2E31A

Structural basis for selection of glycosylated substrate by scffbs1 ubiquitin ligase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
251
structure length
246
Chain Sequence
AVEYLAELPEPLLLRVLAELPATELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWSDVEHGGDGWKVEELPGDNGVEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the selection of glycosylated substrates by SCFFbs1 ubiquitin ligase
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords F-box only protein 2
total genus 59
structure length 246
sequence length 251
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00646 F-box F-box domain
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2e31A01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2e31A02
4PQQA 2YFUA 3OGSA 1O8PA 1OD3A 2HYXA 3OGVA 3T2OA 3MV01 1W9SA 2WAOA 3HNBM 2P1NB 2YG0A 2Z4FA 2VZSA 2PQSA 3K4ZA 1I5PA 4KMQA 5G04L 4RYDA 3UNPA 4MGQA 4ARYA 4BDVB 3CQOA 1XPWA 2WQ8A 1JU3A 2WZ8A 1XNAA 2W87A 2XHNA 4MO3M 3I97A 4GZ9A 1JU4A 2BBAA 2VO5A 2DCKA 4P02B 1EUUA 4E8CA 4AAXA 4CVUA 3IIIA 2J1UA 3JXSA 2QBXA 1ULOA 3MUZ1 4XUPA 2V5DA 2VZ1A 2ZEXA 1UWWA 4QB2A 3DYPA 1J84A 3OEBA 2P1MB 1UYYA 4JX0A 4BK4A 1JZ2A 3VDCA 3WEZA 4P00B 4QX0A 1HN1A 4ZZ8A 1LNSA 1JYNA 3I2JA 2W1UA 4JKLA 1UYXA 3WF2A 3GGLA 4A42A 2W92A 2ZEWA 4L0PA 3GM8A 3HNMA 1JZ8A 3WNPA 2JDAA 1ULPA 1UYZA 5B4XA 2WZEA 1SG3A 3OGLB 2J1RA 4OMDA 3E1F1 4A4AA 5IJRA 1UXXX 2VZ3A 3I2IA 5LA0A 3VDBA 2J1SA 2RV9A 4D8MA 5JUVA 1JZ3A 3MBWA 3CKHA 3WSOA 4I6JB 2DCJA 2J1AA 3WNMA 4DXSA 4QX2A 2W94A 2VQUA 3LE0A 1GQPA 4CU7A 3P6BA 2OKXA 5JR2A 4HG6B 2C4XA 3NJXA 4XUTA 3ACGA 4TXWA 2Y6KA 3DYOA 3FHQA 4ZXEA 4CU9A 3W5NA 1P8JA 1PX4A 3T2QA 2C9KA 1CZTA 2YC4A 5F7UA 3HOBA 3A23A 3T0BA 3DYMA 3ZM8A 3EYPA 4QDRA 2E32A 3PUHA 4ARXA 5JXGA 3K75B 3WF1A 3OBAA 3BGAA 1P22A 3OB8A 1UZ0A 2Y6JA 3THCA 1NEXB 2W46A 1IQDC 1NAEA 2Y6LA 2XOMA 3I3DA 4QX1A 5EJZB 3CZUA 3OEAA 3WNLA 4MADA 1FS1A 4DXTA 4XURA 3T09A 3MV11 1UY0A 4QDQA 3GXUA 3VD4A 1JZ6A 4OZOA 2WUHA 4LHSA 2B4KA 3FHAA 2W1QA 2WBKA 2J1EA 5I0DA 1OH4A 4M4RA 1GOHA 3I2FA 1F4HA 3LEIA 1JZ4A 2RVAA 2QQKA 5IFTA 1T2XA 2X05A 4DEQA 1GOGA 1K42A 1GMMA 2WO3A 3WNKA 2YFZA 3HNYM 4CUAA 3WNOA 1CIYA 3SEEA 3SKVA 4GWJA 5LCWL 2JE8A 3C6OB 3LPGA 3IAQA 1GNYA 4P08A 3AC0A 2ORZA 4FI9A 5C71A 2ZEYA 4BK5A 2VMEA 5IFPA 3I3EA 1NX9A 3A22A 4XUOA 1JYXA 3I2KA 4QAWA 2X10A 4W4ZA 4A3ZA 1KEXA 3C6NB 3ETPA 4BXSV 2VMCA 2VTFA 4PF1A 1MPXA 3C7FA 3W5MA 4XZUG 4UI9L 4CUBA 3PUIA 4DUWA 4E8DA 5IHRA 1UX7A 4ET7A 3L2OB 4CU8A 4A41A 5EJ1B 3OGKB 3HPNA 4YPJA 4XVHA 2P1OB 2W1WA 1UY2A 2EIEA 2RJ2A 4OYUA 4ZY9A 4M4PA 2V72A 5A1AA 1UMIA 3UESA 4GWIA 3MO4A 2W9XA 1US2A 2WO2A 4RN5A 2VZVA 2E31A 1DP0A 3FN9A 2E26A 2VZTA 2WABA 4D0QA 5HXMA 1WCQA 3P1IA 1K3IA 1US3A 2R7EB 2Y6GA 2WN2A 2VZQA 4A45A 3C6PB 1PMHX 4DEVA 3EB7A 1K12A 1JYWA 3T0DA 1K45A 3CZJA 3DECA 4MOAA 1JHJA 1KGYA 3K77A 2VCBA 3WQBA 3K4DA 2X09A 3IDAA 4IUGA 2Y64A 3J7HA 5FUIA 4QPWA 2XONA 1GOFA 1O8SA 2WDBA 2BGPA 2W5FA 1L7RA 4AG4A 4W8JA 4KWUA 2J1VA 3F2ZA 3NJVA 1JI6A 2J1TA 3WF4A 1W9TA 2WO1A 1UXZA 1W8NA 1DYOA 4JKMA 2L9LA 5IBKB 2VL4A 1JZ7A 2P1QB 3I2GA 3HN3A 4QB6A 2E33A 3VD3A 5JXIA 1GUIA 3V7DB 3LQCA 3MUY1 2YB7A 1SHWB 3D3AA 3ACIA 3C7HA 2VMDA 1JYVA 2EICA 1CZVA 3LEGA 4LKSA 2BGOA 2VJXA 2W3JA 2BZDA 4P5YA 4UOJA 1H6XA 2W47A 2VQTA 3LPFA 2DDUA 3C7EA 3WF3A 4A44A 2QQOA 2J7MA 3FL7A 4BJ0A 3HEIA 2VZPA 2VC9A 2BERA 4CUCA 1JZ5A 3THDA 3BN6A 4W50A 3I3BA 5CZKA 2J22A 1W9WA 1EUTA 2JKXA 2ORXA 2V4VA 3CDZB 4OUEA 3MKSB 2OVQB 2Y8KA 3LEKA 5C70A 5JXHA 5JMOA 4QB1A 3VD7A 5C7GA 1J83A 3C8XA 3SEPA 5B4NA 4XUQA 4UAPA 3OGMB 1W99A 2VCCA 2VMFA 5DQ0A 2P1PB 5LA1A 1NKGA 3K4AA 1F4AA 4QX3A 4MGSA 1DLCA 2LW8A 5DPNA 4ZZ5A 2EIDA 3SKJE 2HLEA 1H6YA 2VOTA 3OGRA 4LPLA 2VZUA 1OT5A 1WKYA 2QQJA 2OVPB 2CDOA 2LS6A 4OMCA 1GU3A 5DMYA 3ABZA 1SDDB 5J1XA 2WAAA 1YQ2A 1LDKE 1UY3A 1O59A 4KI5M 2QQMA 1RYYA 1XC6A 4DXRA 2VZOA 2W95A 2EIBA 1CZSA 2W1SA 3OG2A 4CU6A 5JXJA 3ECQA 1UY4A 3CIHA 2B9VA 3T0AA 1R64A 4QDSA 3WNNA 3HJRA 3NNGA 4JHZA 4Z2AA 3A7QA 1TVGA 5DN2A 3T08A 3U37A 4A6OA 4DUVA 3ACFA 1OF4A 1UMHA 1PMJX 3WF0A 2OVRB 2Y6HA 3C7GA 2ZEZA 2YC2A 2JD9A 5LA2A 5HPOA 3I2HA 3IAPA 2VCAA 1XNTA 2WN3A 3K46A 1D7PM 4TTGA 3GDBA 1W8OA 2W91A 1BHGA 2VZRA 3CMGA 2CDPA 3IB3A 4DUXA 1UY1A 2QQLA 4PT6A 5EIYB 3NRUA 1OF3A 2C26A 3A21A 3C7OA 3NQHA 2ZXQA 5CYYA 3VD9A 2VM9A 2ID4A 4LQRA 1NUKA 2QQIA 2VR4A 1CX1A 3T2PA 3ACHA 3VDAA 2QQNA 5IYYA 4XUNA 5G05L 3VD5A 2XQXA 2WYSA 1TG7A 1W0NA 4JKKA 3UETA 1PX3A 2KD7A 1L7QA
chains in the Genus database with same CATH superfamily
1G9DA 4M3TA 4LA2A 5F6KA 4E9KA 1XVFE 1OD3A 2IC1A 3TB0A 3VHNA 1NA1C 3KHCA 1CR7A 3BOWA 5EJ3A 5FZ4A 4W6WA 1XU1A 4Y33A 4Q4W2 4HFSA 3SPYA 2ZABA 3BUCA 3CQ8A 2PHWA 3KD5E 3VBRA 2IXHA 4XF3A 3ES1A 5DAQA 2Z4FA 2RMU2 2O8QA 3G6JB 1SLCA 3K4ZA 1VBB3 3ALQA 4XJAA 4ZS2A 1QMJA 5GLZA 5JAXA 3WHUA 5LK5A 1RUF2 3N3HA 4MGYE 1AYN2 5FR3A 2A6WA 3BKZA 2UY9A 5IVBA 1D4VB 2WQ8A 2WFPA 3RZZA 5I8SA 2Y38A 4AHWA 1OMIA 3LZZA 1T6GC 5LWBA 4IGQA 1O3QA 5BY5A 1X7NA 4W6XA 1WMEA 5BNNA 3GBWA 2VW1A 2JECA 4RHV3 5ACA1 5IK7A 3ZYHA 5FPBA 4AZZA 3I97A 4GZ9A 3AXEA 3BTAA 4AW7A 1BQPA 1V6KA 3R4UA 1R1A3 1HRI3 2AREA 2XVKA 4P02B 4AQ2A 4E4BA 1MMOG 3VL8A 1NE6A 1QIQA 1YWKA 1KD7A 1A3KA 3IIAA 2JKBA 4H2AA 1FOD2 2RG4A 2YU2A 2QBXA 3THPA 5FY0A 2BYVE 3DEMA 3EQEA 3I3QA 4XUPA 4CRQA 1V9U2 1WCDJ 3LDKA 4LKEA 4M3CA 2VVEA 1YCIA 4H7LA 1UWWA 1Y7BA 4Q4X1 2A70A 5K4LA 2XL7A 3AK0A 5IK8A 5CFCB 3OEBA 1H2NA 3WP4A 1LHUA 4LHKA 1O7FA 1JZ2A 2VNGA 5FZBA 4P00B 1Q9XA 4SBVA 1TME3 3RMYA 1HN1A 4AHXA 2XKOA 4C91A 5FUPA 1W6PA 4CCCA 4ZZ8A 3QNNA 1AR92 2HWD2 2WWUA 2W1UA 3WNXA 4S2DA 4YW3A 4JKLA 3WF2A 3ZPYA 1OVPA 1J59A 4CCKA 5A32B 3VKNA 1VAMA 1DZQA 4MGZE 4BLIA 4K6BA 4RR3B 1RUH3 2BV4A 2GH2A 2O8OA 2RMU3 5FMCA 1AR91 2HWD1 2FDFA 2BOIA 1UYZA 1FZ8E 1WMXA 2BJSA 2J1RA 5F1RA 4LIUA 5FY8A 3UO2A 1QH6A 1BLZA 3AZWA 5IJRA 2VZ3A 1NA1B 3EJKA 5JVVA 3S5QA 2VECA 3T30A 3JUUA 2OQ7A 3LIGA 4KH9A 1JZ3A 3P3NA 3BPSA 1W3XA 3MBWA 5A3LA 5J7MA 1YJKA 4ONUA 4FBFA 4AKGA 3GJAA 3I4IA 3O0VA 4RQPA 1V9U1 1D0HA 4A2UA 4I6JB 2DCJA 3TEYA 3LDSA 2HKXA 4QX2A 2CGPA 4AEKA 1ASJ3 2P34A 1OC1A 2W94A 3RWKX 1XJAA 3VBRC 3UGGA 3V56A 2D5HA 1WW7A 3P6BA 2OKXA 2FDJA 4M0NA 5CFCA 5DG2A 4XETA 2QKDA 3NJXA 5LY1A 1A78A 2D6PA 2ZX1A 3PMSA 5J48A 1WCKA 4L97A 1RINA 4CDQB 5F32A 3RWNA 2ZHNA 1KS4A 1PM7A 2IZWA 4YVWC 2JG8A 1LU1A 2HWE3 1PK6C 3HBKA 3HGLA 3K51A 4QT6A 4E27A 4ADOA 4Y26A 5F7UA 3HOBA 1PVXA 5EXOA 2WS93 1RHI3 4FAGA 4YWAA 2O1QA 3EYPA 4KHUA 2DFCA 5FP9A 5L7OB 1GKBA 3RGBA 1VR3A 3K75B 3WF1A 3BGAA 4P9JA 4KI4A 3PU3A 3HWJA 4MGTA 3MW2A 3DXTA 2VJ5A 3SUNA 2HBUA 2Y6LA 4L99A 2VUDA 4LOTA 2AUYA 2P6HA 4FVMA 2Y0OA 4JGYC 1HV0A 2Q0AA 3SNMA 3U10A 1OLRA 4NN0A 3BTZA 2CU5A 3T4HB 3ZDSA 4P5HA 2WKKA 1EV12 1Y9GA 1EY2A 4Q0SA 3HBZA 3T09A 4CCNA 5BUVA 3B00A 3MV11 1UY0A 3R4DB 3GXUA 4QDQA 2R1DA 1KJLA 4HKWA 3KD1E 1FZIE 1LU2A 1AR72 2D6LX 2ZGOA 5C3PA 4UFIA 1YQ5A 2BTVC 2B42B 3N35A 4DZGA 5FJHA 2JE9A 2ZMNA 5GKAC 1MQTC 1GNHA 3QBQA 2J1EA 1OA3A 1SBDA 1XVDE 3AKQA 4FPFA 3QD6A 1OH4A 4GULA 4EYWA 5IWFA 3VHOA 1BBT3 3AKPA 2HWB1 