2E2WA

Solution structure of the first brct domain of human dna ligase iv
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
113
structure length
113
Chain Sequence
b'GSSGSSGKISNIFEDVEFCVMSGTDSQPKPDLENRIAEFGGYIVQNPGPDTYCVIAGSENIRVKNIILSNKHDVVKPAWLLECFKTKSFVPWQPRFMIHMCPSTKEHFAREYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase 4
publication title Solution structure of the first BRCT domain of human DNA ligase IV
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 22
structure length 113
sequence length 113
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2006-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2e2wA01
1N5OX 3K05A 1WF6A 3L46A 3K0KA 3T7IA 3PXEA 2XNHA 3K15A 3OLCX 3EF1A 1OQAA 3KTFA 3SZMA 3PC6A 4BMDA 2COUA 2VXBA 4XPZA 4BMCA 4BU1A 4Y18A 3QVGA 1T15A 1L0BA 2D8MA 3PXBA 1CDZA 3UEOA 1IMOA 2WT8A 2K6GA 1Z56C 3PC8C 4IGKA 4JLUA 2M2IA 4OFBA 2EP8A 1KZYC 1GZHB 2HTFA 2K7FA 3PA6A 4N40A 2XNKA 2NTEA 4BU0A 3AL3A 3PD7A 2COEA 2EBUA 2DUNA 2AZMA 3L41A 4Y2GA 3FA2A 3II6X 3PXCX 3U3ZA 3T1NA 2COKA 4IFIA 2L42A 4XQ0A 3HUFA 3QVGB 3SQDA 3K0HA 4ID3A 3K16A 1IN1A 3EF0A 2EBWA 3COJA 3HUEA 2VXCA 1Y98A 3T7KA 3I0MA 2JW5A 2ETXA 3PXDA 3SHVA 3AL2A 2R1ZA 1T2UA 3JVEA 1T2VA 3PXAA 3PC7A 3UENA 3L40A 3PC8A 5ECGC 2LE0A 3I0NA 2INGX 1L7BA 2E2WA 2ADOA 3SHTA 4U4AA 3T7JA 1T29A 1JNXX
chains in the Genus database with same CATH superfamily
5FUVA 1XFAA 3LUGA 2KI5A 1CUZA 3H0CA 1Z35A 1N5JA 4D6XA 4U5XA 5CCBA 4RGVA 4QUEA 1Y9AA 2OENG 1QDUA 3L02A 5C8DA 4EGJA 3DF7A 1MOSA 5BUSA 3GT4A 2PIDA 3AVWA 2IP4A 4O59O 1Q0UA 4EMUA 4IKOA 2PLWA 4C2BA 1Z07A 4YCAA 4PS0A 3RNOA 1QYRA 3TX6A 3TINA 1RYFA 1V1RB 5AVWA 4I1RA 4RVGA 3GJ8A 4TL9A 1B6SA 1ZIXA 4YRRA 4E7OA 1DI0A 1YQEA 5BN3A 1GDTA 4QWWA 3PCRB 4K87A 1CUSA 4CIAA 2IH2A 2O8CB 5L7TA 4YPOA 1RQ7A 2EERA 4BCDA 2G4LA 1HYQA 2C8JA 4JOBA 3IE2A 4REQB 4YRTA 4X64B 3EWIA 1RJGA 1DJMA 2GEBA 2XQGA 1Y6GA 1C7IA 3D8RA 2QYOA 2YFKA 4HAWA 5LA6A 3TJMA 4B44A 4F1KA 1WP4A 1XDSA 3ROPA 1CUVA 3AIIA 2CHEA 2WYHA 4JITA 4KC0A 3NG1A 6CHYA 4N0DA 2YS7A 2G4VA 3P71T 2ZU0C 4JT4A 4KQCA 4MITA 1TZMA 2DP4E 5EP4A 2AQHA 2NUBA 4ZT2A 3DLAA 3DMHA 3K1YA 1KI3A 4TTPA 1ZOOA 5BRJA 3IUYA 3QUAA 1QXSA 3QWHA 3FMIA 1L5OA 2PZFA 2WJWA 3KQWA 3U0VA 3A31A 5ER9A 1G4UR 3ZJVA 4I46A 3NT2A 5EE0A 5AI4A 3GB9A 3IT0A 4BO7A 2V55B 2Q5QA 1ADBA 3ADOA 3L1JA 5DBHX 3WP1B 3A4YA 2LD4A 3E84A 3WZ2A 5KTMA 2AFHA 4FDUA 5EQDA 2DT5A 3E3AA 2PSEA 3VJMA 2PS1A 1JW9B 3OETA 1DAMA 1GQRA 4RKYA 1BXKA 3PENA 4Q9DA 1YZHA 4KPUB 2AFIB 4HUTA 2XMRA 4MO2A 2CNKA 4DBZA 4GR9A 2R00A 3WS7A 4JJIA 3I04M 2ZGVA 2C42A 3K5HA 2IXEA 3RYHB 2A0FA 4FHZA 3II6X 1QP7A 2I33A 1DWQA 2WJ4A 1GZ7A 4EPWA 5A6SA 1YHYA 1BKSB 2C9BA 1UBEA 1X6VA 2X3FA 2PRJA 4BCCA 1T0HB 1JA9A 3I8XA 4B0OA 4R9VA 2JA1A 5AVQA 3AESB 4M46A 2IIPA 3ZU2A 2CUZA 3DVSX 2G1UA 1F9EA 4UCWA 2DGDA 5FUQA 2PEYA 4JR0A 5C1DA 2ZTUA 2PMBA 3B53X 4TKZA 3MUEA 4UDXX 1CR0A 1QVVA 2VP5A 3HKDB 3HZZA 5F9MA 2RG1A 2I4TA 2JLQA 4MKIA 6NULA 5F76A 1SG9A 3Q4GA 5J2TB 3L49A 4Q6BA 4BTVA 3M3PA 3L8FA 2BI7A 4OHKA 3SZUA 2R5NA 1DC5A 3F6CA 5EP3A 1FE8A 1Q7BA 4PXAA 2Y1OA 2A9JA 1GSOA 1K5PA 1Q12A 3QUCA 4D9NA 5ERXA 3PQ7A 1D2EA 2W6CX 4OHMA 1PWZA 3OE4A 4RDXA 1UBRS 3EZYA 2RBKA 3BF8A 3KR2A 5A7FA 5FFFA 1H3NA 3VNUA 3CLUD 2PL1A 1O9HA 1P2GA 1EVIA 2BGUA 1IQPA 2VZ8A 4A03A 2BYTA 1U81A 1P61B 4H6WA 5CGZA 2MT9A 4FN5A 4P31A 4G01B 1OROA 2Z6QA 2NUTB 4R1QA 1MZPA 4BQOA 1ORRA 2XKBA 4F3TA 1NXVA 2V1XA 3ORRA 3Q11A 1NXSA 2FV8A 3GDGA 4WY2A 1K98A 3AKZA 3CF4G 4Q3LA 2QRGA 1HPLA 4OYRA 5FEMA 4G6ZA 2BZSA 2IQIA 1BWRA 1GEGA 2IEZA 1T6ZA 5CHEA 2XITA 1SNYA 4L57A 2HMTA 5BVGB 1ULAA 3RK1A 2ORWA 1UZLA 3G9TA 4MWZA 4W8HA 3V4ZA 3CEHA 1NJ5A 3JQ6A 1YVEI 3GQBA 2G6TA 3MCVA 3MGCA 1SU4A 3D59A 1CIPA 4EYOA 4JA0A 5F21A 1VL8A 1IFXA 2IKQA 1VXOA 3EWAA 3UEOA 1I7QB 1B2LA 3U7IA 4OI0A 4JBHA 3HKBA 3IVAA 2QZ9A 5G1PA 2C99A 4HG2A 1OH7A 1XZAA 2EDAA 2QLJA 3IBGA 3QW4B 5KYVA 3CLTD 4Z7JA 3I8OA 1TA9A 4LF8B 1P0IA 5K2MA 3IEUA 3EULA 2IPLA 2G8NA 1QAMA 4WESA 1CXZA 3GJ6A 2ZS9A 7REQA 1EWTA 2Z4SA 5GY7A 1UOOA 4AWAA 5TPZD 3U4CA 2V4UA 2DR0A 4IUDS 2ZBGA 2ERCA 4IGFA 3G0GA 4EEKA 1RQ2A 4Q37A 5IUNC 4HXFB 1ZUWA 3AU9A 4HQNA 4Q01A 2OYCA 4EY4A 4KDEA 4IOLA 3DDOA 1Z6XA 3BXGA 3HA7A 1B93A 2GAJA 3DHYA 1DXHA 3LTEA 5F23A 2WWYA 4ETWA 4CG1A 3X1WA 1JIKA 1RACA 1OFVA 5L95A 2JLVA 1XQXA 3WGVA 1K7FB 5HF5A 2RAVA 3AB7A 4M0UA 1H23A 4RS4A 1DX4A 4F71A 4R71A 2F1OA 2NG1A 2R6R1 3UG6A 2QDXA 3L6OO 2B25A 3MNFA 1CTQA 5MF6A 2JGFA 4XYBA 3EGCA 1R27A 1AO3A 1EINA 3GHYA 1ZOPA 1TEZA 1S5PA 3PQDA 1JFFB 4PZAA 1CF9A 4HGNA 1F3OA 2MWMA 2SKEA 4UXIA 1P1CA 2VP2A 1RVV1 2YWDA 3AY6A 1M2EA 3PJGA 5GPBA 5EJ9A 1Z0ZA 2ZYSA 4E5PA 2AFHB 1V45E 2R5WA 2PLNA 3BRWA 3BEOA 2CLFB 5AKLA 4JIMA 3UJNA 4Y9UA 1FX1A 4FMPA 5LLTA 3G0DA 4YH1A 4M9XA 3REFA 2W2XA 4M6WA 4PG7A 3AINA 2PH5A 1U0NA 1YZVA 4HNQA 4ZOLA 1EXWA 3EA0A 3LBHA 1IBKB 1EIWA 1SEVA 4HGRA 2ZRLA 1C3OA 2QUHA 2ZPUA 1Y80A 3OQBA 1I3CA 3ANSA 5A6SB 5K9ZA 2D7JA 4C01A 1A8PA 3FCEA 5EN4A 1NP7A 5DBIA 3HH8A 5FT9A 4RA9A 4DA7A 3GJ7A 5EKXA 4DQKA 4RFLA 1YJAA 4F8EA 4I5IA 4R0VA 4HDKB 3O8CA 3M1AA 1I6WA 1CZLA 3OEHD 1VBMA 2R4TA 2Q29A 3UICA 3L8MA 4ZVMA 3WWEA 6REQA 1Z5VA 