR2 A;  4RW6 A;  5HP1 A;  3CCJ N;  1GLJ O;  3Q7B A;  3QO9 A;  1N34 K;  4YOW A;  1NKC A;  1LCU A;  4BRD A;  1DGK N;  4DV3 K;  4BRG A;  4M42 A;  3I56 N;  4KFB A;  5AQL A;  4IZ9 A;  1NKE A;  4CZI A;  3J7A P;  1DLO A;  3WXK A;  3VEY A;  4KHU A;  3HBT A;  3MCP A;  4OLB A;  4CJR A;  4IOA L;  1TK5 A;  4DUZ K;  3HVT A;  3T1A A;  4RW8 A;  1S9E A;  2GUP A;  3MXJ A;  3RR7 A;  3AVK A;  4EIA A;  4ISE A;  3FGU A;  4O0I A;  2GX9 A;  1T8E A;  4YOR A;  4FJ7 A;  3DRS A;  1KVC A;  1RGI A;  5JIC A;  3LAN A;  2GWK A;  2VG7 A;  3TSQ A;  3KLI A;  4OKJ A;  4I9L A;  3O3G A;  2O8C B;  4FO0 A;  3K9K A;  3CJA A;  3SAF A;  1N36 K;  3CJ9 A;  3DLB A;  4CE9 A;  2J4R A;  4M3U A;  4BC4 A;  4BR7 A;  4B1U B;  4F3T A;  3WXJ A;  3OYK A;  1T6C A;  4C8L A;  3ZX2 A;  5ADX H;  3O3H A;  4B9N A;  3IDH A;  1RBT A;  2E2O A;  3P31 A;  4K8X A;  4E7K A;  3FFK B;  2QWM A;  4PWD A;  1NK8 A;  3THW B;  2IVO A;  3ASM A;  3W0L A;  2I5J A;  1UWB A;  3SJH A;  1CLQ A;  2D0A A;  4AHV A;  5F1X A;  4NCA A;  4KTW A;  4DTN A;  5FDL A;  3OYL A;  2WBN A;  3TAB A;  5KQ8 A;  3R9P A;  1K6Y A;  2P1J A;  4IEI A;  4W5T A;  3B6P A;  2WOM A;  1RFQ A;  2GUI A;  2OTJ N;  3L4I A;  3NF6 A;  4WF9 L;  4J2D A;  5AQN A;  2BAN A;  3GL1 A;  5AQM A;  1KRP A;  3CJB A;  2D1K A;  4CJS A;  2KZZ A;  4F2R A;  1RT6 A;  1NJY A;  4BRH A;  1TYQ A;  2E20 A;  2ITM A;  3O9S A;  1GLL O;  2XRI A;  3CCL N;  3P4I A;  2QKB A;  1WUA A;  4GV3 A;  4CEO A;  4FL9 A;  4JKH A;  4CBW A;  4JRQ A;  5AFU H;  1NGH A;  3RR8 A;  5EU7 A;  4B3M K;  2YJE A;  1N8R O;  4OVL A;  1HNI A;  3K58 A;  4CIE A;  3QEP A;  1SQK A;  2F9T A;  3AY9 A;  3O9T A;  3E1Y A;  1HJR A;  5HRN A;  3CER A;  3BY5 A;  3EY1 A;  1KVB A;  4BR9 A;  4PKH A;  2KTQ A;  4A2A A;  1X9M A;  5DMR A;  3SUO A;  1BA0 A;  2KW4 A;  3CIP A;  4KTZ A;  5AQK A;  1IH7 A;  4YDU A;  3LL3 A;  3MX5 A;  4BC2 A;  3LPU A;  3QNO A;  1WSI A;  4EHT A;  4FWN A;  3K57 A;  4CZJ A;  2YKM A;  4CK1 A;  4LF9 K;  5CZ1 A;  3ZEU B;  4DTX A;  3UKR B;  1VQL N;  3CC2 N;  4HVJ A;  3I8D A;  4DTJ A;  2BTF A;  3QBW A;  4RTF D;  4FJ5 A;  1HMV A;  4FWK A;  1J54 A;  3ZSQ A;  3TTC A;  3SAH A;  2ZJP L;  1NNE A;  1JCE A;  1D9F A;  4Z4C A;  4WYB A;  4L8R B;  3FE1 A;  4KHP K;  4E1M A;  3SPY A;  3L3V A;  4KO0 A;  5TKW A;  4HWI A;  4CFC A;  4RWT A;  2ZGY A;  3VA0 A;  4MO5 A;  3OHR A;  1BL3 A;  3DXM B;  3VES A;  2ZGZ A;  4Q0B A;  1KCF A;  2HNY A;  4W5N A;  5ADX A;  1U48 A;  5E84 A;  3PV8 A;  3KLF A;  3RVC A;  3ZSW A;  4IJN A;  3T1Y K;  3T3F A;  3O9U A;  3K2P A;  4DS4 A;  1BIS A;  3J80 O;  3SAG A;  3CM6 A;  4FWR A;  3UKU A;  3OYD A;  4DSJ A;  4DR5 K;  4WFN L;  4EHU A;  2W6L A;  3O1W A;  1BCM A;  1BDG A;  4R79 A;  4BGA A;  2G8W A;  1KFD A;  3HM9 A;  4BE2 A;  1VQM N;  4IFY A;  5M1F A;  4IKF A;  4E0D A;  1NMD A;  1O13 A;  4CZF A;  3CQ8 A;  2YNH A;  5F2R A;  4CHZ A;  2OYQ A;  4CJQ A;  5AQY A;  5BPN A;  4J2A A;  3SPZ A;  4ISF A;  2BH1 A;  5HL7 L;  3TI0 A;  4DR2 K;  4LD0 A;  2E2N A;  3AVI A;  4DR7 K;  3ENO A;  3WEE A;  3AVG A;  1NMN A;  4AM7 A;  4BG8 A;  4FXD A;  3F9M