5IT6A 4CDXA 1WBFA 2XDVA 1JOJA 1F4HA 5FBZA 4BIFA 2YPJA 3AP6A 4CP1A 4CCDA 5EYXA 3ON7A 4ASMB 3JQXA 3URFA 1V6JA 1K42A 1GMMA 3H0OA 4DTSA 4XQDA 1C8M1 3ZXGA 3QACA 1SLLA 1LOBA 5FK7A 3NDKA 3HNYM 4CEWC 2VNRA 5GLVA 2CGOA 5ABJA 2BPA2 1SFPA 3NE6A 3BU0A 4LBQD 3ZYGA 1FXZA 3ZSJA 2ATFA 2JE8A 5I0RA 2H0VA 1CONA 1GICA 2QXFA 5A70A 1X82A 5JSOA 1GNYA 4YGEA 4Y5SA 1O6UA 1JYTA 1HXS2 2UWAA 4JRLA 4Q26A 2Q1MA 2ZS6B 3H1MA 5C71A 4R9CA 4NUBA 2D7FA 3A0KA 2YU1A 3I3EA 2OVUA 4ZS3A 4DIQA 5CFDB 1LENA 2Q5TA 3ZSEA 1DU3D 2X10A 4FOWA 2GN3A 4W4ZA 2RR13 1JUHA 4XPVA 2SLIA 2IFRA 1KEXA 2KXLA 2K5SA 3WP3A 5BNPC 3SUQA 4AI2A 1RXGA 5KXEA 1QOOA 2MHFA 1MPXA 3C7FA 2WZR1 4XZUG 4JRPA 1HRV1 4UI9L 3AL5A 1UX7A 2OX0A 1O3RA 5FPUA 1PIV2 1B35A 2DCTA 3RG0A 3HP9A 4QHBA 2VULA 1HN0A 3IWZA 4Y22B 1RUJ2 3RSJA 3FZ3A 2JIJA 1KS5A 4B4RA 5CG8A 5H9PA 1PGL2 1XVBE 3EO6A 2ZZJA 1S4CA 1XB9A 3CJXA 2Z5WA 4ZY9A 1OQEA 4HMZA 5DAPA 2PFWA 4GWIA 2R063 4FTSA 4FJHA 4Y3OA 2YXSA 3OGJA 1TMF1 1FV3A 4XACA 4QGMA 1SDWA 1XU3E 4H14A 5GZCA 1PO11 3V0BB 3SMHA 1DP0A 4GMP0 3USUB 1JODA 4KHWA 1LKNA 2VZTA 4AXOA 1N3PA 2WRAA 2XGXA 1F9KA 2WABA 4QQHA 3ZFFC 1GQHA 5HXMA 3L2HA 2OA2A 3MFAA 3MEPA 1BXHA 2GNMA 3AYDA 4ASLA 1LHOA 1U5IA 3C6PB 1IPSA 5LBEA 1DQ4A 1GANA 1K12A 2JG8B 4J2BA 1VBC3 4KHNA 1ZYBA 2PLV1 5L9RA 2ES3A 1JHJA 1H0BA 1CD3G 1MHYG 3NAPA 3RRDA 5BNOB 3BPZA 3FFQA 3JD73 3QOPA 3K4DA 5FWEA 5FDBA 4KWLA 2LTNA 2UU8A 2W08A 4IUGA 3RMXA 4BMBA 5BNOC 1D4M1 3J7HA 5FUIA 3PDQA 4QPWA 4ZPIA 1GOFA 3H8RA 4COWA 3OUIA 1IPKA 3WQ7A 2WDBA 3S9HA 5J37A 3VD3A 3WG4A 5CBLA 2J1VA 3GF6A 4Q0PA 1UN1A 3P3PA 3IDBB 4XHXA 1NXMA 4JDNA 1UOFA 4AVVA 4FK0A 1DYOA 4XJUA 3ZKYA 1RUE2 5A3PA 4HANA 2L9LA 1REEA 1JZ7A 4HCBA 3O0WA 2HWC3 2E33A 1RHI1 4CEWA 4M3CF 3LQCA 1W2TA 4YYOA 2XQRA 4WVWA 3D3AA 3ACIA 4YW6A 2JG9B 2HBTA 1UCXA 3SQ2A 2BGOA 1S2EA 2C6SA 4BCUA 4EN7B 4DO0A 4FXGB 1W6OB 4GH4C 3C7EA 5L36A 4QKFA 2J7MA 3OBZA 4DU1A 3ZFFA 1N3QA 1RMU2 4I0AA 3KM5A 5F5QA 4BJ0A 3AKSA 3HEIA 1GYKA 4HBNA 2HWF2 5DG1A 2E7TA 2XPJA 2VC9A 4AF9A 2BERA 4Z92B 1K5MA 4FAHA 5A3MA 1YJLA 2BBVA 4QPGC 3BN6A 1OKQA 1FAYA 2A73B 3N9OA 4IEPA 3S7EA 2J22A 3ZXFA 1DZTA 1ND2B 4PBPA 4XEZA 3M8LA 3H42B 3TABA 1S0IA 1WZXA 3FLRA 4EN0A 2FDHA 1RTVA 2JHAA 3G7DA 3PUQA 5L73A 3MKSB 3LFIA 2VIXA 5JOWA 1PIV1 1B35C 2VU9A 1SLAA 2W2IA 2Y8KA 5D1IA 4N90A 4AEJA 5CFDC 5JCTA 5C4WC 5JMOA 2EXJA 2HWC1 3U11A 4YGCA 1J83A 1PGL1 1XE8A 3MHZA 4S2GA 2JHCA 3SEPA 2C5DA 1ENSA 1NLQA 2D93A 5GZDA 3TAGA 1H8TA 1S2BA 2NM1A 2HEVF 2QZ3A 2VCCA 2WFF3 1HJGA 3LDBA 1QJFA 1W6NA 2FMDA 3A4UA 4JDMA 1NY71 3WP6A 1MQTA 2YBPA 2WA3A 4FXKB 1NKGA 1GLHA 2X29A 2X53S 2XJSA 2H6CA 3Q8AA 3W9AA 3ENRA 3FFZA 3NKTA 1F4AA 5FZAA 3O1MA 2LW8A 2FDGA 4GKYA 3KV9A 2XLFA 2VPVA 3KS7A 1NY72 2YV8A 1WKYA 3ZYFA 4FPKA 2OVPB 3NNFA 4JGYA 4AGGA 4R52A 5DMYA 4CCOA 1MEC1 3ABZA 1JW2A 1QGLA 4URTA 2WAAA 4YVSB 3O1TA 5E16A 1YQ2A 1S55A 4AQSA 5AFEA 4BQXA 1HXS1 1FZ0E 4KI5M 1J3RA 1RJ8A 1RYYA 4YSFA 3GHNA 3RZHA 3N7KA 1LODA 3GYDA 2EIBA 4XXPA 4INDA 5DZEA 3B3QE 2PELA 2KA3A 2QFEA 3RZGA 3PURA 1NXD1 3MW3A 2ET1A 4AGVA 4BQ5A 2TNFA 3FBMA 3VBHB 2ZA9A 5DABA 1W28A 5AC92 5JMCA 1R092 3CF6E 4B3NA 3OYWA 4LULA 3E4YA 1IS3A 5IVFA 1UD1A 1TVGA 5DN2A 3QEPA 1GP5A 5FZOA 5JDBA 4FO9A 2PQQA 1UZVA 1VMHA 4GALA 2YGMA 3ACFA 1QDCA 4MYEA 4IERA 1WCUA 5C9AC 2PHUA 2OW4A 4XJZA 2VBPA 1Z7S1 2YB5A 3C7GA 1XE0A 4PDWB 2WNOA 5I0TA 1XNCA 5JI7A 4WVMA 1AL23 1W2NA 4IV3C 5LA2A 5A6YA 2VD7A 3UKTA 5HPOA 1NG0A 3KD4A 3ZMNA 4F8AA 3JCIA 4Q4Y3 2VOKA 2ZAAA 4D6QA 2WN3A 4CDUC 4ASKA 5FZ3A 5JOYA 4N7UA 3UIQA 4ZXKA 1LGCA 5FZIA 5SV5A 1W8OA 1XNKA 1YQ6A 1IG0A 4KWJA 3PL0A 4WBBA 4L2NA 5A7PA 1N47A 5L9BA 2X5IB 2WC2A 2UWCA 4YM3A 2RDQA 2XJVA 3FLPA 3KCXA 4MSVA 5GLTA 2WZPP 2EIGA 3U4SA 2R6QA 2TBVA 2P37A 4RS5A 2QQLA 3WHTA 3NRUA 1OF3A 4ADNA 2C26A 1C4RA 3A21A 5FZ6A 1D2QA 4GAMC 5FO8B 3VD9A 1VJ2A 4AKHA 1OI6A 5FXXA 3B01A 2XH6A 1IPJA 3PLQA 5FLJA 1CLQA 3SLIA 1Q9YA 1NCQB 1QJY2 4KG0A 4G9SB 2Z79A 1HKDA 3SCXA 4LQRA 2RM21 4HSLA 3WG2A 2VR4A 3UO3A 1Y4WA 3WDYA 4D3WA 1CX1A 3RYKA 3T2PA 2WIIB 4K3UA 2E6VA 5A3TA 3CBNA 1VRH1 1D4M2 5G05L 4TZDA 4XYXA 2ZX3A 3J7NA 1WCSA 4EN8B 4HCCA 5E88A 4XIOA 1ASJ2 1PZ7A 1TG7A 1W0NA 4JRQA 2DVBA 2ZGQA 5FXWA 1ODNA 5ANQA 5A1LA 1W03A 1VRH2 3OGSA 3WINE 4N53A 1FZ7E 1LHNA 3OGVA 4O9GA 1VBA2 5CFCC 3IN9A 1PZ9A 2NN8A 1FZ2E 5IATA 1J1TA 3HNBM 5KXDA 3KV5A 1MHZG 3PUSA 2A1XA 2VZSA 4XBNA 5CKQA 1RUI1 4YM2A 1JH5A 5AVPA 3VL9A 3NSTA 3ZYPA 1FYUA 4MGQA 3WQ1A 4GAZA 4WM7C 5IVVA 1RVF3 4BDVB 1RUD1 4OHYA 4AFCA 3CQOA 5FP4A 4O61A 1BJQA 4O65A 4Q27A 1V70A 3IKWA 4QX7A 1IG9A 5CB7A 1GFF2 1NZCA 2WZ8A 3IDEA 4L11A 5CKNA 1XNDA 2VNVA 5FWJA 3TN93 2XHNA 3QERA 3HQUA 3MF6A 4Q4Y2 4XJ8A 1M06G 4BQ2A 3VBSA 5EQUA 1RUNA 4DTNA 4MGKE 2JIGA 2DCKA 2R073 1EUUA 2WS92 4E8CA 1XXNA 4CVUA 3IIIA 4YVSC 2J1UA 4NHYA 2R0HA 3KWVA 4EPHA 1LGBA 1RUC1 1XE7A 5JZGC 3MUZ1 1X8MA 2C24A 3O1PA 2PHLA 1W2AX 4DFSA 3LGRA 1I9RA 4PJYA 5CVRA 4NWWA 4UW3A 3IPVB 1QQP3 1J84A 2OUHA 5D8AC 5I8TA 1MZ6A 2TEPA 2DTUA 2P1MB 1DGRA 4KGGA 4JQTA 1MS4A 4FPEA 3WEZA 1WW6A 4XFFA 2W39A 4W65A 1RUOA 4LOSA 4WVZA 4IEOA 1LNSA 2P3JA 2WFF1 3ZSLA 4FJ8A 1AF9A 4Z82A 5JPMB 4NIAA 1QHDA 2W92A 1O3TA 2CWMA 5E8AA 4AWDA 1ZREA 1U5ZA 1TEIA 1DBNA 2ZEWA 4QHZA 1BEV3 1SBEA 3BCWA 2Q8DA 4BLJA 1UZZA 2WFF2 3AP9A 3CJIC 2WL1A 1IS4A 4LBQA 3WNPA 1JZ8A 2P5GA 3ST7A 4DY5A 5B4XA 3L1NA 4QU1A 5FK8A 1SQ4A 2Y26A 3OGLB 1NCRB 3MYXA 3BOPA 4NAMA 3E1F1 4OMDA 3PJYA 2Q8OA 1CAXA 4GWMA 1UXXX 1CAWB 2WS91 3O14A 3ZPOA 1XVEE 2RV9A 2EAAA 3KVBA 5F3CA 4HK8A 4D8MA 2XBO3 3CNAA 2LF6A 2GC2A 3AMMA 1UZYA 2WSUA 5DAXA 4FPLA 5IVCA 3LA2A 3PJQA 2GNBA 4QQPA 2RHPA 4PLOA 5C33A 5I0UA 1FZ6E 1G6NA 2B7MA 2CYFA 5L19A 4CZSA 1QXJA 4XBQA 4QPGB 3WP5A 2A3YA 3DPRC 5FYTA 4QKNA 4A7ZA 3KF5A 1ZZBA 3LSEA 2VH9A 1XU2A 3AB0A 4PLNA 1DQ2A 3H8XA 3HQXA 3UYJA 5T50A 1K5MC 4HG6B 2C4XA 4M3ZA 4DU4A 2R0FA 3ACGA 1MVEA 3HT1A 1X9PA 1IHMA 3HD8B 1Y9QA 3M2MA 4J2EA 1AJKA 3PHMA 2LALA 5AC91 1S0JA 4OZXA 2F4LA 5FPVA 4DXZA 1QJX2 1AR61 2XBO1 2OZMA 1R1A1 4FJJA 2P3YA 3SCFA 3WY6A 1CZTA 1YO8A 4MHRA 4WVVA 1UQXA 1VIWB 1B09A 4HL0A 3O1SA 3DYMA 3RZKA 3ZM8A 5GALA 1CJDA 3WUCA 3R6SA 2E32A 2QUOA 3KGZA 4N9IA 5JXGA 4M45A 1RUI2 2XVLA 1P22A 5GZFA 2Y6JA 3RZLA 1C5IA 2K46A 2MNGA 3B69A 3EMRA 1S2KA 1W8UA 4LBNA 4S2HA 3ZXDA 1IQDC 5C6CA 1LOAA 4QX1A 5FZ1A 5FXZA 3NO8A 1JN2P 3AMHA 4OQ8A 5IAXA 3O5SA 1ZZ8A 2NQYA 3OEAA 4X8NA 2OUJA 4YW1A 4QMAA 4AVTA 1D4M3 2BUKA 4R9DA 4WM8C 5DUVA 4E2SA 4QM9A 5LA9A 1HQNA 4XURA 4K8RB 2PFVA 3VD4A 1JZ6A 4OZOA 5J3UA 2FCVA 2VE1A 2R062 4R4ZA 2B45X 1QJX3 2B8MA 3QH7A 4XCAA 4Q0QA 4AI8A 1A8MA 1H4HA 4Q29A 1G9AA 3W58A 2BNMA 3C2UA 2B4KA 2D3SA 3FHAA 1HQLA 4LTAA 2W1QA 4JAAA 4AI9A 5CAZA 3ZSKA 2JG9A 2WBKA 2VXRA 4NPMA 3UK9A 3V64A 1RGSA 1RVF1 4U36A 3FBYA 5FKBA 1Q8SA 2GDFA 3OPWA 4J1XA 4HETA 5DZGA 4XC9A 4M4RA 1UKGA 4ATEA 3P5BA 2DYCA 2BDRA 4MUVA 2ZCWA 5A33B 2QCSB 1H1MA 3QESA 3FE5A 3Q9OA 1VBD1 4LK6A 3VN4A 3O1RA 1EYBA 1V00A 4UT5A 1TME1 1JZ4A 2QQKA 3AX4A 1T2XA 2B5HA 4P9WA 3T1LA 5BNNC 4YZ5A 1GZWA 1MTYG 4G4FA 5LRRA 4XAAA 3U1XA 3WNOA 1GZWB 3DUIA 3KT4A 1CIYA 1OUSA 4GWJA 5IREA 5F5AA 3NVCA 4AFDA 1PM4A 