2E31A

Structural basis for selection of glycosylated substrate by scffbs1 ubiquitin ligase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
251
structure length
246
Chain Sequence
AVEYLAELPEPLLLRVLAELPATELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWSDVEHGGDGWKVEELPGDNGVEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the selection of glycosylated substrates by SCFFbs1 ubiquitin ligase
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords F-box only protein 2
total genus 59
structure length 246
sequence length 251
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00646 F-box F-box domain
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2e31A01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2e31A02
4BK5A 4XURA 1UYYA 2EIEA 2VO5A 3ACHA 3SKVA 3NNGA 5FUIA 1CZSA 3C7EA 2EICA 3I2IA 4DXRA 3ACGA 2W1SA 1DYOA 3FHAA 4ARXA 2RVAA 2VZPA 2P1OB 2J1TA 3I2KA 3IB3A 2QQKA 4KWUA 4PQQA 2JKXA 4MADA 4HG6B 3D3AA 2VMDA 2VQTA 1SHWB 4OMCA 1K45A 4RN5A 4CU7A 1HN1A 2J22A 3BGAA 5JR2A 4ZZ8A 4KI5M 3ACFA 5IYYA 1CIYA 5EJ1B 3T08A 1CZVA 1GQPA 1ULOA 2YG0A 5I0DA 4LHSA 2ID4A 1ULPA 1WCQA 1JZ2A 1D7PM 5CYYA 3HOBA 5G04L 1JZ4A 2J1UA 3EYPA 3HNYM 1PX4A 3VD5A 1O8PA 2QQNA 4DEQA 2W3JA 1UXXX 2W92A 3C7HA 4RYDA 3IIIA 5B4NA 1MPXA 2Y8KA 4A44A 4P00B 4DUXA 3LPGA 2VCAA 4MOAA 1IQDC 3CIHA 5LA2A 2XONA 3WNLA 1UX7A 2VZQA 1US3A 1K3IA 4W8JA 1JHJA 2E26A 2ZXQA 4DXTA 2RJ2A 3VDBA 1UZ0A 2WDBA 4CUAA 3U37A 4FI9A 4BDVB 1DP0A 1OT5A 2C4XA 2KD7A 5B4XA 4CU6A 4E8CA 1OF3A 2W87A 2YB7A 3NQHA 1JU3A 4OZOA 3NJVA 1XC6A 1LDKE 2QBXA 2W91A 3IDAA 2OVQB 2W47A 3THCA 4JKKA 5JXIA 5G05L 5DN2A 2R7EB 1L7RA 2WO3A 3AC0A 4XUTA 1NUKA 2HLEA 2P1MB 4M4RA 4QX3A 4D0QA 5IHRA 3I2GA 4OMDA 5A1AA 1TG7A 4AG4A 3LEIA 4CU8A 2WAAA 3A23A 3F2ZA 2WQ8A 3W5MA 2BBAA 3CZJA 4QB2A 3K77A 2QQLA 4GWJA 3MUZ1 1GOGA 2Y6GA 2VC9A 1P8JA 5HPOA 3LE0A 3WNKA 3ABZA 1I5PA 1NX9A 4D8MA 4CUCA 4UAPA 4QAWA 1WKYA 4ZZ5A 4OYUA 3OBAA 2ZEYA 1US2A 2E32A 5F7UA 2Y6KA 5C7GA 2J1VA 2WO1A 1RYYA 1J83A 3JXSA 2VZSA 3SKJE 2VJXA 3A21A 1W9WA 3T0BA 3OEAA 1JYVA 2C9KA 1EUTA 2VZ1A 3EB7A 2VL4A 3HEIA 3LQCA 1TVGA 5LA1A 1F4HA 1NAEA 2WYSA 1UY0A 4LKSA 1T2XA 4E8DA 1XPWA 3OB8A 2YFUA 2ZEZA 3WNOA 3CZUA 2PQSA 5HXMA 1GU3A 3GXUA 3ZM8A 3VD7A 3W5NA 2X05A 4LQRA 2QQMA 4ET7A 4KMQA 3CDZB 5J1XA 1O8SA 3I3EA 4IUGA 3WF4A 2DCJA 4CVUA 3MV01 3DYMA 5JUVA 3T09A 4XVHA 3GDBA 2V72A 5CZKA 1W99A 1UY1A 1UYZA 4YPJA 3IAQA 3WNPA 2VOTA 1O59A 3DYPA 3A7QA 3VDAA 3FHQA 4QDSA 3OGRA 2CDOA 1L7QA 3T2PA 4XZUG 3I97A 4GWIA 4QX1A 1JZ8A 1JYXA 1W8NA 4BK4A 1UMHA 4I6JB 2YC4A 3WEZA 1PMHX 3OGMB 3HJRA 4A45A 1UY4A 1GOHA 2B9VA 2P1NB 4UI9L 2J7MA 1JYWA 3C6NB 4LPLA 1UY3A 2W1QA 4JHZA 3LEKA 2VZRA 4A4AA 4DEVA 5EIYB 4L0PA 2P1PB 3C7FA 4W50A 4QPWA 2RV9A 2V5DA 3HNBM 4MO3M 2OVPB 1W9SA 2X09A 1W8OA 4P02B 4CUBA 5C71A 3CMGA 4QX2A 2VCCA 3J7HA 5IFTA 4MGQA 2Z4FA 2WABA 2WZEA 3ECQA 2W94A 4M4PA 3FL7A 2VMEA 2BGOA 2J1RA 3GGLA 4XUOA 3GM8A 1J84A 2XQXA 2EIBA 2VQUA 1JZ6A 4ZXEA 1W0NA 2E31A 5IBKB 3K4DA 4JX0A 3MKSB 3HN3A 1JU4A 3THDA 3WQBA 5C70A 5JXGA 1EUUA 4ARYA 3P1IA 4PF1A 1OD3A 4AAXA 2X10A 2DDUA 4XUQA 2QQOA 4TXWA 3I2FA 1JI6A 1OF4A 4QB1A 1H6YA 3I2HA 3PUIA 1XNTA 1K42A 2XHNA 4DUWA 4QB6A 4A3ZA 2WAOA 3T0AA 3OEBA 4XUNA 1CX1A 2VZ3A 2XOMA 3MO4A 2VCBA 2B4KA 1UXZA 2WN3A 4MGSA 3UNPA 2WZ8A 3K4AA 1UWWA 3A22A 2LW8A 2W5FA 5DQ0A 3OG2A 2C26A 3MBWA 2VZVA 2DCKA 2Y64A 2HYXA 3VD4A 3SEEA 3E1F1 3WF3A 3WSOA 3FN9A 4A6OA 2BZDA 3VD3A 4Z2AA 1GMMA 4QDQA 4DXSA 3IAPA 1JYNA 2VZOA 3NJXA 3CKHA 1OH4A 2JE8A 4PT6A 4BJ0A 3CQOA 2VZUA 1GNYA 1BHGA 3C7GA 3UETA 3MUY1 2Y6LA 5DPNA 2W9XA 3VDCA 1CZTA 2ORZA 3HNMA 1NEXB 4DUVA 3OGLB 3T2QA 3C6PB 2Y6HA 4A42A 1LNSA 2L9LA 3K75B 2ZEWA 5EJZB 2E33A 2QQIA 5IFPA 4QDRA 2VMFA 3I2JA 2Y6JA 3ETPA 3DYOA 2VTFA 2WN2A 4CU9A 1NKGA 1KEXA 3LEGA 4A41A 3WF2A 1PX3A 2EIDA 2VZTA 4XUPA 3UESA 3OGVA 5JXHA 2W95A 3P6BA 2ORXA 2OVRB 3I3DA 3WF1A 1F4AA 2VR4A 2YFZA 1W9TA 3LPFA 1PMJX 1K12A 2VM9A 3WNMA 2YC2A 4BXSV 4JKLA 2WBKA 4JKMA 2CDPA 4OUEA 4TTGA 1R64A 2QQJA 3ACIA 1H6XA 2W1UA 5JXJA 2J1EA 2W1WA 3BN6A 4UOJA 1UMIA 3K4ZA 3VD9A 2BERA 4W4ZA 3SEPA 5LCWL 3V7DB 3WNNA 2V4VA 3K46A 3OGKB 1DLCA 1GOFA 3T0DA 2BGPA 2JDAA 1UY2A 1KGYA 1P22A 2ZEXA 5DMYA 2VMCA 3C8XA 1YQ2A 3C7OA 3OGSA 1GUIA 1UYXA 2J1SA 2W46A 1JZ3A 2P1QB 3T2OA 1JZ7A 1FS1A 2J1AA 2JD9A 4QX0A 1JZ5A 5IJRA 3DECA 3C6OB 1SG3A 3HPNA 3PUHA 5LA0A 2WO2A 4P5YA 3WF0A 2LS6A 2OKXA 4GZ9A 5JMOA 3NRUA 3I3BA 2WUHA 1SDDB 3L2OB 3MV11 4P08A 1XNAA 4ZY9A
chains in the Genus database with same CATH superfamily
2GSYA 3DKQA 4RHV2 3N7LA 1MZ6A 2EIEA 4AI6A 2XLGA 4OI1A 2Q8EA 5FLHA 1U5IA 5BNPC 1HJFA 4YFWA 2FZ2A 2EICA 4FAHA 3I2IA 4PI2A 3ACGA 4EZHA 1DYOA 3GZUC 4TLGA 3WG2A 2D93A 1HIXA 2RVAA 1KDMA 3WR0A 4OUSA 2GZWA 5JOYA 4CTEA 4XYXA 3VDDC 1V6IA 2J1TA 3ZYIB 3TOJA 2UU8A 5FP3A 4RNGA 2OZMA 2BV4A 4KWUA 5IK8A 3M8LA 1OD5A 1EV12 2PA7A 2B1EA 3VV1A 3KD1E 2WSVA 4HG6B 3OD0A 4QD2A 4JTNA 4BPZA 2B45X 1G9CA 4Q4V1 1K45A 3ZXJA 3S57A 4U36A 2ZMLA 2OUJA 4JQTA 1SFYA 1BBT2 1I6XA 3BGAA 1YQ6A 2GC3A 4DU4A 4UW3A 4M3XA 3LIGA 4DQAA 3H8RA 4COVA 4ZZ8A 2DVAA 3ACFA 3I59A 1GNZA 5FO7B 4BWOA 3ZIWA 4YVSB 3T08A 4DOUA 1CZVA 5AFBA 4LULA 1BKZA 2JENA 4Q5OA 1AVBA 1GNHA 2AACA 1QQP1 2XQRA 1FXXA 2H0VA 4A7KA 5I0DA 1QOOA 2GP5A 5FYTA 1QDOA 4LHSA 2RS31 1WCQA 2R1BA 4H2AA 2OYQA 1WMFA 5ACA3 4UT5A 4GMP3 3WD5A 4D3WA 5A7SA 4RQPB 2XLAA 2IWGB 1XB9A 4Z82A 2VJ5A 1O8PA 2Z42A 1CIWA 1IHMA 1YI9A 1ZBA3 3JBG2 4YGEA 3OUHA 1W6NB 5GZFA 4URAA 1VLNA 3OF1A 4WVZA 4YZ2A 5CKNA 1MS8A 1IZ3A 2W92A 4RYDA 4FJNA 1ENQA 2DFCA 3TN93 5CKMA 4COUA 5B4NA 3FLPA 4Y26A 2Y8KA 2PN5A 3NKGA 3PTYA 4WM7B 5F37A 3NVCA 3AM2A 4P00B 5LBEA 3J27A 4UWDA 2GN7A 4KNCA 4ES8A 1QQP3 3VBSA 1OSGA 2DFBA 1Z78A 5FMBA 4DO0A 4DZGA 4AFAA 5K0UC 2VZQA 1US3A 4AEDB 4CP0A 5FPXA 3VBOA 1QJZA 3KVBA 2CGPA 5HCBA 3AZYA 3NHGA 2UYAA 2E7AA 1PO11 2HYKA 3VDBA 1JH5A 1EAH3 4FTBA 4CEYB 2ZHMA 4BDVB 2C4XA 1HV0A 4E8CA 1OF3A 1QQP2 2ZBJA 2YB7A 1HRV3 3LCPA 1UO9A 4Q0VA 3LDRA 1EP0A 4GB32 4QXBA 5I0UA 4WM7A 5LBFA 3ST7A 1UU5A 2QUOA 3H50A 3RYPA 4PJYA 5FXXA 3VBUA 2W91A 5LB6A 1ASJ2 2OVQB 1ZZCA 4META 4E3SA 3SMHA 4X6QB 4Y22B 4Q1PA 1ZBA2 1ZZ9A 3JBG3 2BYVE 5DN2A 3VBOB 2QNKA 2K5SA 4GWNA 2WO3A 4GH4A 1A3KA 3AC0A 4FJJA 2NM1A 1OH3A 3KQRA 5JR7B 2P1MB 4MHUA 2WA3A 3WDYA 1VRBA 1FZ9E 1SLCA 3O14A 1BZWA 4R9AA 4F83A 2WA4A 5C6CA 3RZKA 1H8TB 4QM9A 4NAMA 4CDUB 3WG1A 1KFUL 4COWA 5IZ7A 4AEJA 3FJSA 4JTOA 1VRH2 2YU1A 4JDMA 2BBAA 4A7YA 5CG9A 4AGVA 5FPZA 1UZVA 1EPWA 3MDPA 2BP6A 1JOBA 1LGNA 3AXDA 1HQLA 3CEWA 1YLLA 1MS1A 3Q8CA 3Q8AA 3E5QA 2IXKA 4GULA 1PMIA 4LHNA 4NE9A 4Y22A 4DRVA 1DQ6A 1K5MB 2WS91 1LEDA 2OYZA 4CCCA 1MQTB 1V6NA 4OHYA 5IK4A 3VUOA 1W2TA 4ADOA 2I74A 4QGNA 4CPBD 1NX9A 3TABA 1TME1 2V4AA 5IVJA 2AEYA 5A7OA 2R32A 3NV3A 4QAWA 4YW3A 4B29A 4N7IA 4OYUA 4CDXC 4IGOA 1RUH2 3GCXA 3POSA 2ARXA 3OBAA 3ON7A 1US2A 3POEA 4Q26A 1NY71 5F7UA 4XIOA 1TEIA 4OVEA 5L36A 4HN1A 3RMAA 1NLSA 4PDWA 5F3GA 1D2QA 3I4IA 5FREA 5BY5A 4XMIA 5LBBA 4LJHA 1VBD2 2BDRA 3UKTA 1VAMA 1DHKB 4EWDA 2A70A 1MQTA 2ZX3A 3SKJE 5LW9A 5FZ7A 4IT5A 2H6BA 4V1PA 5L7OA 4LHKA 3J26N 2C9KA 1DGRA 2VZ1A 1O5LA 1SCSA 3J2PA 2R042 4Y24A 1LGBA 1ZRCA 1JODA 1PIV2 1QJU2 2O14A 2R0FA 2VQ0A 2XL9A 2QTWB 4K20A 5FXWA 5KXDA 2RR11 1HV1A 2ZGQA 2VPVA 3LWCA 4ISQA 5FYBA 1WW6A 2OA2A 1KDKA 2WLQA 1RJ7A 4MGYE 3AZVA 1UY0A 2JDYA 2DUOA 2E7TA 1JUIA 4YG6A 3TEZA 3OB8A 4MXVA 2B46X 2B9UA 4DRRA 5IVVA 2AEZA 2YFUA 4RQPC 1S0FA 4FPFA 3UO3A 3SPZA 1RIRA 1XE7A 1LJ7A 2PQSA 3GALA 1XSQA 2XBO2 4FOVA 1UKRA 3CF6E 3GXUA 3WLUA 2IXCA 4LIVA 3ZXFA 4B4PA 5HXMA 3GHMA 3JD73 1N3OA 2F17A 4KWLA 4L99A 5DAVA 1M06G 4RGAA 3OPTA 1FPN1 1W9FA 2YPJA 1SBEA 5LWBA 1ENXA 4K40A 2QQMA 2D6PA 3R05A 5CEHA 5GLTA 2ZOEB 3ZO0B 3BTYA 2D3RA 4ASKA 2RS53 2C6SA 3H42B 1DQ1A 5LEKA 2GC0A 1OQEA 2IXJA 4I0WB 3RWKX 1UIJA 5FPAA 3MIEA 4Q4W2 4V2WA 1VBA3 4LO4B 3GDBA 4ZXKA 3OSDA 4P9GA 2V72A 3BUCA 1WLCA 3AP4A 2I2SA 1RUJ3 2Y38A 4XBQA 4YPJA 4UFLA 4BYYA 1C28A 2VNVA 2BNMA 3PDQA 1RXFA 3C94A 2VOTA 2DVDA 4XIKA 1BVP1 4M3TA 3VDAA 1H2LA 5CIRA 4QDSA 1G9BA 4KH9A 2CDOA 5BNPA 1POV0 5JWPA 1GP4A 1QJY1 1K5MA 4Z8BA 3I97A 4GWIA 3KV9A 2FDJA 2XJVA 3HIFA 2VOWA 5FIXA 4QXKA 3POIA 1GANA 1QH6A 4H3WA 4M3UA 4Y5SA 1UF2C 5LY1A 2LRPA 1FATA 5KWRA 1A6CA 4KWJA 4CCLA 1N3QA 5FDBA 3LD8A 5FKCA 1UY4A 1FYUA 2B9VA 2AZ5A 1FZIE 2DY4A 1ULDA 2WZR1 1W8TA 2ZHNA 4HKOA 5JSOA 4HK9A 3LZIA 3U75A 1FZ4E 3W58A 1AR72 4COYA 2QDNA 4GWMA 1VBA2 4QX8A 4LE3A 4CE8A 4DEVA 4JS4A 5T3NA 1CWPA 2LTNA 2VW1A 4IE7A 2ZGPA 2O8QA 5GLVA 3TNPB 4Z1VA 3J7NA 3VHPA 4HVOA 1AHSA 2YPDA 2D6NA 4O65A 1LGCA 1LCLA 2Z69A 1JXNA 3LGRA 4MGIE 1X36A 2D40A 3SUQA 2VTXJ 4MZUA 2X09A 5A3MA 1W8OA 3GZEA 5HV0A 1JMUB 2UY8A 2VCCA 4AHXA 4X5NA 4FK0A 1W0PA 4C90A 3TAFA 4AFBA 3PIJA 1DG6A 1R1A2 3GZTB 3SCGA 1LOBA 1MHYG 3ECQA 2WQZC 2OIIA 5FK7A 3L8BA 2PLV1 2VMEA 2BGOA 4UF0A 4E2SA 1TE1B 4MGKE 4XF1A 3WQ1A 2FDIA 1TMF1 5FXZA 2XQXA 4CP2A 1HQWA 1NE4A 4N43A 3PUAA 1JZ6A 2O0OA 5CISA 5EWSA 4NWVA 2E31A 3HL8A 4XDPA 5CFCA 2VE1A 3D0JA 4JX0A 2RDRA 3MKSB 2QE3A 5JCTA 1GR3A 2UURA 1R081 2A6ZA 1I3HA 4RS5C 4KGQA 3WQBA 1O3SA 2BQPA 4HK8A 3CNAA 4LBMA 2WNVC 2MZWB 5C8CB 4AKGA 2P3JA 1Z0HA 1RUC1 1S0CA 2HWC3 1AYN1 2XBO1 3P1IA 4YZ4A 3WW2A 4CP1A 2X10A 3SITA 2DDUA 3TL8B 4FPJA 1XSRA 3WY6A 3K3OA 1IPJA 1CAUA 5F2SA 1WMDA 2FDHA 1CAWB 2ZAAA 4Z2WA 5FZBA 3MIFA 3BU0A 3I2HA 3PUIA 5FZ8A 1Y4WA 5FZ0A 1OPMA 1OOPC 4LOSA 4FPOB 4QPGA 3L0MA 2WAOA 5CNAA 5T5JA 4XUNA 4EJRA 3I3MA 1REFA 3M3EA 4KHUA 4PQ9A 2VCBA 1Z7S2 1C1FA 3URFA 1EAH1 1UXZA 1XQNA 4ZPIA 4OULA 4FSJA 1RUD2 3AYDA 4N90A 2VMIA 4X6RB 1ALYA 3H7YA 3K4AA 3WP4A 1FZ3E 4KG8A 1KXGA 3DEMA 3N9QA 2HBUA 1EYBA 1AR63 2C26A 5DAQA 2PAMA 4XDOA 2D6MA 2VU9A 3HN1A 3MBWA 5LA9A 2VZVA 1AXKA 3CFRA 1W6QA 1S4CA 4EZ4A 2V5YA 5JSPA 4G4FA 4GA9A 1E5HA 4UBGA 5JAXA 4RFRB 5FMOL 2LROA 2HWE2 3WSOA 3FN9A 5FQ0B 4OHVA 1IG9A 2WJSA 3B7MA 2QZ2A 3VD3A 4Z2AA 4DXSA 4XJWA 1BEV1 3QETA 3IPVB 4M0HA 1JYNA 5F5IA 2ZA9A 4FFGA 5C3QA 2P6HA 4LT5A 2GNTA 3GBGA 2VZUA 3SUNA 1BHGA 5FYYA 2ET7A 1YWKA 2ZZQA 1AR73 3D82A 3MUY1 1AR61 2BPA2 1JS9A 4LKFA 3VDCA 5JXJA 3DL3A 4Y1ZA 4BM8A 1CONA 5IW0A 3TEWA 5F5AA 4DTXA 1AXYA 3E97A 1G9AA 4CXWA 2K9ZA 2WNVB 2E7QA 2EVXA 3IM0A 4A42A 4OQ8A 2ADEA 1ZBE3 5ABJB 1VIWB 4XQ4A 2L9LA 3N7MA 3PU8A 2VY0A 1VR3A 2HWE3 2QQIA 4KHWA 1U12A 2VMFA 4QDRA 5F5CA 5FY1A 4AVCA 4AEKA 1NCQB 2CTVA 3ETPA 1SCRA 3DYOA 3IPVA 4GB33 4NAOA 1AL22 1B35B 2X53S 3UGHA 3R0RA 1KEXA 4LBLA 4XF9A 1X33A 4F3JA 3CQ8A 2AENA 2LUWA 3MEPA 4MLOA 4P9YA 2VZTA 3NV4A 4PBOA 1QNWA 3UESA 5JXHA 1W6PB 3BIEA 2TBVA 3VBFB 5HCFA 3WCSA 2GC1A 3R4SA 2ORXA 2VBDA 1MVEA 2OVRB 3KMHA 3I3DA 1RMU2 3SHRA 2VBPA 3THPA 1PGL2 3KS7A 1R083 5FZAA 2EAAA 2BJSA 2VM9A 4CXYA 3WNMA 2WFF1 2BOJA 3WG3A 3ZYBA 5C8WA 1MEC3 1EY2A 4JRLA 4JKLA 5C8CC 5A3OA 2CDPA 4IV1C 4LA3A 1LOAA 3VBRC 2RJLA 2QQJA 3ACIA 4HSLA 3JZVA 3O1MA 1J1TA 2J1EA 4XFFA 3MIBA 4XAAA 2BERA 4LITA 4OI2A 1PVXA 4MGZE 3VBFA 3N9PA 1OXCA 2HWC2 5FZMA 5A1LA 3K46A 3HGKE 3OGKB 5DZEA 3WCRA 3WDWA 3WT3A 3JBG1 1PZ8A 2XGXA 2HWD3 3JD72 3NJYA 1GOFA 4YSFA 2C0ZA 5LEJA 2MMBA 3WDTA 1OMIA 4AXOA 3AZWA 1TMF3 1W03A 4AI8A 4ONUA 1UY2A 2IFWA 4NPLA 3INAA 2W08A 1MS3A 1AR81 1G6NA 2VMGA 1UYPA 3E5UA 3LB9A 4ITCA 3VKFC 2J1SA 2P17A 3MW2A 4K7JA 4PLNA 1KITA 4RS5B 1HKDA 1UIKA 4LLOA 1WD3A 1VMJA 2P1QB 3HT1A 4HLTA 5FZOB 1FS1A 2XDVA 5C9AA 1CR7A 5FO9B 1W2NA 2CY6A 4I9LA 1ZZBA 2K0GA 4HOOA 1AX1A 3S7IA 2X8KA 1G8WA 1LOCA 2HWC1 1R1A3 3LOBA 3UK9A 5JOWA 1EV13 1VBC3 2EA7A 3PUHA 1VP6A 5EFUA 1DF0A 5FYIA 5H9QA 3AFKA 4NRMA 4P5YA 3TAEA 5D21A 3O1UA 3LSDA 2OKXA 1WZXA 1UCXA 4GZ9A 1F2NA 4FO9A 5I93A 4OFGA 2R6QA 4ZU7A 1GQGA 2WUHA 3MV11 2HWB1 3WP5A 4XFBA 1H9WA 2XHKA 1XU3E 2VO5A 1IG3A 1XL3C 1NZCA 2VXRA 2D98A 2IVIB 2XWBB 2ZPXA 3AL6A 3LAGA 