A;  5AQU A;  3QIO A;  1XNR K;  4FLY A;  5IT9 O;  4YY3 K;  3SV4 A;  4OX9 K;  4K41 A;  2YX6 A;  4QAG A;  2VWK A;  5KTQ A;  3HP9 A;  4CI6 A;  3SUN A;  4W5O A;  3H08 A;  2G8F A;  4UQG A;  1RDU A;  1Z26 A;  1TL1 A;  3BZC A;  4DTO A;  3OYH A;  4JI2 K;  5AFU A;  1HUX A;  3UE5 A;  3DXK A;  4FZZ A;  3OYA A;  4BDZ A;  3E9O A;  3TAR A;  1BWF O;  3NF7 A;  4H5V A;  4RW9 A;  1TUU A;  4B9Q A;  2G8V A;  3GBT A;  2OAN A;  3G0Z A;  4BE0 A;  1BI4 A;  4M3T A;  2VGN A;  1X9W A;  3I55 N;  5FPE A;  2ITG A;  2ZE2 A;  3WNH A;  4CES A;  3HM8 A;  5AZI A;  3AVL A;  3KD1 E;  4YOX A;  1BA1 A;  2ZM6 K;  1VSJ A;  3KJV A;  4DS5 A;  1YT3 A;  1NGD A;  2A41 A;  1IBK K;  5IWA K;  1EET A;  1HQU A;  1IKV A;  3ALY A;  3AVH A;  3LDS A;  1VSK A;  2YNI A;  2F9W A;  3SMP A;  5AJ3 K;  2PYJ A;  3H46 O;  1FKP A;  1KAZ A;  1ASV A;  1KXP A;  3AA4 A;  1BQM A;  3GE1 A;  3ZT2 A;  4RCH A;  5E41 A;  2UUC K;  5AQR A;  4HUE A;  1YHQ N;  1VHX A;  1RDB A;  1SKS A;  4BQZ A;  3AA2 A;  4NLC A;  2VWB A;  4FJ9 A;  4M63 C;  1JXB A;  4DV5 K;  3OYB A;  3OVN A;  4Y0W A;  3VER A;  5JVG L;  3CCE N;  3LDL A;  4FWL A;  5C24 A;  1VQ4 N;  5FRN A;  4IDH A;  4V19 S;  2JGU A;  5C25 A;  3AO2 A;  5CY4 A;  4JD2 A;  4X65 K;  3CC7 N;  4EZ9 A;  4FLX A;  5C0Y A;  1F21 A;  3TAE A;  3K5N A;  3WNF A;  3EEQ A;  1KAY A;  4QOZ B;  4LC9 B;  3VA3 A;  1JL1 A;  3NMU A;  4A5B A;  4IOX A;  4FWP A;  4CZM A;  4CJ5 A;  1L3T A;  3QFU A;  3V6D A;  3DAW A;  1C0U A;  4BC5 A;  3MN7 A;  4CEE A;  4KAZ A;  2QWR A;  3KD5 E;  2A5X A;  2GEL A;  2HMI A;  4FJN A;  2WC9 A;  2YHY A;  1D5A A;  4BR4 A;  5K14 A;  1C6V A;  3LP0 A;  4BRI A;  1KVA A;  1JLC A;  3AVF A;  4H0V B;  3AVB A;  1NJI O;  4CHY A;  3FLC O;  5BRD A;  4IDK A;  2F8T A;  4BRK A;  1DEJ A;  1NGF A;  4BG9 A;  3V9W A;  1REV A;  2UYT A;  2VQF K;  4X66 K;  1CZ9 A;  3SBG A;  3LM9 A;  4JS4 A;  1Q9Y A;  2IC3 A;  2QEX N;  3C7N A;  1X9S A;  4I9Q A;  4CVN E;  5JLH A;  2O8B B;  4OO1 J;  2A3Z A;  3S3M A;  5M1O A;  4CGH A;  3A8Y A;  4GV6 A;  1M90 O;  4E3S A;  4CJK A;  5HLF A;  4ELV A;  4CEC A;  4FJM A;  4PKG A;  3JXU A;  2DFF A;  1QSS A;  4JI0 K;  3J7Z O;  3H45 C;  3KK2 A;  4BRO A;  1BG3 A;  3VGL A;  3SCX A;  2QM1 A;  2JWK A;  1YJW N;  4O44 A;  3MN5 A;  3OYI A;  3UIQ A;  4JYA K;  2P9L A;  1LWC A;  1NK5 A;  3MEE A;  3O6W A;  2KQ2 A;  4JI1 K;  4FVU A;  2PZS A;  1KLN A;  4MQ3 A;  4FW2 A;  5JVH L;  2RE2 A;  4AIL C;  4DMN A;  4B1Z A;  1SZ2 A;  1U45 A;  2DFH A;  2IOC A;  4BRA A;  4A2B A;  1E4F T;  4KH4 A;  1QVF M;  1RTJ A;  2GEM A;  5FLX O;  3KK1 A;  1OKJ A;  4FJJ A;  4DCH A;  2HBL A;  2O8E A;  4CZL A;  3ZET A;  3DM2 A;  5M1Q A;  4FJI A;  4GMJ B;  4GVE A;  4BR0 A;  5BR8 K;  1U2V B;  3LDQ A;  1WLJ A;  1D8Y A;  3VQB A;  3LP1 A;  1S1T A;  2HBK A;  1KAX A;  4CJV A;  4BVO A;  3TTF A;  5EX5 A;  4C1N I;  4CW7 B;  3KWG A;  3BDP A;  5KPR A;  2HHH K;  4FZX C;  1RBS A;  4I2P A;  5GAE P;  3C6U A;  2D0B A;  1KFS A;  2IVN A;  4WCE L;  3RWU A;  4O55 A;  4KHS A;  4OPJ A;  4FM2 A;  1N5Y A;  1OH6 A;  3MK6 A;  3ZSY A;  2F4V K;  3HO1 A;  2G8U A;  