1PV4A 4FXOA 4L07A 3QVXA 1EWVA 3TLEA 4YR9A 1HGXA 1JHRA 1MFZA 1VG1A 3KB1A 3SYRA 4OHYA 3HRIA 2GOYA 4LXYA 2CLHB 3ANMA 3AW8A 5CEFA 4H7PA 1GSAA 1X77A 1D2AA 3LC2O 1I51A 4ENVA 2AOUA 1FP6A 2IC5A 3FM9A 4AJ4A 3CLSC 4EF5A 1RM4A 1JDBB 3Q3GE 1LLCA 1HRKA 3NOQA 4WKBA 4EJ2A 5DM2A 3UV6A 5AUNB 2A14A 2ZSEA 1IRXA 4Z86A 2COUA 2H08A 3CLRD 2J59A 2D62A 5C52B 2C88A 4MYCA 5K51A 3EDQA 2IY9A 3AI1A 3ONEA 1F8XA 4CEIB 3JD1A 4QXAA 2C83A 4Y2TA 2OB2A 1FJHA 4TSFD 1NNSA 2PMCA 1G21E 2Q6LA 4HWPA 3GBVA 2X4DA 3H9BA 4TLCA 3B89A 4FR2A 1KI8A 1L7DA 2PVCA 4RPKA 4XXHA 3E3NA 3OQ6A 3G9ZA 5CVUA 5ERGB 3WQBA 1HRDA 4ILKA 5A03A 4RMJA 3L05A 4TTTS 2JK1A 4EMSA 4R84A 1QH0A 3DC7A 4GOND 5EXPA 2GFIA 3LRTA 5A7GA 4J7UA 2O20A 4PYKA 3NJRA 1YQUA 3ZZMA 1HETA 3TW4A 1MO5A 2CK3D 1U3VA 1ZINA 2JHGA 3DBIA 4G56A 1YQDA 3KYIB 1QRAA 4RY0A 1GPJA 3BWDD 3M4JA 4DIDA 2QYHA 3FDIA 4JI7B 2X1HA 1V8ZA 4FGUA 4CIXA 2RKOA 4BWYA 1R6AA 1DVRA 2A7XA 3BREA 1E62A 1P0FA 1ML3A 4R01A 3RLIA 3VJLA 1P39A 3N5CA 5AK3A 3KZMA 4R40A 2QIOA 2WDZA 4I66A 1O95A 5I7HA 2HJVA 3HS3A 1NIJA 2PLAA 4S1WA 1N5LA 3P9RA 3ENZA 2RAFA 3GJ5A 3M9XA 3Q1LA 1QIEA 4V38A 3WMFA 2F2TA 2O5RA 1A9SA 2F6RA 2WF8A 4O4HA 4C3OB 3MMNA 4QQRA 3M7IA 3R0IA 2J0UA 3T1NA 4B7XA 3PE4A 3HBNA 1WPXA 3FCYA 4WESB 7REQB 2G1PA 4U9HS 2ZVJA 2FPKA 2H06A 3JZDA 3L9XA 4AN1A 5TXGA 4QJ3A 4Y2QA 4Z0TA 3DFFA 5ED4A 2Q4RA 3F3YA 1LB1B 2P9YA 5EP1A 1P2SA 2YWRA 4ZMRA 2HJSA 2W7TA 2NUAA 1BCRA 3CF0A 1WCV1 3H8WA 4L9WA 1USUA 2VR1A 1KARA 1A9YA 3NHKA 4QNNA 1FNDA 3PXGA 3SK0A 3PD0A 3C3PA 3CC8A 1Y8RA 3DL4A 4CT0A 5C8ZA 3FKSA 3P0EA 1JUDA 2IF0A 4O1HA 4Y2RA 2R1ZA 3AUYA 2B0JA 2BFFA 3BSSA 1HZZA 3HEBA 3PFFA 4M83A 3SN6A 3DM5A 5KU7A 3IB6A 2CMKA 2CMFA 2J85A 4JXZA 3A3PA 2BRUC 4IF4A 4H18A 5FULA 1ZGHA 4LSZA 3F78A 3VR2D 4CUZA 1IBLB 4CMIA 1S1CA 4EARA 4EZEA 1FA9A 4JJFA 5ABPA 3FHCB 3LQ4A 1N3YA 3LX5A 4N5DA 3SICE 1OKKA 2WMDA 3BF7A 3MJSA 4FGJA 5MN5A 2FUG1 5TQJA 3F2IA 5B37A 2WIFA 1GPKA 2GZ3A 4MUEA 4DJAA 3DMRA 3DWIA 4MW1A 1MDFA 4QJIA 3VSAA 4DC0A 2VUTA 4YXWD 1LDYA 4ZOLB 1DXQA 5IVKA 3E9CA 5CX4A 1HUQA 4MUBA 5HR5A 1C3OB 1W36D 4A5OA 2C5HA 2D0OB 4AS2A 4OQQA 1R5JA 3UJPA 2VDNB 4P34A 2F9FA 3TDNA 4A2CA 1VLZA 2FZ4A 5CA0A 2W4MA 2GR9A 5KPJA 1NX6A 1P3JA 1DO2A 1EP3B 2E3JA 1LBTA 5L9AA 3R9KA 5B55A 2Q1YA 4MV5A 4RA9B 3ROEA 4DXAA 1E1YA 3VR4H 2CSUA 1MU0A 4R1LA 4WBXC 3RLFA 4L50A 1UH5A 3KEOA 4WBNA 1KEKA 2LR0A 4RPJA 6REQB 1CETA 4F56A 3BIOA 1WD7A 2ZREA 3MMXA 4URVR 1L8AA 3OCCA 1NSFA 2EARA 1F2DA 3A3OA 1EFCA 5DH9A 3VR6D 5LLSA 1PJSA 4JLUA 5EPEA 2NGRA 3KKKA 5EQJB 1JEAA 4GDFA 2GBGA 3USCS 1GT6A 2XWBF 3E9EA 4GYYA 1JPUA 2DBVO 3CHYA 1CJKC 4ZVVA 3GLIE 4D4LA 1Y37A 3EF3A 1QGZA 5H59A 2JVJA 2Y93A 3JVDA 3QZUA 1NA5A 1LPOA 1IHOA 4NQRA 2EZUA 1ZHOA 3GRKA 5A0TA 4IMRA 5KYXA 1I2BA 4J7CA 1U8YA 2DFTA 2P90A 1A4UA 2UAGA 2B3DA 3R3SA 4HK4A 4KGZA 4BU0A 4PSKA 4WK0B 3CO0S 5DRTA 4OP1A 2WAMA 4G1CA 1XZBA 2LKCA 3WADA 3H18A 2GEKA 1XDZA 3K0AA 5EINA 1LDBA 2ACEA 5GONF 2ISQA 2G83A 3UB4A 1NC1A 5JV5A 2QSJA 3HWWA 4QYMA 2HQBA 4E09A 4GI5A 3LL7A 5HTKA 3O7WA 2J6CA 1QLWA 5K03A 5KMGA 5G53C 4I1OA 2W9XA 2YJNA 1CSEE 1CUAA 2RI6A 1QZ3A 1DXOA 2LNDA 2ZR7A 5EESA 5AI0A 1R16A 1YB4A 2F3QA 3AHJA 3WIBA 4KVGA 4RELA 3IALA 2A6PA 1B8OA 2ZRKA 2ZJ5A 1GZ4A 4DTIA 1D2HA 2HZBA 4NSNA 1NQTA 3W05A 4UD2A 1M0EA 3MJHA 1NJ6A 1V5EA 3MVEA 2V8BA 4HN9A 1JQJC 4I5DA 1NZDA 2BMAA 3T1YB 3BWEA 4D99A 1DKQA 3AEUA 4FSDA 2WVJA 1M8GA 1U0EA 4IJUA 1ZRMA 2VTDA 2WOOA 1NVDA 2ZJOA 3FOCA 4CEHB 4D9IA 3VJRA 2N75A 4F5DA 4K0KB 3CVWA 2QHXA 2F62A 3QVJA 3CCFA 1NNI1 3G6KA 1O58A 2VBCA 4HRVA 5FNVF 5G3YA 2QXUA 1MFPA 5KYNA 4BJ5A 3OPQA 1KEPA 5BQ3A 4D41A 1V95A 2X3YA 3KFXA 4GR5A 2CWWA 5I5EA 2DQ4A 4TL6A 2D74A 3WP0A 4OB8A 4TL7A 4HB3A 3L7LA 3U7JA 1M1YA 1BA2A 2JIZD 3KPJA 1E2NA 4FJ1A 4A10A 1UJ6A 3KQKA 1NGSA 1TI7A 3R3ZA 1MABA 1Z29A 1YVUA 3OZVA 3KLPX 1D1TA 1E2EA 3EGOA 2QWXA 2X9GA 3K05A 2AG5A 5E4YA 5FPTA 2OGSA 4Y67A 4MKHA 3UENA 4D0GA 4ACAA 1DAPA 2KX7A 2CW5A 3G5UA 4YAJA 5JECA 4DCMA 4YJ2A 3DCYA 4C5CA 2O8EB 4FFWA 1FDUA 1ZUNA 1DBIA 5C0OE 3ESXA 3RSCA 1A3CA 3OEYA 3EFBA 3AIKA 3FTDA 4IVQA 4NTZA 1KA9H 5FWNA 1HMYA 5BWOA 1NQXA 5MN6A 3D5TA 3PGLA 3D6AA 3N2YA 4A0FA 3N8DA 2C58A 4CMIB 2Y92A 3GJ4A 4CMKA 1E79D 1KSJA 4QUDA 3WQSB 2NVUA 3GUUA 4XKJA 1WMBA 2ONZA 3OZUA 4DSUA 5GZ1A 5KS2A 4XCXA 4JJAA 4AS3A 2C7QA 1U11A 1W85A 5A4DA 3GW8A 1IPEA 1OSNA 3KJGA 3WGIA 5GV7A 1X0XA 2QX4A 2EAUA 2VDKB 3IUQA 1FNBA 3KOMA 3Q7EA 2ABWA 5C53B 1GCGA 5H16A 5JADA 2Y4NA 5E4JA 1I6MA 3R44A 3GXBA 4NAHA 4D0NA 1J56A 4W6QA 5AJYA 2O2SA 1Z6AA 3TIGA 1QQTA 5BR1A 3O8RA 1MP0A 3C6QA 3KQPA 3G5MA 4K05A 2BP7A 2HU2A 3E9ZA 4GWKA 4OGFA 1E9AA 1T6XA 1SVNA 2ZTMA 1KAOA 4TXHA 1SXGA 1ZD8A 1HDZA 4LRQA 5A4MS 3NALA 3M4YA 3NGMA 3GUCA 4PCLA 4GPZA 3HYLA 1X1DA 2GWHA 3PE6A 2BEVA 5DHSA 4BZPA 5CA1A 3OQOA 4N40A 1BDHA 2JRLA 5ALDA 1ZCFA 5JT1A 2J9YB 3DOIA 1X8JA 4L74A 4WBNB 2C4KA 2Q4TA 3MRTA 4AXBA 4C7KA 4FMDB 3MS2A 1IY9A 2HHLA 5ALNA 5D3MA 3GMDA 4E51A 3P9YA 4IQFA 4EUKA 2HXYA 5KTKA 5SY9A 2HIMA 2HYIC 3TM5A 4UE2A 1J49A 5JDIC 4DEVA 3G9QA 2QLNA 2JJ1A 2BKUA 2Z98A 3T9BA 5LOVA 2EBHX 3UOGA 1T6YA 4Y6QA 5BUZA 2YVKA 2Q8PA 4FIDA 4DAOA 5EHNA 5A5FA 2P4EA 4DV3B 3DFMA 1ZS9A 1JIXA 4FUQA 4GZ3A 3VSCA 2FW0A 