3LPGA 3LB9A 5KHIA 2P3IA 2E7AA 2IWGB 3ZYRA 5FP7A 1LOGA 2ZOEB 1NQDA 4SLIA 1U5XA 4J6GA 2WO7A 2BNNA 1DYPA 4FI9A 2QNKA 2ZEYA 3AFGA 1N1CA 1OXCA 3AYAA 3T1MA 3PTYA 2P1BA 5C8CB 4BB3A 3I2KA 5A7WA 2YY1A 1F2NA 2YDEA 1REFA 2Z69A 4DRRA 2WT1A 4B4PA 1VBC2 3WDWA 2ENRA 1S1AA 1V6LA 3AZYA 4RSUA 3ES4A 4J1WA 1ZBE3 2VMCA 4UBHA 4PF1A 4AQTA 1C8NA 1AR71 2UURA 4GQ7A 4EE2A 5K0UC 3SJJA 3PUIA 4YM0A 2OIIA 2RE9A 4ET7A 1O5UA 3SPZA 1ONAA 2JJ6A 2VOXA 1OD5A 5FYCA 3VBUB 4CU8A 4A41A 4KBBA 1TQ5A 4BM8A 1LR5A 4Q0UA 3K3OA 4RL7A 2D6OX 5EJ1B 5JIUA 3HPNA 1W39A 1OBNA 4YPJA 2PHDA 1ZBA1 2HWB3 2XJTA 5FOJB 4NHMA 5ABJB 3DKQA 2YROA 1UY2A 4HVRA 2RJ2A 2V72A 3ZFGB 1T6BX 5A7OA 4P9YA 3FJSA 1R1A2 1H8TC 3FC0A 3VBFB 3SQ0A 3Q8CA 1DGLA 1HDKA 3MO4A 1URXA 4QNDA 4QPGA 5FO7B 2F6BA 5A7QA 3H3UA 4CP9B 1R093 2FCTA 4OULA 2WLPA 1TE1B 2RR11 1AZDA 1U12A 2VZVA 4CEWB 3UKVA 2RS12 2W68A 3FN9A 1AR83 2G9ZA 4M3YA 4KBZA 1L3JA 2D97A 1SCSA 2ARAA 2LRPA 4AEMA 4HVQA 1RUG3 4JDOA 2G9FA 3P1IA 2R7EB 1SPPA 3L8BA 5GLUA 3SC7X 4PI0A 1GP4A 5ANNA 1SACA 3WCSA 4A45A 1HRV3 1GV9A 1PMHX 1S0DA 4MX3A 4DEVA 3SHRA 4JGZB 4Y20A 4H7MA 4OUSA 5DUXA 2YMZA 1JYWA 1VBB2 3CZJA 1ENQA 3DECA 4QXKA 1KGYA 2ADEA 1L7LA 1AYM3 1RB8G 2RS53 4E2GA 2VMGA 1W0OA 4LNVA 2VCBA 1AL21 4OI4A 4QNCA 2X09A 5JSPA 4XFGA 1WA6X 1CAVA 2Y64A 3AMNA 1AYM2 4JS4A 4M42A 1C8M3 4F3JA 1KDKA 1O8SA 1Q43A 1YUDA 1XBFA 2BGPA 2RS31 4GA9A 4JGYB 3VKFC 1CPMA 3BALA 2GSYA 2QDNA 3B7MA 1C28A 3KCCA 2WWJA 4M3XA 4W8JA 3U4XA 4CPBA 2ERFA 4AYUA 2J1TA 4OUMA 4IEQA 3VBOC 3QEXA 4JKMA 3I59B 4JTOA 4PQ9A 4CPBD 4LBMA 4N43A 4FFHA 4I30A 1BK0A 1QJEA 5L7OC 4N43B 5JXIA 1GUIA 4AVBA 3D0SA 2P2KA 4ATFA 3POGA 3RYRA 1SHWB 2IXKA 2VMDA 2ZMKA 1JYVA 5K0UA 4IETA 1QWRA 2Z2SB 4YVWB 2BZDA 4BIOA 1PO12 1H6XA 2W47A 4QX5A 4AEDB 4XFAA 2DDUA 3WF3A 4A44A 4CDXB 2QQOA 2D3RA 5TSWA 3ZYBA 2XWJB 1VP6A 4UFHA 4QX8A 4Q0VA 2V5YA 5J98B 5T5LA 4Q4V1 1QEXA 4XCBA 2RDRA 4DPNA 1PNGA 4IV1B 1D0GA 4LJHA 5ISLA 3O0XA 1YFYA 3DL3A 5T5JA 1FZ3E 5K7PA 2HEYF 2I07B 1FZ5E 1J3PA 5EFUA 5HV0A 1JTZX 1W9WA 5FTTC 3RQ0A 1W8WA 3QCWA 1EUTA 1COV1 1VBE1 3NNJA 4UFJA 5F3GA 3ZFEC 2ORXA 3LWCA 4CDWB 3TYJA 2XLAA 4P14A 3QEIA 1WD3A 3CO2A 2V4VA 1VMJA 1HW5A 4FPOB 4KU8A 4AKIA 2PYTA 4IE5A 2MPFA 4OUEA 1FZ4E 3FLTA 4MXWB 4UW5A 4DTMA 1XRUA 4CP9A 3PNAA 4DY3A 2QQPA 3QNOA 4LHNA 1FOD1 2X5IA 1JOPA 4RR3C 2FZ1A 3C8XA 1MZEA 3VGIA 1ZZ7A 1ZBA2 3LZIA 4FJMA 3U75A 3ZSMA 4YVWA 3J7MA 2NPIA 3IM0A 5IVJA 2ZX0A 2P1PB 5IZ7A 2ZGSA 4D6SA 2DVAA 1XVCE 1JXNA 1TNRA 4OI0A 5JOZA 3RS6A 4PIZA 1V6NA 4I3GA 1F35A 2CHHA 1DLCA 4MGSA 5DPNA 1NQJA 1SLTA 2VY0A 3SKJE 4LXLA 1VLNA 3AP7A 1FPN1 2HEWF 5EP9A 1H6YA 3OGRA 4LPLA 2VZUA 3KHBA 4MVTA 3U07A 2QQJA 3OPZA 1QF3A 5D8AA 4FVVA 5BXXA 5FXVA 1COV2 1VBE2 5AFBA 5J09A 3ZO0B 3VZKA 1SDDB 3E5QA 4UXAA 4CDXC 4LO8A 4IEVA 1ZVFA 1QOSA 2O14A 1LDKE 1UY3A 3LKJA 3USUA 1XC6A 3RI9A 2VZOA 3DF0A 2W95A 3AKTA 1Q3EA 1CZSA 1PO23 4N43C 4XBLA 3CIHA 1XOYA 3TN92 1FI2A 3TL8B 1H9WA 3OYWB 2I74A 5FO9B 1E5IA 2E7QA 4GB31 1W6OA 2VMHA 3I2DA 4PIXA 5FZ9A 4IW3A 3TAFA 2XJQA 2XVGA 4B29A 2DURA 2VUJA 1QY4A 3MI8A 1YHFA 4C1XA 3NMBA 2WZR2 2B7YA 3ZVXA 5FZCA 3R05A 2PMWB 2RJKA 3ZIWA 4Q4X2 1YIFA 1OF4A 4DTXA 2V09A 3POFA 4I2OA 3EXUA 3ZN6B 1R091 2OXBA 2Y6HA 4F7ZA 4OQ9A 4XF9A 4A7KA 1YFUA 4UBGA 4MV2A 4KWKA 4COZA 5IUQA 1XL3C 4Q4X3 2NP0A 3WDVA 3ROUA 3MICA 2ZHLA 4FPCA 5JZGA 3OSDA 4YLZA 2Q1FA 3IAPA 3H8OA 1KJRA 4G3YC 4CEYC 3AZZA 1YYNA 2KM2A 2CGNA 1D7PM 3VUOA 2JH8A 4NR1A 4HT1T 3USSA 2K2SA 3X29B 2VW0A 1RMU1 3RMBA 1GZTA 3GBFA 5FAXA 1APNA 2GC1A 4EJRA 2VZRA 3MFCA 1MS1A 3EHKA 5FMOS 3RVHA 1PK6A 2A5ZA 2BNOA 3SVIA 4DUXA 4KHYA 4IT5A 4BYYA 1AX2A 1UY1A 2VQ0A 3ILNA 3N9LA 3WDXA 4C8DA 4PT6A 3J9SA 4JHTA 1H8TB 1KITA 1DF0A 2PAEA 2YC0A 5DDJ3 3SQ4A 1RUJ1 1CN1A 2ZXQA 4GMP1 4UFLA 4XF0A 4YG0A 4AVAA 3BTYA 1LOFA 2ID4A 1NUKA 4XW3A 3OJBA 1YLLA 2A6XA 2IXLA 1LEMA 2A3XA 2JB4A 3N9MA 4OHWA 4R9BA 4RS5C 1WLDA 2OQ6A 2QJVA 4GB32 4M01A 3VDAA 4Y1XA 3VDDC 1UOJA 2QQNA 1N1SA 3PVEA 4D69A 1GNZA 1FMD2 4FPGA 2OT7A 4TLGA 4XUNA 4DMIA 1QNYA 4WZCA 5FP3A 2G19A 3VD5A 1PGW2 2QQUA 1AXKA 1H4GA 5GZEA 1WW4A 1QDOA 1FZ9E 1J3QA 2RS11 2EF6A 2ZHMA 4JKKA 4LR4A 4MLOA 4DNYA 4HKOA 2KD7A 2WYFA 2GMEA 4ZU4A 2GC0A 4MXWA 4BMEA 5DDJ1 1LGNA 4RQPB 3J27A 1UU4A 2HYXA 5FMOL 3T2OA 2OPWA 3VBSC 5C5UA 4M3WA 3UGFA 4A6SA 3ZKUA 3MV01 4AHYA 1I1EA 1W9SA 4NHLA 4ES8A 1IKPA 1G9CA 2P1NB 2XKPA 2EALA 2YG0A 2FQPA 1Y9MA 3DPRA 4OFGA 4XMAA 2PQSA 4OI2A 1CGPA 4ITCA 1I5PA 3J26N 4HPKB 2IFWA 4RYDA 3O1UA 3MGUA 5L9VA 4C1WA 3AP5A 1XPWA 1N1TA 3DKWA 1RUJ3 3NWKA 1JU3A 3GZTB 2JDMA 2VOVA 3E6DA 3JZVA 5FYIA 1QXPA 3UT0A 1IS6A 3GCWA 1XNAA 3PVBB 4DTUA 3TAEA 1H30A 4AI3A 2W87A 3D5OA 1YI9A 4NROA 2CAVA 3SITA 4X5MA 2R043 4IEXA 3PVNA 1F15A 3H3ZA 4NRPA 3SISA 3S5AA 2OYQA 2WNUC 3RMCA 2XJRA 3B9CA 3M7AA 2D43A 1JU4A 2BBAA 4OI1A 3WZ1A 2O0OA 4J2AA 2P3KA 4IE4A 3VZOA 2HWE1 4LT5A 1AR63 1LECA 1DYKA 4FPHA 2JB8A 4AAXA 2AEZA 4LBOA 1PVC3 2DV9A 3W59A 4AK3A 4Q8KA 1RHI2 2AR6A 1DGWX 4Q1PA 4P9LA 4CEYA 2HWB2 4YFWA 3PTRB 5F3EA 1ULOA 3HQRA 4ZU5A 4E4ZA 3PIJA 5E6HA 5FKCA 5KWRA 1ZM1A 4QQOA 3ZN4A 2VZ1A 3O1OA 1C5HA 1PVC2 2DF7A 4AFBA 2K0GA 4QB2A 5A6QA 3DYPA 5GZGA 2JH9A 1F5JA 2WINB 3SQ1A 5A3NA 4YW2A 1X36A 1UYYA 4JX0A 2VJ4A 3VDCA 5HCBA 4QX0A 4WM8B 3MDPA 3TNQA 2BOJA 1JYNA 1WAFA 4J2DA 3I2JA 1FXXA 3KSCA 2Q4SA 2WQ4A 3MIGA 1UYXA 2I45A 2YGLA 3LIHA 4LUMA 4EZ4A 1XYOA 2YUEA 4ZKTB 2I2SA 2DTYA 3LCPA 5FMDA 3GM8A 3RNSA 3SXWA 5K8SA 1WA4A 2WA4A 4I09A 4K20A 3ZOIA 3WDTA 4CCEA 3KMHA 3HNMA 4L8QA 4Y1UA 1VB2A 2H0BA 3H1WA 5CADA 1ULPA 1CAWA 4RNGA 1SG3A 1JYIA 3UGHA 1OQ1A 4PF5A 2ZGMA 2BW8A 1HB2A 4Q4W3 3VBSB 5I93A 3VZNA 5LA0A 4FJNA 3I2IA 4U2AA 3POWA 2J1SA 1MS5A 3VDBA 1OPMA 3M3IA 1LCLA 3GZEA 1WBLA 2WR9A 3WSOA 3AXDA 3CKHA 3KQRA 3OY8A 2C0ZA 2GNDA 2ZBJA 4CCJA 2RKHA 4FP2A 5AC93 4UWDA 4Z2WA 3VLBB 5I0SA 2A71A 4COYA 1DG6A 4RGGA 2XWBB 4D7SA 3WNMA 4NMIA 2R1BA 5FQ0B 1NZIA 3LE0A 2E9QA 5F5CA 2YHJA 4CCMA 5JR2A 4NIGA 3V0AB 2QDRA 1S0FA 1UIKA 5LW9A 4XUTA 4Y4RA 1WUVA 4TXWA 2Y6KA 3H1YA 3DYOA 1OHFA 1UX6A 4YGDA 1G7YA 1ULDA 5DUUA 3UV9A 1QU0A 3VKLA 4AHZA 5KC5A 3OF1A 2FHRA 1E57A 4QPIB 1JOBA 4LHLA 4ZXEA 5A33A 3UL2A 4CU9A 3VZLA 4CP2A 4KNCA 4CDUA 1R082 5C3RA 3KGLA 4LBKA 4QPIA 4BQ1A 1GP6A 2H6BA 3HL8A 2GU9A 1MEC2 4LBJA 3TRSB 2JEMA 3KCYA 2NMOA 4NHXA 4LORA 3RJ2X 5KC6A 3RDIA 5HCAA 3CJIB 1R1ZA 2E63A 3AJZA 4IL7A 4JTNA 3IMMA 2RMU1 4NVPA 5CU1A 3THCA 2W46A 1NAEA 1LOFC 1BEV1 4XQ4A 1MZ5A 4Q8LA 3CZUA 3ZMOA 4OCTA 1H2LA 4AL9A 4EP9A 1G8WA 2XR4A 3IT8A 3WR0A 5FPXA 2R30A 3T2TA 1OSGA 4NRQA 1VE0A 2C1FA 4Q5OA 3KV4A 3TAYA 2GMMA 4PLMA 3MIEA 5DUWA 3R0RA 5C3OA 2DWRA 1LHVA 2NYYA 4TN7A 3N7LA 4K8FA 5JOXA 1XSQA 4HK9A 2WQZC 4GJYA 4BPZA 5C5TA 2WUHA 3ZXAC 2PFTA 3JD72 4S2FA 2ZGTA 1UU6A 3LA3A 4QGNA 4UFKA 2FBEA 2B1EA 5I0DA 3ZDVA 5BPXA 3E5UA 1IQAA 4LIVA 1GOHA 1G86A 3HGKE 2OZ6A 3HAGA 3O7OA 5F8PA 3NAPB 5IFTA 1ZZCA 2X05A 1XMFE 2VNOA 4DEQA 1GOGA 3I54A 2WO3A 3WNKA 4XJ9A 1CWPA 4FK4A 2V4AA 2VMIA 2YFZA 4CUAA 3BI3A 3LF7A 5L7OA 1J58A 5T52A 1VALA 3OGGA 3E97A 1A8DA 3C6OB 3I2OA 1Z78A 4WM7A 4LO7A 1DDLA 3BVOA 3IAQA 1ENRA 2ILMA 4MHUA 2LM3A 4PCRA 3T4VA 3H7YA 