1CZSA 2GH8A 4TLFA 1V0AA 3RRDA 3KZ4C 4PF5A 3FHAA 4FXGB 1YQ8A 3PU3A 5ANNA 4FPGA 4EYUA 4M3RA 1AR91 2VZPA 1ND2B 4DY3A 2XJRA 1H4HA 2Y6FA 3B02A 1YIPA 4XXAA 1I9RA 3IB3A 4PQQA 4OQ9A 2G9FA 4MADA 4Y1VA 2RMU1 3D3AA 2DURA 3M3QA 4DS0A 2GU9A 3AVRA 4LTAA 5A3NA 3B01A 2GMMA 3RYRA 4XQDA 1S0GA 4KU7A 5JZGA 3SNMA 2FHRA 4RN5A 4RA0A 4CU7A 5JPMB 2ZGNA 3GF6A 3WDUA 1OQ1A 1RUF3 1CJPA 1GWKA 4A2UA 4JAAA 2BVVA 3HR9A 4RL5A 3MLJA 1ZREA 3HP9A 5FRAA 2XPJA 4YG0A 1OOPB 1JBCA 1ENSA 3KGLA 5JOXA 4ATEA 3N36A 3QEWA 5FJHA 1XU1A 1WUVA 2R1DA 1ULOA 1HXS3 1OHFA 1RUJ2 4EROA 5HBAA 4NPRA 4BA6A 3VBHB 1FZHE 4E2GA 3WHUA 1WW4A 1D7PM 1OURA 3VDDA 4CCNA 4CCJA 1JZ4A 4YGCA 3EYPA 2QQPA 4QHOA 4ATFA 2QQNA 4QPYA 3ZXDA 2HWE1 2W3JA 3SCHA 1NCRB 4KGGA 1ASJ3 4AK3A 2JKBA 4XXPA 1AYM3 2DVFA 4AI0A 1KQRA 3ZX7A 3DUIA 4MV2A 4MYEA 4DNYA 2Q8CA 5IVYA 2EF6A 2G9GA 4DUXA 2VCAA 1DU3D 3APBA 1IQDC 1OLRA 1AR83 3U1XA 3ALQA 3CIHA 3EJKA 1W6OB 5LA2A 3FLRA 1K3IA 2BGCA 3LF7A 2F4PA 4W8JA 3RMYA 1FMD1 1YIFA 3AX4A 4Y20A 2DTYA 3ZFFB 4FPHA 2ZXQA 1A8MA 1BK1A 4GH4B 5CA6A 5FPUA 2ADDA 2JD4A 1V6KA 4CUAA 3LDKA 5CFDA 4AHZA 2BNOA 2UWBA 3IMMA 1REEA 1OT5A 4LBJA 4R4ZA 3T1LA 5K7PA 4M3ZA 2DYCA 4XF3A 4Y1XA 2JDMA 4FPYA 2QQUA 4BCUA 3AXEA 1QJU3 3NQHA 4HVRA 3H0OA 2OS2A 4OZOA 3NJVA 1H8VA 2WINB 2OQ7A 5L9RA 3KB5A 3CL1A 4IEOA 4BHPA 2R062 4UFMA 3VGIA 1RJ8A 3RVHA 4HPKA 3ILFA 4DTSA 3TN92 5JOZA 4JKKA 3O1SA 3PUQA 1F5JA 1YEWA 2R7EB 3O5SA 4P9WA 5D8AB 1LR5A 1L7RA 3LZZA 1ZZ6A 5FY7A 3VBOC 4KU8A 3NJZA 5CFDB 1NUKA 2HLEA 4QX3A 5JVVA 2LF3A 1KS4A 4IEQA 1RUH3 2GNDA 2WIIB 3I2GA 5DDJ1 2E51A 4M41A 1TG7A 5A7NA 1UW8A 1VMHA 5FZEA 1POV1 1ZZ7A 3LEIA 2RS51 5A7WA 3RQ0A 2VUDA 4M01A 3BIWE 5FCCA 2PMWB 4FK2A 4FXKB 3PTRB 3HBZA 2PHUA 3A23A 3ZDSA 3VZKA 1AL0G 3OYWA 2WQ8A 4AFDA 4CCOA 5IAXA 1VBA1 2IVJA 3JU9A 1V9U3 2TUNA 3HQRA 1XVCE 4W6WA 3QEPA 2E9QA 4QGMA 3DPRC 4AEMA 3K77A 1N1CA 4GWJA 4YRDA 5FZCA 5DUVA 1XJAA 3MUZ1 4H7MA 4L9BA 2VMHA 4ZHNA 1V6LA 5F3EA 1WW7A 2A5ZA 3A0NA 4FQZA 1K5JA 4E4ZA 3MGUA 1X8MA 3LE0A 3I7DA 4UW5A 2ES3A 2ZGKA 1PNFA 3VBUB 3WNKA 3ABZA 1I5PA 1PVC3 4AVTA 4LXLA 4D8MA 4IV1A 4CUCA 4QKFA 3S0MA 4I0BA 4DY5A 1XOYA 3MIDA 4HETA 3S6PA 1JYIA 1RUC2 5IVEA 3CO2A 1IH7A 4FVMA 3Q8FA 1DYPA 5FZ4A 1VBB2 3PIGA 4JGZA 3RMDA 4YG3A 3ZXLA 1ZBE1 2Y60A 3OBTA 5C4WC 1L3JA 1RYYA 5BPXA 5JZGB 2JECA 1YYNA 3JXSA 2IZWA 4Y4YA 3N4MA 2DCZA 5FAXA 4YW1A 1RUG2 3S5QA 4FJXA 2WT0A 1EUTA 4Q4W1 1XVFE 4N8MA 3ZN6A 5I0RA 1HRI1 1D4VB 2HWF1 2ZGOA 3HEIA 3LQCA 1HJGA 3ZR5A 5LA1A 1XE0A 1S0EA 2BVBA 1F4HA 3ILRA 2CYFA 3SI6A 4R8HA 5DUWA 5FY0A 1VBE3 2B8IA 2PFTA 2RHPA 4ZS2A 1POQA 2H4TA 2E53A 1D2SA 3KM5A 4XTMA 1WBFA 2DU1A 1TQ5A 4QX7A 1V00A 4XFIA 4URTA 4H55A 2IFRA 1RUG1 3OJBA 1RB8G 3ZM8A 3UYJA 3JB8A 3HBKA 3TEXA 3POJA 4CDWC 1NE6A 5L7OC 2RJKA 1F31A 3SPYA 2ZZJA 5FYZA 1JYTA 5E88A 1R1ZA 2XH6A 4TSVA 1FXZA 1SBFA 1ULFA 1ZM1A 3VKOA 4ET7A 1FPN2 4A7ZA 3AB0A 1O8SA 4D6SA 3LZJA 3MV01 2HEWF 1HX6A 4IEZA 4QMAA 4M0NA 4NJ4A 3T09A 1PZ7A 4XVHA 3ZFEC 2ZCWA 5CB7A 5FZ9A 3ASIA 1UY1A 1N3PA 1HXS2 2CWSA 1O4ZA 5KXBA 3GBFA 3IAQA 1WLWA 1VPHA 1NXD1 3POGA 4MH0E 3VHOA 4BQXA 4RQPA 1W8WA 4IL7A 1YC61 5K8SA 2WFPA 2AREA 1PVC2 4GIQA 5J09A 1APNA 3OGRA 4LKDA 1RVF3 5JZGC 3FLTA 4M3CE 2KM2A 3M3IA 4HPKB 3T2PA 5HXVA 2R041 2RCUA 3CJIC 4IE6A 3ZMOA 4CRQA 5I8TA 5KR7A 4XJ9A 1JZ8A 1W8NA 4JV4A 4YM1A 3J4UH 2H0BA 4BK4A 4Q4X2 3LKJA 5FKBA 1C8M1 1CLQA 2CV6A 2YC4A 2W52A 4Q0PA 5D1IA 4LBQD 4YVWA 3SCFA 4Y5Z0 4Q4Y3 4A45A 2KR2A 1NY72 1VE0A 2FCVA 3SQ2A 1RUE3 5KHHA 1JYWA 1CAUB 1S55A 4CXXA 5BNOC 1UY3A 3ZSJA 2IUWA 3LEKA 2OXBA 3LSEA 2Q0AA 1MHZG 4IESA 3WW3A 2JB8A 4A4AA 5E1RA 5A80A 3LFMA 4M45A 3ZYJB 1TME2 1MS5A 5FMDA 5T5LA 3W9AA 5LASA 2V5DA 3CJIB 3LA2A 3HNBM 1LHUA 1H1AA 2Q1MA 3P3NA 3RS6A 1URXA 4CUBA 5C71A 4QX2A 2DCTA 4DXZA 4W65A 1J59A 3VBSB 4H7LA 4NPMA 2JWPA 2WABA 2WZEA 1ND3B 2BRTA 1LESA 4JDOA 3EBRA 2A1XA 5FZDA 4BLJA 3USSA 1FAYA 3FL7A 5CFDC 2XLFA 4EN7B 3HQUA 3WW1A 1CESA 3AYAA 1DQ2A 5J36A 3RG0A 4IDZA 4I3PA 4EE2A 2ZABA 5A6YA 1QKQA 4CPBA 4ZXEA 5LATA 2NQYA 3FUQA 4BU2A 1BJQA 4GB31 5KC5A 3N1EA 1VBD1 1XRUA 5EYXA 1H30A 2BBVA 3NNFA 1JU4A 4AKIA 1AR82 3RFRA 4AW7A 5L7OB 4YGBA 1ACCA 2PHTA 3AMPA 5F39A 3KHCA 1ZBA1 5IUQA 2N7GA 2DBNA 4FFIA 3S9HA 4ARYA 1GZ9A 3LOIA 5ACA1 4CEWC 1LENA 4XABA 4GMP1 4D69A 2CAVA 1LB2A 4TXWA 2WT1A 1QIQA 3VZLA 2ZGSA 2E6VA 1JI6A 1YQCA 3EHKA 5FR3A 1OF4A 1XBFA 1O91A 1H6YA 2BU9A 3SH5A 5FMOS 1OA4A 1STMA 1XNTA 1K42A 4DUWA 1FI2A 2HWB3 2WS92 4QB6A 3QD6A 5LK7B 2RG4A 4BQ4A 4E27A 2DUQA 1RHI3 4FP2A 4LA2A 1CX1A 5I0SA 5CFCC 1ODNA 1Q8PA 1VB4A 2Q8DA 3H3LA 3JB4C 2WN3A 1DBNA 2MEV1 3NV1A 5A7PA 1SLAA 3ZPYA 2EIGA 4QKNA 3SQ4A 5GZCA 3OG2A 4YZ1A 2ZGRA 2X5IC 1GBGA 5F6LB 1Q5OA 5H9SA 1OA3A 4FFHA 4AI9A 2Y64A 1OBNA 3VB9A 3ELNA 1LECA 3E4WA 1AR92 4QPIB 3BVOA 2VW0A 3AK0A 3DPRA 4JGYA 2WKKA 2BZDA 3LA7A 3WOGA 2JH8A 2BOIA 3AKRA 3BB6A 2MPFA 3TWIA 3IAPA 1UL9A 4C1XA 3NJXA 2RS12 3UL2A 3CKHA 1OH4A 4QPGC 5FMCA 3IWZA 4NIAA 1BQPA 4Q4V2 3CQOA 2MEV2 5D2AA 3AVSA 4KHSA 2NYYA 1PM7A 1AUYA 3C7GA 2DUPA 3D4KA 1O3TA 4Z92B 2KA3A 1JTZX 2OX0A 5T5OA 4JRQA 3ZSLA 3OGJA 2ORZA 3KF5A 2DCYA 3RI9A 1H4GA 3QCWA 2J42A 1WGPA 1LODA 2PQQA 3T2QA 2OVUA 4QPIA 1XMFE 2ZEWA 3ITQA 1PO12 4GAZA 4JGZC 1BEV2 4UW6A 4OLLA 4EQVA 2B8MA 1LHOA 1VBC2 3I3QA 5C4WA 5AVPA 1NKGA 1S1AA 1W6QB 2VVFA 1PX3A 2EIDA 4N9HA 4B1MA 2JPNA 3QESA 1CPNA 4OZXA 4CYDA 4QM8A 1H2KA 1AR62 4GKXA 3PVBB 5GALA 3PL0A 1SBDA 5GJ6A 5IK5A 4AI1A 1W8FA 3THTA 2K46A 1C5HA 3IMNA 3LDBA 1YHFA 2VR4A 2YFZA 2JG8C 2P4EA 3LPFA 3R4UA 1ZRIA 4JCKA 4XTPA 4C91A 2WYFA 1C4RA 2Y0IA 2ZMKA 3CU7A 2YC2A 2A73B 3JD71 3KV4A 4WZCA 4DINB 2DU0A 3ATGA 2RDQA 4DTJA 1ONAA 1Y9GA 4HFSA 5EXOA 4JKMA 4AHWA 5AFEA 2P5BA 3Q9OA 1QJFA 1HW5A 1QU0A 2P3YA 2WO7A 2JXAA 2W0XA 2W1UA 3N9NA 3J9SA 3RWUA 1UMIA 3N1BA 2AGSA 2CAUA 4HSJA 5JSRA 3SEPA 5ABJA 1O3QA 2VULA 1Q8VA 2BWCA 1O4TA 1RUNA 1L7LA 1O3RA 3EXUA 1Q8SA 1AYN2 4XILA 1UD1A 1CAVA 3T0DA 5J37A 5FP4A 2YHJA 1YJLA 1SQ4A 3BOPA 2JDAA 1UOFA 4DIQA 4EPHA 1S2EA 4FK4A 1YFXA 4ZU4A 4P9LA 5DMYA 3OOXA 1ST8A 2DBIA 2VMCA 3K2OA 1OVSA 2G19A 4YW6A 3SH3A 2FBEA 1GUIA 1UYXA 1V70A 2W46A 3ES4A 3VHNA 5C8CA 1CQ9A 4XBLA 1Q43A 2MHFA 2OW4A 4I0AA 3TRSB 5DABA 1GZWB 3AL5A 3T2OA 2FDGA 1JZ7A 4MSVA 3SQ0A 4QHBA 4KL1A 5AC91 1YO8A 2YV8A 1PM4A 5BYNA 1C8M2 5E8AA 4YVWC 5EV7A 2Q5TA 1JZ5A 1HLCA 1X50A 2Z5WA 1FMD3 1UZZA 3C6OB 3RJRA 3HPNA 5KHGA 3T3YA 4DTNA 3ZXEA 4FJHA 1S0IA 4RHV1 1BEV3 3SC7X 1PO13 1SPPA 1X82A 3NNMA 3CJIA 4NHXA 2LS6A 4X8PA 1ENRA 2JDKA 1ZVFA 3QOPA 2D6LX 5JMOA 4FJKA 1DDLA 3W59A 2YB5A 3L2OB 1SDDB 2EXKA 3VKMA 4P08A 2RDSA 4CCKA 3N7JA 1G9DA 4BK5A 4XURA 1UYYA 3FUOA 1XMGE 3SKVA 1GZWA 3NKTA 3NNGA 5C3OA 3WP6A 4ZS3A 4KBBA 2AYHA 4V2VA 3WUCA 1LOGA 5JPNB 3C7EA 4NR1A 4AL9A 5T52A 4Q4V3 2AH2A 1UZWA 3RMBA 2FMYA 1SZBA 3H7JA 4B4RA 4D6RA 5HV4A 1RTVA 1PHMA 3WINE 2QXFA 3HGLA 1FOD1 4NHMA 3H1WA 5FPBA 1SLIA 4I02A 3DKWA 3I2KA 5EHDA 5A70A 4FJ9A 3IBMA 4IGQA 1O7FA 1GP6A 2VMDA 4FPCA 4AZZA 2VQTA 4IEWA 4PLMA 1SHWB 4OMCA 3HT2A 2IC1A 4QXCA 2UWAA 4FPLA 4XC9A 3JQXA 1HXS1 5HCAA 5EP9A 4QPGB 5BNQA 3DCQA 4WM8B 2J22A 1AR71 3IKWA 2BFUL 3U14A 5JR2A 2RM22 4Q4Y1 3RMCA 3RZHA 5CFCB 4YZ3A 3RSJA 1SLBA 5L9VA 1I5ZA 4KI5M 1R092 3SH4A 4FJ7A 5IYYA 1CIYA 3K48A 3O1VA 1Y43B 4NHKA 3KWVA 4FPEA 4BIOA 4C0HA 4YARA 1FOD3 1CAXA 4L8QA 1GQPA 2YG0A 4NN0A 2WS93 4OI4A 2JICA 2ID4A 4FJGA 1AYN3 1ULPA 2WNUC 4J2DA 1JZ2A 1DGRN 4HMZA 5CG8A 2JDZA 5C4WB 4EWEA 3LEMA 1XE8A 1PX4A 1DGLA 2VTXA 2QFEA 1MTYG 1XVBE 2ZX1A 3AP5A 1TNRA 3NNJA 3RWNA 3ROUA 2RS52 1UXXX 3USUA 5KXCA 3C7HA 4XEZA 4BH9A 4O61A 3IIIA 3O12A 5K0UA 5J96B 5FYVA 4A44A 2PLV3 1OC1A 5FYCA 4PLOA 4HCBA 3FWEA 4MOAA 1RUI3 5F3IA 3VN4A 3SQ1A 2B39A 4AVAA 1H2NA 3VL9A 2CHHA 5FY8A 2VAUA 3K3NA 3POBA 3WNLA 1UX7A 1HRI2 2HWF2 5M0TA 2JH9A 1D4M3 1NQJA 3TN91 1DQ5A 4DFSA 4AI2A 4IEXA 2ZHKA 3B5LB 4IQPA 4AEDC 4DXTA 5BUVA 2WWUA 2VVEA 2WDBA 3PNAA 3ZFFC 3R6SA 5A7QA 3ZLIA 2ZX0A 3H1MA 4FI9A 1C5IA 2ILMA 3KV6A 4LORA 2KD7A 4CU6A 3NGIA 4J1XA 5BNNB 2W87A 2A6WA 2P2KA 1WAJA 3OUIA 4ICGC 3KD5E 1JU3A 2R043 4I30A 4QHZA 4BQ1A 5C5UA 2VXJA 4Y33A 1W28A 2HWD1 2Q4SA 1FT9A 1R091 3FHIB 1PIV1 1XC6A 2VG9A 1LDKE 4SLIA 5APAA 4XFAA 3RDIA 5F1RA 3G7DA 2RM21 4XBNA 2C5DA 2W47A 3IN9A 3THCA 1NZIA 3OY8A 5JXIA 1WMXA 4IE5A 4D7SA 3QNOA 3KGZA 3GJAA 5G05L 3M3OA 1LKNA 3VBUC 1JN2P 4NIHA 4C1WA 1G86A 1RHI1 2JJ6A 4M4RA 1YJKA 3ZVXA 4D0QA 5IHRA 3AMMA 2WT2A 5A1AA 2NP0A 4PIYA 3ACLA 1W6MB 3WQ7A 1FOD2 1WW5A 2MEV3 1BVVA 1QJU1 2WSUA 1H1MA 3NDKA 4Q4Y2 3KT4A 2E63A 3D6EA 1MR5A 2WAAA 3F2ZA 4CDUC 2A3YA 2PYTA 3PMSA 1AX0A 2P3KA 2RM23 3DN7A 1GYKA 4Q1RA 3BYWA 4TWTA 1B09A 5FOJB 3KT1A 3PURA 5IATA 1DQ0A 3H3ZA 4JGZB 2QQLA 5EQUA 2XKPA 3ZSKA 1PNGA 1ZRRA 2PAEA 4HT1T 4QKBA 3RZMA 1GOGA 1N1TA 1FZ5E 1H2MA 2ARCA 4L11A 2Y6GA 4Y3OA 2VC9A 1UMZA 4BMEA 4UFKA 1Q3EA 4CDQB 2SBAA 1RVF2 4CDXA 4Y4RA 4C8DA 4RFT0 1YUDA 4R9CA 3E6BA 4IV3B 3G6JB 1LULA 3UV9A 3S30A 3ZSMA 4UAPA 1WKYA 4PDWC 1RUOA 4XJZA 1X9TA 4M3CB 1I1EA 4FJIA 1FZ0E 1VAVA 2D3SA 2RMU2 2PXJA 1Q9YA 4GALA 4ZU5A 3WQ0A 3KCXA 2YZ4A 5JDBA 2E32A 4AFMA 1XVDE 2Y6KA 3H3UA 3POWA 4CEYC 5A6XA 2HBTA 2WO1A 4XHBA 4BIFA 4LHLA 5KXEA 1J83A 3ILNA 5E89A 1RUE1 4BQ2A 4XAEA 1CN1A 2VJXA 4M3YA 2JE7A 1WCDJ 1UU4A 3A21A 2RS11 1W9WA 2ZGTA 5FP7A 4AFCA 5C9AB 3OD4A 4U2AA 3BU7A 5FZ6A 1FMD2 1FZ2E 4FBFA 2VUJA 3EB7A 5FXVA 2VL4A 3O0WA 1CJDA 3MIHA 5SV8A 3E6CC 3WHTA 1HRV1 3KQ4B 1B35A 1NAEA 2DV9A 3PVOA 2WYSA 4YNIA 4DPNA 1W2AX 2VQAA 5I91A 3ZYGA 4IGPA 5ISLA 1T2XA 4L97A 1T6BX 1UOBA 1YQ5A 2NMNA 2NLRA 3RPQA 1UKGA 4E4SA 5BNOB 5DG1A 4GD4A 1H1IA 2YDEA 4WZFA 4AVVA 1WCSA 3CZUA 3UKNA 4AGRA 4WBBA 1GU3A 1TNFA 1NQDA 2EAKA 1S2KA 4HL0A 1UQXA 3NO8A 3NSTA 2YY1A 4Q2FA 2HEYF 3VD7A 3WDXA 1QOTA 3TB0A 4EN6B 3ME2A 1LU2A 1RUJ1 4FT8A 2LM3A 4LQRA 5FZGA 4P9XA 5D8AA 3GCWA 3J8F3 4KMQA 3N9OA 4P9JA 4LOTA 1VBD3 3O1TA 2R16A 3CDZB 5J1XA 3O1RA 1COV2 3I3EA 4IUGA 3WF4A 5FY4A 2DCJA 4CVUA 2KXLA 1NLQA 4D6QA 4OCTA 3DYMA 2FCTA 3MYXA 2IXHA 5DDJ3 2HD0A 3U10A 4RGKA 5ACA2 3C3VA 1LTEA 4IEPA 4BB3A 5CZKA 4YM3A 1W99A 2VNOA 3FFQA 4QU2A 4E2QA 1UYZA 1VRH1 2JG8B 5FBJA 5GLUA 4YW2A 5GZGA 4UXAA 2F4LA 3WNPA 2O1QA 1PZ9A 2JG9B 5LZ6A 1IS5A 2FCUA 1W3XA 1LOEA 1O59A 4E4HA 3A7QA 2BEOA 4I2OA 3PJQA 2XJQA 2W68A 3T4HB 3U07A 3ZOIA 1IPKA 1HN0A 2EALA 1NCRA 5JI9A 1L7QA 4X8NA 3IZOA 4J2EA 3BODA 3NAPB 4K8FA 2K2SA 5FPVA 1XYOA 3HVDA 1N1YA 1QNYA 4Z07A 5EZWA 3U11A 3MLLA 3SJJA 4J6GA 4QX1A 4O9EA 4NIGA 5FY5A 3ZYRA 1JUHA 1OQDA 1RUF1 3OPWA 2AC1A 1UMHA 4NUBA 3NE6A 5EJ3A 1YFYA 5F8PA 1RMU1 3I59B 3U4XA 4OHZA 1V9U2 3MFCA 4GQ7A 1BYHA 2RKHA 2QDRA 2ZGUA 4IEUA 4OHWA 2Q1ZB 3W20A 3WEZA 3U0ZA 2ENRA 5FYHA 4XJ8A 1V6OA 2WC2A 5T5PA 2WNUA 1IKPA 3HJRA 4FPKA 3POYA 3ZXGA 3RZJA 4NMIA 2P1NB 2J7MA 3AZZA 3C6NB 4LPLA 1HDKA 3M70A 3VL8A 3F95A 3VLBB 4WVMA 2VZRA 1WWYA 5H9PA 2R071 1MZEA 2NZ9A 3O1PA 1OVPA 1W6NA 5FZIA 1UAIA 4D7YA 4L0PA 2P1PB 3C7FA 1ASJ1 1COV3 2JDNA 2RV9A 4QPWA 1HQNA 3KLSA 2R0HA 3J8F2 1QOSA 5KBFA 2OVPB 3ZDVA 5IK7A 1MVQA 4J2BA 1W9SA 3KF3A 1F5FA 5CKQA 2R063 1Q8OA 1RITA 1FZ6E 3CMGA 3ZN6B 1J3RA 2VD7A 1CD3G 2JHPA 1DQ4A 3J7HA 3M4FA 4IE0A 4MGQA 2ZHLA 3FMGA 4JDNA 4J1WA 1UNBA 2CNAA 4NHYA 4CDQC 1JW6A 2IXIA 4R4XA 5A3LA 4RL7A 3B93A 4N43C 2W94A 2FMDA 3BPSA 3TBDA 4AEDA 3M1HA 4CSWA 3ZFFA 1FZ1E 1NG0A 1W8UA 1ZYBA 2J1RA 3WUDA 3ZKYA 4ASLA 4RD7A 3BKZA 4UW4A 4K9SA 3B9IA 1UN1A 1QXPA 1W05A 4XUOA 1H8TA 3GM8A 1J84A 1CX4A 3ZSEA 3MHZA 5BNOA 2VW2A 2EIBA 2MW2A 1WA6X 2VQUA 3D0SA 4LLFA 5FLJA 2YU2A 3K4DA 3C2UA 2C9AA 2ERFA 2VBBA 2WQ4A 4HN0A 3N3HA 5FYMA 4XETA 4MX3A 2GNMA 1H9PA 1IKQA 4B3NA 3J7MA 5JXGA 4RSUA 1GKBA 3ZKUA 1EUUA 4YM2A 1SMVA 3ZXAC 1AYM2 1JHNA 3OBRA 3QBQA 2WFF2 2XJSA 1NA1B 4PF1A 1BBT1 2RE9A 4CCMA 2Q8OA 3ZN4A 3VDDB 4AAXA 3MLKA 3WVJA 3VZMA 5B2GB 5J7MA 3O7OA 4FJ8A 2O8OA 2QQOA 4XUQA 3T30A 1TZOA 1RC6A 