5C8XA 1M6NA 1VBKA 1WXFA 2HO4A 3BD7A 1N2ZA 4IPTA 3Q8XB 4UPVA 2Z8XA 3VTAA 2GUGA 5IRCD 2WKPA 2CGEA 1Y48E 2W0MA 1U98A 3M81A 4H31A 2IODA 3RARA 1USVA 3HTXA 1JXOA 5DI3B 3FCCA 1FTYA 4YJ2B 3STUA 3K0AB 1VCIA 2B21A 2IXDA 2WRZA 1QE3A 1P77A 5DJ5A 3H5VA 4EJFA 5DM70 4WVFA 1SBYA 4KX3A 4DUZB 5KMGB 1CS4C 3UW1A 4D1YA 3D2LA 2E4YA 2WU4A 1OREA 4P6VF 5KSZA 4NZZA 1FIUA 3G88A 1NURA 5IAKA 3KJXA 3ZIAD 3RVDA 3WA6A 5JAZA 1V8PA 4W82A 4QD3A 4YJ3F 1UDXA 5KC9A 3HN2A 3RF7A 1Z37A 3VR3A 3AM1A 5E1BA 4POAA 1SCDA 1SKBA 4H0FA 2MCFA 1MC5A 1FC0A 2V4ZA 3BS4A 5B3AA 3VR4D 1X1TA 3T7JA 1MG0A 2FK8A 1JJAA 2C98A 2AT1A 3B12A 3BGWA 3H6HA 1S2IA 3O8OB 5KSPA 3STYA 4CQMA 2P2DA 1UBKS 2AZTA 1ELOA 4KAAA 3UCEA 4PC1A 3SBOA 4PZUA 2C04A 3OTOB 3PDUA 5H4HA 2R5FA 4X9XA 1ORWA 1G9XA 2IYAA 1DQNA 2J33A 2J9XB 3C48A 3UVEA 1I4OA 1XMQB 4IWYA 2AYZA 1RLJA 1YULA 2DE0X 1BS2A 2RI1A 2CSXA 5EMMA 1ZN7A 4O6VA 1Y3AA 1Q91A 2RHWA 3M6LA 3TBKA 4KHPB 1NUPA 1JHPA 3Q6NA 4G0VA 3R5JA 1DDIA 1UJ5A 3G2PA 2O1SA 3NOVA 2FGKA 3IIMA 3PSHA 5J4HA 1C41A 1M1YB 1QIFA 1C7JA 2C0PA 2WTBA 2ETVA 3MJTA 4O5AA 3JRWA 5E4TA 3NHSA 2ZB7A 1L0BA 2V98A 4G5OA 4OLJA 1C0EA 1WDLA 2D5AA 4L0CA 1NF9A 1MABB 4K1XA 4H16A 4N9WA 4QREA 3WRWA 3SIPA 4CF7A 1V7QA 1SA0A 1YXMA 2FR8A 2PBZA 2QMEA 3HYNA 1XKXA 2G70A 4N8SA 2C7GA 2ZYIA 4UUNA 5JOQA 2DCUA 2AKAB 2X6RA 3TI9A 3PYLA 1ZUNB 3BGVA 2H1FA 4NXMB 2IVZA 4LSWA 4Q39A 3U4HA 1KFKB 4QFMA 2CMDA 4BKPA 4AZ3A 3U56A 2DF8A 3S2ZA 3FSEA 1G2QA 4QJ4A 1PT7A 4R1NA 1WZCA 4F4IA 4C0SA 2Q62A 2NADA 3GFTA 2NVUB 1G60A 4YIKA 5KOYA 2JFWA 2XVZA 3FNGA 3AHCA 2MHCA 1UDWA 2X14A 1WW2A 5I4KA 3LYHA 4ZQEA 5GJCA 3WWYA 3RRNA 5FWDA 5FPQA 2OZPA 3I05A 1K9VF 5A9SA 2QW8A 5BRAA 1V8FA 4YONB 4EO7A 3VPHA 1H0SA 3CTMA 5K5EA 3BRQA 2RHLA 2JCYA 4RMGA 2D3WA 2NO5A 4KQFA 1SZDA 1BRTA 2L82A 5HCUA 3I5YA 4PX9A 4J0KA 2CB0A 2XRMA 2AF3C 2BP7B 4RK6A 3BJEA 4M0FA 2DPHA 2VDWB 1G5HA 4G5SA 3CF6R 2BZ0A 4XSGA 4G0UA 5DB4A 5JC1A 1TAQA 2J0SA 4URZR 1M5RA 2ATIA 3HVHA 2O3SA 2WYIA 2J7PD 4EDFA 1OXXK 4B09A 4D42A 3E7DA 3WNCA 1DAKA 2P7IA 3T3HA 4F21A 1X7XB 5HE9A 3RSFA 4XYMA 5K99A 5KVSA 3CONA 1MO4A 3AI2A 3R7LA 2ZCJA 4GBMA 4QOEA 3K0EA 1QFXA 4DHEA 4DLZA 1RQGA 2DWOA 2ILTA 3COZA 4J3JA 4Z9XA 4L4ZA 1T25A 2DUMA 4UVIA 1J21A 3ZQKA 4GPBA 5IFKA 4OM8A 2HF8A 1E6KA 3CN7A 5G0UA 3OIVA 3SHVA 1F2UA 1T2VA 3GNSA 3NP7A 2OUKA 4P4SB 1FRFS 1FTQA 2R66A 3B51X 4CQLA 4LJ8A 1IHXA 4EA8A 1CJVC 4HQ0A 4DADA 4BAUA 3DMTC 4GX5A 1CEXA 1JI3A 2BKXA 4URUR 2V7TA 1T10A 1TYZA 2FK7A 4E31A 2IHUA 4RSGA 1YDGA 2DRIA 1K6XA 4MWBA 3U81A 3ZE1B 4AMYA 1U3GA 3R9XA 1XHLA 2ZBEA 3NETA 5INTA 4JLAA 2AKYA 3WLKX 1W5BA 2QY9A 4K03A 3FPSA 3OF3A 4C0XA 1Z5UA 3JYLA 3PI7A 2XGSA 2QRVA 1LPNA 3PBKA 1WCYA 4NAVA 4F4HA 3T7EA 1Z5NA 1WTAA 3MQFA 2SBTA 3C3XA 2FP4B 1P60A 1T5SA 2O3JA 1MQSA 2Z5GA 1LDEA 3TW0A 5IDVA 4QQKA 5K0LA 4CHGA 4F60A 5BWNA 1DTSA 4Y6SA 2F1JA 1EP2B 5ECDA 1XP8A 2H51A 1UUFA 1MJGA 3K1ZA 2IUYA 2PKCA 1DG9A 3O2QB 4FTWA 4MUHA 4P4UA 4YJKA 2PXAA 1JG1A 4ND3A 4IFBA 4MAFA 3EGWA 4DB2A 3RJ9A 4D02A 3SAJA 2RI0A 3CLUC 4CQMB 2VEDA 4Z4CA 2HSWA 3B3GA 3F1KA 3NTLA 4KOAA 3VKGA 3UHOA 2HWYA 4Y0AA 1DPGA 4BGUA 3NR2A 2FPWA 1D2RA 2OV2A 3TMAA 1TUGA 4KZPA 4L4XA 4WK6A 2DAPA 2X5KO 3L1HA 4C04A 1ODJA 2EEZA 1L2TA 4QDZA 5JCZA 1P7YA 2QN2A 1LH0A 4C3VA 2YBEA 4P3NA 2OT3B 3AETB 1PJ3A 1U7WA 4EUEA 4FMCF 3AL0C 1IATA 4DW8A 8GPBA 5GMOA 4WX2B 1TIBA 1MRSA 4WLFA 2GJ8A 2QD3A 2PLFA 3ABSB 1A9PA 4HP8A 4PZZA 5DP1A 5EGNA 3RVMA 3UJHA 3N28A 3CXUA 3ZCUA 3PG5A 4QYSA 2Q3JA 1CJUC 4N7BA 2QPTA 3CX8A 2OVBA 2RH4A 5M7EA 3G2JA 1QX3A 3R0QA 2EKZA 4UEOA 4H7DA 3VGPA 1KEZA 2IZ1A 2H31A 2Y3IA 4CM6A 2R1VA 5T6MA 1U31A 2GN2A 2OWDA 4KIUA 3SYKA 3N3AC 5C37A 5LQCA 4Q7EA 2YV2A 1IN6A 5ALWA 2B5WA 2DBZA 3ZHUA 2MDTA 4Z1MA 2P5UA 3BH0A 3U3MA 4US2R 1IJFA 4ROTA 1IBRA 3CLTC 2EFCB 2G77B 4ZP1A 5A5DA 5F9FA 1S7GA 1CFZA 3H97A 2B61A 2O2ZA 3FA2A 3V80A 1L7AA 1A9XB 1INLA 1GRCA 4E5KA 5LM3A 2EP5A 4IINA 1P45A 3FJOA 3Q0EA 5EJAA 5HFAA 2OA0A 1TEVA 4B7CA 1O4WA 3EVEA 4S0XA 1QIIA 1X15A 3GFBA 2C2OA 3IQFA 2GYYA 4BLOA 4EPRA 5JANA 1EBFA 4ZQCB 4HL6A 1T91A 2F4NA 1H2AS 1SXJB 2IYWA 1XMSA 4ZANA 3CS3A 3DQQA 1AKEA 3W8NA 1ST2A 3TDMA 3DOOA 4NHEA 2B7CA 4E5DA 3A1TA 4O02B 2I1LA 3VR1A 2FA9A 3TAXA 3GMIA 5FBRB 3NGLA 4PCVA 3KQQA 4FE4A 5ECWA 3VOAA 4E11A 3MT7A 3TEMA 4KNYA 1RJFA 3DYIA 2BGIA 4NULA 5ADVA 5LN1A 2VSFA 5CLHA 2P1ZA 4F1WA 1DZ3A 5IH7A 2VJQA 3I0NA 3HCEA 4RSRA 1IM8A 3GEEA 3TLGB 1WA5A 1XLVA 3UNXA 4BNLA 4FVTA 2VYCA 1J23A 2BKVA 3BK1A 4HUQA 1W7AA 4D0RA 5TSDA 4FN4A 4HX5A 3KD2A 5K0SA 3BBPA 3ICEA 3PCTA 3WVNA 5K05A 1ZCBA 1QE5A 2V74B 4CCSA 1ESMA 2XW6A 3WISA 1ODLA 4BQFA 5LQDA 5TF0A 2WPNA 2P2CA 4WA7A 2O0JA 4CQJA 1UC5B 3JQFA 2HPZA 2VRCD 1I7DA 3SLKA 4RZXA 2IP1A 3G49A 4YCMA 3ZDBA 4XD2A 2BMWA 1XUOA 4DILA 4AKTA 4CQLB 2QVLA 5BQXA 1KOFA 1GXSA 1W47A 4XGIA 5SZKB 2V96A 3LCCA 1YRAA 3DV0A 4C4PA 1S2MA 4X7BA 5F2OA 2YDXA 5E6SA 4U8HA 4BMCA 5CH3A 5E7IA 1GQSA 2ZUVA 4JC4A 4MQEB 3LI2A 4L3OA 5DGDA 1WXEA 2EW2A 5JAQA 4DV4B 5DM4A 3R9XB 1GYRA 3DKPA 1PQYA 2I6XA 1GUYA 1HA3A 3WZLA 5LFAA 4LC0A 4ISCA 1XJ0A 1EA5A 4HEQA 4ZT4A 2QRVB 2VSXA 5E6RA 4ZVNA 4QDTA 1IPFA 5EMHA 1G2PA 2I76A 3T0FA 1N5KA 1JEDA 1HQDA 5FUBA 1XTSA 3ML1A 4NI5A 2Z58A 4TS1A 3CUSA 