1E5SA 1IKQA 1WMFA 4XMIA 5F2SA 3ZFEA 4WM7B 2ZGKA 4DTPA 2JDNA 1QJU3 1QXRA 4XHBA 1GBGA 1KQRA 5AVAA 4AVSA 4COUA 3ETQA 1CVNA 2AH2A 2F4PA 4TLFA 1Q5OA 1KRIA 4NPRA 2BFUS 1NX9A 3A22A 4K7JA 4XUOA 4OHZA 1JYXA 1OOPB 4R9AA 4QAWA 5I8YA 2E53A 2JENA 3JD71 5FUNA 5JWPA 5C8CA 3I49A 1OOPA 3FUQA 4ZHNA 1RITA 4QXHA 3R4SA 4DTOA 4Q4Y1 3IZOA 3ETPA 3HMYA 4BXSV 3GZUC 1V6OA 4IV3A 3W5MA 1I6XA 5F3IA 2JQTA 4QM8A 2Y6FA 1TME2 3ATGA 1OVSA 1LULA 1RC6A 3L2OB 4E8DA 5IHRA 1ZBA3 4PI2A 2UWBA 2G1MA 1C3HA 1BYHA 2ZGUA 1XMHE 3H3LA 5E89A 4AFAA 4QXBA 3NV2A 4IXLA 1LEDA 3AMQA 1IS5A 4FJ5A 2HWE2 4Y22A 3NV4A 1UO9A 2AZ5A 1NCQC 4XVHA 1FNYA 4EWAA 2EIEA 4OYUA 4XQWA 5A3WA 5IK5A 2D6NA 3VZMA 3NJZA 5HI0A 2DUPA 3CLPA 1UMIA 1VBA3 3UESA 4NIHA 4Y24A 3ZIXA 3SNNA 1W2UA 1SZBA 3Q8FA 4Q1RA 5IAVA 4KHSA 2W9XA 3ZFEB 4GJZA 3TEZA 1S0BA 1H2KA 1W0PA 2WO2A 2EXHA 4NJ4A 4ZU7A 3ACLA 4RN5A 4XAEA 2E31A 5D21A 2XJUA 3WDUA 4RG8A 2Q8EA 1RXFA 2B9UA 4KHQA 3WQ0A 4D0QA 3LFMA 4IV1C 1S0EA 2RCUA 4B08A 2QE3A 4Y20B 1S0GA 2WN2A 3N36A 4AE2A 1PNFA 4H3WA 3SH5A 4GH4A 3VV1A 2FYOA 4XABA 5FY4A 3BTXA 1ACCA 3QLQA 1XVGE 3EB7A 3GZAA 4WV8A 3VHPA 4CCLA 4CDUB 5C3SA 4FJGA 4EZHA 3WW2A 5FOBB 3KLSA 1K45A 2ZACA 3FX3A 5LASA 3CFOA 4MOAA 1WWYA 5FYSA 4BHPA 1RUF3 4IV3B 1SEFA 4PDWC 3NJYA 3KZ4C 3OCPA 3WQBA 4AQ6A 1N3OA 2DVGA 1H8VA 3IDAA 4XF1A 4YZ4A 4NRMA 3W20A 4EWDA 5HCFA 2XONA 3VBOA 1BMV1 2RDSA 1JMUB 5BYNA 1L7RA 3AJYA 5FY5A 3PU8A 3OPTA 4KWUA 1POQA 3BU7A 3VBOB 4DRVA 4YZ2A 1W9FA 3B9IA 4FPYA 3RMDA 1QOTA 1H9PA 1Q8OA 2EXKA 4HXCA 3AYEA 3L0MA 3VBHC 5FY9A 5H9QA 2VL4A 2A6VA 1VBD2 3VBFA 1ZA7A 5LBBA 1OUXA 4V2WA 4V1PA 3A0NA 1EPZA 3J7LA 3V7DB 1IH7A 1SLIA 2ZGNA 1ZRFA 4QD2A 4P9XA 2Y60A 1ULEA 3C7HA 4DU3A 1CZVA 2H4TA 4LKSA 1QQP2 5LBFA 2JICA 4FSJA 1SCRA 2W3JA 4P5YA 4UOJA 1FPOA 2CAUA 3L2YA 3AZVA 2VQTA 3LPFA 1XU5E 3I3MA 1DFQA 1BBT1 1UKRA 1COV3 1VBE3 4YM1A 1RL3A 4JGZC 4Q2FA 3AVRA 1E5RA 3KVAA 4UF0A 4IV1A 5T5OA 1PMIA 4N9HA 2P5BA 1F31A 2VZPA 2JPNA 1NCQA 5FRAA 5A7SA 5I91A 1H2MA 4JVAA 4RL5A 2ZGPA 4Y1VA 4CUCA 3H8UA 4BOWA 3E6CC 5FPAA 1PO21 1ND2A 5EYYA 2WWSA 3JB4C 5JLVA 3U0ZA 2WSVA 4HLTA 4QU2A 5A80A 1MVQA 2JKXA 3AM2A 3K48A 2D40A 1W6MB 2BEOA 2VGDA 1ND3A 2GZWA 5ACA2 1BVVA 3NCIA 4E4HA 3NHGA 5KXBA 1DQ5A 2MZWB 1OA4A 1XQNA 2A75A 3CDZB 1LTEA 1MS0A 3HVDA 4CDWA 5ABJC 1ULFA 4YRDA 5A3UA 2OVQB 4HOOA 4M3RA 5JI9A 5FYYA 5JXHA 2PHXA 3DXUA 4QB1A 4XFHA 2JWPA 5C7GA 1STMA 2ETEA 3VBUC 5KXCA 2QTWB 4GD4A 1ULCA 4LLFA 2JDZA 5F6LB 3VBHA 1NT0A 5B4NA 1X9TA 4XUQA 5F39A 5K0UB 4HPKA 2BFUL 4I3PA 5H37A 2JDYA 3ZXKA 4A7YA 4HN1A 5B2GB 2JDHA 3S0MA 1WMDA 2A7AA 3AVSA 3J8F1 2CV6A 4X8PA 5LA1A 3LD8A 1JHNA 1Q8PA 3BODA 2XMLA 4CXWA 4QKDA 3TJYA 1YEWA 4IEYA 1MS8A 4QX3A 3B94A 5CKMA 2PHRA 1PGSA 4Y1YA 4ZZ5A 3J8F2 4QWNA 5C3QA 3WW4A 1AVBA 2VTXA 4YW5A 3NAPC 5LEKA 2NMNA 3POEA 3UKNA 1YC61 1RUH1 1JS9A 5FIXA 2LS6A 3OD0A 1QJY3 1ZRRA 2WNVB 5FYZA 1GU3A 3MZHA 3WV6A 2A6YA 4Q4V3 2P17A 5FYUA 4UYBA 5FY1A 5IVEA 3M70A 4JRAA 2CNAA 2GAUA 3OUJA 5KR7A 5HXVA 4K21A 3S57A 5IK4A 1UYPA 4NOTA 3GCXA 1O59A 4XOGA 5K9YA 4FCAA 5DAVA 2JDPA 1HJFA 2JG9C 4DXRA 2D5FA 2VTXJ 2GP5A 4EN6B 1BVP1 5HBAA 3ZR5A 1KDMA 2W1SA 4NPLA 3ECQA 3ILRA 1UY4A 1JUIA 3DGTA 1R64A 1VBC1 2ARXA 2PLV3 1YI7A 2B46X 2RS32 3S6PA 4FQZA 4DTJA 5LZ6A 3HJRA 2RS13 4RFT0 3N9PA 2P5OA 1GWLA 1W05A 3NNGA 4JHZA 4QHOA 3SCHA 2FCUA 4GKXA 5CIRA 1WLTA 1ZZ6A 1W6NB 3A7QA 3CEWA 4ORFA 4AVCA 4IE7A 3ZYIB 1OURA 4A6OA 4DUVA 5D2AA 3WF0A 5A32A 5KHKA 3GJBA 4LLOA 2XG3A 4I9QA 2BQPA 2IUWA 2RM23 5DQ0A 1DQ0A 2ZEZA 1QQP1 2YC2A 3JB8A 1ZZ9A 1POV1 5FYVA 4EYUA 2VQAA 4KL1A 4QPIC 1V6MA 3WLUA 4AAPA 1RUC3 5BNPA 2VCAA 1XNTA 3K46A 2JG8C 4N53C 1WW5A 4WVMB 5CG9A 4IEZA 3D0JA 4TTGA 2YZ4A 2HYKA 4JS5A 2ZAHA 3DN7A 4IGPA 2RS33 1HRI1 1O3SA 4D7TA 2RR12 2YPDA 5HCHA 1RUI3 2DUOA 4AI1A 3THTA 1BHGA 1RUG1 2F17A 4XJWA 1RMU3 1Y43B 2R041 4K1YA 2AEYA 3TN91 1OLMA 3LAGA 4ES9A 1SFNA 4AFMA 4HONA 4ZONA 3WG1A 1W8ZA 5EIYB 1ODMA 5F37A 1QJZA 4QXCA 3NQHA 5CYYA 1BCXA 2R061 4CDQA 4AR2A 2VM9A 4NHKA 3AZXA 1RUD3 5CA6A 3NGIA 1SFYA 4IE0A 1K5MB 1ZRDA 3ACHA 2BWCA 3ZN5A 1EAH3 1OLME 1QKQA 4DS0A 2HWC2 1AR81 2JX9A 4RFRB 3LOIA 4AI6A 2QQVA 4LKDA 1LRHA 4LO4B 2JDKA 4RGAA 4EWEA 5HV4A 5M0TA 2XQXA 1HB1A 2ET7A 3BVCA 3CU7A 3M3OA 4N53B 2VG9A 3UETA 2LROA 3QEVA 5JPNB 5FPLA 3WG3A 5KBFA 4UAPA 5JXJA 2AENA 1C8M2 1ZBE1 4X5NA 2YFUA 4PQQA 3RMAA 3NW4A 1AR82 3MLLA 1O8PA 3NL1A 5FZEA 5T55A 5BNPB 1XMGE 2XB6C 2HD0A 5LB6A 4HSJA 1XSRA 5FYBA 1NCRC 2D44A 1X8EA 1Q8VA 3WVJA 2WAOA 1HQWA 4EV0A 2B8IA 3HT2A 4B1MA 1XYPA 4BH9A 1DCSA 5DDJ2 4BU2A 2GC3A 4KMQA 3WX5A 5G04L 3E4WA 2R32A 3KV6A 3BB6A 3TNPB 3SH3A 3UNPA 4ARYA 2DY4A 4B7KA 5FYHA 4I02A 1BEV2 2E51A 3E5XA 1RUG2 4NWVA 4UFMA 5A6XA 2QVSB 1HRV2 2PHTA 1EV11 1UW8A 3D4KA 3TOJA 3QEWA 3WW1A 3W21A 1UMZA 2Q8CA 2WNUB 2JE7A 2TUNA 2OZSA 1NCRA 5A1FA 1HX6A 3FMGA 3NNLA 4MO3M 3AYCA 1OQDA 5D8AB 2VO5A 3CJIA 4HN0A 2WNVA 4UW4A 4AI0A 1D2SA 1QJU1 5JZGB 3JXSA 2ZTNA 3VKOA 5EV7A 1OA2A 4YARA 2IXIA 1FX5A 2WNVC 3GALA 4P9GA 2Q1ZB 2V5DA 2ZEXA 1FPN3 1POV3 2ZPXA 1FOD3 4FJLA 1R083 3WXPA 5F2WA 4LUKA 2ZJCA 4M3CB 2EVXA 1FT9A 1M4WA 3AL6A 1F8VA 3BIEA 5C9AA 3JQWA 4FP3A 1ZBE2 2NLRA 2VAUA 3ZXEA 1G9BA 4BK4A 3V0AA 4YGBA 1NLRA 3RZJA 5FZ7A 3LZJA 2ARBA 1HV1A 2JD4A 4BZ4A 3FHIB 3IDCB 1HB3A 1ENXA 2BWAA 1LJ7A 1PO22 3SI6A 1A6CA 3GGLA 3NV1A 4A42A 3VZJA 4F83A 4J25A 1YIPA 2BGCA 2PHFA 1KFXL 1FZHE 1MEC3 3KT7A 4L0PA 1X50A 3CL1A 3LA7A 2ADDA 3ZXLA 5T54A 2J42A 1LB2A 1MZFA 3VDDB 1ZX5A 2JDAA 3M3EA 2WNUA 4N8MA 1NA1A 2WZEA 5FZLA 2WJSA 4XFCA 4FOQA 4MZUA 5BNQA 4A4AA 3OTFA 1RUH2 3OY8B 3WD5A 1AHSA 2D6KA 4GIQA 5KHJA 5GLWA 2A6ZA 1GZ9A 1PZ8A 1JW6A 4MG2A 5JUVA 4K40A 1FV2A 5FLIA 2P4EA 1W2OA 1DHKB 4CDQC 3B02A 4D7YA 1NE4A 2VUCA 1AX1A 1RUE1 4QKBA 3MW4A 3WW3A 3ZX7A 1QJY1 1YQCA 1TZOA 3HN1A 2VUAA 4DB5A 2J1AA 2HH9A 1SLBA 4Z07A 4DXSA 3FUOA 4ISRA 4MXVA 2ARCA 1UOBA 2WLQA 2IVJA 3ZYJB 3VBRB 2VQUA 4X6RB 5JR7B 1GQPA 1NLSA 1X33A 5LY2A 2VOWA 4CU7A 5LEJA 4M00A 3TWIA 1TNFA 4B4QA 4FPJA 4LEJA 2DUQA 4HKLA 4V2VA 4YFZA 3UJOA 1OPOA 4E4SA 3J2PA 1DQ1A 3FHQA 4W6YA 1V9U3 2HWF3 1FPN2 1NOVA 3W5NA 1P8JA 1PX4A 3T2QA 2ZMLA 2C9KA 1HLCA 1UZWA 4R8HA 2YC4A 1KXGA 4D6RA 3IBMA 3INAA 1WAJA 1CQ9A 3A23A 4XXAA 4C0HA 5F5IA 2JXAA 3T0BA 4ICGC 1U5YA 3SCGA 4LE4A 3C94A 2X5IC 4QDRA 4RR3A 5C4WA 3PUHA 1CAVB 4ARXA 3TBDA 3OBAA 1O4YA 3BIWE 4R4XA 1AR93 2HWD3 1UZ0A 3OB8A 3POYA 3T3YA 1NEXB 2ZKLA 5FBJA 4M0HA 4M41A 2DBNA 1AYN1 1CAXB 3B5LB 4JQRA 3MIHA 4LBLA 4FK2A 1WLCA 3IMNA 2XOMA 2GNTA 2GP3A 3CFPA 3I3DA 2XLGA 4XZPA 5EJZB 5CEHA 1WGPA 4RHV2 1UAIA 3K2OA 1YXWA 3WNLA 4MADA 2FDIA 1J1LA 3VKMA 4BQ4A 4TWTA 1FS1A 1AL22 4OLLA 4DXTA 5C8WA 4Y5Z0 2ZHKA 5FZHA 4XFBA 1YRZA 3KF3A 5C9AB 1AYM1 5APAA 1W8HA 4OHVA 4LHSA 1DLLA 5A3OA 1QJU2 1O4TA 2FW3A 2OS2A 4MGIE 4DOUA 4Y5TA 3MPBA 4NIIA 3M4FA 3WT3A 3AP4A 4I9LA 3I2FA 2OZJA 1PGW1 3LEIA 1Q56A 1OFSA 5JIAA 3VBUA 3ORJA 1W6QA 2RVAA 2DBIA 3GHMA 2PA7A 1RIRA 1UPIA 4I01A 4LBQB 1WD4A 5FYMA 1YFWA 2GALA 3RZMA 2R16A 5FZKA 4RD7A 2HJIA 1R081 5FZ0A 1KFUL 3SEEA 4B1LA 1CIWA 3SKVA 5LCWL 2RS51 1UOGA 5F9TA 3SUPA 5EWSA 1W6MA 1HIXA 1H1AA 4I0BA 4B8EA 1Z7S2 