2P5OA 2P6CA 3I2FA 4AR2A 5FOBB 5KHKA 1H0BA 4S2DA 1EV11 4PCRA 1OLME 5ERLA 4XZPA 4LBQA 4CDUA 1MS0A 1RUC3 4A3ZA 1XXNA 3OEBA 2VZ3A 2XOMA 1J58A 5FJKA 5C7GA 4JHTA 1ZRDA 2YBSA 4OHXA 4W6XA 4PDWB 1OA2A 3AMNA 2D6KA 4MGSA 4HCCA 3UNPA 3I2DA 2WZ8A 3PVEA 1OOPA 4C0BA 1RUF2 3A22A 1XVEE 2LW8A 2W5FA 1NYWA 5BXXA 3CFPA 2YBKA 3RNSA 1AF9A 1MZ5A 1ZA7A 1SEFA 1VALA 3POFA 4CEWA 4LUMA 5I0TA 1KJLA 2B5HA 3E1F1 1HB2A 4JC1A 4YGDA 3UKVA 5K9YA 4DMIA 2ZX2A 3H9AA 4A6OA 4FJMA 1NCQC 1GMMA 1U5YA 5SV5A 4Q4X1 2JG9A 2VZOA 3KHBA 4YW4A 1WLTA 2JE8A 4BJ0A 2OZJA 5KHIA 1RUD1 4BXFA 4CEYA 3N9MA 4IV3C 5A3WA 3BALA 4ZONA 5FWJA 1GNYA 1RVF1 1J1LA 1R1A1 1RINA 3T2TA 3UETA 1WA4A 2HKXA 2Y6LA 1COV1 5DPNA 1POV3 4RHV3 5E6HA 1XYPA 1CZTA 2ZX4A 1PGW1 3S5AA 3HNMA 2VOKA 1NEXB 1GLHA 2D7FA 2GMPA 1QHDA 4Y20B 3OPZA 3CLPA 4DUVA 3OGLB 3C6PB 2Y6HA 3GBWA 5HCHA 1LNSA 4LR4A 2Q1FA 5H9RA 3QEVA 1PK6C 4R9BA 2DVGA 2E33A 5EJZB 1B35C 2PFWA 1FV3A 1GSLA 2Q30A 1LHNA 3I2JA 4XFGA 4E9KA 4Q4X3 1OLQA 2Y6JA 4WV8A 2VTFA 2WN2A 4JGYC 3BTAA 3VZJA 4CU9A 3WNXA 3T4VA 1AJKA 4LBNA 3CJXA 3LEGA 4I3GA 4XDQA 3WF2A 4A41A 2VOVA 3NW4A 5GLWA 4F7ZA 5F32A 4D7TA 3OGVA 1GZCA 4JRPA 3B94A 1PO22 3P6BA 1XYNA 4WVMB 4AOCA 4GKYA 4P5HA 2XJPA 4QXHA 1F4AA 3VBRA 3P3PA 1D4M2 1JYCA 4LO6B 2VOXA 2WWJA 1PMJX 1K12A 4QT6A 1W06A 4XCAA 1GFF2 1TMF2 3ES1A 5H37A 4XPVA 4BXSV 1FX5A 1ND2C 1ZA4A 2YXSA 4G3YC 4AYUA 1SDWA 3H8OA 1F35A 2HWD2 4TZDA 2XUEA 2PLV2 1R64A 3PLQA 4FP3A 4N7UA 5DDJ2 4UFJA 2XXZA 5T55A 1H6XA 2V09A 4NOTA 1FPN3 2Z79A 3VD9A 2JHCA 1EPZA 1W39A 2XJTA 4LEJA 4B1LA 4W4ZA 2FD8A 4BZ4A 4IW3A 4WM8C 2BWAA 5LCWL 3SUOA 2WFF3 5K4LA 5L19A 1MEC1 2YBPA 1ZNPA 1Y9MA 1DLCA 2NN8A 3LFIA 3HD8B 3H8UA 4XJUA 4NRPA 5D8AC 1DFQA 1W9YA 1IS3A 1QJX2 4B7EA 1KD7A 4PIXA 2BGPA 2AUYA 1MEC2 3AKPA 4FOWA 5A33B 3O0VA 3WDVA 3GZAA 3T1MA 1SFNA 3VBFC 5AC93 3FC0A 3P5BA 1KGYA 2VNRA 2ZEXA 2XMLA 2ZMNA 4GXLA 3VZNA 4LUKA 1YQ2A 2YMZA 3OGSA 2G1MA 2QZ3A 2ZAHA 4WVVA 4MVTA 2GP3A 3N35A 3SCXA 4IETA 4KI6A 3QNNA 1NA1A 3KCCA 3L1NA 3DXUA 4IEVA 1SFPA 3WZ1A 1PK6B 2VUAA 1A78A 3NAPC 4J2AA 1CAXB 5J48A 3R4DB 2Y26A 4QX0A 4E8DA 1VB2A 2HEVF 5CVRA 2X29A 1UU6A 1ULGA 1NCRC 4DB5A 4EV0A 1UPIA 2MNGA 4GMP0 3E4YA 5ABJC 1KS5A 3DECA 1SG3A 2I45A 3AMQA 1CPMA 2WR9A 4GJZA 5C9AC 3WF0A 4LO7A 1OI6A 3ENRA 4PIZA 2JQTA 1ZBE2 4G9SB 2EXHA 5LK5A 2WZR2 3WW4A 4KHYA 1QXRA 4XCBA 2A7AA 4N43B 4LBKA 1QGLA 3CHXA 4AAPA 5K0UB 3AP9A 1XNAA 2VIXA 1ND3A 1MMOG 1MZFA 3H1YA 1W2OA 4ZY9A 3QACA 5LBCA 2JEMA 3ACHA 5A6ZA 1QH7A 1X7NA 5FUIA 2DWRA 4YFZA 3B00A 3VZOA 3FBYA 1MACA 3NCIA 4AVSA 5KC6A 1DIWA 2XUMA 1IS6A 3PJYA 4QQLA 4DXRA 2W1SA 3E5XA 4ARXA 1OUXA 3DXTA 1XNCA 3BTXA 1W3VA 2P1OB 2D44A 3VBHC 3I49A 1JW2A 2QQKA 2Y33A 2JKXA 4RR3B 1RUH1 2ZTNA 2FDKA 5FZ1A 1NOVA 4LO5B 1C8M3 4S2FA 5BV6A 4IE4A 3HWJA 4BQWA 4ORFA 1U5XA 4FTEA 4XJAA 5C33A 1HN1A 5IT6A 3V56A 3TJYA 2YGMA 1SPPB 1BXHA 4KWKA 4N53C 5DUUA 5IWFA 2FZ1A 3MICA 1RUD3 2FQPA 1E5RA 5EJ1B 3V0BB 4KHQA 3JCIA 3AJZA 3FBMA 5GZEA 4ZKTB 4EP9A 1H8TC 4I9QA 2JE9A 3AP6A 2WRAA 3TEYA 3AMHA 3BCWA 2VVDA 2FYOA 1C3HA 5CYYA 4BQYA 3HOBA 1DGWA 1YI7A 2CGNA 5G04L 4YYOA 3O1OA 2J1UA 4DTOA 2EXIA 3HNYM 3VD5A 4Y1UA 5I8SA 1AJOA 2BFUS 3DPRB 4QQPA 5CADA 4X5MA 4L2NA 3OTFA 4DEQA 2P5GA 4D94A 3CFOA 2XR4A 4XF0A 2R30A 4AHYA 1F15A 1MPXA 1OKQA 3ZFGC 1N47A 3I8TA 5GKAC 1SLLA 1JOPA 4P9IA 3V0BA 1T6GC 4YM0A 3LPGA 3Q8BA 3WXPA 1GP5A 3M3CA 2XVLA 4LKEA 4LMFA 2ZS6B 2JIJA 2XONA 5FP8A 4GH4C 2PTMA 1QJEA 1JHJA 3OCPA 2E26A 1GZTA 1AZDA 4UF0B 2UWCA 3RJ2X 5DAXA 2RJ2A 1UZ0A 2CSGA 3U37A 4KI4A 1VMFA 1Q9XA 2P37A 2CL2A 4RR3A 1DP0A 4S2HA 2DF7A 5B4XA 1NCQA 5ANQA 4XFCA 2PFVA 4JZRA 4JGYB 1PGW2 3SLIA 1UX6A 2PHFA 4DU3A 2C1FA 2GDFA 2OZ6A 2JDUA 2QBXA 2PHXA 3IDAA 2OUHA 2XWJB 3QEXA 1S0JA 1FNZA 3WP3A 2Y0OA 2Z2SB 5HI0A 4QQ2A 4KHNA 3JQWA 3AZXA 3WV6A 4XUTA 2JHAA 4FJ5A 1C8NA 2JG9C 2JX9A 1PK6A 2RMU3 3MI8A 4LK7A 4OMDA 2B7YA 5FK8A 5FYSA 1XNBA 2A3XA 4AG4A 4IV3A 1ZX5A 2EXJA 2VH9A 2IXLA 4L92A 4JRAA 4I09A 1HB3A 2D3PA 3WX5A 4AQ6A 4CU8A 1R093 4F8AA 4AKHA 3VBRB 2TEPA 3ZN5A 2Y34A 4UFHA 3UO2A 4QU1A 4INDA 3ZXKA 4BISA 2R072 4DTPA 4HANA 3CZJA 4Q0UA 1UOJA 2RS32 4QB2A 5F2WA 3SVIA 4CDWB 3U4SA 1CAWA 3TYJA 5IAVA 4B4QA 1W6PA 4KQ7A 5FP9A 1WMEA 3BVCA 1MQTC 2YROA 3H8XA 3K51A 5JI7A 2HJIA 4Y1YA 2B42B 1P8JA 2RS33 5HPOA 1J3QA 2UY9A 5F9TA 4EN8B 2YGLA 3GJBA 3UJOA 3X29B 1FNYA 4B7KA 4R52A 1A34A 1DCSA 1SACA 1V9U1 3I2OA 4UFIA 4HBNA 3QEIA 1BK0A 4AGGA 4FJLA 1XNKA 2PHWA 4YVSC 4ZZ5A 3SNNA 4AQ2A 3TAGA 2XJUA 2HWB2 2FW3A 2ZEYA 1JOJA 4HONA 4QKDA 5GM0A 2FDFA 1G9FA 4EN9B 3UJQA 4RG8A 4XW3A 5FZFA 4NIIA 3V65A 4AWDA 1W8HA 2F6BA 2ATFA 5L9BA 1OKOA 2J1VA 1FV2A 3BI3A 2ZKLA 4PI0A 5A7WB 2JDHA 2ATQA 2X5IB 3VKLA 4CCEA 3HMYA 4W6YA 2VZSA 2XKOA 2VCMA 3ETQA 2I07B 2VNGA 3AKTA 1RUI1 3J7LA 3T0BA 1YRZA 3OEAA 1QXJA 1JYVA 1YNAA 1REDA 2ARAA 3LIHA 2XBO3 2A6YA 4EWAA 4HKWA 2OZSA 4K3UA 1TVGA 3ZIXA 1ODMA 4O9GA 5C3PA 4O7XA 3MPPG 5EPAA 2YC0A 2D5HA 4CDXB 4PHZA 3V0AA 2WL1A 3DV8A 1Y3TA 4J25A 5FZKA 4LKSA 4BLIA 1DYKA 1OFNA 1QF3A 1VJ2A 1XPWA 3MW3A 4IV1B 4IXLA 4Q0SA 4BQ5A 5DXDA 3SXWA 1ULCA 3J8F1 4CDWA 2ZEZA 1HRI3 1O4YA 1W2UA 2HWF3 1QMJA 2P1BA 5E16A 2WZPP 3WNOA 4B08A 1VBC1 2G4IA 3NL1A 1RUI2 2NPIA 3AFGA 2QCSB 4LK6A 3RYKA 5FPLA 2P3IA 3NWKA 3E6DA 1W0OA 4QWNA 5CU1A 1OLMA 2ARBA 3B9CA 3W5NA 1NA1C 1K5MC 5IREA 1ND3C 5AVAA 2X05A 1C1LA 3NAPA 2XL7A 2QQWA 4NROA 4YVWB 5A32A 1U0AA 4N53B 4CA9A 1LOFA 3OBZA 3KSCA 4MUVA 4UBHA 4B8EA 3V64A 3D8CA 2NMOA 2GNBA 2A71A 4LO8A 5JUVA 1AL21 4YWAA 3PHMA 5A3UA 4QNCA 2ET1A 1QWRA 4K1YA 1XVGE 1V6MA 4NIDA 3VBHA 2RDNA 1LRHA 1UOGA 3AKQA 2CGOA 1Y7BA 2WNUB 1RUE2 5BNNA 1R082 3QH6A 2XB6C 4XE9A 3ZYHA 1O6UA 3DYPA 4JVAA 4NO4A 2YUEA 1RMU3 3FHQA 3GHNA 2PELA 3ZFEA 1QDCA 4PBPA 4AI3A 5F5QA 3L2HA 1N1SA 3WG4A 3MIGA 3ZMNA 4NWWA 4M00A 4XZUG 4CZSA 1YXWA 2GAUA 3HAGA 4N53A 5JIUA 1WBLA 1CGPA 1YFUA 3BOWA 3NMBA 1JYXA 4IEYA 4ASMB 1AL23 2A6VA 5I8YA 2GC2A 3TAYA 4I6JB 4FVVA 3S7EA 4ADNA 3EMRA 2R073 4GAMC 2WWSA 4YW5A 2DTUA 3QH7A 3ZR6A 1Q8QA 4AQTA 2QQVA 3M7AA 5A3TA 1PMHX 1BCXA 3OGMB 4EYWA 5DZFA 4UI9L 1GOHA 3KV5A 1GICA 3KCYA 1E5IA 1RL3A 2PHLA 2QKDA 3QERA 2LALA 2W1QA 3LDSA 4FOYA 4JHZA 4MG2A 4BMBA 4AE2A 4Q4W3 5T54A 4AF9A 5IVFA 1WLDA 5EIYB 4W50A 2A3WA 3RZZA 1WD4A 4A6SA 1Z7S1 2RS13 5FYUA 4AVBA 4CP9A 4JQRA 4RS5A 2WZR3 4MO3M 1VBE1 4XHXA 4P02B 3OY8B 2WNVA 4EN0A 1S2BA 4KBZA 3IIAA 5IFTA 4YLZA 2OPWA 3VKNA 1IGOA 2Z4FA 5FV3A 4R9DA 4A3XA 1IS4A 4H14A 2JIGA 3HQXA 1FPOA 1HRV2 1W04A 1NT0A 4M4PA 5F3CA 2UYBA 3GGLA 1QY4A 3PMEA 4MXWA 2TNFA 1OPOA 3ZFGA 3SISA 1D0HA 4COZA 3MPBA 1XNDA 5JMCA 1G7YA 3ZFEB 1EAH2 5EYYA 4AQSA 1W90A 3AJYA 1QEXA 4E4DX 1W0NA 4TYSA 5BNPB 5LRSA 2W39A 1F9KA 5IBKB 1Z7S3 1IOAA 2PHRA 2PHDA 4I01A 2BNNA 1FZ8E 3RZGA 3NNLA 1RHI2 2YYOA 4HKLA 4FTSA 3HN3A 4XFHA 1W8ZA 3A0KA 1PIV3 3B69A 4YW7A 3MF9A 1QJX3 3ORJA 3SQOA 3THDA 3JUUA 2HH9A 3BPZA 3IDCB 5C70A 2QJVA 3BTZA 4K6BA 1S0BA 4N9IA 4RR3C 3A4UA 4K8RB 1Q56A 4XACA 5FQ0A 1ULEA 1OD3A 4Q8LA 4TN7A 4CDQA 5C5TA 4XQWA 3SUPA 2H6CA 3VBSC 1A8DA 4CEWB 4OI0A 1BMV2 4MGTA 1DLLA 4QB1A 5L73A 4CUGA 1W6MA 1LHWA 1VBB3 5LY2A 1DZRA 1GV9A 2VJ4A 4M3CA 4UYBA 4Y5TA 2XHNA 2ZGMA 1PGL1 1F8VA 5FLIA 4M3CF 2DTWA 3T0AA 2ZKNA 3MFAA 2DEBA 3DGTA 3MO4A 4DU1A 2B4KA 3EQEA 3IDBB 4MHRA 3B3QE 4BE3A 1W6OA 1WAFA 5KHJA 1E57A 3FZ3A 4XOGA 1UWWA 5A1FA 1BBT3 3O0XA 1PO23 5DQ0A 5A6QA 1XU2A 2B7MA 3AYEA 5DAWA 2VGDA 5FZOA 4NHLA 4FQ4A 2DCKA 2HYXA 2BW8A 4MXWB 1NLRA 3SEEA 4FAGA 3VD4A 1E5SA 1PVC1 4IERA 3WF3A 3NV2A 2WNEA 4NVPA 3OGGA 1VRH3 2X5IA 3USUB 2QVSB 4DTRA 1WCKA 3FFZA 4QDQA 3MZHA 2D5FA 4QX5A 3U78A 2XVGA 1PGSA 4PT6A 2D43A 1S0DA 4SBVA 4WM7C 3RGBA 3KD4A 1RXGA 3MF6A 5FBZA 4QNDA 1Y9QA 5FWEA 5FUNA 3ZPOA 3PVNA 4KG0A 3EO6A 3RZLA 2C24A 1PO21 2W9XA 1LEMA 1HB1A 3TNQA 3N9LA 4Q27A 5DAPA 4HVQA 1OFSA 3W21A 1ZRFA 3AP7A 2GALA 4YVSA 5FO8B 2WNOA 3MW4A 1DZTA 4LIUA 3KVAA 2WLPA 5LRRA 2CWMA 2ZGLA 5FY9A 1OUSA 5FUPA 4CCDA 5IVCA 5J3UA 1BMV1 2P34A 4OUMA 3K75B 2ZACA 1X9PA 1KJRA 5IFPA 3AKSA 5FFOC 4DTUA 2OQ6A 4QGLA 1AR93 1AXZA 1M4WA 3ZYFA 4WVWA 5FZHA 3UGGA 1CAVB 1ZZ8A 2VUCA 4K21A 3PUSA 1CVNA 5C3SA 1QJY2 2GN3A 4QPIC 5JIAA 2JG8A 4XUPA 1SLTA 2W95A 5CBLA 1WCUA 4JS5A 2RR13 4QQOA 3OUJA 5A32B 4Q29A 1HB4A 1LU1A 3UIQA 2GMEA 3WF1A 1VAKA 3FE5A 1W9TA 1D0GA 3L2YA 5J98B 1QJX1 5A33A 4FFFA 4LNVA 5JLVA 5AC92 1KFXL 3C95A 2R061 1N1VA 4P14A 3UGFA 2WBKA 3W5MA 1D4M1 2D6OX 3KT7A 3N7KA 4OUEA 1O5UA 4TTGA 4K1ZA 2JB4A 1MS9A 2ZJCA 4GJYA 1FYZE 1NXMA 4LE4A 3M2MA 4XF4A 2W1WA 3BN6A 4UOJA 1IPSA 1V6JA 4XMAA 5FZLA 4BQ3A 2OPKA 2GH2A 3K4ZA 3RI8A 3ZFGB 1GWLA 3LA3A 3V7DB 1VBB1 1RGSA 1UZYA 2BUKA 3WNNA 1XMHE 4LBQB 2XG3A 2V4VA 2DVBA 1YCIA 2V73A 3CBNA 5A3PA 1AYM1 4HZFA 1IG0A 2A75A 1UPSA 3Q8EA 1YFWA 1GQHA 1LOFC 4YZ5A 2JDPA 2R49A 3V0AB 5CAZA 1X8EA 1P22A 3C8XA 4HXCA 2AR6A 3C7OA 5T50A 5IVBA 1ND2A 2A6XA 3ZYPA 2D97A 1C57A 2G9ZA 2SLIA 4DTMA 3D5OA 2XVKA 1U5ZA 3GYDA 4LBOA 1JZ3A 1IQAA 2RR12 4RGGA 1VBE2 5GZDA 2CU5A 2ETEA 5FZ3A 3NAEA 5BNNC 3L9JT 2BTVC 1DGWX 4Q0QA 2J1AA 2JD9A 1XU5E 5F6KA 1GWMA 2LF6A 2PAKA 3DF0A 1QJY3 3QLQA 2W2IA 4NRQA 4ES9A 4FOQA 1AX2A 4Q8KA 3GNEA 3FX3A 5DZGA 3RMXA 5IJRA 4WM8A 4E4BA 5GLZA 4M3WA 3OYWB 1RUG3 2WO2A 4QQHA 3VHRA 5C3RA 5LA0A 1KRIA 4ISRA 4FCAA 4BOWA 4CP9B 5FTTC 3AYCA 1LHVA 4S2GA 1BLZA 1DZQA 3IT8A 1MS4A 5DUXA 5DG2A 3IDEA 3NRUA 2VECA 3I3BA 3UT0A 1LAJA 3I54A 1J3PA 4M42A 1TME3 2OT7A 5TSWA 1FZ7E
chains in the Genus database with same CATH topology
4BK5A 4XURA 1UYYA 1XU3E 1XMGE 4AI6A 2EIEA 2VO5A 1XL3C 3ACHA 3SKVA 3NNGA 5FUIA 1CZSA 3NCIA 3C7EA 2EICA 3I2IA 4DXRA 3ACGA 2W1SA 3RMBA 1DYOA 3FHAA 4ARXA 2RVAA 2QXFA 3HGLA 4M3RA 2VZPA 2P1OB 2J1TA 3I2KA 3IB3A 2QQKA 4RNGA 2OZMA 4FJ9A 4KWUA 4PQQA 2JKXA 2B1EA 4MADA 3KD1E 4HG6B 3D3AA 2VMDA 2VQTA 1SHWB 4OMCA 1K45A 4RN5A 4CU7A 1HN1A 2J22A 3BGAA 4DU4A 3TJYA 4M3XA 5JR2A 3RMCA 4ZZ8A 4KI5M 3ACFA 4RL5A 4FJ7A 5IYYA 3HP9A 1CIYA 5EJ1B 4KHQA 3T08A 1CZVA 4EP9A 3QEWA 4I9QA 1GQPA 1FXXA 1ULOA 2YG0A 5I0DA 4LHSA 2ID4A 4FJGA 1ULPA 1FZHE 1WCQA 2FYOA 2OYQA 4J2DA 1D7PM 5CYYA 3HOBA 5G04L 1JZ2A 1JZ4A 2J1UA 4DTOA 3EYPA 1PX4A 3HNYM 3VD5A 2VJ5A 1O8PA 1MTYG 1XVBE 2QQNA 4X5MA 4DEQA 2W3JA 2P5GA 1UXXX 2W92A 3CFOA 3C7HA 4FJNA 4RYDA 3IIIA 5B4NA 1MPXA 2Y8KA 4A44A 4P00B 3J27A 4DUXA 4HCBA 3LPGA 2VCAA 4MOAA 1IQDC 3SQ1A 3CIHA 5LA2A 2XONA 3WNLA 1UX7A 2VZQA 1US3A 1K3IA 2JH9A 4W8JA 1JHJA 2E26A 3NHGA 2ZXQA 4DXTA 2RJ2A 3VDBA 1UZ0A 2WDBA 4CUAA 3U37A 4KI4A 1Q9XA 4FI9A 4BDVB 1DP0A 1OT5A 2C4XA 4M3ZA 2KD7A 5B4XA 3NGIA 4CU6A 4E8CA 1OF3A 2W87A 2PFVA 2YB7A 3NQHA 1WAJA 3KD5E 1JU3A 4OZOA 4DU3A 3NJVA 1XC6A 1LDKE 2QBXA 2W91A 3IDAA 2OVQB 4DTSA 2W47A 4E3SA 3QEXA 4JKKA 3THCA 5JXIA 3QNOA 5G05L 5DN2A 4KHNA 2R7EB 1L7RA 2WO3A 3AC0A 4FJJA 4XUTA 1NUKA 2HLEA 2P1MB 4M4RA 2LF3A 4QX3A 2JHAA 4FJ5A 3I2GA 4D0QA 5IHRA 4OMDA 1FZ9E 4M41A 5A1AA 1TG7A 4AG4A 3LEIA 3NDKA 4FK2A 4CU8A 5IZ7A 2WAAA 3A23A 4AKHA 3F2ZA 2WQ8A 3W5MA 2BBAA 4DTPA 3CZJA 1XVCE 4QB2A 3QEPA 3SVIA 3K77A 2QQLA 4GWJA 3MUZ1 1GOGA 1FZ5E 2Y6GA 2VC9A 1P8JA 5HPOA 3LE0A 3WNKA 4ADOA 3ABZA 1I5PA 1NX9A 4D8MA 3TABA 4CUCA 3QEIA 4UAPA 4QAWA 1WKYA 4FJLA 4ZZ5A 3SNNA 4OYUA 3TAGA 4FJIA 1FZ0E 2FW3A 1Q9YA 2ZEYA 1IH7A 4FVMA 3OBAA 1US2A 2E32A 4RG8A 5F7UA 1XVDE 2Y6KA 3RMDA 3RMAA 5C7GA 2J1VA 2WO1A 1RYYA 2ATQA 1J83A 3JXSA 2VZSA 3SKJE 2VJXA 4M3YA 3A21A 1W9WA 3T0BA 3OEAA 4FJXA 1JYVA 2C9KA 1EUTA 1FZ2E 2VZ1A 1XVFE 3J2PA 3EB7A 2VL4A 3HEIA 3LQCA 2OZSA 1TVGA 5LA1A 1F4HA 3SI6A 1NAEA 2WYSA 2B8IA 2PFTA 1UY0A 4LKSA 1T2XA 4E8DA 1XPWA 2H4TA 3OB8A 2YFUA 2ZEZA 3WNOA 3SPZA 3CZUA 4B08A 2PQSA 5HXMA 1GU3A 3GXUA 3ZM8A 3VD7A 3W5NA 5IREA 3SPYA 2X05A 4LQRA 2QQMA 4ET7A 4KMQA 3CDZB 5J1XA 1O8SA 3I3EA 4IUGA 3WF4A 3LZJA 2DCJA 4CVUA 3MV01 3DYMA 5JUVA 2HD0A 3T09A 2VIXA 4XVHA 3GDBA 4QNCA 2V72A 5CZKA 1XVGE 1W99A 1UY1A 1UYZA 