1IV0 A;  3HPH A;  1RCH A;  1Q82 O;  5C10 A;  1VSI A;  1NGE A;  3L6Q A;  2IAJ A;  3SUQ A;  3QML A;  2FBX A;  5AQT A;  5DM7 L;  3VQ4 A;  5DK5 A;  4C1N K;  1ATS A;  4G1Q A;  2F96 A;  1GLD G;  4FJH A;  3LWM A;  1S1W A;  4IFE A;  1EX4 A;  4B3O A;  2P51 A;  1KSP A;  4CZE A;  1NM1 A;  4JI8 K;  3PX6 A;  5J1E A;  3OJU A;  1S22 A;  1VSH A;  1ZBH A;  5KI6 A;  1U4B A;  3O8M A;  1IKW A;  3P38 A;  1VAZ A;  3EYZ A;  2XO7 A;  1NG9 A;  3D2E B;  4K42 A;  4BY9 C;  2PFU A;  3DLG A;  3QET A;  4U67 L;  3SK3 A;  3OYJ A;  3CM5 A;  3CQX A;  4ZTF A;  4K0K K;  4MDB A;  1KD1 O;  3O3F A;  2E88 A;  3SQ1 A;  4M3X A;  3OTO K;  1RTD A;  2UXB K;  1TKT A;  2P9I A;  3HYF A;  5AZJ B;  1Q7Y O;  1C1C A;  2UXD K;  1ATR A;  4JI7 K;  4CHP A;  4JS5 A;  1TK0 A;  4Z4G A;  1WOQ A;  1GLA G;  3QIN A;  1J9A A;  1B9D A;  3VEZ A;  3C6A A;  3PUF A;  1KC8 O;  2V7Y A;  1FXX A;  4DF4 A;  1OH7 A;  3I33 A;  1HYV A;  3P83 D;  4ID1 A;  3J7Y P;  1MWK A;  3VQ9 A;  1TUY A;  4CJ7 A;  1H1V A;  3SQ4 A;  3ZX3 A;  3OYG A;  4MDA A;  5BR9 A;  4CJE A;  5HRP A;  1YF5 L;  1RBU A;  3O08 A;  5F0X A;  5C2F A;  4LSL A;  1NGB A;  4CF0 A;  3D0P A;  4N56 A;  3ULE B;  4FYD A;  4AHR A;  3LAK A;  5C12 A;  3PLA A;  2IVP A;  1MA9 B;  4DSK A;  2O4G A;  2O8F B;  5EXW A;  2KFN A;  3MN6 A;  5CYQ A;  5FRM A;  3DLE A;  3M8Q A;  4BVP A;  3FR0 A;  3VQC A;  4E7I A;  5LJW A;  3KIO A;  3A5O C;  2EHG A;  1JLA A;  4FVM A;  4O5B A;  2FXU A;  5T7B A;  1HNV A;  5DM6 L;  4GV9 A;  4QCL A;  2GV9 A;  1LW0 A;  2WFB A;  4M7Y A;  3LP3 A;  1VQ8 N;  2Q97 A;  4CGG A;  3MCA B;  4O8U A;  2B5J A;  2O8D B;  3CET A;  3CJ7 A;  2ZD1 A;  1DKG D;  1VQK N;  3V9X A;  5SWM A;  1NKB A;  3QEI A;  1NGC A;  3R6M A;  3NGI A;  2ATQ A;  3FZM A;  1SV5 A;  3E01 A;  2P9N A;  3ZSZ A;  4M7X A;  4CED A;  4J2B A;  4FJX A;  3SNN A;  1OH5 A;  4KKO A;  1I94 K;  3TAN A;  2A1R A;  3CJ1 A;  4FK4 A;  3WXM B;  1SL0 A;  1VSF A;  4FWO A;  2FF6 A;  2RKI A;  4NO7 A;  4YDU C;  1LOT B;  1MWM A;  3EKS A;  1S72 N;  2NLX A;  3QIC A;  2Q2R A;  2HBM A;  4E19 A;  3KVG A;  1BIZ A;  3W3D A;  3SJJ A;  2V7Z A;  1L3S A;  1ZBI A;  2A6A A;  3IG1 A;  4DSE A;  1TKZ A;  2A42 A;  2X6N A;  2CGL A;  2X78 A;  3VEO A;  5J2M A;  3C6H A;  1ASW A;  5KPT A;  2QK9 A;  2AA4 A;  3FZH A;  1J6Z A;  2NRV A;  1J53 A;  1ZBF A;  4KHY A;  1XQS C;  3RMB A;  3P5J A;  1WN7 A;  5C15 A;  4XIU A;  3NE6 A;  3SZ2 A;  4M3Y A;  2OZS A;  2Q0U A;  3PSF A;  2XY5 A;  1K9M O;  3VF2 A;  1S5J A;  3VEW A;  2ZJR L;  3DMJ A;  3S41 A;  1J5O A;  2QXL A;  1DTT A;  1RDC A;  5HRO A;  5AQV A;  4FM0 A;  5B8H A;  2DFE A;  1T7P A;  3F73 A;  3D2F B;  4DF8 A;  3ZT3 A;  1HYS A;  1IJJ A;  2NUB A;  3I0S A;  1BO5 O;  3N4Q A;  1BUP A;  3V81 A;  4AM6 A;  4DU1 A;  4IBN A;  4QS9 A;  5J2N A;  1U49 A;  4A61 A;  2P9S A;  1C1A A;  1T05 A;  2DTU A;  2YCH A;  4DUY K;  1XHZ A;  5HOO A;  4KH6 A;  3BUZ B;  2VYP A;  4M3W A;  2PAV A;  4BRP A;  4NCG A;  3EN9 A;  2E4L A;  3TPQ A;  4OGE A;  3M8P A;  3MEC A;  4C23 A;  1SKR A;  1EQY A;  4H5T A;  4FLW A;  2H3G X;  4DTU A;  2O8C A;  1QQC A;  1BI4 