2ZGLA 4IE6A 1UIJA 4Q4V2 4P08A 5EZWA 4BWOA 3AC0A 1MR5A 4FJKA 4Y4YA 4NAOA 1SBFA 1MS9A 4QQLA 5ERLA 1DQ6A 2ORZA 1C1FA 5E1RA 4BK5A 2VMEA 5IFPA 3LEMA 2DVFA 5A7NA 4FOVA 5IW0A 3UJQA 4RHV1 5ACA3 2CWSA 3N9QA 4CE8A 1UL9A 2ZX2A 3LDRA 5DXDA 4DTRA 2RJLA 5CFDA 2VBDA 5FP8A 5DAWA 5A7WB 4JGZA 4A3ZA 1ULGA 4BXFA 2NZ9A 4FJIA 1O4ZA 3C6NB 3VHRA 4BISA 3HIFA 4CDWC 1N1YA 4FFFA 2PLV2 4FJXA 4LKFA 2VTFA 5FMBA 2XXZA 1BZWA 1I5ZA 4UF0B 2SBAA 2CY6A 1ND3C 2VW2A 5FCCA 4KGQA 3MIDA 2FMYA 1C1LA 4CUBA 4NE9A 1W8TA 4DUWA 4FTBA 4LO5B 3VDDA 1OOPC 4BQYA 1C57A 4IGOA 3C95A 2BVVA 3OUHA 3Q8EA 4FFGA 3MLJA 3FWEA 3OD4A 4A3XA 5C4WB 3AMPA 4PIYA 4C0BA 3OGKB 1B35B 1IOAA 1JYCA 3JBG2 3M3QA 3V65A 2EXIA 1YQ8A 3MF9A 4AGRA 2RM22 2P1OB 2W1WA 1UPSA 2WZR3 3C3VA 4M4PA 1AR73 5A1AA 4CXYA 3M1HA 4AEDC 2XUMA 1AR62 1VRBA 4LE3A 5H9RA 2YBSA 3NNMA 1ND2C 2WT0A 4LMFA 1US2A 2QZ2A 4PBOA 5EHDA 1REDA 5H9SA 2MMBA 2RDNA 5FZDA 5FQ0A 2XHKA 4BE3A 2N7GA 4COVA 2PTMA 2Z42A 4LK7A 1VRH3 2E26A 1LOEA 1EAH1 3ITQA 4GWNA 4KQ7A 4CUGA 2PAKA 1OH3A 1RJ7A 1WCQA 2QQWA 4TYSA 1K3IA 1US3A 2Y6GA 3KT1A 4YG6A 5IVYA 1CJPA 2VZQA 3RI8A 4H55A 2MW2A 4HZFA 2DFBA 4XF4A 4GB33 2D6MA 3QH6A 4GXLA 4IDZA 3QETA 3E6BA 1EAH2 4GH4B 5FZMA 3T0DA 1UNBA 1AXZA 1AX0A 1BK1A 1UU5A 1QNWA 1DZRA 3K77A 1W6QB 2Y0IA 5FJKA 2ZZQA 1Q8QA 1RUD2 3HR9A 2VCMA 2UYBA 3MIBA 1Z7S3 1W90A 3K3NA 1HXS3 5LBCA 1POV0 3O1VA 2DVDA 3ME2A 4N7IA 2C9AA 3I8TA 4Z1VA 2BU9A 2W5FA 5T5PA 2W52A 4PDWA 5FREA 3POIA 4AG4A 3NV3A 4UW6A 1VBD3 3M3CA 3LOBA 4QGLA 3F2ZA 3NJVA 2GMPA 1JI6A 3WF4A 1DGRN 1W9TA 2WO1A 1UXZA 1W8NA 3RPQA 1LESA 3CFRA 5J36A 2LF3A 1GWMA 1H1IA 4FFIA 5IBKB 2AGSA 5KHHA 2XUEA 3B93A 2VXJA 2P1QB 1FMD3 1Y3TA 2MEV1 2VVDA 3I2GA 1ASJ1 3HN3A 3I59A 4K1ZA 3F95A 2AC1A 1AJOA 3OBRA 4QB6A 4FOYA 3D8CA 4XDOA 4XDQA 3MUY1 4YW7A 1QJX1 2DU0A 1PHMA 5CNAA 2YB7A 1DIWA 1RUC2 4EN9B 3ASIA 2EICA 3LEGA 4YNIA 3H50A 4I0WB 1IGOA 1LHWA 5FY7A 2VJXA 2KR2A 3VBFC 3VB9A 5FZFA 2XL9A 2HWF1 1MACA 4EROA 1SPPB 4P9IA 2GH8A 3ZFGC 3RJRA 1A34A 1XYNA 3H9AA 3OBTA 3FL7A 1BKZA 3JBG3 2ZKNA 2EAKA 2FZ2A 2ZX4A 4KI6A 1HRI2 1VPHA 1O91A 3D82A 5LK7B 4JZRA 3ZFFB 1JZ5A 5BNOA 3THDA 3DCQA 2Y33A 2DTWA 4O9EA 2JHPA 4FJ9A 1RUE3 2VBBA 2R042 3I3BA 4W50A 1S0CA 3DV8A 5CZKA 3TEXA 1IZ3A 2W0XA 4YZ1A 3N4MA 1W8FA 5CISA 4AOCA 4LITA 3D6EA 3POJA 2D3PA 4M3CE 3GNEA 1LAJA 2BRTA 1GSLA 2PXJA 3AKRA 2AACA 4CP0A 3AFKA 4JCKA 1AYN3 4CTEA 3H7JA 5JSRA 5BV6A 1AXYA 1RVF2 5C8CC 2YYOA 4XIKA 3WCRA 3LEKA 5C70A 1FMD1 2MEV3 2R072 3VD7A 2PN5A 1DGWA 1AL0G 2IVIB 1K5JA 3JBG1 3ZN6A 1I3HA 3MPPG 3RYPA 1EP0A 4LO6B 1JBCA 3U14A 1PIV3 4Y1ZA 3PVOA 4RA0A 4QPYA 3PIGA 1ZNPA 4XDPA 3OGMB 1W99A 2VMFA 4AEDA 2OYZA 4E4DX 1QH7A 3SUOA 5FPZA 2G4IA 2R071 5FZOB 3NAEA 3J8F3 3L9JT 4XFIA 5SV8A 4XE9A 3RWUA 1TMF2 3CHXA 3K4AA 5FZ8A 1FNZA 4XTPA 4BQWA 3POBA 4YW4A 4Q4W1 2EIDA 2V73A 2Q30A 3ILFA 5KHGA 2HLEA 2ZGRA 4E3SA 3APBA 1BBT2 3KQ4B 4OVEA 4B7EA 5BNNB 2VOTA 2YBKA 2XBO2 4TSVA 3SQOA 3SH4A 1OT5A 4META 3LSDA 4NO4A 4IQPA 2CDOA 4OMCA 3V0BA 4NIDA 3N1BA 3EBRA 3N9NA 3ZFGA 2RS52 5LATA 3POSA 3WUDA 5J1XA 3ELNA 1GQGA 2ATQA 1SMVA 4LA3A 4FJ7A 4WZFA 2X8KA 1VBB1 4L92A 5J96B 4JV4A 1W3VA 2AYHA 2VVFA 4JC1A 2QQMA 3OOXA 4YVSA 4M3UA 1FYZE 1V6IA 1VB4A 3MLKA 1AUYA 2LUWA 3IPVA 4CSWA 1GWKA 3OG2A 1V0AA 4CU6A 1CX4A 1ZRCA 3N1EA 2JDUA 1TMF3 1LOCA 2B9VA 1IG3A 5T3NA 3T0AA 2EA7A 1HB4A 2CL2A 1ST8A 2Y34A 4QDSA 2XJPA 1ZRIA 2OPKA 1OLQA 2WT2A 3S7IA 3WNNA 1CAUB 4L9BA 1GZCA 2PAMA 3TEWA 3U78A 4EQVA 4RGKA 4Z2AA 1E5HA 4ISQA 1OFNA 2FDKA 3T08A 1MQTB 3S30A 1PVC1 4YZ3A 4BA6A 3U37A 1WLWA 1CAUA 1CPNA 2MEV2 3J4UH 3O12A 1UMHA 1PMJX 2OVRB 4E2QA 5GM0A 1PO13 2G9GA 1FATA 2GN7A 4PHZA 2IXJA 4FT8A 2K9ZA 1VMFA 4RQPC 2JD9A 1G9FA 1XNBA 4YG3A 1VBA1 1N1VA 4IESA 3NKGA 2D98A 1EV13 3I7DA 1ALYA 3I2HA 1FZ1E 3BYWA 2WNEA 3MIFA 4OHXA 4CA9A 5FV3A 1W9YA 2DCZA 1MS3A 4KG8A 3PUAA 5DZFA 2R49A 3GBGA 3GDBA 4K9SA 2CSGA 3KB5A 1VAKA 1W06A 3WOGA 1U0AA 1NYWA 2UY8A 1VAVA 4CXXA 3ZXJA 2W91A 2DEBA 1ZA4A 3CMGA 3PMEA 3DPRB 4IEUA 4URAA 4RS5B 2DU1A 2CDPA 3IB3A 3ZLIA 1CESA 2IXCA 4CYDA 3RFRA 4GMP3 5A6ZA 2UYAA 2DCYA 4WM8A 1W6PB 1RUF1 1PK6B 2BVBA 4HVOA 4QQ2A 3C7OA 4DQAA 5FZGA 4MH0E 2FD8A 3ZR6A 2CTVA 4D94A 3N7MA 1O5LA 4X6QB 4O7XA 3Q8BA 2P6CA 2QQIA 3N7JA 1UF2C 5GJ6A 1W04A 4DINB 5FFOC 1YFXA 4FTEA 1GR3A 1YNAA 5FLHA 1F5FA 3JU9A 5IYYA 4FQ4A 4C90A 4BQ3A 5EPAA 1Z0HA 1EPWA 1OKOA 1BMV2 2A3WA 2WYSA 2B39A 4KU7A 4XTMA 4Z8BA 5LRSA 1ND3B 4IEWA 4CEYB 4XILA 1PX3A 2BP6A 1L7QA
chains in the Genus database with same CATH topology
4PQQA 4M3TA 2YFUA 3RMAA 3OGSA 1O8PA 1XVFE 1OD3A 3J27A 1FZ7E 1XMGE 2HYXA 3OGVA 3T2OA 2HD0A 4M3WA 3SPYA 3MV01 1FZ2E 3CQ8A 1W9SA 3KD5E 2B8IA 2WAOA 3HNBM 2P1NB 1MHZG 2YG0A 2Z4FA 2VZSA 2PQSA 3K4ZA 1I5PA 4KMQA 5G04L 3E4WA 4RYDA 3UNPA 4MGQA 4ARYA 2DY4A 4BDVB 3CQOA 1XPWA 2WQ8A 1JU3A 1IG9A 2WZ8A 1XNAA 4DTUA 3TAEA 2W87A 3QEWA 2XHNA 4X5MA 3QERA 2OZSA 2OYQA 3RMCA 4MO3M 3I97A 4GZ9A 1JU4A 2BBAA 2VO5A 4DTNA 4J2AA 2DCKA 4P02B 4E4BA 1EUUA 4E8CA 4AAXA 1MMOG 4CVUA 3IIIA 2J1UA 3JXSA 2QBXA 4EPHA 1ULOA 3MUZ1 4XUPA 2V5DA 2VZ1A 2ZEXA 1UWWA 4QB2A 3DYPA 4FJLA 1J84A 2JH9A 3SQ1A 2DTUA 3OEBA 2P1MB 1UYYA 4JX0A 4BK4A 2VJ4A 1JZ2A 3VDCA 3WEZA 3LZJA 4P00B 1Q9XA 4QX0A 1HN1A 4ZZ8A 1LNSA 4FJ8A 1WAFA 3QNNA 4J2DA 1FXXA 3I2JA 1JYNA 2W1UA 4JKLA 1UYXA 3WF2A 3SI6A 3GGLA 4A42A 2W92A 2ZEWA 1FZHE 4L0PA 3GM8A 3HNMA 1JZ8A 3WNPA 2JDAA 2P5GA 1ULPA 1UYZA 3L1NA 5B4XA 1FZ8E 2WZEA 4RNGA 1SG3A 3OGLB 2J1RA 4OMDA 3E1F1 4A4AA 5IJRA 1UXXX 4FJNA 2VZ3A 3I2IA 5LA0A 2J1SA 3VDBA 1XVEE 2RV9A 4D8MA 5JUVA 1JZ3A 3MBWA 3CKHA 3WSOA 2LF6A 4AKGA 1FZ6E 2B7MA 4I6JB 2DCJA 2J1AA 3WNMA 3LDSA 4DXSA 4QX2A 2W94A 2VQUA 3LE0A 1GQPA 4CU7A 3P6BA 2OKXA 5JR2A 4HG6B 2C4XA 4M3ZA 4DU4A 3NJXA 4XUTA 3ACGA 4TXWA 2Y6KA 3DYOA 3J2PA 3FHQA 4J2EA 4ZXEA 4CU9A 3W5NA 1P8JA 1PX4A 3T2QA 2OZMA 4FJJA 2C9KA 3HGLA 1CZTA 2YC4A 4ADOA 5F7UA 3HOBA 1WAJA 3A23A 3HL8A 3DYMA 3T0BA 3ZM8A 3EYPA 4KHUA 3C94A 4QDRA 2E32A 3PUHA 4ARXA 5JXGA 3K75B 3WF1A 3OBAA 4M45A 3BGAA 1P22A 4KI4A 1UZ0A 2Y6JA 3OB8A 3THCA 1NEXB 4M41A 2W46A 1IQDC 2VJ5A 3SUNA 1NAEA 2Y6LA 4FK2A 2XOMA 3I3DA 3CFPA 4QX1A 5EJZB 3CZUA 4FVMA 3K2OA 3OEAA 4EP9A 4MADA 3WNLA 1FS1A 4DXTA 4XURA 3T09A 2PFVA 1UY0A 3MV11 3GXUA 4QDQA 3VD4A 1JZ6A 4OZOA 3KD1E 1FZIE 2WUHA 4LHSA 2PFTA 2B4KA 3FHAA 2W1QA 2FW3A 2WBKA 2J1EA 1XVDE 2B1EA 5I0DA 1OH4A 4EYWA 4M4RA 1GOHA 4I9LA 3I2FA 3HGKE 1F4HA 3LEIA 3QESA 1JZ4A 2RVAA 2QQKA 5IFTA 1T2XA 1XMFE 2X05A 4DEQA 1GOGA 1K42A 1GMMA 1MTYG 4DTSA 2WO3A 3WNKA 4FK4A 2YFZA 3NDKA 3HNYM 4CUAA 3WNOA 1CIYA 3SEEA 3NE6A 3SKVA 4GWJA 5LCWL 5IREA 2JE8A 3C6OB 3LPGA 2QXFA 3SUPA 3IAQA 1GNYA 4P08A 3AC0A 4DTPA 4FJKA 2ORZA 4FI9A 5C71A 2ZEYA 4BK5A 2VMEA 5IFPA 3I3EA 1NX9A 3A22A 4XUOA 1JYXA 3I2KA 4QAWA 2X10A 4W4ZA 4DTRA 4A3ZA 1KEXA 4FJIA 4DTOA 3C6NB 3SUQA 3ETPA 4BXSV 4FJXA 2VMCA 2VTFA 4PF1A 1MPXA 3C7FA 3W5MA 4XZUG 4JRPA 3SJJA 4UI9L 4CUBA 3PUIA 4DUWA 4E8DA 5IHRA 1UX7A 4ET7A 3L2OB 3SPZA 3C95A 4CU8A 3HP9A 4A41A 1XMHE 5EJ1B 3OGKB 3HPNA 1XVBE 4YPJA 4FJ5A 4XVHA 2P1OB 2W1WA 1UY2A 2EIEA 2RJ2A 4OYUA 4ZY9A 4M4PA 2V72A 5A1AA 1UMIA 3UESA 4GWIA 