4YPJA 3IAQA 3WNPA 3C94A 2VOTA 4M3TA 1O59A 3DYPA 3A7QA 3VDAA 3FHQA 4QDSA 3OGRA 2CDOA 1L7QA 4J2EA 3T2PA 4XZUG 3I97A 3SJJA 2RCUA 4GWIA 4QX1A 1JZ8A 1JYXA 1W8NA 4BK4A 1UMHA 3NE6A 4I6JB 4ADNA 1CLQA 4GAMC 4M3UA 2YC4A 3WEZA 2DTUA 1PMHX 3LD8A 3OGMB 3HJRA 4EYWA 4A45A 1UY4A 1GOHA 2B9VA 2P1NB 3SQ2A 4UI9L 2J7MA 1FZIE 2DY4A 1JYWA 3C6NB 4LPLA 3QERA 1UY3A 3LZIA 2W1QA 3LDSA 3LEKA 4JHZA 1FZ4E 2VZRA 1MHZG 4A4AA 4DEVA 4JS4A 4M45A 5EIYB 4L0PA 2P1PB 3C7FA 4W50A 4QPWA 2RV9A 2V5DA 3HNBM 4MO3M 2OVPB 3SUQA 4J2BA 1W9SA 1W8OA 2X09A 4P02B 4CUBA 5C71A 3CMGA 4QX2A 2VCCA 1FZ6E 4X5NA 4FK0A 3J7HA 2JHPA 5IFTA 3TAFA 4MGQA 2Z4FA 2WABA 2WZEA 1MHYG 3ECQA 2W94A 3L8BA 4M4PA 3FL7A 2VMEA 1FZ1E 2BGOA 2J1RA 3GGLA 4XUOA 3GM8A 1J84A 2XQXA 2EIBA 2VQUA 1JZ6A 4ZXEA 1W0NA 2E31A 3HL8A 5IBKB 3N1EA 3K4DA 1FZ8E 4JX0A 3MKSB 3HN3A 1JU4A 4AKIA 3THDA 3WQBA 5C70A 5JXGA 2MZWB 4AKGA 1EUUA 3S9HA 4ARYA 3P1IA 4PF1A 1OD3A 4AAXA 3SUPA 2X10A 2DDUA 3TL8B 4FJ8A 4XUQA 2QQOA 4TXWA 2P5OA 3I2FA 1JI6A 1OF4A 4QB1A 1H6YA 3I2HA 2VJ4A 1XNTA 3PUIA 1K42A 2XHNA 4DUWA 4QB6A 4A3ZA 3L0MA 2WAOA 3T0AA 3OEBA 4XUNA 1CX1A 2VZ3A 4KHUA 2XOMA 2DEBA 3MO4A 2VCBA 4DU1A 2B4KA 1UXZA 2WN3A 4MGSA 4HCCA 3UNPA 2WZ8A 3K4AA 1WAFA 1FZ3E 1UWWA 3A22A 1XVEE 2LW8A 3SQ4A 2W5FA 5DQ0A 3OG2A 3CFPA 2C26A 2B7MA 3MBWA 2VZVA 2DCKA 3CFRA 2Y64A 2HYXA 3VD4A 3SEEA 3E1F1 3E4WA 3WF3A 3WSOA 3FN9A 4A6OA 4FJMA 2BZDA 1IG9A 3VD3A 2JH8A 4DTRA 4Z2AA 1GMMA 4QDQA 4DXSA 3IAPA 1JYNA 3QETA 2VZOA 3NJXA 3CKHA 1OH4A 2JE8A 4PT6A 4BJ0A 3CQOA 4QNDA 4KHSA 2VZUA 1GNYA 3SUNA 1BHGA 3C7GA 3UETA 3MUY1 2Y6LA 4JRQA 5DPNA 2W9XA 3VDCA 1CZTA 2ORZA 3HNMA 4DTXA 1NEXB 4DUVA 3OGLB 3T2QA 3C6PB 2Y6HA 4A42A 1LNSA 1XMFE 2L9LA 3K75B 2ZEWA 3QEVA 5EJZB 2E33A 2QQIA 5IFPA 4KHWA 4DTUA 4QDRA 2VMFA 3I2JA 2Y6JA 3ETPA 3DYOA 2VTFA 2WN2A 4CU9A 1NKGA 1KEXA 3LEGA 4A41A 3WF2A 3CQ8A 1PX3A 2EIDA 2VZTA 4XUPA 2JPNA 3QESA 3OGVA 4ZY9A 2W95A 4JRPA 3P6BA 3UESA 5JXHA 4JS5A 2ORXA 2OVRB 3UIQA 3I3DA 3WF1A 3LDBA 1F4AA 2VR4A 2YFZA 1W9TA 3LPFA 1PMJX 1K12A 2VM9A 3WNMA 2YC2A 4BXSV 5H37A 3C95A 4DTJA 4JKLA 2WBKA 4JKMA 2CDPA 4OUEA 4TTGA 1R64A 2QQJA 3ACIA 1FYZE 1H6XA 2W1UA 5JXJA 2J1EA 2W1WA 3BN6A 4UOJA 3RWUA 1UMIA 3N1BA 3K4ZA 3VD9A 2JHCA 2BERA 4W4ZA 3SEPA 5LCWL 3V7DB 3SUOA 3WNNA 1XMHE 2V4VA 3HGKE 3OGKB 1DLCA 3K46A 1GOFA 3T0DA 2MMBA 2BGPA 2JDAA 1UY2A 4EPHA 1KGYA 4FK4A 1P22A 2ZEXA 5DMYA 2VMCA 3K2OA 3C8XA 1YQ2A 3C7OA 3OGSA 1GUIA 1UYXA 2J1SA 2W46A 4DTMA 3SCXA 2P1QB 1JZ3A 3T2OA 4KI6A 3QNNA 1JZ7A 1FS1A 3L1NA 3NAEA 3SQ0A 2J1AA 2JD9A 1XU5E 2LF6A 4J2AA 4QX0A 4I9LA 1JZ5A 3E4YA 5IJRA 3DECA 4E4BA 3C6OB 1SG3A 3HPNA 4M3WA 3PUHA 4DTNA 4FJHA 2WO2A 5LA0A 4P5YA 3TAEA 3WF0A 2LS6A 4KHYA 2OKXA 4GZ9A 5JMOA 4FJKA 3NRUA 3I3BA 2WUHA 2YB5A 3L2OB 1SDDB 4M42A 3MV11 4P08A 1XNAA 1MMOG 1FZ7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BK5 A;  4XUR A;  1UYY A;  2EIE A;  2VO5 A;  3ACH A;  3SKV A;  3NNG A;  5FUI A;  1CZS A;  3C7E A;  2EIC A;  3I2I A;  4DXR A;  3ACG A;  2W1S A;  1DYO A;  3FHA A;  4ARX A;  2RVA A;  2VZP A;  2P1O B;  2J1T A;  3I2K A;  3IB3 A;  2QQK A;  4KWU A;  4PQQ A;  2JKX A;  4MAD A;  4HG6 B;  3D3A A;  2VMD A;  2VQT A;  1SHW B;  4OMC A;  1K45 A;  4RN5 A;  4CU7 A;  1HN1 A;  2J22 A;  3BGA A;  5JR2 A;  4ZZ8 A;  4KI5 M;  3ACF A;  5IYY A;  1CIY A;  5EJ1 B;  3T08 A;  1CZV A;  1GQP A;  1ULO A;  2YG0 A;  5I0D A;  4LHS A;  2ID4 A;  1ULP A;  1WCQ A;  1JZ2 A;  1D7P M;  5CYY A;  3HOB A;  5G04 L;  1JZ4 A;  2J1U A;  3EYP A;  3HNY M;  1PX4 A;  3VD5 A;  1O8P A;  2QQN A;  4DEQ A;  2W3J A;  1UXX X;  2W92 A;  3C7H A;  4RYD A;  3III A;  5B4N A;  1MPX A;  2Y8K A;  4A44 A;  4P00 B;  4DUX A;  3LPG A;  2VCA A;  4MOA A;  1IQD C;  3CIH A;  5LA2 A;  2XON A;  3WNL A;  1UX7 A;  2VZQ A;  1US3 A;  1K3I A;  4W8J A;  1JHJ A;  2E26 A;  2ZXQ A;  4DXT A;  2RJ2 A;  3VDB A;  1UZ0 A;  2WDB A;  4CUA A;  3U37 A;  4FI9 A;  4BDV B;  1DP0 A;  1OT5 A;  2C4X A;  2KD7 A;  5B4X A;  4CU6 A;  4E8C A;  1OF3 A;  2W87 A;  2YB7 A;  3NQH A;  1JU3 A;  4OZO A;  3NJV A;  1XC6 A;  1LDK E;  2QBX A;  2W91 A;  3IDA A;  2OVQ B;  2W47 A;  3THC A;  4JKK A;  5JXI A;  5G05 L;  5DN2 A;  2R7E B;  1L7R A;  2WO3 A;  3AC0 A;  4XUT A;  1NUK A;  2HLE A;  2P1M B;  4M4R A;  4QX3 A;  4D0Q A;  5IHR A;  3I2G A;  4OMD A;  5A1A A;  1TG7 A;  4AG4 A;  3LEI A;  4CU8 A;  2WAA A;  3A23 A;  3F2Z A;  2WQ8 A;  3W5M A;  2BBA A;  3CZJ A;  4QB2 A;  3K77 A;  2QQL A;  4GWJ A;  3MUZ 1;  1GOG A;  2Y6G A;  2VC9 A;  1P8J A;  5HPO A;  3LE0 A;  3WNK A;  3ABZ A;  1I5P A;  1NX9 A;  4D8M A;  4CUC A;  4UAP A;  4QAW A;  1WKY A;  4ZZ5 A;  4OYU A;  3OBA A;  2ZEY A;  1US2 A;  2E32 A;  5F7U A;  2Y6K A;  5C7G A;  2J1V A;  2WO1 A;  1RYY A;  1J83 A;  3JXS A;  2VZS A;  3SKJ E;  2VJX A;  3A21 A;  1W9W A;  3T0B A;  3OEA A;  1JYV A;  2C9K A;  1EUT A;  2VZ1 A;  3EB7 A;  2VL4 A;  3HEI A;  3LQC A;  1TVG A;  5LA1 A;  1F4H A;  1NAE A;  2WYS A;  1UY0 A;  4LKS A;  1T2X A;  4E8D A;  1XPW A;  3OB8 A;  2YFU A;  2ZEZ A;  3WNO A;  3CZU A;  2PQS A;  5HXM A;  1GU3 A;  3GXU A;  3ZM8 A;  3VD7 A;  3W5N A;  2X05 A;  4LQR A;  2QQM A;  4ET7 A;  4KMQ A;  3CDZ B;  5J1X A;  1O8S A;  3I3E A;  4IUG A;  3WF4 A;  2DCJ A;  4CVU A;  3MV0 1;  3DYM A;  5JUV A;  3T09 A;  4XVH A;  3GDB A;  2V72 A;  5CZK A;  1W99 A;  1UY1 A;  1UYZ A;  4YPJ A;  3IAQ A;  3WNP A;  2VOT A;  1O59 A;  3DYP A;  3A7Q A;  3VDA A;  3FHQ A;  4QDS A;  3OGR A;  2CDO A;  1L7Q A;  3T2P A;  4XZU G;  3I97 A;  4GWI A;  4QX1 A;  1JZ8 A;  1JYX A;  1W8N A;  4BK4 A;  1UMH A;  4I6J B;  2YC4 A;  3WEZ A;  1PMH X;  3OGM B;  3HJR A;  4A45 A;  1UY4 A;  1GOH A;  2B9V A;  2P1N B;  4UI9 L;  2J7M A;  1JYW A;  3C6N B;  4LPL A;  1UY3 A;  2W1Q A;  4JHZ A;  3LEK A;  2VZR A;  4A4A A;  4DEV A;  5EIY B;  4L0P A;  2P1P B;  3C7F A;  4W50 A;  4QPW A;  2RV9 A;  2V5D A;  3HNB M;  4MO3 M;  2OVP B;  1W9S A;  2X09 A;  1W8O A;  4P02 B;  4CUB A;  5C71 A;  3CMG A;  4QX2 A;  2VCC A;  3J7H A;  5IFT A;  4MGQ A;  2Z4F A;  2WAB A;  2WZE A;  3ECQ A;  2W94 A;  4M4P A;  3FL7 A;  2VME A;  2BGO A;  2J1R A;  3GGL A;  4XUO A;  3GM8 A;  1J84 A;  2XQX A;  2EIB A;  2VQU A;  1JZ6 A;  4ZXE A;  1W0N A;  2E31 A;  5IBK B;  3K4D A;  4JX0 A;  3MKS B;  3HN3 A;  1JU4 A;  3THD A;  3WQB A;  5C70 A;  5JXG A;  1EUU A;  4ARY A;  3P1I A;  4PF1 A;  1OD3 A;  4AAX A;  2X10 A;  2DDU A;  4XUQ A;  2QQO A;  4TXW A;  3I2F A;  1JI6 A;  1OF4 A;  4QB1 A;  1H6Y A;  3I2H A;  3PUI A;  1XNT A;  1K42 A;  2XHN A;  4DUW A;  4QB6 A;  4A3Z A;  2WAO A;  3T0A A;  3OEB A;  4XUN A;  1CX1 A;  2VZ3 A;  2XOM A;  3MO4 A;  2VCB A;  2B4K A;  1UXZ A;  2WN3 A;  4MGS A;  3UNP A;  2WZ8 A;  3K4A A;  1UWW A;  3A22 A;  2LW8 A;  2W5F A;  5DQ0 A;  3OG2 A;  2C26 A;  3MBW A;  2VZV A;  2DCK A;  2Y64 A;  2HYX A;  3VD4 A;  3SEE A;  3E1F 1;  3WF3 A;  3WSO A;  3FN9 A;  4A6O A;  2BZD A;  3VD3 A;  4Z2A A;  1GMM A;  4QDQ A;  4DXS A;  3IAP A;  1JYN A;  2VZO A;  3NJX A;  3CKH A;  1OH4 A;  2JE8 A;  4PT6 A;  4BJ0 A;  3CQO A;  2VZU A;  1GNY A;  1BHG A;  3C7G A;  3UET A;  3MUY 1;  2Y6L A;  5DPN A;  2W9X A;  3VDC A;  1CZT A;  2ORZ A;  3HNM A;  1NEX B;  4DUV A;  3OGL B;  3T2Q A;  3C6P B;  2Y6H A;  4A42 A;  1LNS A;  2L9L A;  3K75 B;  2ZEW A;  5EJZ B;  2E33 A;  2QQI A;  5IFP A;  4QDR A;  2VMF A;  3I2J A;  2Y6J A;  3ETP A;  3DYO A;  2VTF A;  2WN2 A;  4CU9 A;  1NKG A;  1KEX A;  3LEG A;  4A41 A;  3WF2 A;  1PX3 A;  2EID A;  2VZT A;  4XUP A;  3UES A;  3OGV A;  5JXH A;  2W95 A;  3P6B A;  2ORX A;  2OVR B;  3I3D A;  3WF1 A;  1F4A A;  2VR4 A;  2YFZ A;  1W9T A;  3LPF A;  1PMJ X;  1K12 A;  2VM9 A;  3WNM A;  2YC2 A;  4BXS V;  4JKL A;  2WBK A;  4JKM A;  2CDP A;  4OUE A;  4TTG A;  1R64 A;  2QQJ A;  3ACI A;  1H6X A;  2W1U A;  5JXJ A;  2J1E A;  2W1W A;  3BN6 A;  4UOJ A;  1UMI A;  3K4Z A;  3VD9 A;  2BER A;  4W4Z A;  3SEP A;  5LCW L;  3V7D B;  3WNN A;  2V4V A;  3K46 A;  3OGK B;  1DLC A;  1GOF A;  3T0D A;  2BGP A;  2JDA A;  1UY2 A;  1KGY A;  1P22 A;  2ZEX A;  5DMY A;  2VMC A;  3C8X A;  1YQ2 A;  3C7O A;  3OGS A;  1GUI A;  1UYX A;  2J1S A;  2W46 A;  1JZ3 A;  2P1Q B;  3T2O A;  1JZ7 A;  1FS1 A;  2J1A A;  2JD9 A;  4QX0 A;  1JZ5 A;  5IJR A;  3DEC A;  3C6O B;  1SG3 A;  3HPN A;  3PUH A;  5LA0 A;  2WO2 A;  4P5Y A;  3WF0 A;  2LS6 A;  2OKX A;  4GZ9 A;  5JMO A;  3NRU A;  3I3B A;  2WUH A;  1SDD B;  3L2O B;  3MV1 1;  4P08 A;  1XNA A;  4ZY9 A; 
#chains in the Genus database with same CATH topology
 2GSY A;  3DKQ A;  4RHV 2;  3N7L A;  1MZ6 A;  2EIE A;  4AI6 A;  2XLG A;  4OI1 A;  2Q8E A;  5FLH A;  1U5I A;  5BNP C;  1HJF A;  4YFW A;  2FZ2 A;  2EIC A;  4FAH A;  3I2I A;  4PI2 A;  3ACG A;  4EZH A;  1DYO A;  3GZU C;  4TLG A;  3WG2 A;  2D93 A;  1HIX A;  2RVA A;  1KDM A;  3WR0 A;  4OUS A;  2GZW A;  5JOY A;  4CTE A;  4XYX A;  3VDD C;  1V6I A;  2J1T A;  3ZYI B;  3TOJ A;  2UU8 A;  5FP3 A;  4RNG A;  2OZM A;  2BV4 A;  4KWU A;  5IK8 A;  3M8L A;  1OD5 A;  1EV1 2;  2PA7 A;  2B1E A;  3VV1 A;  3KD1 E;  2WSV A;  4HG6 B;  3OD0 A;  4QD2 A;  4JTN A;  4BPZ A;  2B45 X;  1G9C A;  4Q4V 1;  1K45 A;  3ZXJ A;  3S57 A;  4U36 A;  2ZML A;  2OUJ A;  4JQT A;  1SFY A;  1BBT 2;  1I6X A;  3BGA A;  1YQ6 A;  2GC3 A;  4DU4 A;  4UW3 A;  4M3X A;  3LIG A;  4DQA A;  3H8R A;  4COV A;  4ZZ8 A;  2DVA A;  3ACF A;  3I59 A;  1GNZ A;  5FO7 B;  4BWO A;  3ZIW A;  4YVS B;  3T08 A;  4DOU A;  1CZV A;  5AFB A;  4LUL A;  1BKZ A;  2JEN A;  4Q5O A;  1AVB A;  1GNH A;  2AAC A;  1QQP 1;  2XQR A;  1FXX A;  2H0V A;  4A7K A;  5I0D A;  1QOO A;  2GP5 A;  5FYT A;  1QDO A;  4LHS A;  2RS3 1;  1WCQ A;  2R1B A;  4H2A A;  2OYQ A;  1WMF A;  5ACA 3;  4UT5 A;  4GMP 3;  3WD5 A;  4D3W A;  5A7S A;  4RQP B;  2XLA A;  2IWG B;  1XB9 A;  4Z82 A;  2VJ5 A;  1O8P A;  2Z42 A;  1CIW A;  1IHM A;  1YI9 A;  1ZBA 3;  3JBG 2;  4YGE A;  3OUH A;  1W6N B;  5GZF A;  4URA A;  1VLN A;  3OF1 A;  4WVZ A;  4YZ2 A;  5CKN A;  1MS8 A;  1IZ3 A;  2W92 A;  4RYD A;  4FJN A;  1ENQ A;  2DFC A;  3TN9 3;  5CKM A;  4COU A;  5B4N A;  3FLP A;  4Y26 A;  2Y8K A;  2PN5 A;  3NKG A;  3PTY A;  4WM7 B;  5F37 A;  3NVC A;  3AM2 A;  4P00 B;  5LBE A;  3J27 A;  4UWD A;  2GN7 A;  4KNC A;  4ES8 A;  1QQP 3;  3VBS A;  1OSG A;  2DFB A;  1Z78 A;  5FMB A;  4DO0 A;  4DZG A;  4AFA A;  5K0U C;  2VZQ A;  1US3 A;  4AED B;  4CP0 A;  5FPX A;  3VBO A;  1QJZ A;  3KVB A;  2CGP A;  5HCB A;  3AZY A;  3NHG A;  2UYA A;  2E7A A;  1PO1 1;  2HYK A;  3VDB A;  1JH5 A;  1EAH 3;  4FTB A;  4CEY B;  2ZHM A;  4BDV B;  2C4X A;  1HV0 A;  4E8C A;  1OF3 A;  1QQP 2;  2ZBJ A;  2YB7 A;  1HRV 3;  3LCP A;  1UO9 A;  4Q0V A;  3LDR A;  1EP0 A;  4GB3 2;  4QXB A;  5I0U A;  4WM7 A;  5LBF A;  3ST7 A;  1UU5 A;  2QUO A;  3H50 A;  3RYP A;  4PJY A;  5FXX A;  3VBU A;  2W91 A;  5LB6 A;  1ASJ 2;  2OVQ B;  1ZZC A;  4MET A;  4E3S A;  3SMH A;  4X6Q B;  4Y22 B;  4Q1P A;  1ZBA 2;  1ZZ9 A;  3JBG 3;  2BYV E;  5DN2 A;  3VBO B;  2QNK A;  2K5S A;  4GWN A;  2WO3 A;  4GH4 A;  1A3K A;  3AC0 A;  4FJJ A;  2NM1 A;  1OH3 A;  3KQR A;  5JR7 B;  2P1M B;  4MHU A;  2WA3 A;  3WDY A;  1VRB A;  1FZ9 E;  1SLC A;  3O14 A;  1BZW A;  4R9A A;  4F83 A;  2WA4 A;  5C6C A;  3RZK A;  1H8T B;  4QM9 A;  4NAM A;  4CDU B;  3WG1 A;  1KFU L;  4COW A;  5IZ7 A;  4AEJ A;  3FJS A;  4JTO A;  1VRH 2;  2YU1 A;  4JDM A;  2BBA A;  4A7Y A;  5CG9 A;  4AGV A;  5FPZ A;  1UZV A;  1EPW A;  3MDP A;  2BP6 A;  1JOB A;  1LGN A;  3AXD A;  1HQL A;  3CEW A;  1YLL A;  1MS1 A;  3Q8C A;  3Q8A A;  3E5Q A;  2IXK A;  4GUL A;  1PMI A;  4LHN A;  4NE9 A;  4Y22 A;  4DRV A;  1DQ6 A;  1K5M B;  2WS9 1;  1LED A;  2OYZ A;  4CCC A;  1MQT B;  1V6N A;  4OHY A;  5IK4 A;  3VUO A;  1W2T A;  4ADO A;  2I74 A;  4QGN A;  4CPB D;  1NX9 A;  