2AN5A 3IHTA 1SC4A 3TZQA 1U8AA 3PJDA 4RDCA 1CULC 2BFNA 1ZXBA 5I3CA 5CCDA 1P1JA 4QU5A 5JY1A 3CUTA 1TC1A 1G9SA 4UBMA 2IH4A 4KR3A 1FVXA 2GAFA 4L6CA 1NNLA 2XNKA 3KU1A 4KR6A 2NTEA 2PH3A 3ZS8A 4Z53A 1Z4JA 1O9BA 3HYCA 1CEEA 4CV3A 3JR3A 1BFKA 1RWOA 4OBXA 3HDVA 2RKWA 3ZDXB 3L8YA 1NOKA 1Z2DA 3DL2A 2RGDA 5LYJA 1U4SA 4TKUA 1CUDA 1NUTA 2PUTA 2VDLB 3L7NA 4FZJA 4PSDA 1PNOA 4YQYA 3S70A 3HN6A 4TYWA 2IW1A 3M6MD 1UZUA 3DMDA 3ELDA 3R4VA 2RB5A 1MB4A 1OCEA 2QN6A 1JHDA 3RBZA 8MHTA 2FQWA 4GZLA 4MQUA 5C31A 3TXYA 5TF4A 1KP3A 1L1EA 3OMWA 1YRHA 3U3ZA 3PQ8A 1GA1A 2PV7A 5T7BA 3L7DA 3IUBA 2I7DA 4EYEA 4H1HA 4DR3B 4O4IA 1TM2A 4NE9A 2WIKA 3EVBA 3G8YA 4IMJB 2QVBA 1XT6A 1COWA 4RBNA 4K9QA 2GZMA 4Z54A 1S3FA 2Y68A 3IAS1 3UYKA 4TZ0A 3K16A 1UQRA 1QNLA 4YRAA 2PYDA 4Y7CA 3AUAA 3GP3A 4LRTB 3VPXA 1Y3BE 1KMHB 2CVZA 4YRQA 2WZCA 4FJ2A 1ESNA 2NYAA 1G7RA 2EFDB 4A73A 5EP2A 4YPVA 5L4LA 1QG2A 1RNLA 3L5KA 2WMNB 3GD5A 4R81A 5JH7B 4MYRA 3R2JA 4KXXA 4F4UA 4PWZA 5HG0A 2GYVA 3BORA 2I6QA 3I34X 2P9BA 1WBBA 1M34E 1W35A 2O7RA 5FB3A 5JC8A 3M1IA 1GNTA 2QRNA 3MPOA 1F5SA 1U1DA 3FTNA 2FF7A 2OBXA 3UF0A 3WK7A 4B8YA 4DUYB 1J1UA 1KZ4A 3KQTA 2FPUA 3LPCA 2WJVA 1P33A 1NHWA 3SHWA 3SZOA 4EZIA 5LXTA 4UFPA 1F2TA 3RC9A 4BVBA 3FLEA 4MPRA 1XAJA 4OI1A 3UJ8A 2OGWA 1OAOC 2JLSA 3N1UA 3ZV3A 4RQAA 4RJKA 4OREX 1W0JD 3VNSA 4RTKA 4KN8A 3E8MA 4ZPJA 1JR4A 2Z5FA 5G1NA 1QHXA 2B9VA 3WYFA 4ZKDA 3GPDG 3HFJA 2Z57A 4YI3A 4B85A 3GLUA 1RCFA 1V5GA 4F2DA 4P36A 3RVQA 5KNBA 3O75A 3ORSA 1FQWA 1YFZA 1B6RA 5LZ4A 1JEOA 1NJ2A 2FWAA 4ZDJA 3QIAA 4KMSA 3WYGA 3OC6A 4UPEA 1LSSA 5IKXA 4B3RB 5FL3A 4IIXA 1WP9A 3DQPA 4HUQB 5JFOA 5JVDA 3EQ9A 4XGKA 2WJ3A 2P9FA 3L7YA 1NTOA 4I9FA 3A1NA 4CM4A 5AW5A 3LDGA 3CX7A 3DMFA 2YIMA 3STWA 2YNMD 3W2TA 4E5NA 3HP4A 1JQKA 1YAHA 2VKTA 3B85A 1UBFA 3R77A 1YR2A 3W1WA 4BV2A 4WLOA 1HXHA 3U44B 4DQLA 1W36C 3U5ZB 1X1AA 3ZE9A 1GXSB 2VUUA 1VSQA 3IAM1 2QTHA 1GNVA 3GOHA 1CZHA 1QIDA 3I39X 4G36A 2V6GA 2ANBA 3H9EO 2Q2WA 3H5RA 4ZJYA 3UMRA 4G8JA 2C2KA 2J67A 2VT7A 4E6EA 2FZCA 2I2FA 1OY1A 3MWKA 1JHVA 3AKDA 5DSZA 3LUDA 3HADA 3U31A 4Q4JA 3EZ2A 4JJ8A 3WJAA 1OASA 5KU1A 1K8ZB 2AH5A 2DLDA 2O8BA 1R3UA 3ME5A 3EFHA 3OJOA 3OMXA 3QEKA 2JJ8A 5TPWB 3W2FA 4C7JA 1OAKA 9LDTA 2ALJA 5KCMA 2JJ2D 4AJOA 4J76A 4HEA1 1H5QA 3KUXA 4CMGA 3RS9A 1ICEA 1TJ4A 1DO8A 4BUZA 1XEFA 4U8GA 5CM9C 3EUAA 3PEFA 5LPNA 4XJTA 3V8BA 2WIGA 4ARVA 2HA5A 4D4HA 1XMOB 1PL8A 4Y2GA 1M2HA 2D1YA 5KJCA 5CITA 3LUHA 3M5DA 3B78A 2POCA 2WHEA 4RD3A 4UASA 4CL0A 4JROA 1APBA 2GKGA 2XLCA 3I1IA 3I9LA 4ZZ0A 1RLUA 1L7EA 5KVQA 4LVCA 1GN9A 1NQWA 1UP4A 4TROA 4XQ0A 1H1TA 4Y9DA 1LBIA 4AG5A 2I3AA 4H1WA 1NC3A 4R7TA 3NNSA 3CH6A 3EC7A 3OU2A 2GJKA 2OXRA 2Z4TA 1L5FA 3CPEA 1KDPA 5F2KA 3Q72A 3V1MA 3WIOA 1V41E 1XQ1A 2QTNA 3I9OA 4JWTA 2VPQA 3OD1A 2XQKA 1ZSNA 1MQAA 4FFDA 1X38A 4IGEA 3NHMA 2DSNA 4MV0A 3VZCA 4BKMA 4EJ0A 5JROA 1T8WA 2QGFA 3G7NA 4KSYA 3EMDA 2A9RA 2QRZA 5AMXA 1TVKA 1R9JA 2I1WA 2NQ8A 3PHGA 4Y6OA 4HPXB 5IF9A 4LOKA 2IYPA 1NYRA 3GJ3A 2F1RA 1SKAA 2QZZA 4QUJA 5G0WA 1D0IA 3FWHA 2RSLA 1PRYA 2FPPA 3K1TA 4TS4A 4H7FA 3ICQB 3FRIA 1Z62A 1F06A 3QI2A 1O08A 3FAKA 4C3ZA 2E0IA 5EUQB 1V8BA 1XU9A 4O5OA 3EPRA 1KAEA 5JW6A 3F5QA 1VZ3A 2JRCA 3FYDA 4K2AA 4ZQHA 3TQHA 3PGVA 1PTKA 4A82A 3F4LA 4UHKA 1K5DA 3DH0A 2XF8A 3E61A 1UMDA 2PBRA 1JG6A 2RJ3A 5BRNA 4IQGA 4BNHA 1E7YA 1NVUQ 4C4YA 4J75A 2V45A 3PD1A 2M32A 1JV2B 5B58T 1JLKA 3TSOA 2K87A 2YWJA 1C81A 3NEPX 2J3DA 2Q5CA 3OQIA 1NQ5A 4F38A 2JFOA 1OYVA 4Q4HB 2IKSA 2WV7A 3EBLA 1I9GA 5IMBA 1KQGA 2P9HA 4I8XA 1B00A 3BHNA 1L4FA 3KKZA 4QPCA 5EL0A 3CT6A 1KTVA 3ZZNA 4NENB 2IYLD 3B20A 3F3MA 3DAPA 1F2TB 3WIUA 1KC3A 5CW1A 4AJHA 2I4LA 2ENUA 3KSBC 5DASA 4J7AA 4XWGA 4D6PA 2ID7A 1LBEA 2HT6A 5I9MA 2EKPA 3ZY2A 3TBHA 2VNSA 5E38A 3ECAA 2V5AA 1IMOA 1WB9A 4F3KA 1U2PA 5FCDA 1E77A 3NNDA 4G8BA 2QTZA 3V8PA 1ZIOA 4C3UA 3AEZA 1WF3A 4HRXA 1PT6A 1UKBA 4AKGA 1WUHS 2YS6A 3ESYA 3CQ9A 3FF1A 2BEUB 4C08A 4KFRA 3BDAA 5D6NA 3UHFA 4A0RA 4AP9A 1AY0A 1V3QE 2I29A 3JQ7A 2P5YA 4URHA 2Q21A 2IEIA 5KYGA 3OZDA 3HY6A 3OKFA 4IDDA 1YR8A 4L78A 4Y6PA 3ZGLA 4BTLA 2CLDX 4CM4B 3TXAA 1DAEA 5ITVA 3NDBB 1OWMA 1SXQA 1SUPA 2X1VA 3NVDA 2QZPA 2QPAA 4U7GA 1GG5A 2QXTA 1CUXA 4ZZIA 1YFJA 2R48A 1Z88A 1X2BA 5L3QA 3I6YA 5AR1A 4LCEA 3EJWA 3PUYA 4JDPA 3B6KA 5FADA 3U4DA 3PC2A 3U7QB 2WAAA 5I9NA 2OK8A 4GXRA 4NPAA 4WKGA 4QIHA 1V0JA 1JECA 4FYHA 4IVPA 5FTLA 1BHJA 2GI4A 4OP2A 4P7JA 4A6XA 2UV8A 3EXAA 5EIAA 2FUNB 4AG3A 2CCGA 1ZI6A 3ND8A 1GPDG 3ONWA 1Z4IA 4V0QA 3D0RA 2BGLA 4MR7B 4Q4JB 3K71B 5CA1F 5MGNA 4EY6A 4PYIA 4MCAA 2CLIB 4FZRA 2BLNA 1YZKA 2VFAA 3KLOA 4G9GA 3FR7A 1E8NA 4U6NA 3GK3A 4XLTA 5J4VA 1PZEA 3NOXA 3PFHA 5CXUA 2G04A 4TMXA 5BSGA 1MLDA 1L5LA 4OXIA 5BW5A 2FW6A 3W3AA 1RKUA 4QARA 1GZVA 3UWOA 2ZIWB 2D5IA 3IODA 2NYVA 2EDCA 1KOJA 3W4IA 2ZPAA 1OWPA 3EGEA 5DXAA 4LJ9A 3S68A 4TMYA 3RS5A 1OV6A 1XPOA 5JDIA 1ECBA 4CHTA 1YR3A 3OIGA 3RGWS 1RAIA 4ENWA 1LTKA 1IOVA 2NVWA 3FOEC 4KK3A 4PLWA 2VP6A 2VO1A 5DLQC 3PU6A 1U5BA 1ZBQA 3JATB 1J2TA 5HS4A 3QWBA 3ZGOA 3VDRA 4JJ7A 3D4NA 4V3CA 3SNKA 3IB3A 4QM7A 1K7XB 4OJTA 1VBNA 2FQYA 2BH2A 5KQMA 4I1VA 3TECE 2DETA 4NHOA 2IS6A 1JKJA 2H8KA 3DE2X 5EZQA 1J8MF 1UBLS 