4FJHA 3SNNA 3SQ0A 3MO4A 4KHSA 4QNDA 1US2A 2W9XA 1XU3E 2WO2A 2MMBA 4RN5A 2VZVA 2E31A 1DP0A 3FN9A 4RG8A 4KHWA 2E26A 4M3YA 2VZTA 4KHQA 2WABA 4D0QA 5HXMA 1WCQA 3P1IA 2RCUA 4B08A 1K3IA 1US3A 2R7EB 3L8BA 2WN2A 2VZQA 2Y6GA 4A45A 3C6PB 1PMHX 2FYOA 4DEVA 1XVGE 3EB7A 1K12A 3QETA 4J2BA 1JYWA 4FJGA 4KHNA 3T0DA 1K45A 3CZJA 3CFOA 3DECA 4MOAA 1JHJA 1KGYA 3K77A 1MHYG 2VCBA 3WQBA 3K4DA 4QNCA 2X09A 3IDAA 4IUGA 2Y64A 3J7HA 4JS4A 4M42A 4QPWA 2XONA 1GOFA 5FUIA 1O8SA 2WDBA 3S9HA 2BGPA 2W5FA 1L7RA 4AG4A 4W8JA 4M3XA 4KWUA 2J1VA 3F2ZA 3NJVA 1JI6A 2J1TA 3WF4A 3RMDA 1W9TA 1UXZA 4FK0A 1DYOA 1W8NA 3CFRA 3QEXA 2WO1A 4JKMA 2L9LA 2LF3A 3L0MA 5IBKB 2VL4A 1JZ7A 4HCBA 2P1QB 3I2GA 3HN3A 4QB6A 2E33A 3VD3A 5JXIA 3V7DB 1IH7A 1GUIA 3LQCA 3MUY1 2YB7A 1SHWB 3D3AA 3ACIA 3C7HA 2VMDA 4DU3A 2EICA 1CZVA 3LEGA 2H4TA 1JYVA 4LKSA 3SQ2A 2BGOA 2VJXA 2W3JA 2BZDA 4P5YA 4UOJA 1H6XA 2W47A 2VQTA 3LPFA 1XU5E 2DDUA 3C7EA 3WF3A 4A44A 2QQOA 2J7MA 4DU1A 3FL7A 4BJ0A 3HEIA 2VZPA 2JPNA 4KI6A 4RL5A 2VC9A 2BERA 4CUCA 1JZ5A 3THDA 3BN6A 1FZ3E 4W50A 2JHPA 4FJ9A 3I3BA 1FZ5E 5CZKA 2J22A 1W9WA 1EUTA 2JKXA 2ORXA 3TABA 3QEIA 2JHAA 3NCIA 2V4VA 3NHGA 2MZWB 4AKIA 3CDZB 4OUEA 1FZ4E 4DTMA 3MKSB 2VIXA 2OVQB 2Y8KA 4M3RA 3LEKA 5C70A 3QNOA 5JXHA 5JMOA 4QB1A 3VD7A 5C7GA 1J83A 3C8XA 2JHCA 3LZIA 3SEPA 5B4NA 4XUQA 4FJMA 5H37A 3TAGA 4UAPA 3OGMB 1W99A 2VMFA 2VCCA 5DQ0A 3LDBA 2P1PB 3SUOA 5IZ7A 5LA1A 3LD8A 3NAEA 1XVCE 3RWUA 1NKGA 3K4AA 3TJYA 1F4AA 4QX3A 4MGSA 1DLCA 2LW8A 5DPNA 4ZZ5A 2EIDA 3SKJE 2HLEA 4E3SA 1H6YA 2VOTA 3OGRA 4LPLA 2VZUA 1OT5A 1WKYA 2QQJA 2OVPB 2CDOA 2LS6A 4OMCA 3N1BA 1GU3A 5DMYA 3ABZA 1SDDB 5J1XA 2WAAA 2ATQA 1YQ2A 4FJ7A 1LDKE 1FZ0E 1O59A 1UY3A 4KI5M 2QQMA 1RYYA 4M3UA 1FYZE 1XC6A 4DXRA 2VZOA 2W95A 2EIBA 1CZSA 2W1SA 3OG2A 4CU6A 5JXJA 3ECQA 3N1EA 1UY4A 3CIHA 2B9VA 3T0AA 3TL8B 1R64A 4QDSA 4DTJA 3WNNA 3HJRA 3TAFA 2P5OA 3NNGA 4JHZA 3E4YA 4Z2AA 3A7QA 1TVGA 5DN2A 3QEPA 3T08A 3U37A 4A6OA 4DUVA 3ACFA 1OF4A 1UMHA 4DTXA 1PMJX 3WF0A 2OVRB 2Y6HA 4I9QA 2YB5A 3C7GA 1XL3C 2ZEZA 2YC2A 2JD9A 5LA2A 5HPOA 3I2HA 3IAPA 1FZ1E 2VCAA 1XNTA 2WN3A 3K46A 1D7PM 2JH8A 4TTGA 3UIQA 4JS5A 3GDBA 1W8OA 3RMBA 2W91A 2DEBA 1BHGA 2VZRA 3CMGA 2CDPA 3SVIA 3IB3A 4DUXA 4KHYA 1UY1A 2QQLA 4PT6A 5EIYB 3NRUA 1OF3A 4ADNA 2C26A 3A21A 3C7OA 4GAMC 3SQ4A 2ZXQA 3NQHA 5CYYA 3VD9A 4AKHA 2VM9A 1CLQA 1Q9YA 2ID4A 4LQRA 1NUKA 3NGIA 3SCXA 2QQIA 2VR4A 1CX1A 3T2PA 3ACHA 3VDAA 2QQNA 5IYYA 4XUNA 5G05L 4AI6A 3VD5A 2XQXA 4HCCA 2WYSA 1TG7A 1W0NA 1FZ9E 4JKKA 3UETA 4JRQA 3QEVA 1PX3A 2KD7A 4X5NA 1L7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PQQ A;  2YFU A;  3OGS A;  1O8P A;  1OD3 A;  2HYX A;  3OGV A;  3T2O A;  3MV0 1;  1W9S A;  2WAO A;  3HNB M;  2P1N B;  2YG0 A;  2Z4F A;  2VZS A;  2PQS A;  3K4Z A;  1I5P A;  4KMQ A;  5G04 L;  4RYD A;  3UNP A;  4MGQ A;  4ARY A;  4BDV B;  3CQO A;  1XPW A;  2WQ8 A;  1JU3 A;  2WZ8 A;  1XNA A;  2W87 A;  2XHN A;  4MO3 M;  3I97 A;  4GZ9 A;  1JU4 A;  2BBA A;  2VO5 A;  2DCK A;  4P02 B;  1EUU A;  4E8C A;  4AAX A;  4CVU A;  3III A;  2J1U A;  3JXS A;  2QBX A;  1ULO A;  3MUZ 1;  4XUP A;  2V5D A;  2VZ1 A;  2ZEX A;  1UWW A;  4QB2 A;  3DYP A;  1J84 A;  3OEB A;  2P1M B;  1UYY A;  4JX0 A;  4BK4 A;  1JZ2 A;  3VDC A;  3WEZ A;  4P00 B;  4QX0 A;  1HN1 A;  4ZZ8 A;  1LNS A;  1JYN A;  3I2J A;  2W1U A;  4JKL A;  1UYX A;  3WF2 A;  3GGL A;  4A42 A;  2W92 A;  2ZEW A;  4L0P A;  3GM8 A;  3HNM A;  1JZ8 A;  3WNP A;  2JDA A;  1ULP A;  1UYZ A;  5B4X A;  2WZE A;  1SG3 A;  3OGL B;  2J1R A;  4OMD A;  3E1F 1;  4A4A A;  5IJR A;  1UXX X;  2VZ3 A;  3I2I A;  5LA0 A;  3VDB A;  2J1S A;  2RV9 A;  4D8M A;  5JUV A;  1JZ3 A;  3MBW A;  3CKH A;  3WSO A;  4I6J B;  2DCJ A;  2J1A A;  3WNM A;  4DXS A;  4QX2 A;  2W94 A;  2VQU A;  3LE0 A;  1GQP A;  4CU7 A;  3P6B A;  2OKX A;  5JR2 A;  4HG6 B;  2C4X A;  3NJX A;  4XUT A;  3ACG A;  4TXW A;  2Y6K A;  3DYO A;  3FHQ A;  4ZXE A;  4CU9 A;  3W5N A;  1P8J A;  1PX4 A;  3T2Q A;  2C9K A;  1CZT A;  2YC4 A;  5F7U A;  3HOB A;  3A23 A;  3T0B A;  3DYM A;  3ZM8 A;  3EYP A;  4QDR A;  2E32 A;  3PUH A;  4ARX A;  5JXG A;  3K75 B;  3WF1 A;  3OBA A;  3BGA A;  1P22 A;  3OB8 A;  1UZ0 A;  2Y6J A;  3THC A;  1NEX B;  2W46 A;  1IQD C;  1NAE A;  2Y6L A;  2XOM A;  3I3D A;  4QX1 A;  5EJZ B;  3CZU A;  3OEA A;  3WNL A;  4MAD A;  1FS1 A;  4DXT A;  4XUR A;  3T09 A;  3MV1 1;  1UY0 A;  4QDQ A;  3GXU A;  3VD4 A;  1JZ6 A;  4OZO A;  2WUH A;  4LHS A;  2B4K A;  3FHA A;  2W1Q A;  2WBK A;  2J1E A;  5I0D A;  1OH4 A;  4M4R A;  1GOH A;  3I2F A;  1F4H A;  3LEI A;  1JZ4 A;  2RVA A;  2QQK A;  5IFT A;  1T2X A;  2X05 A;  4DEQ A;  1GOG A;  1K42 A;  1GMM A;  2WO3 A;  3WNK A;  2YFZ A;  3HNY M;  4CUA A;  3WNO A;  1CIY A;  3SEE A;  3SKV A;  4GWJ A;  5LCW L;  2JE8 A;  3C6O B;  3LPG A;  3IAQ A;  1GNY A;  4P08 A;  3AC0 A;  2ORZ A;  4FI9 A;  5C71 A;  2ZEY A;  4BK5 A;  2VME A;  5IFP A;  3I3E A;  1NX9 A;  3A22 A;  4XUO A;  1JYX A;  3I2K A;  4QAW A;  2X10 A;  4W4Z A;  4A3Z A;  1KEX A;  3C6N B;  3ETP A;  4BXS V;  2VMC A;  2VTF A;  4PF1 A;  1MPX A;  3C7F A;  3W5M A;  4XZU G;  4UI9 L;  4CUB A;  3PUI A;  4DUW A;  4E8D A;  5IHR A;  1UX7 A;  4ET7 A;  3L2O B;  4CU8 A;  4A41 A;  5EJ1 B;  3OGK B;  3HPN A;  4YPJ A;  4XVH A;  2P1O B;  2W1W A;  1UY2 A;  2EIE A;  2RJ2 A;  4OYU A;  4ZY9 A;  4M4P A;  2V72 A;  5A1A A;  1UMI A;  3UES A;  4GWI A;  3MO4 A;  2W9X A;  1US2 A;  2WO2 A;  4RN5 A;  2VZV A;  2E31 A;  1DP0 A;  3FN9 A;  2E26 A;  2VZT A;  2WAB A;  4D0Q A;  5HXM A;  1WCQ A;  3P1I A;  1K3I A;  1US3 A;  2R7E B;  2Y6G A;  2WN2 A;  2VZQ A;  4A45 A;  3C6P B;  1PMH X;  4DEV A;  3EB7 A;  1K12 A;  1JYW A;  3T0D A;  1K45 A;  3CZJ A;  3DEC A;  4MOA A;  1JHJ A;  1KGY A;  3K77 A;  2VCB A;  3WQB A;  3K4D A;  2X09 A;  3IDA A;  4IUG A;  2Y64 A;  3J7H A;  5FUI A;  4QPW A;  2XON A;  1GOF A;  1O8S A;  2WDB A;  2BGP A;  2W5F A;  1L7R A;  4AG4 A;  4W8J A;  4KWU A;  2J1V A;  3F2Z A;  3NJV A;  1JI6 A;  2J1T A;  3WF4 A;  1W9T A;  2WO1 A;  1UXZ A;  1W8N A;  1DYO A;  4JKM A;  2L9L A;  5IBK B;  2VL4 A;  1JZ7 A;  2P1Q B;  3I2G A;  3HN3 A;  4QB6 A;  2E33 A;  3VD3 A;  5JXI A;  1GUI A;  3V7D B;  3LQC A;  3MUY 1;  2YB7 A;  1SHW B;  3D3A A;  3ACI A;  3C7H A;  2VMD A;  1JYV A;  2EIC A;  1CZV A;  3LEG A;  4LKS A;  2BGO A;  2VJX A;  2W3J A;  2BZD A;  4P5Y A;  4UOJ A;  1H6X A;  2W47 A;  2VQT A;  3LPF A;  2DDU A;  3C7E A;  3WF3 A;  4A44 A;  2QQO A;  2J7M A;  3FL7 A;  4BJ0 A;  3HEI A;  2VZP A;  2VC9 A;  2BER A;  4CUC A;  1JZ5 A;  3THD A;  3BN6 A;  4W50 A;  3I3B A;  5CZK A;  2J22 A;  1W9W A;  1EUT A;  2JKX A;  2ORX A;  2V4V A;  3CDZ B;  4OUE A;  3MKS B;  2OVQ B;  2Y8K A;  3LEK A;  5C70 A;  5JXH A;  5JMO A;  4QB1 A;  3VD7 A;  5C7G A;  1J83 A;  3C8X A;  3SEP A;  5B4N A;  4XUQ A;  4UAP A;  3OGM B;  1W99 A;  2VCC A;  2VMF A;  5DQ0 A;  2P1P B;  5LA1 A;  1NKG A;  3K4A A;  1F4A A;  4QX3 A;  4MGS A;  1DLC A;  2LW8 A;  5DPN A;  4ZZ5 A;  2EID A;  3SKJ E;  2HLE A;  1H6Y A;  2VOT A;  3OGR A;  4LPL A;  2VZU A;  1OT5 A;  1WKY A;  