3TAB A;  1TME 1;  2V4A A;  5IVJ A;  2AEY A;  5A7O A;  2R32 A;  3NV3 A;  4QAW A;  4YW3 A;  4B29 A;  4N7I A;  4OYU A;  4CDX C;  4IGO A;  1RUH 2;  3GCX A;  3POS A;  2ARX A;  3OBA A;  3ON7 A;  1US2 A;  3POE A;  4Q26 A;  1NY7 1;  5F7U A;  4XIO A;  1TEI A;  4OVE A;  5L36 A;  4HN1 A;  3RMA A;  1NLS A;  4PDW A;  5F3G A;  1D2Q A;  3I4I A;  5FRE A;  5BY5 A;  4XMI A;  5LBB A;  4LJH A;  1VBD 2;  2BDR A;  3UKT A;  1VAM A;  1DHK B;  4EWD A;  2A70 A;  1MQT A;  2ZX3 A;  3SKJ E;  5LW9 A;  5FZ7 A;  4IT5 A;  2H6B A;  4V1P A;  5L7O A;  4LHK A;  3J26 N;  2C9K A;  1DGR A;  2VZ1 A;  1O5L A;  1SCS A;  3J2P A;  2R04 2;  4Y24 A;  1LGB A;  1ZRC A;  1JOD A;  1PIV 2;  1QJU 2;  2O14 A;  2R0F A;  2VQ0 A;  2XL9 A;  2QTW B;  4K20 A;  5FXW A;  5KXD A;  2RR1 1;  1HV1 A;  2ZGQ A;  2VPV A;  3LWC A;  4ISQ A;  5FYB A;  1WW6 A;  2OA2 A;  1KDK A;  2WLQ A;  1RJ7 A;  4MGY E;  3AZV A;  1UY0 A;  2JDY A;  2DUO A;  2E7T A;  1JUI A;  4YG6 A;  3TEZ A;  3OB8 A;  4MXV A;  2B46 X;  2B9U A;  4DRR A;  5IVV A;  2AEZ A;  2YFU A;  4RQP C;  1S0F A;  4FPF A;  3UO3 A;  3SPZ A;  1RIR A;  1XE7 A;  1LJ7 A;  2PQS A;  3GAL A;  1XSQ A;  2XBO 2;  4FOV A;  1UKR A;  3CF6 E;  3GXU A;  3WLU A;  2IXC A;  4LIV A;  3ZXF A;  4B4P A;  5HXM A;  3GHM A;  3JD7 3;  1N3O A;  2F17 A;  4KWL A;  4L99 A;  5DAV A;  1M06 G;  4RGA A;  3OPT A;  1FPN 1;  1W9F A;  2YPJ A;  1SBE A;  5LWB A;  1ENX A;  4K40 A;  2QQM A;  2D6P A;  3R05 A;  5CEH A;  5GLT A;  2ZOE B;  3ZO0 B;  3BTY A;  2D3R A;  4ASK A;  2RS5 3;  2C6S A;  3H42 B;  1DQ1 A;  5LEK A;  2GC0 A;  1OQE A;  2IXJ A;  4I0W B;  3RWK X;  1UIJ A;  5FPA A;  3MIE A;  4Q4W 2;  4V2W A;  1VBA 3;  4LO4 B;  3GDB A;  4ZXK A;  3OSD A;  4P9G A;  2V72 A;  3BUC A;  1WLC A;  3AP4 A;  2I2S A;  1RUJ 3;  2Y38 A;  4XBQ A;  4YPJ A;  4UFL A;  4BYY A;  1C28 A;  2VNV A;  2BNM A;  3PDQ A;  1RXF A;  3C94 A;  2VOT A;  2DVD A;  4XIK A;  1BVP 1;  4M3T A;  3VDA A;  1H2L A;  5CIR A;  4QDS A;  1G9B A;  4KH9 A;  2CDO A;  5BNP A;  1POV 0;  5JWP A;  1GP4 A;  1QJY 1;  1K5M A;  4Z8B A;  3I97 A;  4GWI A;  3KV9 A;  2FDJ A;  2XJV A;  3HIF A;  2VOW A;  5FIX A;  4QXK A;  3POI A;  1GAN A;  1QH6 A;  4H3W A;  4M3U A;  4Y5S A;  1UF2 C;  5LY1 A;  2LRP A;  1FAT A;  5KWR A;  1A6C A;  4KWJ A;  4CCL A;  1N3Q A;  5FDB A;  3LD8 A;  5FKC A;  1UY4 A;  1FYU A;  2B9V A;  2AZ5 A;  1FZI E;  2DY4 A;  1ULD A;  2WZR 1;  1W8T A;  2ZHN A;  4HKO A;  5JSO A;  4HK9 A;  3LZI A;  3U75 A;  1FZ4 E;  3W58 A;  1AR7 2;  4COY A;  2QDN A;  4GWM A;  1VBA 2;  4QX8 A;  4LE3 A;  4CE8 A;  4DEV A;  4JS4 A;  5T3N A;  1CWP A;  2LTN A;  2VW1 A;  4IE7 A;  2ZGP A;  2O8Q A;  5GLV A;  3TNP B;  4Z1V A;  3J7N A;  3VHP A;  4HVO A;  1AHS A;  2YPD A;  2D6N A;  4O65 A;  1LGC A;  1LCL A;  2Z69 A;  1JXN A;  3LGR A;  4MGI E;  1X36 A;  2D40 A;  3SUQ A;  2VTX J;  4MZU A;  2X09 A;  5A3M A;  1W8O A;  3GZE A;  5HV0 A;  1JMU B;  2UY8 A;  2VCC A;  4AHX A;  4X5N A;  4FK0 A;  1W0P A;  4C90 A;  3TAF A;  4AFB A;  3PIJ A;  1DG6 A;  1R1A 2;  3GZT B;  3SCG A;  1LOB A;  1MHY G;  3ECQ A;  2WQZ C;  2OII A;  5FK7 A;  3L8B A;  2PLV 1;  2VME A;  2BGO A;  4UF0 A;  4E2S A;  1TE1 B;  4MGK E;  4XF1 A;  3WQ1 A;  2FDI A;  1TMF 1;  5FXZ A;  2XQX A;  4CP2 A;  1HQW A;  1NE4 A;  4N43 A;  3PUA A;  1JZ6 A;  2O0O A;  5CIS A;  5EWS A;  4NWV A;  2E31 A;  3HL8 A;  4XDP A;  5CFC A;  2VE1 A;  3D0J A;  4JX0 A;  2RDR A;  3MKS B;  2QE3 A;  5JCT A;  1GR3 A;  2UUR A;  1R08 1;  2A6Z A;  1I3H A;  4RS5 C;  4KGQ A;  3WQB A;  1O3S A;  2BQP A;  4HK8 A;  3CNA A;  4LBM A;  2WNV C;  2MZW B;  5C8C B;  4AKG A;  2P3J A;  1Z0H A;  1RUC 1;  1S0C A;  2HWC 3;  1AYN 1;  2XBO 1;  3P1I A;  4YZ4 A;  3WW2 A;  4CP1 A;  2X10 A;  3SIT A;  2DDU A;  3TL8 B;  4FPJ A;  1XSR A;  3WY6 A;  3K3O A;  1IPJ A;  1CAU A;  5F2S A;  1WMD A;  2FDH A;  1CAW B;  2ZAA A;  4Z2W A;  5FZB A;  3MIF A;  3BU0 A;  3I2H A;  3PUI A;  5FZ8 A;  1Y4W A;  5FZ0 A;  1OPM A;  1OOP C;  4LOS A;  4FPO B;  4QPG A;  3L0M A;  2WAO A;  5CNA A;  5T5J A;  4XUN A;  4EJR A;  3I3M A;  1REF A;  3M3E A;  4KHU A;  4PQ9 A;  2VCB A;  1Z7S 2;  1C1F A;  3URF A;  1EAH 1;  1UXZ A;  1XQN A;  4ZPI A;  4OUL A;  4FSJ A;  1RUD 2;  3AYD A;  4N90 A;  2VMI A;  4X6R B;  1ALY A;  3H7Y A;  3K4A A;  3WP4 A;  1FZ3 E;  4KG8 A;  1KXG A;  3DEM A;  3N9Q A;  2HBU A;  1EYB A;  1AR6 3;  2C26 A;  5DAQ A;  2PAM A;  4XDO A;  2D6M A;  2VU9 A;  3HN1 A;  3MBW A;  5LA9 A;  2VZV A;  1AXK A;  3CFR A;  1W6Q A;  1S4C A;  4EZ4 A;  2V5Y A;  5JSP A;  4G4F A;  4GA9 A;  1E5H A;  4UBG A;  5JAX A;  4RFR B;  5FMO L;  2LRO A;  2HWE 2;  3WSO A;  3FN9 A;  5FQ0 B;  4OHV A;  1IG9 A;  2WJS A;  3B7M A;  2QZ2 A;  3VD3 A;  4Z2A A;  4DXS A;  4XJW A;  1BEV 1;  3QET A;  3IPV B;  4M0H A;  1JYN A;  5F5I A;  2ZA9 A;  4FFG A;  5C3Q A;  2P6H A;  4LT5 A;  2GNT A;  3GBG A;  2VZU A;  3SUN A;  1BHG A;  5FYY A;  2ET7 A;  1YWK A;  2ZZQ A;  1AR7 3;  3D82 A;  3MUY 1;  1AR6 1;  2BPA 2;  1JS9 A;  4LKF A;  3VDC A;  5JXJ A;  3DL3 A;  4Y1Z A;  4BM8 A;  1CON A;  5IW0 A;  3TEW A;  5F5A A;  4DTX A;  1AXY A;  3E97 A;  1G9A A;  4CXW A;  2K9Z A;  2WNV B;  2E7Q A;  2EVX A;  3IM0 A;  4A42 A;  4OQ8 A;  2ADE A;  1ZBE 3;  5ABJ B;  1VIW B;  4XQ4 A;  2L9L A;  3N7M A;  3PU8 A;  2VY0 A;  1VR3 A;  2HWE 3;  2QQI A;  4KHW A;  1U12 A;  2VMF A;  4QDR A;  5F5C A;  5FY1 A;  4AVC A;  4AEK A;  1NCQ B;  2CTV A;  3ETP A;  1SCR A;  3DYO A;  3IPV A;  4GB3 3;  4NAO A;  1AL2 2;  1B35 B;  2X53 S;  3UGH A;  3R0R A;  1KEX A;  4LBL A;  4XF9 A;  1X33 A;  4F3J A;  3CQ8 A;  2AEN A;  2LUW A;  3MEP A;  4MLO A;  4P9Y A;  2VZT A;  3NV4 A;  4PBO A;  1QNW A;  3UES A;  5JXH A;  1W6P B;  3BIE A;  2TBV A;  3VBF B;  5HCF A;  3WCS A;  2GC1 A;  3R4S A;  2ORX A;  2VBD A;  1MVE A;  2OVR B;  3KMH A;  3I3D A;  1RMU 2;  3SHR A;  2VBP A;  3THP A;  1PGL 2;  3KS7 A;  1R08 3;  5FZA A;  2EAA A;  2BJS A;  2VM9 A;  4CXY A;  3WNM A;  2WFF 1;  2BOJ A;  3WG3 A;  3ZYB A;  5C8W A;  1MEC 3;  1EY2 A;  4JRL A;  4JKL A;  5C8C C;  5A3O A;  2CDP A;  4IV1 C;  4LA3 A;  1LOA A;  3VBR C;  2RJL A;  2QQJ A;  3ACI A;  4HSL A;  3JZV A;  3O1M A;  1J1T A;  2J1E A;  4XFF A;  3MIB A;  4XAA A;  2BER A;  4LIT A;  4OI2 A;  1PVX A;  4MGZ E;  3VBF A;  3N9P A;  1OXC A;  2HWC 2;  5FZM A;  5A1L A;  3K46 A;  3HGK E;  3OGK B;  5DZE A;  3WCR A;  3WDW A;  3WT3 A;  3JBG 1;  1PZ8 A;  2XGX A;  2HWD 3;  3JD7 2;  3NJY A;  1GOF A;  4YSF A;  2C0Z A;  5LEJ A;  2MMB A;  3WDT A;  1OMI A;  4AXO A;  3AZW A;  1TMF 3;  1W03 A;  4AI8 A;  4ONU A;  1UY2 A;  2IFW A;  4NPL A;  3INA A;  2W08 A;  1MS3 A;  1AR8 1;  1G6N A;  2VMG A;  1UYP A;  3E5U A;  3LB9 A;  4ITC A;  3VKF C;  2J1S A;  2P17 A;  3MW2 A;  4K7J A;  4PLN A;  1KIT A;  4RS5 B;  1HKD A;  1UIK A;  4LLO A;  1WD3 A;  1VMJ A;  2P1Q B;  3HT1 A;  4HLT A;  5FZO B;  1FS1 A;  2XDV A;  5C9A A;  1CR7 A;  5FO9 B;  1W2N A;  2CY6 A;  4I9L A;  1ZZB A;  2K0G A;  4HOO A;  1AX1 A;  3S7I A;  2X8K A;  1G8W A;  1LOC A;  2HWC 1;  1R1A 3;  3LOB A;  3UK9 A;  5JOW A;  1EV1 3;  1VBC 3;  2EA7 A;  3PUH A;  1VP6 A;  5EFU A;  1DF0 A;  5FYI A;  5H9Q A;  3AFK A;  4NRM A;  4P5Y A;  3TAE A;  5D21 A;  3O1U A;  3LSD A;  2OKX A;  1WZX A;  1UCX A;  4GZ9 A;  1F2N A;  4FO9 A;  5I93 A;  4OFG A;  2R6Q A;  4ZU7 A;  1GQG A;  2WUH A;  3MV1 1;  2HWB 1;  3WP5 A;  4XFB A;  1H9W A;  2XHK A;  1XU3 E;  2VO5 A;  1IG3 A;  1XL3 C;  1NZC A;  2VXR A;  2D98 A;  2IVI B;  2XWB B;  2ZPX A;  3AL6 A;  3LAG A;  1CZS A;  2GH8 A;  4TLF A;  1V0A A;  3RRD A;  3KZ4 C;  4PF5 A;  3FHA A;  4FXG B;  1YQ8 A;  3PU3 A;  5ANN A;  4FPG A;  4EYU A;  4M3R A;  1AR9 1;  2VZP A;  1ND2 B;  4DY3 A;  2XJR A;  1H4H A;  2Y6F A;  3B02 A;  1YIP A;  4XXA A;  1I9R A;  3IB3 A;  4PQQ A;  4OQ9 A;  2G9F A;  4MAD A;  4Y1V A;  2RMU 1;  3D3A A;  2DUR A;  3M3Q A;  4DS0 A;  2GU9 A;  3AVR A;  4LTA A;  5A3N A;  3B01 A;  2GMM A;  3RYR A;  4XQD A;  1S0G A;  4KU7 A;  5JZG A;  3SNM A;  2FHR A;  4RN5 A;  4RA0 A;  4CU7 A;  5JPM B;  2ZGN A;  3GF6 A;  3WDU A;  1OQ1 A;  1RUF 3;  1CJP A;  1GWK A;  4A2U A;  4JAA A;  2BVV A;  3HR9 A;  4RL5 A;  3MLJ A;  1ZRE A;  3HP9 A;  5FRA A;  2XPJ A;  4YG0 A;  1OOP B;  1JBC A;  1ENS A;  3KGL A;  5JOX A;  4ATE A;  3N36 A;  3QEW A;  5FJH A;  1XU1 A;  1WUV A;  2R1D A;  1ULO A;  1HXS 3;  1OHF A;  1RUJ 2;  4ERO A;  5HBA A;  4NPR A;  4BA6 A;  3VBH B;  1FZH E;  4E2G A;  3WHU A;  1WW4 A;  1D7P M;  1OUR A;  3VDD A;  4CCN A;  4CCJ A;  1JZ4 A;  4YGC A;  3EYP A;  2QQP A;  4QHO A;  4ATF A;  2QQN A;  4QPY A;  3ZXD A;  2HWE 1;  2W3J A;  3SCH A;  1NCR B;  4KGG A;  1ASJ 3;  4AK3 A;  2JKB A;  4XXP A;  1AYM 3;  2DVF A;  4AI0 A;  1KQR A;  3ZX7 A;  3DUI A;  4MV2 A;  4MYE A;  4DNY A;  2Q8C A;  5IVY A;  2EF6 A;  2G9G A;  4DUX A;  2VCA A;  1DU3 D;  3APB A;  1IQD C;  1OLR A;  1AR8 3;  3U1X A;  3ALQ A;  3CIH A;  3EJK A;  1W6O B;  5LA2 A;  3FLR A;  1K3I A;  2BGC A;  3LF7 A;  2F4P A;  4W8J A;  3RMY A;  1FMD 1;  1YIF A;  3AX4 A;  4Y20 A;  2DTY A;  3ZFF B;  4FPH A;  2ZXQ A;  1A8M A;  1BK1 A;  4GH4 B;  5CA6 A;  5FPU A;  2ADD A;  2JD4 A;  1V6K A;  4CUA A;  3LDK A;  5CFD A;  4AHZ A;  2BNO A;  2UWB A;  3IMM A;  1REE A;  1OT5 A;  4LBJ A;  4R4Z A;  3T1L A;  5K7P A;  4M3Z A;  2DYC A;  4XF3 A;  4Y1X A;  2JDM A;  4FPY A;  2QQU A;  4BCU A;  3AXE A;  1QJU 3;  3NQH A;  4HVR A;  3H0O A;  2OS2 A;  4OZO A;  3NJV A;  1H8V A;  2WIN B;  2OQ7 A;  5L9R A;  3KB5 A;  3CL1 A;  4IEO A;  4BHP A;  2R06 2;  4UFM A;  3VGI A;  1RJ8 A;  3RVH A;  4HPK A;  3ILF A;  4DTS A;  3TN9 2;  5JOZ A;  4JKK A;  3O1S A;  3PUQ A;  1F5J A;  1YEW A;  2R7E B;  3O5S A;  4P9W A;  5D8A B;  1LR5 A;  1L7R A;  3LZZ A;  1ZZ6 A;  5FY7 A;  3VBO C;  4KU8 A;  3NJZ A;  5CFD B;  1NUK A;  2HLE A;  4QX3 A;  5JVV A;  2LF3 A;  1KS4 A;  4IEQ A;  1RUH 3;  2GND A;  2WII B;  3I2G A;  5DDJ 1;  2E51 A;  4M41 A;  1TG7 A;  5A7N A;  1UW8 A;  1VMH A;  5FZE A;  1POV 1;  1ZZ7 A;  3LEI A;  2RS5 1;  5A7W A;  3RQ0 A;  2VUD A;  4M01 A;  3BIW E;  5FCC A;  2PMW B;  4FK2 A;  4FXK B;  3PTR B;  3HBZ A;  2PHU A;  3A23 A;  3ZDS A;  3VZK A;  1AL0 G;  3OYW A;  2WQ8 A;  4AFD A;  4CCO A;  5IAX A;  1VBA 1;  2IVJ A;  3JU9 A;  1V9U 3;  2TUN A;  3HQR A;  1XVC E;  4W6W A;  3QEP A;  2E9Q A;  4QGM A;  3DPR C;  4AEM A;  3K77 A;  1N1C A;  4GWJ A;  4YRD A;  5FZC A;  5DUV A;  1XJA A;  3MUZ 1;  4H7M A;  4L9B A;  2VMH A;  4ZHN A;  1V6L A;  5F3E A;  1WW7 A;  2A5Z A;  3A0N A;  4FQZ A;  1K5J A;  4E4Z A;  3MGU A;  1X8M A;  3LE0 A;  3I7D A;  4UW5 A;  2ES3 A;  2ZGK A;  1PNF A;  3VBU B;  3WNK A;  3ABZ A;  1I5P A;  1PVC 3;  4AVT A;  4LXL A;  4D8M A;  4IV1 A;  4CUC A;  4QKF A;  3S0M A;  4I0B A;  4DY5 A;  1XOY A;  3MID A;  4HET A;  3S6P A;  1JYI A;  1RUC 2;  5IVE A;  3CO2 A;  1IH7 A;  4FVM A;  3Q8F A;  1DYP A;  5FZ4 A;  1VBB 2;  3PIG A;  4JGZ A;  3RMD A;  4YG3 A;  3ZXL A;  1ZBE 1;  2Y60 A;  3OBT A;  5C4W C;  1L3J A;  1RYY A;  5BPX A;  5JZG B;  2JEC A;  1YYN A;  3JXS A;  2IZW A;  4Y4Y A;  3N4M A;  2DCZ A;  5FAX A;  4YW1 A;  1RUG 2;  3S5Q A;  4FJX A;  2WT0 A;  1EUT A;  4Q4W 1;  1XVF E;  4N8M A;  3ZN6 A;  5I0R A;  1HRI 1;  1D4V B;  2HWF 1;  2ZGO A;  3HEI A;  3LQC A;  1HJG A;  3ZR5 A;  5LA1 A;  1XE0 A;  1S0E A;  2BVB A;  1F4H A;  3ILR A;  2CYF A;  3SI6 A;  4R8H A;  5DUW A;  5FY0 A;  1VBE 3;  2B8I A;  2PFT A;  2RHP A;  4ZS2 A;  1POQ A;  2H4T A;  2E53 A;  1D2S A;  3KM5 A;  4XTM A;  1WBF A;  2DU1 A;  1TQ5 A;  4QX7 A;  1V00 A;  4XFI A;  4URT A;  4H55 A;  2IFR A;  1RUG 1;  3OJB A;  1RB8 G;  3ZM8 A;  3UYJ A;  3JB8 A;  3HBK A;  3TEX A;  3POJ A;  4CDW C;  1NE6 A;  5L7O C;  2RJK A;  1F31 A;  3SPY A;  2ZZJ A;  5FYZ A;  1JYT A;  5E88 A;  1R1Z A;  2XH6 A;  