4A2QA 1G5IA 2C2YA 2V9ZA 5C1PA 5B53A 1O5TA 1SHZA 3L0IB 2D5CA 1OXKB 2DR2A 5FD8A 5AQ1A 5FOXA 2A1TS 5FLEX 1D3AA 1TVKB 3OOSA 5GZ3A 1VJRA 4HMQA 3R9IA 3VZSA 3J7TA 1JDTA 2NO1A 4EKEA 5BV7A 5DNVA 1N2CA 3JWGA 1Z22A 4RVUA 2IHNA 1R9GA 1UPCA 2FN4A 3AC0A 2FPPB 1ZD2P 1VLJA 3OT5A 1NW6A 2HLHA 4LYEA 4U7WA 3D64A 4E6PA 2XOKD 1UKZA 4M9SA 4PINA 1VL5A 3GRAA 5AD1A 3ZG6A 1JSZA 4WV3A 1C8LA 3ZHCA 1A9TA 1RLTA 4F6LA 3DSRA 3UFBA 2NQTA 4MQFA 3UMCA 3QKSA 4K9PA 4CKYA 4CYMA 5LQNA 1JEQA 2GM3A 4RDIA 1RSZA 1WSWA 1WV1A 2ZJ0A 3PC8C 2AGVA 2PZJA 1X7DA 1UMDB 4D9JA 3ZNOA 2IJGX 5E7QA 3UATA 4DSTA 3JTMA 3BT7A 2XPCA 1NUUA 1WL8A 2JEOA 1JDNA 3OQIB 3ONFA 5CIWA 3E1KA 2WNIA 4XD7A 2C95A 3N75A 1FTGA 3DBLA 1TIKA 4TUYB 4W99A 3P2MA 4OD0A 4B7AA 4CV1A 1NZFA 2CVHA 1E20A 4YAFA 1M2NA 3NXSA 2GBPA 1YDWA 1UFVA 2H7YA 2QMZA 2XCQA 2YYZA 4ZOEA 3S1AA 5LMCA 1C30B 1QYXA 1VE7A 2GHTA 2GLXA 3IQXA 4RPLA 3I5XA 5DBFA 2HK9A 2BHSA 2Q3FA 4Q21A 3UJ3X 2PCJA 4P5DA 3Q40A 4HVTA 1IQUA 5ICSA 1FLDA 4JBIA 1AF7A 3W7VA 4DLLA 4MMYB 2ODAA 4M7WA 5IM4A 2YKGA 4D2IA 5K0TA 1D9XA 4OSPA 3SYTA 4IHKA 4B6EA 2BR4A 2Z1NA 3JD0A 3HRHA 4TPKA 1P62B 2E7ZA 2C3OA 4CU2A 3UK6A 4MPDA 4R2XA 4RLSA 2A0YA 4LCJA 1GAWA 1QV9A 3OWHA 3WI7A 2PD4A 5HPYB 2OLJA 5FTWA 3WGHA 1EFAA 1P4JA 1E18A 2AHOA 3SZRA 2COKA 1WABA 2ZTHA 4FZ3A 1UXKA 4QFBA 4R5MA 5T64A 5CBPB 3NP9A 2E85A 4TLDA 3MOSA 4N6OA 2GB4A 3OOHA 1TVCA 3KSRA 5TV2A 4YRNA 3VR0A 5UKDA 2VAVA 3EPLA 1TW3A 1IN1A 1E4EA 4UE6A 1PD0A 1E98A 2AR9A 2RHTA 3K8ZA 4C6TA 1LBQA 1J5EB 1TUEA 3TTXA 4U2FA 4N47A 2VQ6A 3PXDA 5E8JA 4HOYA 2CE7A 2CT8A 2RK4A 3B6JA 3AB8A 3KKEA 4BQNA 3JVEA 3IRUA 1CQZA 3KZCA 2FPLA 2P67A 4B4VA 4U63A 4QASA 5AVJA 3PC7A 3SKVA 3M5WA 2I66A 4MYHA 3WLEA 4L8FA 1R8JA 4I4CA 3FTQA 4ZREA 3IUEA 1LRJA 4DGSA 4K3UA 2OOKA 5BMVF 1PK9A 5KKNB 4MDEA 1C5KA 1UDCA 3AUTA 3NVMB 4PRLA 1ZN8A 4J8PA 3REQA 4DAEA 4OHPA 1SC6A 2YYAA 4B3DA 1XTIA 1U5CA 3DZKA 3VAZA 1WMAA 1AA6A 2EC5A 1G20B 3D7KA 4D3FA 1M74A 1YKSA 2RGGA 3IDOA 4KN9S 3ZH2A 3WL3A 2ZYTX 4NYMQ 4Z0PA 4ZYLA 2A7QA 2V3WA 2VF2A 5CJJA 4DMUB 3G6WA 1NR1A 1OGIA 2Q0QA 1PVOA 2GJ4A 2FQQA 1IXSB 4A8JA 1RPAA 1YZ3A 3LYUA 4UU8A 1RI4A 2ASEA 4KGXA 4DSNA 2ADMA 2JZCA 4JJEA 3AP3A 3F5DA 1UC8A 1J7JA 5LP6B 2SECE 1FX0B 5H5JA 3P2KA 5AKXA 1VP3A 3C7CB 4X90A 1SU8A 3NNNA 1QB8A 5ALYA 1S96A 2B3TA 5EE1A 2L19A 4NBUA 1H9CA 2X42A 3IDAA 2GTIA 1C3EA 2W71A 3TUIC 1J90A 2J3MA 2OC9A 2IZ7A 3KAPA 1JKJB 1J2YA 1M2VB 2JBHA 3OY7A 4P1ZA 5HE8A 1M6WA 5A62A 2AMVA 3DPSA 1HFJA 3I64A 3YASA 1D7AA 1DMRA 1K3FA 4PR3A 3RSLA 3SS9X 1OBOA 1DV1A 1P0PA 4N0MA 4BZQA 4L9AA 4ALMA 3W6NA 1I9CA 1D2GA 1CERA 1K5GA 1FCJA 1KVQA 1V7PC 1B8NA 2C3MA 5I7UA 1MW9X 1N2CB 4AJ2A 5BOSB 1KY5A 4UDNA 1I13A 1VG9B 2GYWA 2YMMA 4HWKA 2HBYA 3H5AA 2IYRA 2C5LA 2FRVA 4UCFA 1LLFA 3T1VA 2QK4A 2GPJA 4F6RA 3OWXA 1P0MA 1ZGCA 1KYVA 2G5TA 3PICA 3K4QA 4MQFB 4X3PA 1SQ6A 3QKSB 2J0EA 3DD1A 5DGIA 5BT8A 3VMMA 1JEQB 2XUAA 3BGOS 1I3OA 1M73E 4OVKA 1U0HC 2ANCA 2I80A 2J07A 2WM2A 4G0MA 4RMIA 4RQUA 3TOXA 1PZGA 3PX7A 5I7SA 4NJMA 4H27A 1W0CA 1XZLA 2BMDA 1MC8A 3OCVA 3VZPA 5KKCA 3VM6A 4IV8A 1DTEA 1E92A 1KQ3A 4RGQA 1NATA 5F7ZA 2YY6A 5BN5B 4RX1A 3V1YA 1Q15A 4D8WA 5JHHB 3P5BA 3B1YA 2I71A 3DBLB 3EGVA 3L8HA 5I4IA 3ZU5A 1AK9A 1LK0A 3HB9A 1OYOA 4A36A 3A3KA 3NATA 4D82A 4PTYA 3N8HA 4N7JA 2J3HA 3B8EA 4DA8A 2FW9A 3ESQA 5LWHA 1Z13A 4CM8A 1NG9A 4QUIA 4ZI7F 3GT7A 4BEJA 1KBQA 1M83A 4W5JA 1CDOA 2BGRA 1F8UA 2F55A 1A5AB 4ZJUA 3N3BC 4JVMA 2QNBA 4L8GA 5ENDA 2BDTA 3AF2A 4OJKA 3KAQA 1RPJA 3TIVA 1MD9A 3ZC3A 5BWMA 4BLWA 1VMAA 2DYKA 3HY4A 1M0WA 3S2GA 3A4NA 5AVTA 1AKWA 1MVOA 3OIWA 4RH3A 1OHHD 4L85A 4AN0A 4QZVA 5IEJA 1J8YF 3W8RA 4O0LA 3CA8A 2EV9A 3BAFA 4HGZA 2ZDGA 3H2SA 5KDDA 4LISA 4L2IA 1KAGA 4IMPA 1RYDA 6LDHA 3NKVA 1NSYA 1UXIA 2YOFA 4GU5A 1E6CA 5BR4A 4RD0A 2PH1A 3LHDA 5DYIA 1KO1A 3WGZA 5DNCA 1U90A 3G82C 4NZ9A 1HKHA 4V0RA 4GOOD 2QT0A 1M1XB 1RMQA 1X9HA 3GDFA 3K30A 4GECA 1Q14A 3MELA 1M3SA 2CDAA 2ZCUA 3KDPA 4FMBB 4R9SA 1IZYA 2QL5A 1EFTA 3UWMA 3WL5A 5FWYA 4AY2A 1K8QA 1CCWA 4YVFA 1XA3A 3M70A 4JKIA 1I7NA 2CXUA 2ZDHA 5DTMA 5F77A 5KAMA 3T5DA 1ZZGA 1R5BA 1P1HA 3LWDA 4UFNA 5FTJA 3UOAB 1NMEA 1D8AA 2CUNA 3ZUPA 1LWNA 3BZWA 2Q7XA 3BB3A 1L7MA 4WOPA 5JPIA 1Y4UA 4XB2A 2I78A 1WEKA 3BMCA 4H4DA 4CL2A 4F9GA 3HZRA 1KYWA 4AROA 3C6YA 3QLUC 2WMYA 5EE3A 1VPTA 3E9DA 5DBGA 1FFXA 1CYEA 2PGIA 4J3FA 3EA5A 3Q6MA 2G9ZA 1ZG3A 1YB6A 2FXIA 1CDZA 2IU6A 2NW6A 2Q0SA 2BCEA 1FS6A 2HCJB 2HHCA 1UPFA 3G23A 3DE7X 3PCXA 3GUVA 4FCVA 1YBAA 4N3NA 4JI5B 3UQZA 3DBRB 3FOBA 4JCCA 2G1JA 1H5NA 4C76A 1M7HA 1C1DA 2ID9A 3ER6A 4K8RB 2P9JA 5BSTA 1BX0A 1DOHA 1KSHA 2CKMA 1KKLA 2CUKA 5HWSA 3QUQA 1WZ2A 4ZCQA 2AUNA 1WE2A 3JZMA 5IPFA 1RKXA 4ZIRB 5IFLA 4P3YA 4Q05A 3IAHA 1HR0B 2R8XA 4HLQB 2VQFB 4CEIA 1IHYA 4R2JA 1LZKA 3ETEA 3I2FA 4YREA 2VHZA 4KE6A 4K46A 2V7PA 3ZDAA 2VATA 1PFYA 2M6SA 4X41A 3GD7A 5AHOA 4OJMX 1Q0QA 2OFPA 3AJ8A 2FN7A 3UO8B 5MFZA 4LGVA 4B48A 5HS6A 1ZKMA 4XEHA 1LTHR 3A28A 4BIIA 3HJTA 3X1DA 4BRZA 1E0DA 4QBKA 3FOAA 1U0TA 1SQ0A 3GPLA 1SUWA 1JTVA 3K4PA 3BILA 3NOOA 3FY4A 1XU7A 4PU0A 4PZEA 4YALA 4CETA 3LWNA 4PAWA 3QI7A 4QOHA 4HVAA 4J0DA 4UUBA 1CKEA 1HDXA 2NVBA 2IYXA 3OX3A 4OATA 1XG5A 5E3IA 1YK0A 2V7QA 1ANKA 