2QQJ A;  2OVP B;  2CDO A;  2LS6 A;  4OMC A;  1GU3 A;  5DMY A;  3ABZ A;  1SDD B;  5J1X A;  2WAA A;  1YQ2 A;  1LDK E;  1UY3 A;  1O59 A;  4KI5 M;  2QQM A;  1RYY A;  1XC6 A;  4DXR A;  2VZO A;  2W95 A;  2EIB A;  1CZS A;  2W1S A;  3OG2 A;  4CU6 A;  5JXJ A;  3ECQ A;  1UY4 A;  3CIH A;  2B9V A;  3T0A A;  1R64 A;  4QDS A;  3WNN A;  3HJR A;  3NNG A;  4JHZ A;  4Z2A A;  3A7Q A;  1TVG A;  5DN2 A;  3T08 A;  3U37 A;  4A6O A;  4DUV A;  3ACF A;  1OF4 A;  1UMH A;  1PMJ X;  3WF0 A;  2OVR B;  2Y6H A;  3C7G A;  2ZEZ A;  2YC2 A;  2JD9 A;  5LA2 A;  5HPO A;  3I2H A;  3IAP A;  2VCA A;  1XNT A;  2WN3 A;  3K46 A;  1D7P M;  4TTG A;  3GDB A;  1W8O A;  2W91 A;  1BHG A;  2VZR A;  3CMG A;  2CDP A;  3IB3 A;  4DUX A;  1UY1 A;  2QQL A;  4PT6 A;  5EIY B;  3NRU A;  1OF3 A;  2C26 A;  3A21 A;  3C7O A;  3NQH A;  2ZXQ A;  5CYY A;  3VD9 A;  2VM9 A;  2ID4 A;  4LQR A;  1NUK A;  2QQI A;  2VR4 A;  1CX1 A;  3T2P A;  3ACH A;  3VDA A;  2QQN A;  5IYY A;  4XUN A;  5G05 L;  3VD5 A;  2XQX A;  2WYS A;  1TG7 A;  1W0N A;  4JKK A;  3UET A;  1PX3 A;  2KD7 A;  1L7Q A; 
#chains in the Genus database with same CATH topology
 1G9D A;  4M3T A;  4LA2 A;  5F6K A;  4E9K A;  1XVF E;  1OD3 A;  2IC1 A;  3TB0 A;  3VHN A;  1NA1 C;  3KHC A;  1CR7 A;  3BOW A;  5EJ3 A;  5FZ4 A;  4W6W A;  1XU1 A;  4Y33 A;  4Q4W 2;  4HFS A;  3SPY A;  2ZAB A;  3BUC A;  3CQ8 A;  2PHW A;  3KD5 E;  3VBR A;  2IXH A;  4XF3 A;  3ES1 A;  5DAQ A;  2Z4F A;  2RMU 2;  2O8Q A;  3G6J B;  1SLC A;  3K4Z A;  1VBB 3;  3ALQ A;  4XJA A;  4ZS2 A;  1QMJ A;  5GLZ A;  5JAX A;  3WHU A;  5LK5 A;  1RUF 2;  3N3H A;  4MGY E;  1AYN 2;  5FR3 A;  2A6W A;  3BKZ A;  2UY9 A;  5IVB A;  1D4V B;  2WQ8 A;  2WFP A;  3RZZ A;  5I8S A;  2Y38 A;  4AHW A;  1OMI A;  3LZZ A;  1T6G C;  5LWB A;  4IGQ A;  1O3Q A;  5BY5 A;  1X7N A;  4W6X A;  1WME A;  5BNN A;  3GBW A;  2VW1 A;  2JEC A;  4RHV 3;  5ACA 1;  5IK7 A;  3ZYH A;  5FPB A;  4AZZ A;  3I97 A;  4GZ9 A;  3AXE A;  3BTA A;  4AW7 A;  1BQP A;  1V6K A;  3R4U A;  1R1A 3;  1HRI 3;  2ARE A;  2XVK A;  4P02 B;  4AQ2 A;  4E4B A;  1MMO G;  3VL8 A;  1NE6 A;  1QIQ A;  1YWK A;  1KD7 A;  1A3K A;  3IIA A;  2JKB A;  4H2A A;  1FOD 2;  2RG4 A;  2YU2 A;  2QBX A;  3THP A;  5FY0 A;  2BYV E;  3DEM A;  3EQE A;  3I3Q A;  4XUP A;  4CRQ A;  1V9U 2;  1WCD J;  3LDK A;  4LKE A;  4M3C A;  2VVE A;  1YCI A;  4H7L A;  1UWW A;  1Y7B A;  4Q4X 1;  2A70 A;  5K4L A;  2XL7 A;  3AK0 A;  5IK8 A;  5CFC B;  3OEB A;  1H2N A;  3WP4 A;  1LHU A;  4LHK A;  1O7F A;  1JZ2 A;  2VNG A;  5FZB A;  4P00 B;  1Q9X A;  4SBV A;  1TME 3;  3RMY A;  1HN1 A;  4AHX A;  2XKO A;  4C91 A;  5FUP A;  1W6P A;  4CCC A;  4ZZ8 A;  3QNN A;  1AR9 2;  2HWD 2;  2WWU A;  2W1U A;  3WNX A;  4S2D A;  4YW3 A;  4JKL A;  3WF2 A;  3ZPY A;  1OVP A;  1J59 A;  4CCK A;  5A32 B;  3VKN A;  1VAM A;  1DZQ A;  4MGZ E;  4BLI A;  4K6B A;  4RR3 B;  1RUH 3;  2BV4 A;  2GH2 A;  2O8O A;  2RMU 3;  5FMC A;  1AR9 1;  2HWD 1;  2FDF A;  2BOI A;  1UYZ A;  1FZ8 E;  1WMX A;  2BJS A;  2J1R A;  5F1R A;  4LIU A;  5FY8 A;  3UO2 A;  1QH6 A;  1BLZ A;  3AZW A;  5IJR A;  2VZ3 A;  1NA1 B;  3EJK A;  5JVV A;  3S5Q A;  2VEC A;  3T30 A;  3JUU A;  2OQ7 A;  3LIG A;  4KH9 A;  1JZ3 A;  3P3N A;  3BPS A;  1W3X A;  3MBW A;  5A3L A;  5J7M A;  1YJK A;  4ONU A;  4FBF A;  4AKG A;  3GJA A;  3I4I A;  3O0V A;  4RQP A;  1V9U 1;  1D0H A;  4A2U A;  4I6J B;  2DCJ A;  3TEY A;  3LDS A;  2HKX A;  4QX2 A;  2CGP A;  4AEK A;  1ASJ 3;  2P34 A;  1OC1 A;  2W94 A;  3RWK X;  1XJA A;  3VBR C;  3UGG A;  3V56 A;  2D5H A;  1WW7 A;  3P6B A;  2OKX A;  2FDJ A;  4M0N A;  5CFC A;  5DG2 A;  4XET A;  2QKD A;  3NJX A;  5LY1 A;  1A78 A;  2D6P A;  2ZX1 A;  3PMS A;  5J48 A;  1WCK A;  4L97 A;  1RIN A;  4CDQ B;  5F32 A;  3RWN A;  2ZHN A;  1KS4 A;  1PM7 A;  2IZW A;  4YVW C;  2JG8 A;  1LU1 A;  2HWE 3;  1PK6 C;  3HBK A;  3HGL A;  3K51 A;  4QT6 A;  4E27 A;  4ADO A;  4Y26 A;  5F7U A;  3HOB A;  1PVX A;  5EXO A;  2WS9 3;  1RHI 3;  4FAG A;  4YWA A;  2O1Q A;  3EYP A;  4KHU A;  2DFC A;  5FP9 A;  5L7O B;  1GKB A;  3RGB A;  1VR3 A;  3K75 B;  3WF1 A;  3BGA A;  4P9J A;  4KI4 A;  3PU3 A;  3HWJ A;  4MGT A;  3MW2 A;  3DXT A;  2VJ5 A;  3SUN A;  2HBU A;  2Y6L A;  4L99 A;  2VUD A;  4LOT A;  2AUY A;  2P6H A;  4FVM A;  2Y0O A;  4JGY C;  1HV0 A;  2Q0A A;  3SNM A;  3U10 A;  1OLR A;  4NN0 A;  3BTZ A;  2CU5 A;  3T4H B;  3ZDS A;  4P5H A;  2WKK A;  1EV1 2;  1Y9G A;  1EY2 A;  4Q0S A;  3HBZ A;  3T09 A;  4CCN A;  5BUV A;  3B00 A;  3MV1 1;  1UY0 A;  3R4D B;  3GXU A;  4QDQ A;  2R1D A;  1KJL A;  4HKW A;  3KD1 E;  1FZI E;  1LU2 A;  1AR7 2;  2D6L X;  2ZGO A;  5C3P A;  4UFI A;  1YQ5 A;  2BTV C;  2B42 B;  3N35 A;  4DZG A;  5FJH A;  2JE9 A;  2ZMN A;  5GKA C;  1MQT C;  1GNH A;  3QBQ A;  2J1E A;  1OA3 A;  1SBD A;  1XVD E;  3AKQ A;  4FPF A;  3QD6 A;  1OH4 A;  4GUL A;  4EYW A;  5IWF A;  3VHO A;  1BBT 3;  3AKP A;  2HWB 1;  5IT6 A;  4CDX A;  1WBF A;  2XDV A;  1JOJ A;  1F4H A;  5FBZ A;  4BIF A;  2YPJ A;  3AP6 A;  4CP1 A;  4CCD A;  5EYX A;  3ON7 A;  4ASM B;  3JQX A;  3URF A;  1V6J A;  1K42 A;  1GMM A;  3H0O A;  4DTS A;  4XQD A;  1C8M 1;  3ZXG A;  3QAC A;  1SLL A;  1LOB A;  5FK7 A;  3NDK A;  3HNY M;  4CEW C;  2VNR A;  5GLV A;  2CGO A;  5ABJ A;  2BPA 2;  1SFP A;  3NE6 A;  3BU0 A;  4LBQ D;  3ZYG A;  1FXZ A;  3ZSJ A;  2ATF A;  2JE8 A;  5I0R A;  2H0V A;  1CON A;  1GIC A;  2QXF A;  5A70 A;  1X82 A;  5JSO A;  1GNY A;  4YGE A;  4Y5S A;  1O6U A;  1JYT A;  1HXS 2;  2UWA A;  4JRL A;  4Q26 A;  2Q1M A;  2ZS6 B;  3H1M A;  5C71 A;  4R9C A;  4NUB A;  2D7F A;  3A0K A;  2YU1 A;  3I3E A;  2OVU A;  4ZS3 A;  4DIQ A;  5CFD B;  1LEN A;  2Q5T A;  3ZSE A;  1DU3 D;  2X10 A;  4FOW A;  2GN3 A;  4W4Z A;  2RR1 3;  1JUH A;  4XPV A;  2SLI A;  2IFR A;  1KEX A;  2KXL A;  2K5S A;  3WP3 A;  5BNP C;  3SUQ A;  4AI2 A;  1RXG A;  5KXE A;  1QOO A;  2MHF A;  1MPX A;  3C7F A;  2WZR 1;  4XZU G;  4JRP A;  1HRV 1;  4UI9 L;  3AL5 A;  1UX7 A;  2OX0 A;  1O3R A;  5FPU A;  1PIV 2;  1B35 A;  2DCT A;  3RG0 A;  3HP9 A;  4QHB A;  2VUL A;  1HN0 A;  3IWZ A;  4Y22 B;  1RUJ 2;  3RSJ A;  3FZ3 A;  2JIJ A;  1KS5 A;  4B4R A;  5CG8 A;  5H9P A;  1PGL 2;  1XVB E;  3EO6 A;  2ZZJ A;  1S4C A;  1XB9 A;  3CJX A;  2Z5W A;  4ZY9 A;  1OQE A;  4HMZ A;  5DAP A;  2PFW A;  4GWI A;  2R06 3;  4FTS A;  4FJH A;  4Y3O A;  2YXS A;  3OGJ A;  1TMF 1;  1FV3 A;  4XAC A;  4QGM A;  1SDW A;  1XU3 E;  4H14 A;  5GZC A;  1PO1 1;  3V0B B;  3SMH A;  1DP0 A;  4GMP 0;  3USU B;  1JOD A;  4KHW A;  1LKN A;  2VZT A;  4AXO A;  1N3P A;  2WRA A;  2XGX A;  1F9K A;  2WAB A;  4QQH A;  3ZFF C;  1GQH A;  5HXM A;  3L2H A;  2OA2 A;  3MFA A;  3MEP A;  1BXH A;  2GNM A;  3AYD A;  4ASL A;  1LHO A;  1U5I A;  3C6P B;  1IPS A;  5LBE A;  1DQ4 A;  1GAN A;  1K12 A;  2JG8 B;  4J2B A;  1VBC 3;  4KHN A;  1ZYB A;  2PLV 1;  5L9R A;  2ES3 A;  1JHJ A;  1H0B A;  1CD3 G;  1MHY G;  3NAP A;  3RRD A;  5BNO B;  3BPZ A;  3FFQ A;  3JD7 3;  3QOP A;  3K4D A;  5FWE A;  5FDB A;  4KWL A;  2LTN A;  2UU8 A;  2W08 A;  4IUG A;  3RMX