4TSV A;  1FXZ A;  1SBF A;  1ULF A;  1ZM1 A;  3VKO A;  4ET7 A;  1FPN 2;  4A7Z A;  3AB0 A;  1O8S A;  4D6S A;  3LZJ A;  3MV0 1;  2HEW F;  1HX6 A;  4IEZ A;  4QMA A;  4M0N A;  4NJ4 A;  3T09 A;  1PZ7 A;  4XVH A;  3ZFE C;  2ZCW A;  5CB7 A;  5FZ9 A;  3ASI A;  1UY1 A;  1N3P A;  1HXS 2;  2CWS A;  1O4Z A;  5KXB A;  3GBF A;  3IAQ A;  1WLW A;  1VPH A;  1NXD 1;  3POG A;  4MH0 E;  3VHO A;  4BQX A;  4RQP A;  1W8W A;  4IL7 A;  1YC6 1;  5K8S A;  2WFP A;  2ARE A;  1PVC 2;  4GIQ A;  5J09 A;  1APN A;  3OGR A;  4LKD A;  1RVF 3;  5JZG C;  3FLT A;  4M3C E;  2KM2 A;  3M3I A;  4HPK B;  3T2P A;  5HXV A;  2R04 1;  2RCU A;  3CJI C;  4IE6 A;  3ZMO A;  4CRQ A;  5I8T A;  5KR7 A;  4XJ9 A;  1JZ8 A;  1W8N A;  4JV4 A;  4YM1 A;  3J4U H;  2H0B A;  4BK4 A;  4Q4X 2;  3LKJ A;  5FKB A;  1C8M 1;  1CLQ A;  2CV6 A;  2YC4 A;  2W52 A;  4Q0P A;  5D1I A;  4LBQ D;  4YVW A;  3SCF A;  4Y5Z 0;  4Q4Y 3;  4A45 A;  2KR2 A;  1NY7 2;  1VE0 A;  2FCV A;  3SQ2 A;  1RUE 3;  5KHH A;  1JYW A;  1CAU B;  1S55 A;  4CXX A;  5BNO C;  1UY3 A;  3ZSJ A;  2IUW A;  3LEK A;  2OXB A;  3LSE A;  2Q0A A;  1MHZ G;  4IES A;  3WW3 A;  2JB8 A;  4A4A A;  5E1R A;  5A80 A;  3LFM A;  4M45 A;  3ZYJ B;  1TME 2;  1MS5 A;  5FMD A;  5T5L A;  3W9A A;  5LAS A;  2V5D A;  3CJI B;  3LA2 A;  3HNB M;  1LHU A;  1H1A A;  2Q1M A;  3P3N A;  3RS6 A;  1URX A;  4CUB A;  5C71 A;  4QX2 A;  2DCT A;  4DXZ A;  4W65 A;  1J59 A;  3VBS B;  4H7L A;  4NPM A;  2JWP A;  2WAB A;  2WZE A;  1ND3 B;  2BRT A;  1LES A;  4JDO A;  3EBR A;  2A1X A;  5FZD A;  4BLJ A;  3USS A;  1FAY A;  3FL7 A;  5CFD C;  2XLF A;  4EN7 B;  3HQU A;  3WW1 A;  1CES A;  3AYA A;  1DQ2 A;  5J36 A;  3RG0 A;  4IDZ A;  4I3P A;  4EE2 A;  2ZAB A;  5A6Y A;  1QKQ A;  4CPB A;  4ZXE A;  5LAT A;  2NQY A;  3FUQ A;  4BU2 A;  1BJQ A;  4GB3 1;  5KC5 A;  3N1E A;  1VBD 1;  1XRU A;  5EYX A;  1H30 A;  2BBV A;  3NNF A;  1JU4 A;  4AKI A;  1AR8 2;  3RFR A;  4AW7 A;  5L7O B;  4YGB A;  1ACC A;  2PHT A;  3AMP A;  5F39 A;  3KHC A;  1ZBA 1;  5IUQ A;  2N7G A;  2DBN A;  4FFI A;  3S9H A;  4ARY A;  1GZ9 A;  3LOI A;  5ACA 1;  4CEW C;  1LEN A;  4XAB A;  4GMP 1;  4D69 A;  2CAV A;  1LB2 A;  4TXW A;  2WT1 A;  1QIQ A;  3VZL A;  2ZGS A;  2E6V A;  1JI6 A;  1YQC A;  3EHK A;  5FR3 A;  1OF4 A;  1XBF A;  1O91 A;  1H6Y A;  2BU9 A;  3SH5 A;  5FMO S;  1OA4 A;  1STM A;  1XNT A;  1K42 A;  4DUW A;  1FI2 A;  2HWB 3;  2WS9 2;  4QB6 A;  3QD6 A;  5LK7 B;  2RG4 A;  4BQ4 A;  4E27 A;  2DUQ A;  1RHI 3;  4FP2 A;  4LA2 A;  1CX1 A;  5I0S A;  5CFC C;  1ODN A;  1Q8P A;  1VB4 A;  2Q8D A;  3H3L A;  3JB4 C;  2WN3 A;  1DBN A;  2MEV 1;  3NV1 A;  5A7P A;  1SLA A;  3ZPY A;  2EIG A;  4QKN A;  3SQ4 A;  5GZC A;  3OG2 A;  4YZ1 A;  2ZGR A;  2X5I C;  1GBG A;  5F6L B;  1Q5O A;  5H9S A;  1OA3 A;  4FFH A;  4AI9 A;  2Y64 A;  1OBN A;  3VB9 A;  3ELN A;  1LEC A;  3E4W A;  1AR9 2;  4QPI B;  3BVO A;  2VW0 A;  3AK0 A;  3DPR A;  4JGY A;  2WKK A;  2BZD A;  3LA7 A;  3WOG A;  2JH8 A;  2BOI A;  3AKR A;  3BB6 A;  2MPF A;  3TWI A;  3IAP A;  1UL9 A;  4C1X A;  3NJX A;  2RS1 2;  3UL2 A;  3CKH A;  1OH4 A;  4QPG C;  5FMC A;  3IWZ A;  4NIA A;  1BQP A;  4Q4V 2;  3CQO A;  2MEV 2;  5D2A A;  3AVS A;  4KHS A;  2NYY A;  1PM7 A;  1AUY A;  3C7G A;  2DUP A;  3D4K A;  1O3T A;  4Z92 B;  2KA3 A;  1JTZ X;  2OX0 A;  5T5O A;  4JRQ A;  3ZSL A;  3OGJ A;  2ORZ A;  3KF5 A;  2DCY A;  3RI9 A;  1H4G A;  3QCW A;  2J42 A;  1WGP A;  1LOD A;  2PQQ A;  3T2Q A;  2OVU A;  4QPI A;  1XMF E;  2ZEW A;  3ITQ A;  1PO1 2;  4GAZ A;  4JGZ C;  1BEV 2;  4UW6 A;  4OLL A;  4EQV A;  2B8M A;  1LHO A;  1VBC 2;  3I3Q A;  5C4W A;  5AVP A;  1NKG A;  1S1A A;  1W6Q B;  2VVF A;  1PX3 A;  2EID A;  4N9H A;  4B1M A;  2JPN A;  3QES A;  1CPN A;  4OZX A;  4CYD A;  4QM8 A;  1H2K A;  1AR6 2;  4GKX A;  3PVB B;  5GAL A;  3PL0 A;  1SBD A;  5GJ6 A;  5IK5 A;  4AI1 A;  1W8F A;  3THT A;  2K46 A;  1C5H A;  3IMN A;  3LDB A;  1YHF A;  2VR4 A;  2YFZ A;  2JG8 C;  2P4E A;  3LPF A;  3R4U A;  1ZRI A;  4JCK A;  4XTP A;  4C91 A;  2WYF A;  1C4R A;  2Y0I A;  2ZMK A;  3CU7 A;  2YC2 A;  2A73 B;  3JD7 1;  3KV4 A;  4WZC A;  4DIN B;  2DU0 A;  3ATG A;  2RDQ A;  4DTJ A;  1ONA A;  1Y9G A;  4HFS A;  5EXO A;  4JKM A;  4AHW A;  5AFE A;  2P5B A;  3Q9O A;  1QJF A;  1HW5 A;  1QU0 A;  2P3Y A;  2WO7 A;  2JXA A;  2W0X A;  2W1U A;  3N9N A;  3J9S A;  3RWU A;  1UMI A;  3N1B A;  2AGS A;  2CAU A;  4HSJ A;  5JSR A;  3SEP A;  5ABJ A;  1O3Q A;  2VUL A;  1Q8V A;  2BWC A;  1O4T A;  1RUN A;  1L7L A;  1O3R A;  3EXU A;  1Q8S A;  1AYN 2;  4XIL A;  1UD1 A;  1CAV A;  3T0D A;  5J37 A;  5FP4 A;  2YHJ A;  1YJL A;  1SQ4 A;  3BOP A;  2JDA A;  1UOF A;  4DIQ A;  4EPH A;  1S2E A;  4FK4 A;  1YFX A;  4ZU4 A;  4P9L A;  5DMY A;  3OOX A;  1ST8 A;  2DBI A;  2VMC A;  3K2O A;  1OVS A;  2G19 A;  4YW6 A;  3SH3 A;  2FBE A;  1GUI A;  1UYX A;  1V70 A;  2W46 A;  3ES4 A;  3VHN A;  5C8C A;  1CQ9 A;  4XBL A;  1Q43 A;  2MHF A;  2OW4 A;  4I0A A;  3TRS B;  5DAB A;  1GZW B;  3AL5 A;  3T2O A;  2FDG A;  1JZ7 A;  4MSV A;  3SQ0 A;  4QHB A;  4KL1 A;  5AC9 1;  1YO8 A;  2YV8 A;  1PM4 A;  5BYN A;  1C8M 2;  5E8A A;  4YVW C;  5EV7 A;  2Q5T A;  1JZ5 A;  1HLC A;  1X50 A;  2Z5W A;  1FMD 3;  1UZZ A;  3C6O B;  3RJR A;  3HPN A;  5KHG A;  3T3Y A;  4DTN A;  3ZXE A;  4FJH A;  1S0I A;  4RHV 1;  1BEV 3;  3SC7 X;  1PO1 3;  1SPP A;  1X82 A;  3NNM A;  3CJI A;  4NHX A;  2LS6 A;  4X8P A;  1ENR A;  2JDK A;  1ZVF A;  3QOP A;  2D6L X;  5JMO A;  4FJK A;  1DDL A;  3W59 A;  2YB5 A;  3L2O B;  1SDD B;  2EXK A;  3VKM A;  4P08 A;  2RDS A;  4CCK A;  3N7J A;  1G9D A;  4BK5 A;  4XUR A;  1UYY A;  3FUO A;  1XMG E;  3SKV A;  1GZW A;  3NKT A;  3NNG A;  5C3O A;  3WP6 A;  4ZS3 A;  4KBB A;  2AYH A;  4V2V A;  3WUC A;  1LOG A;  5JPN B;  3C7E A;  4NR1 A;  4AL9 A;  5T52 A;  4Q4V 3;  2AH2 A;  1UZW A;  3RMB A;  2FMY A;  1SZB A;  3H7J A;  4B4R A;  4D6R A;  5HV4 A;  1RTV A;  1PHM A;  3WIN E;  2QXF A;  3HGL A;  1FOD 1;  4NHM A;  3H1W A;  5FPB A;  1SLI A;  4I02 A;  3DKW A;  3I2K A;  5EHD A;  5A70 A;  4FJ9 A;  3IBM A;  4IGQ A;  1O7F A;  1GP6 A;  2VMD A;  4FPC A;  4AZZ A;  2VQT A;  4IEW A;  4PLM A;  1SHW B;  4OMC A;  3HT2 A;  2IC1 A;  4QXC A;  2UWA A;  4FPL A;  4XC9 A;  3JQX A;  1HXS 1;  5HCA A;  5EP9 A;  4QPG B;  5BNQ A;  3DCQ A;  4WM8 B;  2J22 A;  1AR7 1;  3IKW A;  2BFU L;  3U14 A;  5JR2 A;  2RM2 2;  4Q4Y 1;  3RMC A;  3RZH A;  5CFC B;  4YZ3 A;  3RSJ A;  1SLB A;  5L9V A;  1I5Z A;  4KI5 M;  1R09 2;  3SH4 A;  4FJ7 A;  5IYY A;  1CIY A;  3K48 A;  3O1V A;  1Y43 B;  4NHK A;  3KWV A;  4FPE A;  4BIO A;  4C0H A;  4YAR A;  1FOD 3;  1CAX A;  4L8Q A;  1GQP A;  2YG0 A;  4NN0 A;  2WS9 3;  4OI4 A;  2JIC A;  2ID4 A;  4FJG A;  1AYN 3;  1ULP A;  2WNU C;  4J2D A;  1JZ2 A;  1DGR N;  4HMZ A;  5CG8 A;  2JDZ A;  5C4W B;  4EWE A;  3LEM A;  1XE8 A;  1PX4 A;  1DGL A;  2VTX A;  2QFE A;  1MTY G;  1XVB E;  2ZX1 A;  3AP5 A;  1TNR A;  3NNJ A;  3RWN A;  3ROU A;  2RS5 2;  1UXX X;  3USU A;  5KXC A;  3C7H A;  4XEZ A;  4BH9 A;  4O61 A;  3III A;  3O12 A;  5K0U A;  5J96 B;  5FYV A;  4A44 A;  2PLV 3;  1OC1 A;  5FYC A;  4PLO A;  4HCB A;  3FWE A;  4MOA A;  1RUI 3;  5F3I A;  3VN4 A;  3SQ1 A;  2B39 A;  4AVA A;  1H2N A;  3VL9 A;  2CHH A;  5FY8 A;  2VAU A;  3K3N A;  3POB A;  3WNL A;  1UX7 A;  1HRI 2;  2HWF 2;  5M0T A;  2JH9 A;  1D4M 3;  1NQJ A;  3TN9 1;  1DQ5 A;  4DFS A;  4AI2 A;  4IEX A;  2ZHK A;  3B5L B;  4IQP A;  4AED C;  4DXT A;  5BUV A;  2WWU A;  2VVE A;  2WDB A;  3PNA A;  3ZFF C;  3R6S A;  5A7Q A;  3ZLI A;  2ZX0 A;  3H1M A;  4FI9 A;  1C5I A;  2ILM A;  3KV6 A;  4LOR A;  2KD7 A;  4CU6 A;  3NGI A;  4J1X A;  5BNN B;  2W87 A;  2A6W A;  2P2K A;  1WAJ A;  3OUI A;  4ICG C;  3KD5 E;  1JU3 A;  2R04 3;  4I30 A;  4QHZ A;  4BQ1 A;  5C5U A;  2VXJ A;  4Y33 A;  1W28 A;  2HWD 1;  2Q4S A;  1FT9 A;  1R09 1;  3FHI B;  1PIV 1;  1XC6 A;  2VG9 A;  1LDK E;  4SLI A;  5APA A;  4XFA A;  3RDI A;  5F1R A;  3G7D A;  2RM2 1;  4XBN A;  2C5D A;  2W47 A;  3IN9 A;  3THC A;  1NZI A;  3OY8 A;  5JXI A;  1WMX A;  4IE5 A;  4D7S A;  3QNO A;  3KGZ A;  3GJA A;  5G05 L;  3M3O A;  1LKN A;  3VBU C;  1JN2 P;  4NIH A;  4C1W A;  1G86 A;  1RHI 1;  2JJ6 A;  4M4R A;  1YJK A;  3ZVX A;  4D0Q A;  5IHR A;  3AMM A;  2WT2 A;  5A1A A;  2NP0 A;  4PIY A;  3ACL A;  1W6M B;  3WQ7 A;  1FOD 2;  1WW5 A;  2MEV 3;  1BVV A;  1QJU 1;  2WSU A;  1H1M A;  3NDK A;  4Q4Y 2;  3KT4 A;  2E63 A;  3D6E A;  1MR5 A;  2WAA A;  3F2Z A;  4CDU C;  2A3Y A;  2PYT A;  3PMS A;  1AX0 A;  2P3K A;  2RM2 3;  3DN7 A;  1GYK A;  4Q1R A;  3BYW A;  4TWT A;  1B09 A;  5FOJ B;  3KT1 A;  3PUR A;  5IAT A;  1DQ0 A;  3H3Z A;  4JGZ B;  2QQL A;  5EQU A;  2XKP A;  3ZSK A;  1PNG A;  1ZRR A;  2PAE A;  4HT1 T;  4QKB A;  3RZM A;  1GOG A;  1N1T A;  1FZ5 E;  1H2M A;  2ARC A;  4L11 A;  2Y6G A;  4Y3O A;  2VC9 A;  1UMZ A;  4BME A;  4UFK A;  1Q3E A;  4CDQ B;  2SBA A;  1RVF 2;  4CDX A;  4Y4R A;  4C8D A;  4RFT 0;  1YUD A;  4R9C A;  3E6B A;  4IV3 B;  3G6J B;  1LUL A;  3UV9 A;  3S30 A;  3ZSM A;  4UAP A;  1WKY A;  4PDW C;  1RUO A;  4XJZ A;  1X9T A;  4M3C B;  1I1E A;  4FJI A;  1FZ0 E;  1VAV A;  2D3S A;  2RMU 2;  2PXJ A;  1Q9Y A;  4GAL A;  4ZU5 A;  3WQ0 A;  3KCX A;  2YZ4 A;  5JDB A;  2E32 A;  4AFM A;  1XVD E;  2Y6K A;  3H3U A;  3POW A;  4CEY C;  5A6X A;  2HBT A;  2WO1 A;  4XHB A;  4BIF A;  4LHL A;  5KXE A;  1J83 A;  3ILN A;  5E89 A;  1RUE 1;  4BQ2 A;  4XAE A;  1CN1 A;  2VJX A;  4M3Y A;  2JE7 A;  1WCD J;  1UU4 A;  3A21 A;  2RS1 1;  1W9W A;  2ZGT A;  5FP7 A;  4AFC A;  5C9A B;  3OD4 A;  4U2A A;  3BU7 A;  5FZ6 A;  1FMD 2;  1FZ2 E;  4FBF A;  2VUJ A;  3EB7 A;  5FXV A;  2VL4 A;  3O0W A;  1CJD A;  3MIH A;  5SV8 A;  3E6C C;  3WHT A;  1HRV 1;  3KQ4 B;  1B35 A;  1NAE A;  2DV9 A;  3PVO A;  2WYS A;  4YNI A;  4DPN A;  1W2A X;  2VQA A;  5I91 A;  3ZYG A;  4IGP A;  5ISL A;  1T2X A;  4L97 A;  1T6B X;  1UOB A;  1YQ5 A;  2NMN A;  2NLR A;  3RPQ A;  1UKG A;  4E4S A;  5BNO B;  5DG1 A;  4GD4 A;  1H1I A;  2YDE A;  4WZF A;  4AVV A;  1WCS A;  3CZU A;  3UKN A;  4AGR A;  4WBB A;  1GU3 A;  1TNF A;  1NQD A;  2EAK A;  1S2K A;  4HL0 A;  1UQX A;  3NO8 A;  3NST A;  2YY1 A;  4Q2F A;  2HEY F;  3VD7 A;  3WDX A;  1QOT A;  3TB0 A;  4EN6 B;  3ME2 A;  1LU2 A;  1RUJ 1;  4FT8 A;  2LM3 A;  4LQR A;  5FZG A;  4P9X A;  5D8A A;  3GCW A;  3J8F 3;  4KMQ A;  3N9O A;  4P9J A;  4LOT A;  1VBD 3;  3O1T A;  2R16 A;  3CDZ B;  5J1X A;  3O1R A;  1COV 2;  3I3E A;  4IUG A;  3WF4 A;  5FY4 A;  2DCJ A;  4CVU A;  2KXL A;  1NLQ A;  4D6Q A;  4OCT A;  3DYM A;  2FCT A;  3MYX A;  2IXH A;  5DDJ 3;  2HD0 A;  3U10 A;  4RGK A;  5ACA 2;  3C3V A;  1LTE A;  4IEP A;  4BB3 A;  5CZK A;  4YM3 A;  1W99 A;  2VNO A;  3FFQ A;  4QU2 A;  4E2Q A;  1UYZ A;  1VRH 1;  2JG8 B;  5FBJ A;  5GLU A;  4YW2 A;  5GZG A;  4UXA A;  2F4L A;  3WNP A;  2O1Q A;  1PZ9 A;  2JG9 B;  5LZ6 A;  1IS5 A;  2FCU A;  1W3X A;  1LOE A;  1O59 A;  4E4H A;  3A7Q A;  2BEO A;  4I2O A;  3PJQ A;  2XJQ A;  2W68 A;  3T4H B;  3U07 A;  3ZOI A;  1IPK A;  1HN0 A;  2EAL A;  1NCR A;  5JI9 A;  1L7Q A;  4X8N A;  3IZO A;  4J2E A;  3BOD A;  3NAP B;  4K8F A;  2K2S A;  5FPV A;  1XYO A;  3HVD A;  1N1Y A;  1QNY A;  4Z07 A;  5EZW A;  3U11 A;  3MLL A;  3SJJ A;  4J6G A;  4QX1 A;  4O9E A;  4NIG A;  5FY5 A;  3ZYR A;  1JUH A;  1OQD A;  1RUF 1;  3OPW A;  2AC1 A;  1UMH A;  4NUB A;  3NE6 A;  5EJ3 A;  1YFY A;  5F8P A;  1RMU 1;  3I59 B;  3U4X A;  4OHZ A;  1V9U 2;  3MFC A;  4GQ7 A;  1BYH A;  2RKH A;  2QDR A;  2ZGU A;  4IEU A;  4OHW A;  2Q1Z B;  3W20 A;  3WEZ A;  3U0Z A;  2ENR A;  5FYH A;  4XJ8 A;  1V6O A;  2WC2 A;  5T5P A;  2WNU A;  1IKP A;  3HJR A;  4FPK A;  3POY A;  3ZXG A;  3RZJ A;  4NMI