2OQRA 2Y1CA 1LDNA 3MRVA 1Q2XA 1DX6A 3OI7A 4Z2AA 1XRQA 4DSAA 1OIWA 1SD5A 1T1SA 2HKIA 1E0SA 2W6JA 2ZE7A 4YJFA 4GOJA 4O4LA 3TRFA 3TVTA 3INNA 3UAZA 4F4CA 5EWLA 3RS3A 3A2KA 3WAGA 2W4QA 4BECA 2XTNA 3UMGA 3GWZA 1YL6A 2VTKA 2B1GA 2HBZA 1ISMA 2JZOA 3KEQA 4QPJC 4WGFA 3FUCA 4XYGA 2FSVC 3RC1A 4M8KA 1JG7A 3C8UA 4QG7A 3AWIA 5D00A 1RQLA 3JSAA 2H00A 1J2UA 2NZUG 2UVDA 2VPXA 4MTCA 4G5YA 5GQSA 3T35A 3F5SA 1JAZA 3VHXA 3NIDB 4F85A 3L4JA 1MB2A 4UBNA 1F38A 3I04A 1DX9A 1N78A 4M1OA 5C8YA 4Q1VA 1GZ6A 3U6BA 2ZP1A 3F71A 3PDHA 2OKCA 2OP0A 2C96A 2YMLA 2VJDA 5B58C 4X66B 2ONJA 3SOPA 3TRIA 2XE8A 4URYR 1ZNQO 5DXFA 2X22A 3ZE8A 2FUG6 4F5YA 3NTQA 4PZCA 3BGSA 1YIDA 3ADKA 4R51A 3DDCA 3JQ9C 2QVXX 1U1EA 3GLQA 1CZUA 1DKUA 1H9BA 2Y1FA 3GLFE 3GEPA 1S2NA 3GRYA 1KDTA 4KIGA 4A1FA 5F12A 4HX9A 4BQIA 1NY6A 3AI3A 4KN5A 1JPVA 1KH3A 3LP5A 5KKAA 4DCJA 4TN5A 3EJ6A 4RABA 4XE5A 5KSOA 4IS3A 2AVNA 3K0KA 2AYXA 3TQRA 3NBMA 1DOZA 3SQWA 1FLVA 5JO0A 4WNIA 5BQ5A 3QVUA 3K20A 221PA 3Q2KA 4H6PA 4OGGA 1F8GA 3CZ4A 1IEQA 3HBFA 1E2HA 3HU2A 2FI1A 3L6RA 2JAHA 3E81A 4L2IB 4L9RA 1EEHA 2WIAA 2AN3A 2QVZX 3IGFA 1G4AE 1OLUB 1SKUA 3BSYA 5CXXA 5ALLA 1CZRA 1UBTS 3VXKA 2XYVA 4C0QC 5TVGA 1U99A 1C7RA 2CNBA 4P2BA 1KEVA 4PLHA 5D1NA 5EKTA 1CF2O 5A6VA 1XVTA 3C3MA 2JL1A 1ZRSA 1ZD5A 2VF5X 3GFQA 4ZYWA 3R9WA 5FPSA 1JHOA 3DB1A 1CJCA 1MV8A 4QU8A 4CM3A 1O94A 1F6DA 1HQCA 1RAHA 5JD5A 1I14A 2O7SA 2WLSA 3OFKA 1NBAA 2PXCA 4WKOA 3F5MA 4JS0A 3QSYA 4BRWA 5EIEA 4I1IA 3KZXA 2IPXA 1K6IA 2GM9A 4HLNA 1P19A 3RUEA 4EG4A 1FTNA 3H6KA 2A33A 5KNDD 4WDQA 3BMCB 1U0BB 3EISA 3N7AA 1SVIA 5FTKA 2H16A 2I7CA 2C4UA 3K2QA 5TGTA 1TM5E 1FFXB 2WFLB 2B1QA 3DAOA 3GAAA 2FMTA 1BX3A 1D6NA 5JSZA 2RHBA 4H7KA 1AKTA 1AB5A 1VPWA 5IWCA 5SYMA 3P0RA 1DRJA 4F5EA 3COPA 3AXSA 2YNMC 4EWLA 3ROGA 2PFKA 4GL2A 1V9SA 4I3GA 3GPCA 3S44A 1C1DB 1F8YA 1R0CA 1WMFA 3W8DA 4MYDA 4RNDB 4BVKA 3O8NA 2AIRA 2PAFA 3NHBA 1OJLA 5I45A 1FP2A 1PJLA 4ZHQF 1WOMA 2JI8A 3N0VA 1XRPA 3Q8KA 3H13A 3M33A 1IWBB 4LX8A 4UBOA 4YXWA 3UCFA 3TW6A 2IU3A 2OZLB 3FB1A 3V55A 4EJ6A 2UVPA 3O2SB 4NKRA 3EXIB 3VOTA 3IQEA 3FZYA 1QANA 3IJRA 2AZXA 1ZU4A 2DPMA 3GFPA 3R24A 1UKEA 4LBYA 4AULA 5KQLA 1ACLA 1F7UA 4U2KA 1UK7A 5BQPA 3TLCA 4F2HA 1G5RA 5DK4A 1MBZA 2JF0A 1QGDA 1EB8A 1KO7A 1T36A 2YMPA 4GP9A 1YOBA 2D2XA 4RXUA 2F1HA 3LD9A 3C43A 3WLTA 4DCTA 2PUBA 4CG2A 1PTJA 1X3LA 4N7MA 1VGVA 2E48A 1JN0A 3ZBPA 4MQBA 1SVLA 4ALJA 1UBMS 2YINC 5DM1A 1TX4B 2X9QA 2C31A 1ZM9A 3ENKA 1WWKA 3V1TC 3I53A 3D6MA 2F90A 2Z30A 3CZRA 3RVBA 3LHFA 3Q85A 1QBKC 1GRQA 3KEGA 3ZWKA 4UM9B 2DHQA 1SOUA 3MAJA 3TKLA 5JATA 4JC8A 4LF7B 4KXUA 1ZP6A 3DCNA 2R8OA 3IEPA 1UBHS 3COVA 5IWAB 5DK6A 2P9CA 4HJXA 1I6LA 3ANLA 1T3LA 1DAHA 4WFJA 2GCNA 5DTJA 4C0JA 1ZUHA 4E30A 1NW4A 3F74A 5EWLB 1ADGA 1JDPA 1Z47A 3CX6A 3CTPA 3D8BA 4EMTA 1MO3A 1XIVA 4DMHA 3VU3A 3I6IA 4FR0A 3K9CA 4EFNA 2FOLA 2FPRA 5A9RA 3OE5A 2QZSA 2O0HA 1TYEB 2VLBA 4EFDA 3VHXB 3JYOA 4KE8A 4MW6A 1I1OA 3DAHA 3G5TA 4G4IA 1YS6A 2X5XA 4IIVA 3B5JA 4JSTA 2C07A 1CUWA 4ITUA 4RC9A 1VC2A 1H94A 1CF4A 4EG7A 3NAMA 2QR2A 5C8YB 2H6EA 3TLBA 3KT0A 4MVWA 1JA1A 1XQ9A 3QEOA 3G0IA 3M2TA 4NEQA 4W4TA 4D7AA 3PC4A 3UHJA 4UNQA 4U7PB 3KYJB 3HJFA 1I5OA 1ODKA 1RCUA 2GJSA 4LQCA 4C89A 3HE3A 4ZCRA 5T4EA 4X20A 1EI9A 1EM6A 5LQJA 4AZVA 1CIVA 2C94A 3CRZA 2PKRA 2BKEA 2X7HA 1JU4A 2YJ5A 4ER7A 3LCJA 1XD9A 4ENUA 4NZPA 1J8DA 2RC5A 4FS3A 2CZCA 3D7NA 4PIMA 3QMMA 3DKRA 2QJFA 5DNEA 3TKAA 1NASA 4EELA 2IEBA 2V9PA 4HS4A 3WAJA 2Z3WA 4EKIA 4EI8A 1O57A 3K1AA 3OCZA 3H16A 3VO1A 1Z2PX 3C39A 1EQ2A 1IN4A 3C0KA 1GZ5A 1ABEA 1WHTA 3DPIA 2QG4A 3KL2A 1JPNA 2Q3BA 2OYSA 4K2HA 3EMVA 4INPA 4V0LA 3D9QX 3DOEA 2EU8A 2XVXA 1PZHA 4RIEA 3K2IA 4EAAA 3O6VA 3EOBI 4RY9A 5JI3E 4MUKA 5B1SA 1T1GA 3EDRA 1QSGA 3W06A 1HFKA 3L7MA 2QXYA 2XB9A 2XDAA 3P7MA 4M98A 4B76A 2XCSB 4Y7DA 2Y0PA 4BXOB 3M9WA 4TX1A 2NP7A 1EJ2A 4HNAA 1TKCA 3FE2A 1YR1A 4EPVA 1TPZA 1EE2A 5TQ2A 4ZKEA 2HW8A 3F6PA 3CLKA 4C2AA 1NJGA 2CLSA 3FBWA 4FYVA 1VIYA 1C1XA 5EOVA 2E5WA 5BNTA 3AFGA 4BNDA 2G76A 2Q3CA 4J2OA 2XXAA 4DDHA 1M2WA 9MHTA 1Z0FA 4I4TB 1ZHHA 2NU6A 2CJFA 4MWTA 2I8AA 4N5LA 1CRWG 1PEAA 4QJBA 4BFYA 1KS9A 2WY2D 4YYZA 3PJEA 4ZU1X 2I2XB 3TPCA 4QG3A 5JSZB 2WU1A 1W5TA 4MP3A 4K1LA 5TC4A 1NM5C 1MJHA 2GZAA 2YHIA 4OO3A 4ZC8A 3L1VA 3ANTA 3INTA 1DWOA 1QAOA 2YJ4A 3A11A 4KEAA 1Q7EA 1CUBA 3WNDA 3WRYC 1O03A 2TS1A 3IUJA 5LSAA 5P21A 5BQOA 4N49A 4NZYA 3LUCA 5IDYA 1TM1E 1C9YA 2UVPB 4GEKA 4JLJA 2YYSA 3I4FA 4L4SA 5JBIA 3AWDA 5M2QA 1W88A 1J8VA 3D6UA 1QHSA 2RIPA 4IVRA 2W2PA 3ED5A 1HI9A 1VJDA 1BDJA 3QKIA 1KVTA 3SE0A 5IASA 4H3KB 4PHHA 5CNIA 2R7AA 3S2FA 2RARA 3RHSA 2G36A 1LS1A 2AX4A 3IAEA 3EZGA 5JMOA 2IYEA 1BDBA 2G25A 1B6GA 1A8QA 4D4IA 1N1DA 5HM8A 1VJCA 4EYKA 1F3LA 4MR9A 2GWRA 3SJ7A 3OLCX 1ZFNA 1Q6YA 4I19A 2WTMA 4TXJA 2Y2UA 1REQA 3EIEA 1MX9A 1PVDA 5AW0A 5JWOA 4UHFA 1RYYA 4I4LA 3VVBA 3NDPA 3GEIA 1U4NA 5BR8B 1KPIA 3ZLTA 2C3YA 4BU1A 3EWSA 2NV2B 4WKCA 4IHAA 5AVSA 3T5MA 3N7TA 4TZTA 1TQHA 1TA4A 2O48X 1EG2A 2AOTA 3PXBA 4PO1A 1MN6A 1EEXB 1K0FA 1YVRA 3DOCA 3NC0C 3QKWA 4GT1A 1E3WB 1Y1LA 2HA7A 3NM6B 5FUXA 4QUGA 3IVCA 2YRFA 1T5IA 3I01M 3CUWA 3THSA 3ELYA 3ORQA 1R8SA 4N3AA 3CYFA 4Q4DA 1OMOA 1JXAA 