B;  4JEP A;  4KHW A;  3GG4 A;  3VQD A;  3V9S A;  3QIP A;  1D4X A;  4CJU A;  2P9U B;  5AZI B;  3DLK A;  3AA3 A;  4DV4 K;  1BOT O;  2QWO A;  3IFR A;  4DLG A;  2XY6 A;  4IG3 A;  1EWQ A;  1IKX A;  3L0Q A;  4KB0 A;  5C42 A;  3HZ6 A;  1NLV A;  3C94 A;  4CJW A;  1ATN A;  3ZSR A;  1BIU A;  2UXC K;  3KKR A;  3AV9 A;  4BAC A;  4H5R A;  3TWH A;  4IEE A;  4FWS A;  3AAP A;  1KLM A;  4BRQ A;  1EXQ A;  1QE1 A;  1TKX A;  3LPT A;  5HRS A;  3KLH A;  1P8Z A;  4NLB A;  3NF8 A;  5KQD A;  4B8A B;  3HSC A;  4KV8 A;  4XH1 A;  5AQQ A;  1YIJ N;  3AO5 A;  1JLQ A;  4EFH A;  4FJG A;  2QA4 N;  4G9Z A;  3IMX A;  2OA8 A;  3ID8 A;  2X74 A;  4EP4 A;  3VQ5 A;  4FWQ A;  1WBB A;  2FC0 A;  4JK9 A;  3EKU A;  2HVI A;  4N41 A;  4MO4 A;  2P9P B;  4JHD B;  3CCQ N;  3M8R A;  4C8O A;  3R3L A;  1N6Q A;  4CEZ A;  1HPM A;  1U04 A;  4XH5 A;  2E6L A;  1T03 A;  2RPI A;  4N76 A;  5AQO A;  4CEF A;  4DSF A;  4K25 A;  3ATU A;  2VQE K;  4Z4F A;  3OBY A;  2YKN A;  4JKB A;  3VMF B;  5M1P A;  4CEA A;  1RTH A;  1VQ5 N;  1RBR A;  1NK0 A;  4C8M A;  1HLU A;  1Q86 O;  1VQ7 N;  4MLE A;  2XY8 A;  4IOC L;  5AQX A;  1NGI A;  1I39 A;  1W2B M;  1K8K B;  3AGR A;  5SZT A;  4IO9 L;  3KZB A;  1VRU A;  3SI6 A;  5CR4 A;  3L2W A;  3IAY A;  4ICL A;  1U47 A;  2W41 A;  4DV1 K;  4JK7 A;  4JI4 K;  4PUO A;  4F4K A;  3THY B;  1XMQ K;  1N32 K;  4CCH A;  2BDP A;  4E1J A;  1G99 A;  2W6K A;  5GIP A;  1RDW X;  1QQN A;  1W7A A;  2EWS A;  2Z1J A;  5CZ2 A;  3MEG A;  5EOY A;  4CD3 A;  4DTM A;  4Z0U A;  1B9F A;  3ZLJ A;  5A2Q O;  1C0F A;  3HOT A;  3EE8 A;  4EZ6 A;  4H5N A;  1HKG A;  1Z6R A;  3TU5 A;  1SAZ A;  3DJC A;  2Q31 A;  3C0B A;  5GIN A;  1UA0 A;  1TVR A;  1GOA A;  3A0I X;  2QI2 A;  3VEV A;  3PO4 A;  2FSJ A;  1IBM K;  3DXM A;  2AP1 A;  4FJL A;  4JLH A;  3U4L A;  1VK0 A;  1RT2 A;  2VG6 A;  3DOK A;  3CMA N;  3CI5 A;  3VEX A;  4K43 A;  4CFA A;  3D7E O;  3M8S A;  2F7T A;  4CGJ A;  4ID5 A;  3OY9 A;  3U3Y A;  2FSK A;  2OPP A;  3CCU N;  3KTQ A;  3VQ6 A;  2OTL N;  3QDK A;  4DQR A;  4ILH A;  5LL6 Z;  4R5P A;  3L2R A;  1HX1 A;  2V51 B;  3SQ0 A;  1A5X A;  3EZW A;  1NK7 A;  3LAL A;  5JS1 A;  3OA9 A;  4RW7 A;  3EO3 A;  1GOC A;  4JKG B;  2YHW A;  3VTI A;  1GOB A;  1VQP N;  2YI1 A;  3O5B A;  3Q7C A;  3V9Z A;  1J5E K;  1X9J A;  2Q1N A;  1E3M A;  2HOE A;  2GTD A;  2NRT A;  2V52 B;  1S3X A;  4CBX A;  4CEB A;  4DSI A;  1L3V A;  4CF1 A;  2W40 A;  3ZCM A;  4AQY K;  3OW2 M;  3ENB A;  2G8I A;  4OJR A;  3WXL A;  2Z1I A;  3O9R A;  2QXF A;  1IG8 A;  2B4J A;  1UA1 A;  3K5M A;  4CJ3 A;  1UAX A;  1ZBU A;  3MDQ A;  5FPM A;  1VQO N;  4WFA L;  1WSG A;  4BE1 A;  2D0P A;  3DOL A;  4A5A A;  3WQT A;  1HJO A;  3VGM A;  3LWL A;  2KKZ A;  3OYC A;  1NGJ A;  5CHI A;  4OPH A;  3ZSO A;  2JWL A;  4FPA A;  1SS6 A;  3A5N C;  1QZ5 A;  4PQU A;  3QB0 A;  3AVN A;  4NB4 A;  3V4I A;  1W0H A;  4QS8 A;  1S1V A;  4UY8 O;  3R8E A;  5J2P A;  1GLF O;  1WSF A;  4JN4 A;  4M41 A;  4JI6 K;  4B08 A;  1WSE A;  3NGY A;  3NH2 A;  4OPA A;  3K5O A;  3CYM A;  3LP2 A;  2QWQ A;  3CD6 N;  3QLH A;  4M3R A;  4I6M B;  