A;  2P1N B;  2J7M A;  3AZZ A;  3C6N B;  4LPL A;  1HDK A;  3M70 A;  3VL8 A;  3F95 A;  3VLB B;  4WVM A;  2VZR A;  1WWY A;  5H9P A;  2R07 1;  1MZE A;  2NZ9 A;  3O1P A;  1OVP A;  1W6N A;  5FZI A;  1UAI A;  4D7Y A;  4L0P A;  2P1P B;  3C7F A;  1ASJ 1;  1COV 3;  2JDN A;  2RV9 A;  4QPW A;  1HQN A;  3KLS A;  2R0H A;  3J8F 2;  1QOS A;  5KBF A;  2OVP B;  3ZDV A;  5IK7 A;  1MVQ A;  4J2B A;  1W9S A;  3KF3 A;  1F5F A;  5CKQ A;  2R06 3;  1Q8O A;  1RIT A;  1FZ6 E;  3CMG A;  3ZN6 B;  1J3R A;  2VD7 A;  1CD3 G;  2JHP A;  1DQ4 A;  3J7H A;  3M4F A;  4IE0 A;  4MGQ A;  2ZHL A;  3FMG A;  4JDN A;  4J1W A;  1UNB A;  2CNA A;  4NHY A;  4CDQ C;  1JW6 A;  2IXI A;  4R4X A;  5A3L A;  4RL7 A;  3B93 A;  4N43 C;  2W94 A;  2FMD A;  3BPS A;  3TBD A;  4AED A;  3M1H A;  4CSW A;  3ZFF A;  1FZ1 E;  1NG0 A;  1W8U A;  1ZYB A;  2J1R A;  3WUD A;  3ZKY A;  4ASL A;  4RD7 A;  3BKZ A;  4UW4 A;  4K9S A;  3B9I A;  1UN1 A;  1QXP A;  1W05 A;  4XUO A;  1H8T A;  3GM8 A;  1J84 A;  1CX4 A;  3ZSE A;  3MHZ A;  5BNO A;  2VW2 A;  2EIB A;  2MW2 A;  1WA6 X;  2VQU A;  3D0S A;  4LLF A;  5FLJ A;  2YU2 A;  3K4D A;  3C2U A;  2C9A A;  2ERF A;  2VBB A;  2WQ4 A;  4HN0 A;  3N3H A;  5FYM A;  4XET A;  4MX3 A;  2GNM A;  1H9P A;  1IKQ A;  4B3N A;  3J7M A;  5JXG A;  4RSU A;  1GKB A;  3ZKU A;  1EUU A;  4YM2 A;  1SMV A;  3ZXA C;  1AYM 2;  1JHN A;  3OBR A;  3QBQ A;  2WFF 2;  2XJS A;  1NA1 B;  4PF1 A;  1BBT 1;  2RE9 A;  4CCM A;  2Q8O A;  3ZN4 A;  3VDD B;  4AAX A;  3MLK A;  3WVJ A;  3VZM A;  5B2G B;  5J7M A;  3O7O A;  4FJ8 A;  2O8O A;  2QQO A;  4XUQ A;  3T30 A;  1TZO A;  1RC6 A;  2P5O A;  2P6C A;  3I2F A;  4AR2 A;  5FOB B;  5KHK A;  1H0B A;  4S2D A;  1EV1 1;  4PCR A;  1OLM E;  5ERL A;  4XZP A;  4LBQ A;  4CDU A;  1MS0 A;  1RUC 3;  4A3Z A;  1XXN A;  3OEB A;  2VZ3 A;  2XOM A;  1J58 A;  5FJK A;  5C7G A;  4JHT A;  1ZRD A;  2YBS A;  4OHX A;  4W6X A;  4PDW B;  1OA2 A;  3AMN A;  2D6K A;  4MGS A;  4HCC A;  3UNP A;  3I2D A;  2WZ8 A;  3PVE A;  1OOP A;  4C0B A;  1RUF 2;  3A22 A;  1XVE E;  2LW8 A;  2W5F A;  1NYW A;  5BXX A;  3CFP A;  2YBK A;  3RNS A;  1AF9 A;  1MZ5 A;  1ZA7 A;  1SEF A;  1VAL A;  3POF A;  4CEW A;  4LUM A;  5I0T A;  1KJL A;  2B5H A;  3E1F 1;  1HB2 A;  4JC1 A;  4YGD A;  3UKV A;  5K9Y A;  4DMI A;  2ZX2 A;  3H9A A;  4A6O A;  4FJM A;  1NCQ C;  1GMM A;  1U5Y A;  5SV5 A;  4Q4X 1;  2JG9 A;  2VZO A;  3KHB A;  4YW4 A;  1WLT A;  2JE8 A;  4BJ0 A;  2OZJ A;  5KHI A;  1RUD 1;  4BXF A;  4CEY A;  3N9M A;  4IV3 C;  5A3W A;  3BAL A;  4ZON A;  5FWJ A;  1GNY A;  1RVF 1;  1J1L A;  1R1A 1;  1RIN A;  3T2T A;  3UET A;  1WA4 A;  2HKX A;  2Y6L A;  1COV 1;  5DPN A;  1POV 3;  4RHV 3;  5E6H A;  1XYP A;  1CZT A;  2ZX4 A;  1PGW 1;  3S5A A;  3HNM A;  2VOK A;  1NEX B;  1GLH A;  2D7F A;  2GMP A;  1QHD A;  4Y20 B;  3OPZ A;  3CLP A;  4DUV A;  3OGL B;  3C6P B;  2Y6H A;  3GBW A;  5HCH A;  1LNS A;  4LR4 A;  2Q1F A;  5H9R A;  3QEV A;  1PK6 C;  4R9B A;  2DVG A;  2E33 A;  5EJZ B;  1B35 C;  2PFW A;  1FV3 A;  1GSL A;  2Q30 A;  1LHN A;  3I2J A;  4XFG A;  4E9K A;  4Q4X 3;  1OLQ A;  2Y6J A;  4WV8 A;  2VTF A;  2WN2 A;  4JGY C;  3BTA A;  3VZJ A;  4CU9 A;  3WNX A;  3T4V A;  1AJK A;  4LBN A;  3CJX A;  3LEG A;  4I3G A;  4XDQ A;  3WF2 A;  4A41 A;  2VOV A;  3NW4 A;  5GLW A;  4F7Z A;  5F32 A;  4D7T A;  3OGV A;  1GZC A;  4JRP A;  3B94 A;  1PO2 2;  3P6B A;  1XYN A;  4WVM B;  4AOC A;  4GKY A;  4P5H A;  2XJP A;  4QXH A;  1F4A A;  3VBR A;  3P3P A;  1D4M 2;  1JYC A;  4LO6 B;  2VOX A;  2WWJ A;  1PMJ X;  1K12 A;  4QT6 A;  1W06 A;  4XCA A;  1GFF 2;  1TMF 2;  3ES1 A;  5H37 A;  4XPV A;  4BXS V;  1FX5 A;  1ND2 C;  1ZA4 A;  2YXS A;  4G3Y C;  4AYU A;  1SDW A;  3H8O A;  1F35 A;  2HWD 2;  4TZD A;  2XUE A;  2PLV 2;  1R64 A;  3PLQ A;  4FP3 A;  4N7U A;  5DDJ 2;  4UFJ A;  2XXZ A;  5T55 A;  1H6X A;  2V09 A;  4NOT A;  1FPN 3;  2Z79 A;  3VD9 A;  2JHC A;  1EPZ A;  1W39 A;  2XJT A;  4LEJ A;  4B1L A;  4W4Z A;  2FD8 A;  4BZ4 A;  4IW3 A;  4WM8 C;  2BWA A;  5LCW L;  3SUO A;  2WFF 3;  5K4L A;  5L19 A;  1MEC 1;  2YBP A;  1ZNP A;  1Y9M A;  1DLC A;  2NN8 A;  3LFI A;  3HD8 B;  3H8U A;  4XJU A;  4NRP A;  5D8A C;  1DFQ A;  1W9Y A;  1IS3 A;  1QJX 2;  4B7E A;  1KD7 A;  4PIX A;  2BGP A;  2AUY A;  1MEC 2;  3AKP A;  4FOW A;  5A33 B;  3O0V A;  3WDV A;  3GZA A;  3T1M A;  1SFN A;  3VBF C;  5AC9 3;  3FC0 A;  3P5B A;  1KGY A;  2VNR A;  2ZEX A;  2XML A;  2ZMN A;  4GXL A;  3VZN A;  4LUK A;  1YQ2 A;  2YMZ A;  3OGS A;  2G1M A;  2QZ3 A;  2ZAH A;  4WVV A;  4MVT A;  2GP3 A;  3N35 A;  3SCX A;  4IET A;  4KI6 A;  3QNN A;  1NA1 A;  3KCC A;  3L1N A;  3DXU A;  4IEV A;  1SFP A;  3WZ1 A;  1PK6 B;  2VUA A;  1A78 A;  3NAP C;  4J2A A;  1CAX B;  5J48 A;  3R4D B;  2Y26 A;  4QX0 A;  4E8D A;  1VB2 A;  2HEV F;  5CVR A;  2X29 A;  1UU6 A;  1ULG A;  1NCR C;  4DB5 A;  4EV0 A;  1UPI A;  2MNG A;  4GMP 0;  3E4Y A;  5ABJ C;  1KS5 A;  3DEC A;  1SG3 A;  2I45 A;  3AMQ A;  1CPM A;  2WR9 A;  4GJZ A;  5C9A C;  3WF0 A;  4LO7 A;  1OI6 A;  3ENR A;  4PIZ A;  2JQT A;  1ZBE 2;  4G9S B;  2EXH A;  5LK5 A;  2WZR 2;  3WW4 A;  4KHY A;  1QXR A;  4XCB A;  2A7A A;  4N43 B;  4LBK A;  1QGL A;  3CHX A;  4AAP A;  5K0U B;  3AP9 A;  1XNA A;  2VIX A;  1ND3 A;  1MMO G;  1MZF A;  3H1Y A;  1W2O A;  4ZY9 A;  3QAC A;  5LBC A;  2JEM A;  3ACH A;  5A6Z A;  1QH7 A;  1X7N A;  5FUI A;  2DWR A;  4YFZ A;  3B00 A;  3VZO A;  3FBY A;  1MAC A;  3NCI A;  4AVS A;  5KC6 A;  1DIW A;  2XUM A;  1IS6 A;  3PJY A;  4QQL A;  4DXR A;  2W1S A;  3E5X A;  4ARX A;  1OUX A;  3DXT A;  1XNC A;  3BTX A;  1W3V A;  2P1O B;  2D44 A;  3VBH C;  3I49 A;  1JW2 A;  2QQK A;  2Y33 A;  2JKX A;  4RR3 B;  1RUH 1;  2ZTN A;  2FDK A;  5FZ1 A;  1NOV A;  4LO5 B;  1C8M 3;  4S2F A;  5BV6 A;  4IE4 A;  3HWJ A;  4BQW A;  4ORF A;  1U5X A;  4FTE A;  4XJA A;  5C33 A;  1HN1 A;  5IT6 A;  3V56 A;  3TJY A;  2YGM A;  1SPP B;  1BXH A;  4KWK A;  4N53 C;  5DUU A;  5IWF A;  2FZ1 A;  3MIC A;  1RUD 3;  2FQP A;  1E5R A;  5EJ1 B;  3V0B B;  4KHQ A;  3JCI A;  3AJZ A;  3FBM A;  5GZE A;  4ZKT B;  4EP9 A;  1H8T C;  4I9Q A;  2JE9 A;  3AP6 A;  2WRA A;  3TEY A;  3AMH A;  3BCW A;  2VVD A;  2FYO A;  1C3H A;  5CYY A;  4BQY A;  3HOB A;  1DGW A;  1YI7 A;  2CGN A;  5G04 L;  4YYO A;  3O1O A;  2J1U A;  4DTO A;  2EXI A;  3HNY M;  3VD5 A;  4Y1U A;  5I8S A;  1AJO A;  2BFU S;  3DPR B;  4QQP A;  5CAD A;  4X5M A;  4L2N A;  3OTF A;  4DEQ A;  2P5G A;  4D94 A;  3CFO A;  2XR4 A;  4XF0 A;  2R30 A;  4AHY A;  1F15 A;  1MPX A;  1OKQ A;  3ZFG C;  1N47 A;  3I8T A;  5GKA C;  1SLL A;  1JOP A;  4P9I A;  3V0B A;  1T6G C;  4YM0 A;  3LPG A;  3Q8B A;  3WXP A;  1GP5 A;  3M3C A;  2XVL A;  4LKE A;  4LMF A;  2ZS6 B;  2JIJ A;  2XON A;  5FP8 A;  4GH4 C;  2PTM A;  1QJE A;  1JHJ A;  3OCP A;  2E26 A;  1GZT A;  1AZD A;  4UF0 B;  2UWC A;  3RJ2 X;  5DAX A;  2RJ2 A;  1UZ0 A;  2CSG A;  3U37 A;  4KI4 A;  1VMF A;  1Q9X A;  2P37 A;  2CL2 A;  4RR3 A;  1DP0 A;  4S2H A;  2DF7 A;  5B4X A;  1NCQ A;  5ANQ A;  4XFC A;  2PFV A;  4JZR A;  4JGY B;  1PGW 2;  3SLI A;  1UX6 A;  2PHF A;  4DU3 A;  2C1F A;  2GDF A;  2OZ6 A;  2JDU A;  2QBX A;  2PHX A;  3IDA A;  2OUH A;  2XWJ B;  3QEX A;  1S0J A;  1FNZ A;  3WP3 A;  2Y0O A;  2Z2S B;  5HI0 A;  4QQ2 A;  4KHN A;  3JQW A;  3AZX A;  3WV6 A;  4XUT A;  2JHA A;  4FJ5 A;  1C8N A;  2JG9 C;  2JX9 A;  1PK6 A;  2RMU 3;  3MI8 A;  4LK7 A;  4OMD A;  2B7Y A;  5FK8 A;  5FYS A;  1XNB A;  2A3X A;  4AG4 A;  4IV3 A;  1ZX5 A;  2EXJ A;  2VH9 A;  2IXL A;  4L92 A;  4JRA A;  4I09 A;  1HB3 A;  2D3P A;  3WX5 A;  4AQ6 A;  4CU8 A;  1R09 3;  4F8A A;  4AKH A;  3VBR B;  2TEP A;  3ZN5 A;  2Y34 A;  4UFH A;  3UO2 A;  4QU1 A;  4IND A;  3ZXK A;  4BIS A;  2R07 2;  4DTP A;  4HAN A;  3CZJ A;  4Q0U A;  1UOJ A;  2RS3 2;  4QB2 A;  5F2W A;  3SVI A;  4CDW B;  3U4S A;  1CAW A;  3TYJ A;  5IAV A;  4B4Q A;  1W6P A;  4KQ7 A;  5FP9 A;  1WME A;  3BVC A;  1MQT C;  2YRO A;  3H8X A;  3K51 A;  5JI7 A;  2HJI A;  4Y1Y A;  2B42 B;  1P8J A;  2RS3 3;  5HPO A;  1J3Q A;  2UY9 A;  5F9T A;  4EN8 B;  2YGL A;  3GJB A;  3UJO A;  3X29 B;  1FNY A;  4B7K A;  4R52 A;  1A34 A;  1DCS A;  1SAC A;  1V9U 1;  3I2O A;  4UFI A;  4HBN A;  3QEI A;  1BK0 A;  4AGG A;  4FJL A;  1XNK A;  2PHW A;  4YVS C;  4ZZ5 A;  3SNN A;  4AQ2 A;  3TAG A;  2XJU A;  2HWB 2;  2FW3 A;  2ZEY A;  1JOJ A;  4HON A;  4QKD A;  5GM0 A;  2FDF A;  1G9F A;  4EN9 B;  3UJQ A;  4RG8 A;  4XW3 A;  5FZF A;  4NII A;  3V65 A;  4AWD A;  1W8H A;  2F6B A;  2ATF A;  5L9B A;  1OKO A;  2J1V A;  1FV2 A;  3BI3 A;  2ZKL A;  4PI0 A;  5A7W B;  2JDH A;  2ATQ A;  2X5I B;  3VKL A;  4CCE A;  3HMY A;  4W6Y A;  2VZS A;  2XKO A;  2VCM A;  3ETQ A;  2I07 B;  2VNG A;  3AKT A;  1RUI 1;  3J7L A;  3T0B A;  1YRZ A;  3OEA A;  1QXJ A;  1JYV A;  1YNA A;  1RED A;  2ARA A;  3LIH A;  2XBO 3;  2A6Y A;  4EWA A;  4HKW A;  2OZS A;  4K3U A;  1TVG A;  3ZIX A;  1ODM A;  4O9G A;  5C3P A;  4O7X A;  3MPP G;  5EPA A;  2YC0 A;  2D5H A;  4CDX B;  4PHZ A;  3V0A A;  2WL1 A;  3DV8 A;  1Y3T A;  4J25 A;  5FZK A;  4LKS A;  4BLI A;  1DYK A;  1OFN A;  1QF3 A;  1VJ2 A;  1XPW A;  3MW3 A;  4IV1 B;  4IXL A;  4Q0S A;  4BQ5 A;  5DXD A;  3SXW A;  1ULC A;  3J8F 1;  4CDW A;  2ZEZ A;  1HRI 3;  1O4Y A;  1W2U A;  2HWF 3;  1QMJ A;  2P1B A;  5E16 A;  2WZP P;  3WNO A;  4B08 A;  1VBC 1;  2G4I A;  3NL1 A;  1RUI 2;  2NPI A;  3AFG A;  2QCS B;  4LK6 A;  3RYK A;  5FPL A;  2P3I A;  3NWK A;  3E6D A;  1W0O A;  4QWN A;  5CU1 A;  1OLM A;  2ARB A;  3B9C A;  3W5N A;  1NA1 C;  1K5M C;  5IRE A;  1ND3 C;  5AVA A;  2X05 A;  1C1L A;  3NAP A;  2XL7 A;  2QQW A;  4NRO A;  4YVW B;  5A32 A;  1U0A A;  4N53 B;  4CA9 A;  1LOF A;  3OBZ A;  3KSC A;  4MUV A;  4UBH A;  4B8E A;  3V64 A;  3D8C A;  2NMO A;  2GNB A;  2A71 A;  4LO8 A;  5JUV A;  1AL2 1;  4YWA A;  3PHM A;  5A3U A;  4QNC A;  2ET1 A;  1QWR A;  4K1Y A;  1XVG E;  1V6M A;  4NID A;  3VBH A;  2RDN A;  1LRH A;  1UOG A;  3AKQ A;  2CGO A;  1Y7B A;  2WNU B;  1RUE 2;  5BNN A;  1R08 2;  3QH6 A;  2XB6 C;  4XE9 A;  3ZYH A;  1O6U A;  3DYP A;  4JVA A;  4NO4 A;  2YUE A;  1RMU 3;  3FHQ A;  3GHN A;  2PEL A;  3ZFE A;  1QDC A;  4PBP A;  4AI3 A;  5F5Q A;  3L2H A;  1N1S A;  3WG4 A;  3MIG A;  3ZMN A;  4NWW A;  4M00 A;  4XZU G;  4CZS A;  1YXW A;  2GAU A;  3HAG A;  4N53 A;  5JIU A;  1WBL A;  1CGP A;  1YFU A;  3BOW A;  3NMB A;  1JYX A;  4IEY A;  4ASM B;  1AL2 3;  2A6V A;  5I8Y A;  2GC2 A;  3TAY A;  4I6J B;  4FVV A;  3S7E A;  4ADN A;  3EMR A;  2R07 3;  4GAM C;  2WWS A;  4YW5 A;  2DTU A;  3QH7 A;  3ZR6 A;  1Q8Q A;  4AQT A;  2QQV A;  3M7A A;  5A3T A;  1PMH X;  1BCX A;  3OGM B;  4EYW A;  5DZF A;  4UI9 L;  1GOH A;  3KV5 A;  1GIC A;  3KCY A;  1E5I A;  1RL3 A;  2PHL A;  2QKD A;  3QER A;  2LAL A;  2W1Q A;  3LDS A;  4FOY A;  4JHZ A;  4MG2 A;  4BMB A;  4AE2 A;  4Q4W 3;  5T54 A;  4AF9 A;  5IVF A;  1WLD A;  5EIY B;  4W50 A;  2A3W A;  3RZZ A;  1WD4 A;  4A6S A;  1Z7S 1;  2RS1 3;  5FYU A;  4AVB A;  4CP9 A;  4JQR A;  4RS5 A;  2WZR 3;  4MO3 M;  1VBE 1;  4XHX A;  4P02 B;  3OY8 B;  2WNV A;  4EN0 A;  1S2B A;  4KBZ A;  3IIA A;  5IFT A;  4YLZ A;  2OPW A;  3VKN A;  1IGO A;  2Z4F A;  5FV3 A;  4R9D A;  4A3X A;  1IS4 A;  4H14 A;  2JIG A;  3HQX A;  1FPO A;  1HRV 2;  1W04 A;  1NT0 A;  4M4P A;  5F3C A;  2UYB A;  3GGL A;  1QY4 A;  3PME A;  4MXW A;  2TNF A;  1OPO A;  3ZFG A;  3SIS A;  1D0H A;  4COZ A;  3MPB A;  1XND A;  5JMC A;  1G7Y A;  3ZFE B;  1EAH 2;  5EYY A;  4AQS A;  1W90 A;  3AJY A;  1QEX A;  4E4D X;  1W0N A;  4TYS A;  5BNP B;  5LRS A;  2W39 A;  1F9K A;  5IBK B;  1Z7S 3;  1IOA A;  2PHR A;  2PHD A;  4I01 A;  2BNN A;  1FZ8 E;  3RZG A;  3NNL A;  1RHI 2;  2YYO A;  4HKL A;  4FTS A;  