2QRMA 5AXDA 3U3KA 3WDKA 1SXHA 2FW1A 3R7FA 4OU5A 4U00A 1F0YA 1CHDA 3CZQA 5IK2D 1RC8A 3K32A 2VWPA 1II9A 2W6MA 2C5GA 4PGAA 3ZIAA 3Q9UA 4JWKA 5KTSA 1B15A 4HO1X 1VG0B 1EESA 2W90A 3BTSA 4B0PA 5ITZA 2BBSA 1N7HA 2HCFA 1GYQA 5AHKA 3KVYA 4G85A 2YVAA 3R7NA 1TAGA 3VZRA 5L51A 1N5MA 2ZXFA 4KBGA 4KOEC 5K01A 1GUFA 3N8KA 3OTQA 5PGMA 1SGWA 1RI3A 5BNIA 1JHQA 1VL2A 5GJWC 2B4YA 3RYCA 1J1ZA 2D06A 3S0JA 3TVYA 4ASUA 4LCBA 2D4AA 3K1AB 4YIHA 4RADA 3IPAA 5JSKA 2DLNA 3HWRA 3ET5A 2WUFA 3GRZA 3PLNA 4EFLA 4Q1AA 2I4RA 3C1UA 3HB0A 3UMJA 1WHTB 3LXMA 4RLHA 2DXIA 1MAWA 3M6XA 3BG5A 2ZJFA 1WDTA 3K5WA 4Q16A 2W6QA 4TMVA 1NXQA 3AKYA 3UANA 3CIOA 2RJNA 4YHBA 4MB6A 1FFSA 2WWGA 4D45A 1O2DA 1L1FA 5EUCA 1YGYA 4DIBA 4KXVA 1OC4A 5B3JC 2WE7A 4FYKA 2ECPA 7ABPA 3DBHA 2VP9A 4ES6A 3OU6A 2V7UA 4EKYA 1U02A 3CY6A 1XMPA 1BE8A 2WSSD 1MAHA 3ES9A 4HNAB 3FVWA 1GR0A 3C3EA 1C7EA 2G5PA 1HFEL 1Q3KA 2QYSA 3QQPA 5DGXA 4PAGA 1ISHA 5TQ2B 5CVEA 1R2QA 2C0CA 5CBKA 4DR7B 4UMEA 1O3YA 4OA8A 4ND8A 1NXXA 1C1XB 5KINB 3CVYA 1BOFA 1Z83A 1IZ7A 1R8QA 2XXAB 3Q5EA 1PKXA 3SHOA 1C0LA 1DJQA 5JISA 2NU6B 1FU4A 2Y99A 5D3ZA 3TRKA 1W25A 4AJPA 3WAKA 1E5DA 4B8ZA 5EI5A 1SHTX 2F9MA 5AP9A 1CQPA 4X3OA 1Y6ZA 3HP7A 5A2QA 1VSTA 5HIAA 5KYWA 1I4WA 1EE1A 3M34A 2JG3A 2IHKA 4MV1A 1ENPA 5CK5A 5JS8A 2CV1A 1YS2X 4D79A 2WFMA 1E60A 2Q99A 1ONNA 1NZJA 3GH3A 3W8FA 1O0BA 4BQQA 5DHAA 3FYUA 1YBFA 5KB3A 1TT5A 2Z6AA 3RT1A 1KMCA 2O2HA 4ZTZB 2JKVA 1Z4LA 3GRUA 4FKZA 3U26A 3T1HB 3GGGA 3U9LA 4DCOA 3HEMA 4PG4A 4BEVA 4A6EA 3PUZA 4F2WA 3CJTA 5AVRA 1NT4A 2PX3A 4A2PA 1W59A 4KTTE 4WCFC 4RL4A 3U13A 4Z9BA 4GOLD 1TB4A 1EGVB 1E2QA 4GR4A 2J7PA 4G65A 1A04A 2O3TA 5JNWA 2EX1A 2OCXA 2XDQB 4DCCA 3MCWA 4WUVA 5CR9A 2F3TA 1U8XX 4LYDA 1Y3FE 4Q1BA 3TF5A 3ZH9B 3CRVA 1YF3A 1ZI8A 4MR9B 1PUXA 2NZ8A 4DLRA 2BEKA 4U3JA 3PRYA 5EJEA 1OIXA 1REQB 2H63A 1COZA 3KOXA 2IU4A 3BMOA 5IJ9B 4D9HA 1G6HA 5JJIA 4A92A 3NTXA 2CMGA 3KYDB 4L72A 3QG5A 1DG1G 2JGIA 4Z4HA 5AVXA 3PPVA 3Q5GA 4IZ6A 3L07A 3PC3A 1D2CA 1E3QA 2W8BA 3JW8A 4FCWA 4WRRA 3MQ4A 1OA1A 3UW3A 2R2GA 3V5NA 2AOTB 2PX8A 3NWJA 1W4BA 1NBIA 4G5FA 1VB5A 2BAGA 4GICA 2VDOB 4OFXA 5DZSA 3ZWAA 3KE8A 4L5AA 4NS1A 4KMMA 1JA0A 1KGSA 4D3XA 1CUCA 4OLHA 3H1GA 1FTSA 4NICA 5K0CA 2JB9A 2CL0X 3A6DA 5JQWA 3SJCA 4KR2A 4QBIA 3C6XA 4GXQA 1L5GB 4EX7A 4JDUA 1XWWA 2PWZA 3DE3X 3KOYA 7ADHA 4E1VA 3IUSA 2YCBA 3QW2A 1OIVA 1U9ZA 3ITKA 3MD9A 4JVSB 3EPPA 2CKDA 2Q6VA 1WMDA 1YZLA 2J30A 5ITZB 3X1XA 4GRAA 4BKOA 3TLKA 5BPHA 1FP1D 2R85A 1GKLA 1DEXA 3W5DA 1NN5A 2BISA 2E4VA 3KX2A 5IW8A 3RE1A 4GVXA 3M1YA 3V8VA 2VUSA 1M6HA 1DFHA 2WJYA 5CJPA 1JTFA 3O8QB 2JCXA 5BP7A 3FOZA 1I2DA 5DF1A 1GFZA 2P2LA 1T9KA 2QUZA 3U37A 1IYZA 1I0ZA 4JIGA 2HV9A 3TIXB 1F0PA 3TL2A 1A5SB 1IH8A 4AMBA 4MRRA 1KAMA 1IE3A 3MGGA 5F7OA 3LLSA 5IN4A 4PZ9A 4Q4AA 3LLMA 3V8EA 3HHPA 1UFQA 3QITA 1MO2A 3KYCA 4FINA 4YCSA 3WMRA 2ZIZA 3H8JA 4MGIR 1F7VA 4IIJA 1BW9A 3QX9A 4B3TB 2HMAA 1BU8A 3KETA 2PWAA 3EEOA 1JFVA 1OI7A 1RLIA 4IJ5A 3RK4A 4ARIA 4N18A 3D7RA 5JH7F 1GGJA 2XMPA 3M5PA 3PB3A 4QJ5A 4B34A 5J4YA 4GVLA 1XFDA 4ND8B 1NXTA 2J48A 1YI1A 3HCPA 1AQNA 4YV7A 4JT2A 4K9OA 1G1AA 2FF5A 4NABA 3C8HA 3IKVA 2NPFA 4BMDA 4D0SA 4JJ6A 5BWBA 4DLWA 4KJZA 1PYGA 3WNBA 4KACA 3ZXSA 4XQ9A 1RQPA 2X6TA 3LV8A 4KXLA 5D5PA 1YR6A 3EEIA 3KJIA 3IH5A 2JIRA 3W0LB 5B6PA 4B3XA 1LV8A 1LW7A 3KXLA 3O4VA 2AEMA 3NX4A 2HSJA 4BUCA 2W00A 4DQUA 5GVRA 4PO9A 2F9LA 3AFOA 3HN7A 2HSGA 4UJ5A 1XKLA 4DCUA 3RAEC 4CF6A 1P74A 2E1RA 4O2BF 4RMNA 5ESXA 3E8SA 2AC4A 3FYUB 2G8LA 1D1SA 3RG8A 4RANA 3C7TA 3MAAC 2F67A 5B1IA 2IPOA 3ET4A 3H4IA 3KFLA 3ZS9A 5D86A 3TMKA 1ILEA 1JMKC 1RYZA 1BXGB 1IK4A 1SBZA 3E82A 4OOEA 1SBIA 4S35A 5G1OA 1CY7A 2X2EA 2EOAA 3PDCA 3PXUA 2VCYA 1QFYA 4HYQA 2NUPA 4IHJF 3DO5A 1UAGA 2RHGB 2L2QA 4NJOA 4QQNA 4KAXA 3FR8A 3NCTA 1QRRA 1KERA 3Q9LA 4R16A 3NBXX 1Z7BA 4WUTA 3BL6A 2RB4A 4YDQA 4A2WA 3WLNA 4EL5A 4FFNA 1QYVA 1E2MA 1XN4A 1GRNA 1VPVA 1YBMA 3VKFA 1PNRA 3I3SR 2RBGA 2PGLA 4QA9A 3IJPA 5AI9A 4EVQA 5L3SA 1PJAA 2IOYA 2PMDA 4LHSA 1RXUA 2G9NA 3LQ1A 3QLUA 2GVZC 2OM2A 4Q7MB 1EFLA 2Y77A 4LJSA 2IUFA 4J49A 4S0ZA 1XPRA 1HF3A 2FDXA 1NJFA 2YFYA 3PF8A 4FBGA 4OQMA 2O2DA 2PQ0A 4Q03A 4ZRNA 4CLRA 4HGYA 1N5DA 3HYSA 4XZ3A 2R60A 5ALTA 2OO3A 3AT1A 1HT2E 4PZDA 1ZH0A 2PG3A 4Z4EA 5AIBA 3SWWA 5GINE 3NHRA 4WZBA 4X91A 1HNNA 2VRCA 2EJBA 4GXNA 1A7UA 4NCHA 3BUSA 2WWTA 3FYHA 2B6HA 1YU9A 1XQ6A 2V7XA 4OXNA 3IAS6 3BTUA 2HMUA 5CHYA 1RHJA 3CKLA 1H3FA 5FV7A 2HBQA 3QNWA 4QM6A 2VJCA 3C8DA 3WJ1A 1AN9A 3ETNA 3ZDDA 5DYGA 3D6TB 1J9GA 4J2HA 2A84A 3STTA 3ZBUA 5CB8A 3F2VA 5BO5A 2UXDB 2EKQA 4GMHA 5AKJA 4LWZA 1RM5A 4BNGA 4RIFA 3PUVA 4CODB 1DDOA 1Y1RA 2CNOA 3HUUA 1E2KA 1IIBA 2H2HA 1EWQA 3PITA 4MS3B 4PSCA 1HY3A 2G0TA 2J31A 1AHNA 1RM3A 1W5AA 5CB4F 4PZYA 4H2DA 4DIMA 3MTDA 5IM5A 4OL0A 5HF9A 1TGYA 3EIWA 3ZY5A 4B3IA 1SPXA 3VPBA 3UWDA 1Y5LA 1UXHA 4LPSA 1N57A 2WWVD 3B6ZA 1GU1A 1EUDA 3KWLA 3UJDA 5TMBA 1YONA 4G84A 2FEOA 4JBNA 1DKPA 4HB4A 3RIGA 4YDSA 4DBLC 4DR2B 2VZLA 2DPXA 1PU2A 3AR8A 3VAAA 3L8DA 3T4UA 1DBPA 1OZ0A 4WHMA 1TUIA 2PX4A 3KPYA 5DO9A 4JMPA 3B9PA 1TFRA 4YECA 4PE5B 2DJIA 2XXJA 3EC2A 4JL6A 4LOIA 5DSXA 3VZQA 1G3QA 2MINA 4F9EA 4AY4A 1ODFA 4PFQA 