2Y1J A;  4B9L A;  4JKD A;  4CJL A;  1HQE A;  4F3O A;  1S1U A;  2AJQ A;  2WUS A;  4O5F A;  3TAP A;  3DLL L;  3G71 N;  4LH4 A;  1L3U A;  4LSN A;  2XY7 A;  3NAE A;  3ULD A;  1WNS A;  4DTS A;  4KTQ A;  4ELU A;  2HHV A;  1VSD A;  4JK8 A;  2G8K A;  1C0M A;  1FJG K;  1GLC G;  4BRL A;  1A5W A;  5HRR A;  3BEX A;  4C8N A;  4CIF A;  1QSY A;  3F5T A;  3DWL A;  5KRS A;  5CYM A;  3PX0 A;  4WQ5 A;  4IO8 A;  5BPM A;  1CZA N;  3O4N A;  4HCB A;  4KB1 A;  3FZL A;  4JAX A;  3NVK A;  5FPN A;  4C8K A;  3KK7 A;  5ELZ A;  2D4W A;  4WQ4 A;  4CJ4 A;  1NOY A;  3J81 O;  3MED A;  2UUB K;  4FSV A;  4I2Q A;  3U3G A;  2FBT A;  4GW6 A;  5AQF A;  3VQP A;  3G25 A;  2KHO A;  4QS7 A;  1W97 L;  1LV5 A;  4WE1 A;  4OKE A;  1NJW A;  2OZM A;  3HPO A;  3ID6 A;  3MMV A;  2HHQ A;  5I9E B;  1IBL K;  2VCP A;  3G4S N;  1DTQ A;  3AO3 A;  3NF9 A;  3TSU A;  3THX A;  1NBW A;  3T69 A;  2HHX A;  2YNG A;  4LF5 K;  4FZY A;  3A5M C;  5MLC Q;  3UB5 A;  3S9H A;  3DYA A;  1Z05 A;  4YOY A;  3RSE A;  3VQE A;  4FOI A;  1YVU A;  4F8R A;  4TSX A;  1ASU A;  4DV7 K;  1JKH A;  3HPG A;  4YOU A;  4B3R K;  4GNI A;  4DU3 A;  4DFJ A;  3MXM A;  3CME N;  3E66 A;  4CD1 A;  3HJF A;  3LDO A;  5I42 A;  4DQQ A;  4NCB A;  4B8C A;  3O1B A;  1ILY A;  2P9N B;  4XH4 A;  4CBU A;  3T1H K;  4NYN A;  1X3M A;  3LDP A;  3RRG A;  1RNH A;  1TAQ A;  1VSM A;  2EX3 A;  3HT3 A;  1WAF A;  1NK4 A;  3L2Q A;  1S6P A;  4DKW A;  4DTP A;  4KRE A;  3CPE A;  5AQS A;  1RT3 A;  2GBZ A;  1U6Z A;  1JLB A;  4B1Y B;  3BP8 A;  4IXC A;  3NFA A;  4BDY A;  2O8B A;  3AAR A;  3CFP A;  1ZC6 A;  4JV5 K;  4BRN A;  3FFI A;  4JRP A;  3JAM O;  1LAW A;  2I7N A;  1LW2 A;  1HNZ K;  3LDN A;  1HRH A;  3ZSX A;  4DLE A;  4E89 A;  5AQP A;  5D3G A;  1RTI A;  3KLE A;  1Q81 O;  3OYF A;  1XWL A;  1RT4 A;  4FM1 A;  5E26 A;  2PBD A;  3KHY A;  1JXE A;  4PY5 A;  2B6A A;  2HHS A;  4FJ8 A;  5JS2 A;  4YOT A;  3VN5 A;  3L3U A;  1HYZ A;  1TYQ B;  4B3S K;  4BRF A;  4JNE A;  3QNN A;  4FK2 A;  4IFV A;  4H0Y B;  1FK9 A;  4BC3 A;  4CIG A;  3F2K A;  3EL2 A;  5LJV A;  1BCO A;  2Q36 A;  2RN2 A;  4O0J A;  5KGW A;  1LAV A;  4FW1 A;  4X62 K;  1EO1 A;  4KBO A;  1YVN A;  3WNG A;  2JLE A;  2YHB A;  3LAM A;  1U2V A;  2FLO A;  2HF3 A;  2ZWH A;  1QTM A;  3TAM A;  1HNX K;  1KTQ A;  3N4P A;  2OPS A;  3WNE A;  1RBV A;  2P9S B;  3J8A A;  4PL8 A;  2WTU A;  3DLR A;  2HBJ A;  1BQN A;  1S9G A;  4A62 A;  3KKS A;  1XNQ K;  3U8X A;  1NJX A;  3A5L C;  2KZM A;  3AVJ A;  1IO2 A;  4DQP A;  4CFD A;  3D6R A;  4LY7 A;  4FLT A;  2ZJQ L;  4AH9 A;  3LZJ A;  1OVY A;  5AQG A;  3PSI A;  2PYL A;  2QKK A;  3QES A;  1E4G T;  3T19 A;  3MAQ A;  1WSJ A;  4N47 A;  1C0G A;  1HKB A;  3M3Z A;  1SKW A;  5LY3 A;  1MDU B;  1ZBL A;  5GIO A;  3BGR A;  3SYZ A;  4KI4 A;  4DV2 K;  1YJ9 N;  4LFA K;  4GKJ K;  3KLG A;  1K8A O;  4AF1 A;  2DPN A;  2KFZ A;  4ELT A;  1X3N A;  1WSH A;  1YJN N;  3D2E A;  2VG5 A;  2YV0 X;  1R59 O;  3OS2 A;  1NK6 A;  2P9K A;  4YOV A;  4E7J A;  1B92 A;  1YI2 N; 
#chains in the Genus database with same CATH homology