3HN3 A;  4XFH A;  1W8Z A;  3A0K A;  1PIV 3;  3B69 A;  4YW7 A;  3MF9 A;  1QJX 3;  3ORJ A;  3SQO A;  3THD A;  3JUU A;  2HH9 A;  3BPZ A;  3IDC B;  5C70 A;  2QJV A;  3BTZ A;  4K6B A;  1S0B A;  4N9I A;  4RR3 C;  3A4U A;  4K8R B;  1Q56 A;  4XAC A;  5FQ0 A;  1ULE A;  1OD3 A;  4Q8L A;  4TN7 A;  4CDQ A;  5C5T A;  4XQW A;  3SUP A;  2H6C A;  3VBS C;  1A8D A;  4CEW B;  4OI0 A;  1BMV 2;  4MGT A;  1DLL A;  4QB1 A;  5L73 A;  4CUG A;  1W6M A;  1LHW A;  1VBB 3;  5LY2 A;  1DZR A;  1GV9 A;  2VJ4 A;  4M3C A;  4UYB A;  4Y5T A;  2XHN A;  2ZGM A;  1PGL 1;  1F8V A;  5FLI A;  4M3C F;  2DTW A;  3T0A A;  2ZKN A;  3MFA A;  2DEB A;  3DGT A;  3MO4 A;  4DU1 A;  2B4K A;  3EQE A;  3IDB B;  4MHR A;  3B3Q E;  4BE3 A;  1W6O A;  1WAF A;  5KHJ A;  1E57 A;  3FZ3 A;  4XOG A;  1UWW A;  5A1F A;  1BBT 3;  3O0X A;  1PO2 3;  5DQ0 A;  5A6Q A;  1XU2 A;  2B7M A;  3AYE A;  5DAW A;  2VGD A;  5FZO A;  4NHL A;  4FQ4 A;  2DCK A;  2HYX A;  2BW8 A;  4MXW B;  1NLR A;  3SEE A;  4FAG A;  3VD4 A;  1E5S A;  1PVC 1;  4IER A;  3WF3 A;  3NV2 A;  2WNE A;  4NVP A;  3OGG A;  1VRH 3;  2X5I A;  3USU B;  2QVS B;  4DTR A;  1WCK A;  3FFZ A;  4QDQ A;  3MZH A;  2D5F A;  4QX5 A;  3U78 A;  2XVG A;  1PGS A;  4PT6 A;  2D43 A;  1S0D A;  4SBV A;  4WM7 C;  3RGB A;  3KD4 A;  1RXG A;  3MF6 A;  5FBZ A;  4QND A;  1Y9Q A;  5FWE A;  5FUN A;  3ZPO A;  3PVN A;  4KG0 A;  3EO6 A;  3RZL A;  2C24 A;  1PO2 1;  2W9X A;  1LEM A;  1HB1 A;  3TNQ A;  3N9L A;  4Q27 A;  5DAP A;  4HVQ A;  1OFS A;  3W21 A;  1ZRF A;  3AP7 A;  2GAL A;  4YVS A;  5FO8 B;  2WNO A;  3MW4 A;  1DZT A;  4LIU A;  3KVA A;  2WLP A;  5LRR A;  2CWM A;  2ZGL A;  5FY9 A;  1OUS A;  5FUP A;  4CCD A;  5IVC A;  5J3U A;  1BMV 1;  2P34 A;  4OUM A;  3K75 B;  2ZAC A;  1X9P A;  1KJR A;  5IFP A;  3AKS A;  5FFO C;  4DTU A;  2OQ6 A;  4QGL A;  1AR9 3;  1AXZ A;  1M4W A;  3ZYF A;  4WVW A;  5FZH A;  3UGG A;  1CAV B;  1ZZ8 A;  2VUC A;  4K21 A;  3PUS A;  1CVN A;  5C3S A;  1QJY 2;  2GN3 A;  4QPI C;  5JIA A;  2JG8 A;  4XUP A;  1SLT A;  2W95 A;  5CBL A;  1WCU A;  4JS5 A;  2RR1 3;  4QQO A;  3OUJ A;  5A32 B;  4Q29 A;  1HB4 A;  1LU1 A;  3UIQ A;  2GME A;  3WF1 A;  1VAK A;  3FE5 A;  1W9T A;  1D0G A;  3L2Y A;  5J98 B;  1QJX 1;  5A33 A;  4FFF A;  4LNV A;  5JLV A;  5AC9 2;  1KFX L;  3C95 A;  2R06 1;  1N1V A;  4P14 A;  3UGF A;  2WBK A;  3W5M A;  1D4M 1;  2D6O X;  3KT7 A;  3N7K A;  4OUE A;  1O5U A;  4TTG A;  4K1Z A;  2JB4 A;  1MS9 A;  2ZJC A;  4GJY A;  1FYZ E;  1NXM A;  4LE4 A;  3M2M A;  4XF4 A;  2W1W A;  3BN6 A;  4UOJ A;  1IPS A;  1V6J A;  4XMA A;  5FZL A;  4BQ3 A;  2OPK A;  2GH2 A;  3K4Z A;  3RI8 A;  3ZFG B;  1GWL A;  3LA3 A;  3V7D B;  1VBB 1;  1RGS A;  1UZY A;  2BUK A;  3WNN A;  1XMH E;  4LBQ B;  2XG3 A;  2V4V A;  2DVB A;  1YCI A;  2V73 A;  3CBN A;  5A3P A;  1AYM 1;  4HZF A;  1IG0 A;  2A75 A;  1UPS A;  3Q8E A;  1YFW A;  1GQH A;  1LOF C;  4YZ5 A;  2JDP A;  2R49 A;  3V0A B;  5CAZ A;  1X8E A;  1P22 A;  3C8X A;  4HXC A;  2AR6 A;  3C7O A;  5T50 A;  5IVB A;  1ND2 A;  2A6X A;  3ZYP A;  2D97 A;  1C57 A;  2G9Z A;  2SLI A;  4DTM A;  3D5O A;  2XVK A;  1U5Z A;  3GYD A;  4LBO A;  1JZ3 A;  1IQA A;  2RR1 2;  4RGG A;  1VBE 2;  5GZD A;  2CU5 A;  2ETE A;  5FZ3 A;  3NAE A;  5BNN C;  3L9J T;  2BTV C;  1DGW X;  4Q0Q A;  2J1A A;  2JD9 A;  1XU5 E;  5F6K A;  1GWM A;  2LF6 A;  2PAK A;  3DF0 A;  1QJY 3;  3QLQ A;  2W2I A;  4NRQ A;  4ES9 A;  4FOQ A;  1AX2 A;  4Q8K A;  3GNE A;  3FX3 A;  5DZG A;  3RMX A;  5IJR A;  4WM8 A;  4E4B A;  5GLZ A;  4M3W A;  3OYW B;  1RUG 3;  2WO2 A;  4QQH A;  3VHR A;  5C3R A;  5LA0 A;  1KRI A;  4ISR A;  4FCA A;  4BOW A;  4CP9 B;  5FTT C;  3AYC A;  1LHV A;  4S2G A;  1BLZ A;  1DZQ A;  3IT8 A;  1MS4 A;  5DUX A;  5DG2 A;  3IDE A;  3NRU A;  2VEC A;  3I3B A;  3UT0 A;  1LAJ A;  3I54 A;  1J3P A;  4M42 A;  1TME 3;  2OT7 A;  5TSW A;  1FZ7 E; 
#chains in the Genus database with same CATH homology
 4BK5 A;  4XUR A;  1UYY A;  1XU3 E;  1XMG E;  4AI6 A;  2EIE A;  2VO5 A;  1XL3 C;  3ACH A;  3SKV A;  3NNG A;  5FUI A;  1CZS A;  3NCI A;  3C7E A;  2EIC A;  3I2I A;  4DXR A;  3ACG A;  2W1S A;  3RMB A;  1DYO A;  3FHA A;  4ARX A;  2RVA A;  2QXF A;  3HGL A;  4M3R A;  2VZP A;  2P1O B;  2J1T A;  3I2K A;  3IB3 A;  2QQK A;  4RNG A;  2OZM A;  4FJ9 A;  4KWU A;  4PQQ A;  2JKX A;  2B1E A;  4MAD A;  3KD1 E;  4HG6 B;  3D3A A;  2VMD A;  2VQT A;  1SHW B;  4OMC A;  1K45 A;  4RN5 A;  4CU7 A;  1HN1 A;  2J22 A;  3BGA A;  4DU4 A;  3TJY A;  4M3X A;  5JR2 A;  3RMC A;  4ZZ8 A;  4KI5 M;  3ACF A;  4RL5 A;  4FJ7 A;  5IYY A;  3HP9 A;  1CIY A;  5EJ1 B;  4KHQ A;  3T08 A;  1CZV A;  4EP9 A;  3QEW A;  4I9Q A;  1GQP A;  1FXX A;  1ULO A;  2YG0 A;  5I0D A;  4LHS A;  2ID4 A;  4FJG A;  1ULP A;  1FZH E;  1WCQ A;  2FYO A;  2OYQ A;  4J2D A;  1D7P M;  5CYY A;  3HOB A;  5G04 L;  1JZ2 A;  1JZ4 A;  2J1U A;  4DTO A;  3EYP A;  1PX4 A;  3HNY M;  3VD5 A;  2VJ5 A;  1O8P A;  1MTY G;  1XVB E;  2QQN A;  4X5M A;  4DEQ A;  2W3J A;  2P5G A;  1UXX X;  2W92 A;  3CFO A;  3C7H A;  4FJN A;  4RYD A;  3III A;  5B4N A;  1MPX A;  2Y8K A;  4A44 A;  4P00 B;  3J27 A;  4DUX A;  4HCB A;  3LPG A;  2VCA A;  4MOA A;  1IQD C;  3SQ1 A;  3CIH A;  5LA2 A;  2XON A;  3WNL A;  1UX7 A;  2VZQ A;  1US3 A;  1K3I A;  2JH9 A;  4W8J A;  1JHJ A;  2E26 A;  3NHG A;  2ZXQ A;  4DXT A;  2RJ2 A;  3VDB A;  1UZ0 A;  2WDB A;  4CUA A;  3U37 A;  4KI4 A;  1Q9X A;  4FI9 A;  4BDV B;  1DP0 A;  1OT5 A;  2C4X A;  4M3Z A;  2KD7 A;  5B4X A;  3NGI A;  4CU6 A;  4E8C A;  1OF3 A;  2W87 A;  2PFV A;  2YB7 A;  3NQH A;  1WAJ A;  3KD5 E;  1JU3 A;  4OZO A;  4DU3 A;  3NJV A;  1XC6 A;  1LDK E;  2QBX A;  2W91 A;  3IDA A;  2OVQ B;  4DTS A;  2W47 A;  4E3S A;  3QEX A;  4JKK A;  3THC A;  5JXI A;  3QNO A;  5G05 L;  5DN2 A;  4KHN A;  2R7E B;  1L7R A;  2WO3 A;  3AC0 A;  4FJJ A;  4XUT A;  1NUK A;  2HLE A;  2P1M B;  4M4R A;  2LF3 A;  4QX3 A;  2JHA A;  4FJ5 A;  3I2G A;  4D0Q A;  5IHR A;  4OMD A;  1FZ9 E;  4M41 A;  5A1A A;  1TG7 A;  4AG4 A;  3LEI A;  3NDK A;  4FK2 A;  4CU8 A;  5IZ7 A;  2WAA A;  3A23 A;  4AKH A;  3F2Z A;  2WQ8 A;  3W5M A;  2BBA A;  4DTP A;  3CZJ A;  1XVC E;  4QB2 A;  3QEP A;  3SVI A;  3K77 A;  2QQL A;  4GWJ A;  3MUZ 1;  1GOG A;  1FZ5 E;  2Y6G A;  2VC9 A;  1P8J A;  5HPO A;  3LE0 A;  3WNK A;  4ADO A;  3ABZ A;  1I5P A;  1NX9 A;  4D8M A;  3TAB A;  4CUC A;  3QEI A;  4UAP A;  4QAW A;  1WKY A;  4FJL A;  4ZZ5 A;  3SNN A;  4OYU A;  3TAG A;  4FJI A;  1FZ0 E;  2FW3 A;  1Q9Y A;  2ZEY A;  1IH7 A;  4FVM A;  3OBA A;  1US2 A;  2E32 A;  4RG8 A;  5F7U A;  1XVD E;  2Y6K A;  3RMD A;  3RMA A;  5C7G A;  2J1V A;  2WO1 A;  1RYY A;  2ATQ A;  1J83 A;  3JXS A;  2VZS A;  3SKJ E;  2VJX A;  4M3Y A;  3A21 A;  1W9W A;  3T0B A;  3OEA A;  4FJX A;  1JYV A;  2C9K A;  1EUT A;  1FZ2 E;  2VZ1 A;  1XVF E;  3J2P A;  3EB7 A;  2VL4 A;  3HEI A;  3LQC A;  2OZS A;  1TVG A;  5LA1 A;  1F4H A;  3SI6 A;  1NAE A;  2WYS A;  2B8I A;  2PFT A;  1UY0 A;  4LKS A;  1T2X A;  4E8D A;  1XPW A;  2H4T A;  3OB8 A;  2YFU A;  2ZEZ A;  3WNO A;  3SPZ A;  3CZU A;  4B08 A;  2PQS A;  5HXM A;  1GU3 A;  3GXU A;  3ZM8 A;  3VD7 A;  3W5N A;  5IRE A;  3SPY A;  2X05 A;  4LQR A;  2QQM A;  4ET7 A;  4KMQ A;  3CDZ B;  5J1X A;  1O8S A;  3I3E A;  4IUG A;  3WF4 A;  3LZJ A;  2DCJ A;  4CVU A;  3MV0 1;  3DYM A;  5JUV A;  2HD0 A;  3T09 A;  2VIX A;  4XVH A;  3GDB A;  4QNC A;  2V72 A;  5CZK A;  1XVG E;  1W99 A;  1UY1 A;  1UYZ A;  4YPJ A;  3IAQ A;  3WNP A;  3C94 A;  2VOT A;  4M3T A;  1O59 A;  3DYP A;  3A7Q A;  3VDA A;  3FHQ A;  4QDS A;  3OGR A;  2CDO A;  1L7Q A;  4J2E A;  3T2P A;  4XZU G;  3I97 A;  3SJJ A;  2RCU A;  4GWI A;  4QX1 A;  1JZ8 A;  1JYX A;  1W8N A;  4BK4 A;  1UMH A;  3NE6 A;  4I6J B;  4ADN A;  1CLQ A;  4GAM C;  4M3U A;  2YC4 A;  3WEZ A;  2DTU A;  1PMH X;  3LD8 A;  3OGM B;  3HJR A;  4EYW A;  4A45 A;  1UY4 A;  1GOH A;  2B9V A;  2P1N B;  3SQ2 A;  4UI9 L;  2J7M A;  1FZI E;  2DY4 A;  1JYW A;  3C6N B;  4LPL A;  3QER A;  1UY3 A;  3LZI A;  2W1Q A;  3LDS A;  3LEK A;  4JHZ A;  1FZ4 E;  2VZR A;  1MHZ G;  4A4A A;  4DEV A;  4JS4 A;  4M45 A;  5EIY B;  4L0P A;  2P1P B;  3C7F A;  4W50 A;  4QPW A;  2RV9 A;  2V5D A;  3HNB M;  4MO3 M;  2OVP B;  3SUQ A;  4J2B A;  1W9S A;  1W8O A;  2X09 A;  4P02 B;  4CUB A;  5C71 A;  3CMG A;  4QX2 A;  2VCC A;  1FZ6 E;  4X5N A;  4FK0 A;  3J7H A;  2JHP A;  5IFT A;  3TAF A;  4MGQ A;  2Z4F A;  2WAB A;  2WZE A;  1MHY G;  3ECQ A;  2W94 A;  3L8B A;  4M4P A;  3FL7 A;  2VME A;  1FZ1 E;  2BGO A;  2J1R A;  3GGL A;  4XUO A;  3GM8 A;  1J84 A;  2XQX A;  2EIB A;  2VQU A;  1JZ6 A;  4ZXE A;  1W0N A;  2E31 A;  3HL8 A;  5IBK B;  3N1E A;  3K4D A;  1FZ8 E;  4JX0 A;  3MKS B;  3HN3 A;  1JU4 A;  4AKI A;  3THD A;  3WQB A;  5C70 A;  5JXG A;  2MZW B;  4AKG A;  1EUU A;  3S9H A;  4ARY A;  3P1I A;  4PF1 A;  1OD3 A;  4AAX A;  3SUP A;  2X10 A;  2DDU A;  3TL8 B;  4FJ8 A;  4XUQ A;  2QQO A;  4TXW A;  2P5O A;  3I2F A;  1JI6 A;  1OF4 A;  4QB1 A;  1H6Y A;  3I2H A;  2VJ4 A;  1XNT A;  3PUI A;  1K42 A;  2XHN A;  4DUW A;  4QB6 A;  4A3Z A;  3L0M A;  2WAO A;  3T0A A;  3OEB A;  4XUN A;  1CX1 A;  2VZ3 A;  4KHU A;  2XOM A;  2DEB A;  3MO4 A;  2VCB A;  4DU1 A;  2B4K A;  1UXZ A;  2WN3 A;  4MGS A;  4HCC A;  3UNP A;  2WZ8 A;  3K4A A;  1WAF A;  1FZ3 E;  1UWW A;  3A22 A;  1XVE E;  2LW8 A;  3SQ4 A;  2W5F A;  5DQ0 A;  3OG2 A;  3CFP A;  2C26 A;  2B7M A;  3MBW A;  2VZV A;  2DCK A;  3CFR A;  2Y64 A;  2HYX A;  3VD4 A;  3SEE A;  3E1F 1;  3E4W A;  3WF3 A;  3WSO A;  3FN9 A;  4A6O A;  4FJM A;  2BZD A;  1IG9 A;  3VD3 A;  2JH8 A;  4DTR A;  4Z2A A;  1GMM A;  4QDQ A;  4DXS A;  3IAP A;  1JYN A;  3QET A;  2VZO A;  3NJX A;  3CKH A;  1OH4 A;  2JE8 A;  4PT6 A;  4BJ0 A;  3CQO A;  4QND A;  4KHS A;  2VZU A;  1GNY A;  3SUN A;  1BHG A;  3C7G A;  3UET A;  3MUY 1;  2Y6L A;  4JRQ A;  5DPN A;  2W9X A;  3VDC A;  1CZT A;  2ORZ A;  3HNM A;  4DTX A;  1NEX B;  4DUV A;  3OGL B;  3T2Q A;  3C6P B;  2Y6H A;  4A42 A;  1LNS A;  1XMF E;  2L9L A;  3K75 B;  2ZEW A;  3QEV A;  5EJZ B;  2E33 A;  2QQI A;  5IFP A;  4KHW A;  4DTU A;  4QDR A;  2VMF A;  3I2J A;  2Y6J A;  3ETP A;  3DYO A;  2VTF A;  2WN2 A;  4CU9 A;  1NKG A;  1KEX A;  3LEG A;  4A41 A;  3WF2 A;  3CQ8 A;  1PX3 A;  2EID A;  2VZT A;  4XUP A;  2JPN A;  3QES A;  3OGV A;  4ZY9 A;  2W95 A;  4JRP A;  3P6B A;  3UES A;  5JXH A;  4JS5 A;  2ORX A;  2OVR B;  3UIQ A;  3I3D A;  3WF1 A;  3LDB A;  1F4A A;  2VR4 A;  2YFZ A;  1W9T A;  3LPF A;  1PMJ X;  1K12 A;  2VM9 A;  3WNM A;  2YC2 A;  4BXS V;  5H37 A;  3C95 A;  4DTJ A;  4JKL A;  2WBK A;  4JKM A;  2CDP A;  4OUE A;  4TTG A;  1R64 A;  2QQJ A;  3ACI A;  1FYZ E;  1H6X A;  2W1U A;  5JXJ A;  2J1E A;  2W1W A;  3BN6 A;  4UOJ A;  3RWU A;  1UMI A;  3N1B A;  3K4Z A;  3VD9 A;  2JHC A;  2BER A;  4W4Z A;  3SEP A;  5LCW L;  3V7D B;  3SUO A;  3WNN A;  1XMH E;  2V4V A;  3HGK E;  3OGK B;  1DLC A;  3K46 A;  1GOF A;  3T0D A;  2MMB A;  2BGP A;  2JDA A;  1UY2 A;  4EPH A;  1KGY A;  4FK4 A;  1P22 A;  2ZEX A;  5DMY A;  2VMC A;  3K2O A;  3C8X A;  1YQ2 A;  3C7O A;  3OGS A;  1GUI A;  1UYX A;  2J1S A;  2W46 A;  4DTM A;  3SCX A;  2P1Q B;  1JZ3 A;  3T2O A;  4KI6 A;  3QNN A;  1JZ7 A;  1FS1 A;  3L1N A;  3NAE A;  3SQ0 A;  2J1A A;  2JD9 A;  1XU5 E;  2LF6 A;  4J2A A;  4QX0 A;  4I9L A;  1JZ5 A;  3E4Y A;  5IJR A;  3DEC A;  4E4B A;  3C6O B;  1SG3 A;  3HPN A;  4M3W A;  3PUH A;  4DTN A;  4FJH A;  2WO2 A;  5LA0 A;  4P5Y A;  3TAE A;  3WF0 A;  2LS6 A;  4KHY A;  2OKX A;  4GZ9 A;  5JMO A;  4FJK A;  3NRU A;  3I3B A;  2WUH A;  2YB5 A;  3L2O B;  1SDD B;  4M42 A;  3MV1 1;  4P08 A;  1XNA A;  1MMO G;  1FZ7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...