5CG1A 3ASVA 4Q4AB 2Y27A 3BCSA 1L3IA 1OOEA 3B2EA 1ADFA 3PTZA 4N3GA 1JLLB 3CBQA 4HYYA 4BFSA 1ADJA 3VC3A 2Y66A 1DO0A 5AKKA 3JQPA 1BW9B 1ZWKA 4LHZA 5L53A 4W5QA 3BWCA 1TU3A 1EBUA 4YCDA 4YBZA 3V4VB 1JBEA 4FDAA 2ZUSA 3HG7A 5ADWA 5K8IA 4YFYA 2QG6A 4BB9A 1CUJA 2WB4A 4RK7A 3VU1A 2YN2A 3HCRA 1U7HA 1XTKA 2C29D 5KOJA 3X1JA 1P3DA 3JQ9A 3RU9A 3ZWYA 1EQAA 1L4MA 1YOVB 2PJRA 2HDHA 5SZIA 2E4WA 2PMWB 3HA5A 3IAM6 3PA8A 4U2BA 3IO3A 1IEVA 2P77A 3K70D 3F6EX 4PPNA 1T8PA 5AI6A 4O2AF 5NULA 1BHQ1 3QU2A 4LDAA 4TVOA 1KMNA 4A0SA 4F46A 2J8ZA 4IZIA 4XGQA 4KW7A 3OHSX 2UYOA 1FMCA 4PNHA 3GHHA 2ECQA 3GZNB 2ORVA 4KRXA 4BEWA 1ZA1A 1PX2A 1Y4SA 2BCJQ 2WJJA 2X8WA 2VWQA 3HU5A 1CQJA 1XF1A 4HEA6 5EHGA 2W2OA 2MOKA 2GPYA 4OJQA 3S29A 4DNQA 1P91A 4KQJA 2FFHA 3DFKA 4WOCA 1LJ8A 3QKTA 1W6UA 3QX8A 3KT6A 4J0HA 1CT9A 4PANA 1UFRA 1K7SN 2LZ0A 1W0JA 4LV5B 5H4GA 5ICGA 1KIMA 2FLVA 3PNOA 4EW6A 1TCAA 1E69A 1GPH1 4DLNA 1JEYA 1TK9A 2RGYA 2Y71A 2VHQA 5KOHB 1X8KA 4JC0A 5HKOA 4GBED 3NMUF 3PZBA 3QPCA 3JD2A 4K88A 3VZBA 3X2FA 4KJXA 1O95D 2HRRA 2CFIA 4MROA 1CY4A 1RXEA 2DKFA 4DM3A 4EG8A 1W9HA 4Q9NA 5IT0A 4JEIA 3IMGA 1P75A 1ZVKA 5DMXA 2E6KA 1IBCA 4PXSA 4U7TB 3CEPB 4CF5A 4GQIA 4DYVA 4CKWB 2ODBA 1VQ1A 3IP1A 3RG2A 4DY6A 3ZHTA 2QR5A 2FUCA 2GPSA 3AF1A 1Q1GA 1AKMA 4Q24A 3UPTA 3LVRE 4CLRB 1R0ZA 5FR1A 1PWHA 5LNK1 5HRAA 4OHZA 1GU0A 2B8EA 4LRYA 1XNQB 4RTLA 5P8WA 2WFZA 2DSTA 3G8AA 2XCTB 2ZB3A 5TMPA 1ECPA 3AOGA 3IP6A 3SF8A 3H4MA 4KNVA 3TZLA 3QELA 4NV1A 3TLMA 1WJGA 4A8PA 4B4UA 1HEYA 3FKSD 1W4ZA 4O0MA 4WY8A 4KP7A 3JZAA 3ZTYA 1HFWA 3ORFA 2PKQO 2ZWPA 3B6IA 4DV6B 1MIHA 1K7EB 4MQLA 3D02A 4B6JA 2Q1SA 3HK2A 1U3TA 5EY5B 4S1NA 5IARA 4D5GA 4PG8A 1RRCA 1V48A 3ECCA 4XVRA 2WQ7A 3LF1A 4D56A 4YMVA 4PGHA 2O9JA 1VPLA 3DGEC 1Q50A 1EDBA 4CT5A 1OKKD 1VSBA 3IP7A 2I3BA 3A6KA 1QRUA 5T57A 3GJSA 4XQGA 2QD2A 1SRQA 1K1EA 1Z5ZA 2HNAA 1B3RA 1B8UA 1TQDA 2HA0A 2ZQYA 1PUIA 4ND6A 3PKIA 5CCEA 2EIHA 3LVFO 3QY9A 3OUUA 1LFAA 3M1LA 5GAJA 1YJXA 1XD8A 2Z1MA 1ZH4A 3O3MB 3UXEA 3WIDA 2AYYA 2CHFA 2EJVA 3FCSB 4BO6A 3Q12A 2XZOA 1N6KA 4AMUA 1KAHA 3SSMA 4X0EA 5E9AA 1X80A 3T15A 3I4LA 3M83A 4RTMA 2QD1A 3K9LA 2P65A 1SUCA 2D0IA 1VPDA 3T9DA 3ZX5A 2CL7X 4MNTA 1J8FA 4MH0R 5TQ0B 1SCBA 3NBFA 2FPIB 3V42A 1VHTA 4BNYA 3O4FA 2GRAA 5F1OA 2O2CA 2DVMA 3KUKA 4EY8A 5JTTA 3HCBA 1U6KA 3W9UA 2D3TA 3HGTA 4YRGA 5EJ6A 4KAFA 3F4BA 1PAUA 1VA5A 3KRTA 4MI9A 3ZIUA 1NVVQ 1POXA 1Z34A 2D1TA 3O4HA 4FILA 4K26A 4MA0A 4ZZ2A 3X3HA 4EMBA 3CG4A 3G8CA 2HWXA 3AL3A 1TQ2A 5BURA 3LECA 2I65A 1ORVA 2YW9A 2FZEA 3RS8A 2VHTA 3ZHOA 1FSPA 2EZ9A 4IGAA 2VSYA 3KKQA 4YK7A 3ZCTA 1VHDA 5TQVA 3L4EA 1DRWA 3F6YA 3RROA 2JBAA 3A9WA 3M2PA 3LA6A 4QBHA 3WNZA 4KIWA 3DE0X 3WKDA 1FDRA 1G41A 2B69A 4INOA 1Y6JA 2WINI 4ZQFA 1CVIA 5DNWA 4FZVA 4BB6A 4EJMA 1J0XO 4OGLA 1C9KA 3FDZA 4GUDA 4EJSA 4EHFA 4NXNB 4KLCA 1J5PA 3SD7A 5CCXA 3F67A 1GGHA 1G3RA 4K6CA 4PX5A 2HHAA 4AZ0A 4BV8A 5DM60 3AM3A 1SZCA 4A26A 5HJ2A 5HA5A 1ZRNA 4FQ5A 2YXBA 2NNWB 1SHUX 2LXNA 4LBZA 1TTQB 4YRZA 3ZWVA 1JYSA 4ZU6X 4QYIA 2GLUA 2BSAA 3DOFA 3TOCA 2EKBA 2OD7A 3U40A 1OWOA 4RA6A 4HVCA 4QT4A 4D97A 3WL4A 5I4BA 1NHGA 1NBME 5KWEA 1S0UA 1BQ3A 3O3CA 5EJ2A 5GONA 2YWHA 1L5HA 2VZ0A 3HJUA 4HWOA 1XPJA 4P98A 2QRHA 5HKBA 1NJ8A 1T2UA 4FI3C 1G291 5HYVA 1DQZA 4NFSA 3I5AA 2ZLBA 3IQDB 4RHEA 3SKYA 4DDMA 5KNCH 3P9NA 1I4TD 1Z2CA 4KRGA 3F8SA 5DWVA 1U2EA 1JEYB 4QGHA 3WBFA 3JWIA 4E5YA 2I7XA 3B1ZA 3OEWA 1WXGA 1YZQA 4DDTA 1PT5A 4FXPA 3GLTA 4JJGA 4F4DA 4IF6A 3ZCPA 2XF2A 3HR4A 1YL7A 2HPAA 3GCXA 2V97A 4FCCA 5DYTA 3RU3A 1OB5A 4YRIA 2XVYA 4HY3A 1FJ2A 2KYRA 2NZVG 3KVOA 4X60A 2QE6A 1FFCA 1U0JA 1E3JA 4ZYXA 1P80A 1DG3A 2H3HA 3GAMA 2X2OA 2ODPA 3VDMA 5JPDA 1JDZA 2XBUA 3UMYA 2P2YA 2ZWAA 5F52A 1NM5A 3AYXB 4RM3A 3LGAA 5CFMA 3WOHA 1H05A 4JHLA 5FA8A 5LU9A 4WSOA 3G02A 4D92A 4P4LA 4FWIB 4FGSA 4R1OA 2BH9A 3NPAA 5SYAA 3GPBA 3ZBTA 2FEXA 1UDAA 4OA5A 5ETJA 4ZT3A 3W5HA 3AIMA 2CLOB 1OLSB 1GG2A 2P5SA 2JAWA 3RBAA 1O96A 3MOGA 4TMTA 1IG0A 1Y9DA 2P1RA 3VU9A 5AW6A 3H5NA 3T41A 3QV2A 5ALVA 1F60A 5G0SA 2ZFUA 2DG2A 3CZAA 1EFHA 4UHHA 2WQ6A 4Y8VA 1EZ4A 1UT8A 3BQMB 1XZHA 4ZOCA 4G0WA 3GBSA 5LP6F 4LXHA 2XWSA 4LK3A 1TW2A 1ZN2A 1KEWA 2O06A 4KODA 4OYLA 4J0QA 4RZ3A 4UTPA 5GIOE 2G1AA 4AJKA 1I01A 1H4SA 2V7EA 4QEKA 1NMZA 4RJLA 4UCXA 3TNDA 5TEVA 5AUPB 4JI0B 3WWCA 1T0JB 1OUMA 4EO4A 4YRSA 1IUNA 2JK0A 3BRCA 1ZW6A 2Q1TA 1DNPA 1PE0A 4O3FA 4C5BA 1X80B 4TRRA 3VH3A 3BE5A 3C16C 1EVQA 3MCAA 4IEFB 1JG2A 1GO2A 1RM0A 2OZVA 2OCBA 5MFPA 2CXTA 2WHQA 3O47A 4EPTA 2I6FA 4NZNA 1DL5A 4JFAA 2Y0EA 3WQHA 3IQZA 4EBBA 4FUTA 3IVXA 1KIAA 2P75A 2YV5A 3AFHA 1Z18A 4OX9Y 5TVKA 1SIBE 5AOVA 2W2KA 3EZNA 4AJLA 3PFKA 3PRHA 1U9IA 4XH9B 1GPMA 4F6CA 2OG2A 5BN1A 3SQXA 4CJXA 5U1PA 2OCPA 4NPHA 1DIHA 3QVGB 1CDEA 5CDGA 2FSPA 2JJ1D 1G42A 1LC0A 3GVHA 4BNFA 2JFHA 3CH7A 2P0YA 3LP6A 1ISPA 2HWWA 4EYQA 4ESHA 3COJA 4U2EA 2XOKA 4HSGA 2NO4A 2C4NA 4L4RA 3QSGA 2VQDA 1CB0A 2JW5A 5BORA 4JENA 3T7AA 2OE2A 4ZHQB 1NONA 1S3GA 3TR6A 2JDIA 1RTKA 1N6RA 4KLZA 3B13B 3Q3HA 4OV6B 2GESA 3PXAA 1NBEA 1K3TA 3UB3A 1AV7A 2OORC 3BWXA 4RSMA 4LWPA 4AF7A 3I6QA 5LNK6 2SCUB 3AVOA 4G8CA 4FSXA 1AA9A 4ZAYA 1FK8A 2CFCA 3FFTA 3PXXA 4L1KA 5BXYA 3KJHA<