 3DAW A;  4BC5 A;  3MN7 A;  3CCR N;  3T7Z A;  4MO4 A;  2QWR A;  5AZJ A;  2P9P B;  4JHD B;  3CCQ N;  2A5X A;  2GEL A;  5AQH A;  3R3L A;  4IWV A;  3UKU B;  1HPM A;  2WC9 A;  4XH5 A;  3FZF A;  5AQO A;  3MWP A;  1BU6 O;  2YHY A;  4BR4 A;  4K25 A;  3H6E A;  3ATU A;  2FF3 B;  3OBW A;  3R1X A;  3OBY A;  4BRI A;  4PHT X;  3CCS N;  4JKB A;  3VMF B;  4H0V B;  4XEI A;  5M1P A;  4PL7 A;  1NJI O;  3FLC O;  5JLF A;  3M5R A;  2NNW A;  1VQ5 N;  2E2P A;  4A57 A;  4I6M A;  3VOV A;  4ISG A;  4FOE A;  5BRD A;  2P9K B;  5BRH A;  1HLU A;  2E8A A;  3C65 A;  1DEJ A;  1NGF A;  3WEE B;  4BG9 A;  4BRK A;  3EE9 A;  2ASO A;  3O9Q A;  4MLE A;  3MWT A;  2UYT A;  3WT0 A;  4JKE A;  4ILJ A;  4B1V A;  2I7P A;  3SBG A;  3LM9 A;  2ZF5 O;  1NGI A;  5AQX A;  4IOC L;  1W2B M;  1K8K B;  2HST A;  3VET A;  2NRZ A;  3AGR A;  3CQY A;  3ULE A;  2QEX N;  3C7N A;  4IO9 L;  1VQ9 N;  2YJF A;  4O8K A;  3KZB A;  4FPB A;  1P90 A;  2QWL A;  4BR5 A;  1HKC A;  2QW9 A;  5JLH A;  3L4Q A;  5CR4 A;  1QHA A;  4DHY A;  4OO1 J;  2A3Z A;  3O4W A;  4L3Q A;  4H5W A;  5M1O A;  2W41 A;  3A8Y A;  4GV6 A;  3NVM A;  4JK7 A;  1M90 O;  2QWP A;  5FPD A;  3SLC A;  1VQ6 N;  3CHW A;  4E1J A;  1G99 A;  4BR2 A;  4PKG A;  2CH5 A;  3JXU A;  1RDW X;  3E9P A;  5GIP A;  1QQN A;  3CCJ N;  1GLJ O;  2EWS A;  3Q7B A;  3DXK B;  3H45 C;  2E2Q A;  3J7Z O;  4BRO A;  1BG3 A;  4H03 B;  4H0X B;  4YOW A;  3VGL A;  2QM1 A;  1LCU A;  1VQN N;  2IIR A;  5EOY A;  4BRD A;  1DGK N;  2JWK A;  4CD3 A;  4BRG A;  5AQW A;  5GAG P;  1YJW N;  3I56 N;  5AQL A;  1C0F A;  4IZ9 A;  3EE8 A;  3HOS A;  3MN5 A;  4H5N A;  4CZI A;  3HOT A;  1HKG A;  2P9L A;  3WXK A;  1Z6R A;  3VEY A;  3O6W A;  1SAZ A;  3TU5 A;  2FSN A;  3DJC A;  3HBT A;  2Q31 A;  3C0B A;  3MCP A;  4FVU A;  5GIN A;  5JVH L;  2RE2 A;  1XUP O;  1QVG M;  3A0I X;  2QI2 A;  3VEV A;  4IOA L;  4B1Z A;  1SZ2 A;  2CH6 A;  4FWM A;  3QFP A;  5AR0 A;  2FSJ A;  3DXM A;  2AP1 A;  3TSP A;  3U4L A;  4BRA A;  4A2B A;  5H1S Q;  1E4F T;  2GUP A;  1M1K O;  3CMA N;  3CI5 A;  4KH4 A;  1QVF M;  2GEM A;  4EIA A;  4ISE A;  3VEX A;  1OKJ A;  3FGU A;  4GY2 B;  4K43 A;  3WUH A;  4DCH A;  2GX9 A;  2HBL A;  3D7E O;  4YOR A;  2F7T A;  4CZL A;  3ZET A;  5M1Q A;  4GVE A;  1RGI A;  4BR0 A;  5JIC A;  2FSK A;  2Q0R A;  3AGK A;  2GWK A;  1U2V B;  3TSQ A;  3CCU N;  3LDQ A;  1QQO A;  3M1F A;  2BUP A;  4FO0 A;  3K9K A;  3CC4 N;  3IKM A;  2OTL N;  3QDK A;  2HBK A;  4ILH A;  3CJA A;  1KAX A;  3SAF A;  4BVO A;  3TTF A;  5EX5 A;  1HX1 A;  2V51 B;  3EZW A;  3H3N O;  3CJ9 A;  4C1N I;  5BPL A;  2J4R A;  3KWG A;  4BC4 A;  3MN9 A;  3OA9 A;  4BR7 A;  4B1U B;  5KPR A;  3EO3 A;  3WXJ A;  1T6C A;  4JKG B;  3ZX2 A;  5GAE P;  2YHW A;  3VTI A;  5ADX H;  1VQP N;  2YI1 A;  3O5B A;  3Q7C A;  2IVN A;  3GDQ A;  3IDH A;  4WCE L;  1YAG A;  1GLB G;  2E2O A;  3P31 A;  3FFK B;  3MK6 A;  2QWM A;  3TTD A;  1X9J A;  2Q1N A;  2IVO A;  3I8B A;  4JKC A;  1Q82 O;  2HOE A;  5C10 A;  3W0L A;  2GTD A;  1NGE A;  3L6Q A;  4BGB A;  2NRT A;  1XC3 A;  1S3X A;  2V52 B;  3SJH A;  4CBX A;  3QML A;  5AQT A;  5F1X A;  5DM7 L;  3VTH A;  2W40 A;  4C1N K;  2WBN A;  1NWK A;  1ATS A;  5KQ8 A;  3OW2 M;  3R9P A;  1GLD G;  3ENB A;  3FZK A;  3WXL A;  3O9R A;  4IEI A;  4IFE A;  2A40 A;  1RFQ A;  4CZE A;  1IG8 A;  1NM1 A;  2OTJ N;  2GWJ A;  1GLE G;  3L4I A;  4JD2 B;  4WF9 L;  1YUW A;  2HMP A;  5AQN A;  1S22 A;  3MDQ A;  3MX2 A;  5FPM A;  3GL1 A;  3O8M A;  5AQM A;  1T44 A;  2HF4 A;  5M1N A;  1VQO N;  3P38 A;  1VAZ A;  4WFA L;  3D2F A;  3D2E B;  4K42 A;  4BY9 C;  2PFU A;  2D0P A;  1JJ2 M;  3K9J A;  4A5A A;  3CJB A;  2D1K A;  4U67 L;  3HRG A;  3SK3 A;  3CQX A;  3WQT A;  4MDB A;  1HJO A;  3VEN A;  4CZH A;  1KD1 O;  5AQJ A;  3O80 A;  2E88 A;  2QWN A;  3VGM A;  3VGK A;  2KKZ A;  4BRH A;  1NGJ A;  1TYQ A;  2E20 A;  3ZYY X;  5CHI A;  3PIO L;  2ITM A;  4OPH A;  4H0T B;  3O9S A;  1GLL O;  3CCL N;  3P4I A;  5AZJ B;  2P9I A;  2JWL A;  4CZG A;  4FPA A;  1Q7Y O;  1SS6 A;  1WUA A;  3A5N C;  4GV3 A;  3E9L A;  1QZ5 A;  4FL9 A;  4JKH A;  1ATR A;  3QB0 A;  4NB4 A;  4F9O A;  4CBW A;  3LM2 A;  4QS8 A;  5AFU H;  1NGH A;  1WOQ A;  1GLA G;  3CJC A;  3M6G A;  4Z94 A;  1Q86 O;  4UY8 O;  3R8E A;  1GLF O;  3VEZ A;  4JN4 A;  3C6A A;  2YJE A;  1N8R O;  1T6D A;  2E1Y A;  3ZEU A;  4OPA A;  1KC8 O;  2V7Y A;  3CD6 N;  2QWQ A;  3I33 A;  4B1W B;  1SQK A;  2F9T A;  4WFB L;  1MWK A;  3ATV A;  1TUY A;  4CJ7 A;  3AY9 A;  1H1V A;  3E1Y A;  3O9T A;  4I6M B;  5EVZ A;  3UKR A;  3ZX3 A;  4MDA A;  3BF3 A;  3VF6 A;  4JKD A;  5BR9 A;  3CER A;  2WUS A;  4O5F A;  3HI0 A;  1YF5 L;  3ZX0 A;  4BR9 A;  4PKH A;  3DLL L;  3G71 N;  3O08 A;  5F0X A;  5C2F A;  4A2A A;  2P9U A;  1NGB A;  3ENH A;  4KH5 A;  1BA0 A;  3ULE B;  3CIP A;  5AQK A;  3C7N B;  4YDU A;  3LL3 A;  5C12 A;  3PLA A;  2IVP A;  3MX5 A;  4BC2 A;  5BN8 A;  1MA9 B;  5EXW A;  3MN6 A;  4JK8 A;  4EHT A;  4FWN A;  2D0O A;  3QBX A;  1JCG A;  1GLC G;  4CZJ A;  4BRL A;  3ZEU B;  3BEX A;  4DQ8 A;  3HTV A;  4BVP A;  3FR0 A;  3F5T A;  3DWL A;  3UKR B;  5LJW A;  1VQL N;  3A5O C;  1QZ6 A;  4WQ5 A;  3CC2 N;  4IO8 A;  5BPM A;  1CZA N;  5GAH P;  2BTF A;  3QBW A;  2FXU A;  3FZL A;  4JAX A;  4GV9 A;  4RTF D;  5DM6 L;  5FPN A;  1YIT N;  3NVK A;  4FWK A;  2NRR A;  2WFB A;  3KK7 A;  4M7Y A;  3TTC A;  1VQ8 N;  5ELZ A;  2Q97 A;  2D4W A;  3SAH A;  4WQ4 A;  2ZJP L;  3B8A X;  2P9L B;  1JCE A;  3U9Z A;  3MCA B;  4O8U A;  1ZBS A;  4ILG B;  4JKF A;  4WYB A;  4FSV A;  3FE1 A;  3CET A;  3CJ7 A;  2NRW A;  5TKW A;  2QTD A;  1DKG D;  4HWI A;  5AQF A;  3G25 A;  1VQK N;  2KHO A;  4QS7 A;  4RWT A;  2ZGY A;  1W97 L;  4B1X B;  1NGC A;  4MO5 A;  3R6M A;  3OHR A;  3FZM A;  3DXM B;  3VES A;  2ZGZ A;  3WXI A;  2P9N A;  3ID6 A;  3MMV A;  5ADX A;  5I9E B;  2VCP A;  5E84 A;  3G4S N;  3RVC A;  4M7X A;  3VF4 A;  1V4T A;  4IJN A;  3ZET B;  3TSU A;  1NBW A;  3T69 A;  3O9U A;  4H0P A;  2P9P A;  3A5M C;  4JHD A;  5KPZ A;  5MLC Q;  3UB5 A;  3SAG A;  3CJ1 A;  1Z05 A;  4FWR A;  4YOY A;  3UKU A;  3RSE A;  3WXM B;  2E1Z A;  4WFN L;  4FOI A;  4EHU A;  4NO7 A;  4FWO A;  2FF6 A;  3O1W A;  4YDU C;  1LOT B;  3SBT A;  1MWM A;  3EKS A;  1BDG A;  1S72 N;  2NLX A;  3QIC A;  2Q2R A;  4R79 A;  2HBM A;  5TKY A;  4YOU A;  4BGA A;  5CE3 A;  3KVG A;  4GNI A;  3U9D A;  1VQM N;  3CME N;  3JS6 A;  5M1F A;  3W3D A;  2V7Z A;  3E66 A;  4CD1 A;  1NMD A;  1O13 A;  3LDO A;  4CZF A;  5F2R A;  2A6A A;  5AQY A;  3O1B A;  5BPN A;  1ILY A;  4EAH D;  3H1Q A;  2P9N B;  4ISF A;  4XH4 A;  2A42 A;  4CBU A;  2BH1 A;  5HL7 L;  1QQM A;  2CGL A;  5BRE A;  2E2N A;  4WQ5 C;  3ENO A;  2KLA A;  3VEO A;  3C6H A;  3WEE A;  1K73 O;  1X3M A;  3LDP A;  5KPT A;  5GAD P;  4AM7 A;  4BG8 A;  2AA4 A;  3F9M A;  3FZH A;  1J6Z A;  2NRV A;  1K8K A;  5AQU A;  4DKW A;  4WQ4 C;  1V4S A;  3CPE A;  5AQS A;  3RSE B;  1XQS C;  4K41 A;  2YX6 A;  5C15 A;  1U6Z A;  2ASP A;  3BP8 A;  4IXC A;  4B1Y B;  2Q0U A;  4CI6 A;  3H3O B;  3AAR A;  1ZC6 A;  1K9M O;  4BRN A;  3VF2 A;  3VEW A;  3G6E N;  2ZJR L;  1ZXO A;  1RDU A;  2I7N A;  3KWI A;  3CPW M;  3S41 A;  2QXL A;  3LDN A;  5C2D A;  5AQV A;  3VPZ A;  5AFU A;  5B8H A;  4H0O A;  4U7B A;  1HUX A;  3UE5 A;  3DXK A;  5AQP A;  3H1V X;  3P39 A;  1Q81 O;  3D2F B;  3E9O A;  1NGG A;  1BWF O;  4H5V A;  1TUU A;  1NGA A;  1YXQ A;  4B9Q A;  5E26 A;  2PBD A;  1IJJ A;  3GBT A;  3KHY A;  2OAN A;  1BO5 O;  3N4Q A;  1BUP A;  2ASM A;  4AM6 A;  1ESV A;  4QS9 A;  2VGN A;  5M1K A;  4YOT A;  4A61 A;  2P9S A;  3I55 N;  1TYQ B;  2CGJ A;  2NZT A;  4BRF A;  5FPE A;  2NRX A;  4JNE A;  2P9I B;  4J8F A;  2RHK A;  2YCH A;  3HM8 A;  5AZI A;  4H0Y B;  4BC3 A;  1DT9 A;  3WQU A;  3F2K A;  1VQ7 N;  3EL2 A;  5LJV A;  3CXC M;  5HOO A;  4KH6 A;  5AQZ A;  4YOX A;  4BRE A;  3BUZ B;  2VYP A;  1BA1 A;  2PAV A;  4BRP A;  2Q36 A;  3EN9 A;  4IJA A;  1NGD A;  3TPQ A;  3IUC A;  2A41 A;  1EO1 A;  4KBO A;  1YVN A;  4HTL A;  3BF1 A;  4C23 A;  1EQY A;  1U2V A;  4H5T A;  3SMP A;  2F9W A;  2H3G X;  2FLO A;  3H46 O;  3CF5 L;  4MLH A;  2HF3 A;  2ZWH A;  4BRC A;  1KAZ A;  4JEP A;  2CGK A;  3N4P A;  1KXP A;  3GG4 A;  3J8A A;  2P9S B;  4PL8 A;  3GE1 A;  1D4X A;  2HBJ A;  2P9U B;  4A62 A;  3U8X A;  5AZI B;  1Y64 A;  3SMS A;  4JKG A;  4RCH A;  3A5L C;  1BOT O;  2QWO A;  3IFR A;  3L0Q A;  5JMV A;  3D6R A;  5AQR A;  2ZJQ L;  1YHQ N;  4BQZ A;  4NLC A;  2VWB A;  1OVY A;  3HZ6 A;  4M63 C;  1NLV A;  1JCF A;  1Q18 A;  5BN9 A;  2VGM A;  1ATN A;  5AQG A;  4CZK A;  2NRH A;  5BRF A;  4A59 A;  4Y0W A;  3VER A;  1E4G T;  5JVG L;  3PIP L;  3CCE N;  4H5R A;  1C0G A;  3LDL A;  4FWL A;  4IEE A;  5EY4 A;  4JKA A;  1T3V A;  1HKB A;  1VQ4 N;  4FWS A;  3M3Z A;  2YHX A;  4BQL A;  3AAP A;  5LY3 A;  1MDU B;  3AAQ A;  4BRQ A;  4IDH A;  5GIO A;  1YJ9 N;  1P8Z A;  4BRM A;  3GOI A;  4NLB A;  1K8A O;  5KQD A;  4AF1 A;  3HSC A;  4JD2 A;  3CC7 N;  4PKI A;  4XH1 A;  2DPN A;  5AQQ A;  1YIJ N;  1X3N A;  5C0Y A;  3CCM N;  4EFH A;  1YJN N;  3D2E A;  2QA4 N;  4G9Z A;  3IMX A;  1KAY A;  4LC9 B;  3ID8 A;  1R59 O;  3NMU A;  4FWQ A;  5AQI A;  4A5B A;  2P9K A;  4IOX A;  3CCV N;  4FWP A;  4YOV A;  4CZM A;  1KQS M;  4JK9 A;  3QFU A;  4DB3 A;  1YI2 N;  3EKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...