A;  4BMB A;  5BNO C;  1D4M 1;  3J7H A;  5FUI A;  3PDQ A;  4QPW A;  4ZPI A;  1GOF A;  3H8R A;  4COW A;  3OUI A;  1IPK A;  3WQ7 A;  2WDB A;  3S9H A;  5J37 A;  3VD3 A;  3WG4 A;  5CBL A;  2J1V A;  3GF6 A;  4Q0P A;  1UN1 A;  3P3P A;  3IDB B;  4XHX A;  1NXM A;  4JDN A;  1UOF A;  4AVV A;  4FK0 A;  1DYO A;  4XJU A;  3ZKY A;  1RUE 2;  5A3P A;  4HAN A;  2L9L A;  1REE A;  1JZ7 A;  4HCB A;  3O0W A;  2HWC 3;  2E33 A;  1RHI 1;  4CEW A;  4M3C F;  3LQC A;  1W2T A;  4YYO A;  2XQR A;  4WVW A;  3D3A A;  3ACI A;  4YW6 A;  2JG9 B;  2HBT A;  1UCX A;  3SQ2 A;  2BGO A;  1S2E A;  2C6S A;  4BCU A;  4EN7 B;  4DO0 A;  4FXG B;  1W6O B;  4GH4 C;  3C7E A;  5L36 A;  4QKF A;  2J7M A;  3OBZ A;  4DU1 A;  3ZFF A;  1N3Q A;  1RMU 2;  4I0A A;  3KM5 A;  5F5Q A;  4BJ0 A;  3AKS A;  3HEI A;  1GYK A;  4HBN A;  2HWF 2;  5DG1 A;  2E7T A;  2XPJ A;  2VC9 A;  4AF9 A;  2BER A;  4Z92 B;  1K5M A;  4FAH A;  5A3M A;  1YJL A;  2BBV A;  4QPG C;  3BN6 A;  1OKQ A;  1FAY A;  2A73 B;  3N9O A;  4IEP A;  3S7E A;  2J22 A;  3ZXF A;  1DZT A;  1ND2 B;  4PBP A;  4XEZ A;  3M8L A;  3H42 B;  3TAB A;  1S0I A;  1WZX A;  3FLR A;  4EN0 A;  2FDH A;  1RTV A;  2JHA A;  3G7D A;  3PUQ A;  5L73 A;  3MKS B;  3LFI A;  2VIX A;  5JOW A;  1PIV 1;  1B35 C;  2VU9 A;  1SLA A;  2W2I A;  2Y8K A;  5D1I A;  4N90 A;  4AEJ A;  5CFD C;  5JCT A;  5C4W C;  5JMO A;  2EXJ A;  2HWC 1;  3U11 A;  4YGC A;  1J83 A;  1PGL 1;  1XE8 A;  3MHZ A;  4S2G A;  2JHC A;  3SEP A;  2C5D A;  1ENS A;  1NLQ A;  2D93 A;  5GZD A;  3TAG A;  1H8T A;  1S2B A;  2NM1 A;  2HEV F;  2QZ3 A;  2VCC A;  2WFF 3;  1HJG A;  3LDB A;  1QJF A;  1W6N A;  2FMD A;  3A4U A;  4JDM A;  1NY7 1;  3WP6 A;  1MQT A;  2YBP A;  2WA3 A;  4FXK B;  1NKG A;  1GLH A;  2X29 A;  2X53 S;  2XJS A;  2H6C A;  3Q8A A;  3W9A A;  3ENR A;  3FFZ A;  3NKT A;  1F4A A;  5FZA A;  3O1M A;  2LW8 A;  2FDG A;  4GKY A;  3KV9 A;  2XLF A;  2VPV A;  3KS7 A;  1NY7 2;  2YV8 A;  1WKY A;  3ZYF A;  4FPK A;  2OVP B;  3NNF A;  4JGY A;  4AGG A;  4R52 A;  5DMY A;  4CCO A;  1MEC 1;  3ABZ A;  1JW2 A;  1QGL A;  4URT A;  2WAA A;  4YVS B;  3O1T A;  5E16 A;  1YQ2 A;  1S55 A;  4AQS A;  5AFE A;  4BQX A;  1HXS 1;  1FZ0 E;  4KI5 M;  1J3R A;  1RJ8 A;  1RYY A;  4YSF A;  3GHN A;  3RZH A;  3N7K A;  1LOD A;  3GYD A;  2EIB A;  4XXP A;  4IND A;  5DZE A;  3B3Q E;  2PEL A;  2KA3 A;  2QFE A;  3RZG A;  3PUR A;  1NXD 1;  3MW3 A;  2ET1 A;  4AGV A;  4BQ5 A;  2TNF A;  3FBM A;  3VBH B;  2ZA9 A;  5DAB A;  1W28 A;  5AC9 2;  5JMC A;  1R09 2;  3CF6 E;  4B3N A;  3OYW A;  4LUL A;  3E4Y A;  1IS3 A;  5IVF A;  1UD1 A;  1TVG A;  5DN2 A;  3QEP A;  1GP5 A;  5FZO A;  5JDB A;  4FO9 A;  2PQQ A;  1UZV A;  1VMH A;  4GAL A;  2YGM A;  3ACF A;  1QDC A;  4MYE A;  4IER A;  1WCU A;  5C9A C;  2PHU A;  2OW4 A;  4XJZ A;  2VBP A;  1Z7S 1;  2YB5 A;  3C7G A;  1XE0 A;  4PDW B;  2WNO A;  5I0T A;  1XNC A;  5JI7 A;  4WVM A;  1AL2 3;  1W2N A;  4IV3 C;  5LA2 A;  5A6Y A;  2VD7 A;  3UKT A;  5HPO A;  1NG0 A;  3KD4 A;  3ZMN A;  4F8A A;  3JCI A;  4Q4Y 3;  2VOK A;  2ZAA A;  4D6Q A;  2WN3 A;  4CDU C;  4ASK A;  5FZ3 A;  5JOY A;  4N7U A;  3UIQ A;  4ZXK A;  1LGC A;  5FZI A;  5SV5 A;  1W8O A;  1XNK A;  1YQ6 A;  1IG0 A;  4KWJ A;  3PL0 A;  4WBB A;  4L2N A;  5A7P A;  1N47 A;  5L9B A;  2X5I B;  2WC2 A;  2UWC A;  4YM3 A;  2RDQ A;  2XJV A;  3FLP A;  3KCX A;  4MSV A;  5GLT A;  2WZP P;  2EIG A;  3U4S A;  2R6Q A;  2TBV A;  2P37 A;  4RS5 A;  2QQL A;  3WHT A;  3NRU A;  1OF3 A;  4ADN A;  2C26 A;  1C4R A;  3A21 A;  5FZ6 A;  1D2Q A;  4GAM C;  5FO8 B;  3VD9 A;  1VJ2 A;  4AKH A;  1OI6 A;  5FXX A;  3B01 A;  2XH6 A;  1IPJ A;  3PLQ A;  5FLJ A;  1CLQ A;  3SLI A;  1Q9Y A;  1NCQ B;  1QJY 2;  4KG0 A;  4G9S B;  2Z79 A;  1HKD A;  3SCX A;  4LQR A;  2RM2 1;  4HSL A;  3WG2 A;  2VR4 A;  3UO3 A;  1Y4W A;  3WDY A;  4D3W A;  1CX1 A;  3RYK A;  3T2P A;  2WII B;  4K3U A;  2E6V A;  5A3T A;  3CBN A;  1VRH 1;  1D4M 2;  5G05 L;  4TZD A;  4XYX A;  2ZX3 A;  3J7N A;  1WCS A;  4EN8 B;  4HCC A;  5E88 A;  4XIO A;  1ASJ 2;  1PZ7 A;  1TG7 A;  1W0N A;  4JRQ A;  2DVB A;  2ZGQ A;  5FXW A;  1ODN A;  5ANQ A;  5A1L A;  1W03 A;  1VRH 2;  3OGS A;  3WIN E;  4N53 A;  1FZ7 E;  1LHN A;  3OGV A;  4O9G A;  1VBA 2;  5CFC C;  3IN9 A;  1PZ9 A;  2NN8 A;  1FZ2 E;  5IAT A;  1J1T A;  3HNB M;  5KXD A;  3KV5 A;  1MHZ G;  3PUS A;  2A1X A;  2VZS A;  4XBN A;  5CKQ A;  1RUI 1;  4YM2 A;  1JH5 A;  5AVP A;  3VL9 A;  3NST A;  3ZYP A;  1FYU A;  4MGQ A;  3WQ1 A;  4GAZ A;  4WM7 C;  5IVV A;  1RVF 3;  4BDV B;  1RUD 1;  4OHY A;  4AFC A;  3CQO A;  5FP4 A;  4O61 A;  1BJQ A;  4O65 A;  4Q27 A;  1V70 A;  3IKW A;  4QX7 A;  1IG9 A;  5CB7 A;  1GFF 2;  1NZC A;  2WZ8 A;  3IDE A;  4L11 A;  5CKN A;  1XND A;  2VNV A;  5FWJ A;  3TN9 3;  2XHN A;  3QER A;  3HQU A;  3MF6 A;  4Q4Y 2;  4XJ8 A;  1M06 G;  4BQ2 A;  3VBS A;  5EQU A;  1RUN A;  4DTN A;  4MGK E;  2JIG A;  2DCK A;  2R07 3;  1EUU A;  2WS9 2;  4E8C A;  1XXN A;  4CVU A;  3III A;  4YVS C;  2J1U A;  4NHY A;  2R0H A;  3KWV A;  4EPH A;  1LGB A;  1RUC 1;  1XE7 A;  5JZG C;  3MUZ 1;  1X8M A;  2C24 A;  3O1P A;  2PHL A;  1W2A X;  4DFS A;  3LGR A;  1I9R A;  4PJY A;  5CVR A;  4NWW A;  4UW3 A;  3IPV B;  1QQP 3;  1J84 A;  2OUH A;  5D8A C;  5I8T A;  1MZ6 A;  2TEP A;  2DTU A;  2P1M B;  1DGR A;  4KGG A;  4JQT A;  1MS4 A;  4FPE A;  3WEZ A;  1WW6 A;  4XFF A;  2W39 A;  4W65 A;  1RUO A;  4LOS A;  4WVZ A;  4IEO A;  1LNS A;  2P3J A;  2WFF 1;  3ZSL A;  4FJ8 A;  1AF9 A;  4Z82 A;  5JPM B;  4NIA A;  1QHD A;  2W92 A;  1O3T A;  2CWM A;  5E8A A;  4AWD A;  1ZRE A;  1U5Z A;  1TEI A;  1DBN A;  2ZEW A;  4QHZ A;  1BEV 3;  1SBE A;  3BCW A;  2Q8D A;  4BLJ A;  1UZZ A;  2WFF 2;  3AP9 A;  3CJI C;  2WL1 A;  1IS4 A;  4LBQ A;  3WNP A;  1JZ8 A;  2P5G A;  3ST7 A;  4DY5 A;  5B4X A;  3L1N A;  4QU1 A;  5FK8 A;  1SQ4 A;  2Y26 A;  3OGL B;  1NCR B;  3MYX A;  3BOP A;  4NAM A;  3E1F 1;  4OMD A;  3PJY A;  2Q8O A;  1CAX A;  4GWM A;  1UXX X;  1CAW B;  2WS9 1;  3O14 A;  3ZPO A;  1XVE E;  2RV9 A;  2EAA A;  3KVB A;  5F3C A;  4HK8 A;  4D8M A;  2XBO 3;  3CNA A;  2LF6 A;  2GC2 A;  3AMM A;  1UZY A;  2WSU A;  5DAX A;  4FPL A;  5IVC A;  3LA2 A;  3PJQ A;  2GNB A;  4QQP A;  2RHP A;  4PLO A;  5C33 A;  5I0U A;  1FZ6 E;  1G6N A;  2B7M A;  2CYF A;  5L19 A;  4CZS A;  1QXJ A;  4XBQ A;  4QPG B;  3WP5 A;  2A3Y A;  3DPR C;  5FYT A;  4QKN A;  4A7Z A;  3KF5 A;  1ZZB A;  3LSE A;  2VH9 A;  1XU2 A;  3AB0 A;  4PLN A;  1DQ2 A;  3H8X A;  3HQX A;  3UYJ A;  5T50 A;  1K5M C;  4HG6 B;  2C4X A;  4M3Z A;  4DU4 A;  2R0F A;  3ACG A;  1MVE A;  3HT1 A;  1X9P A;  1IHM A;  3HD8 B;  1Y9Q A;  3M2M A;  4J2E A;  1AJK A;  3PHM A;  2LAL A;  5AC9 1;  1S0J A;  4OZX A;  2F4L A;  5FPV A;  4DXZ A;  1QJX 2;  1AR6 1;  2XBO 1;  2OZM A;  1R1A 1;  4FJJ A;  2P3Y A;  3SCF A;  3WY6 A;  1CZT A;  1YO8 A;  4MHR A;  4WVV A;  1UQX A;  1VIW B;  1B09 A;  4HL0 A;  3O1S A;  3DYM A;  3RZK A;  3ZM8 A;  5GAL A;  1CJD A;  3WUC A;  3R6S A;  2E32 A;  2QUO A;  3KGZ A;  4N9I A;  5JXG A;  4M45 A;  1RUI 2;  2XVL A;  1P22 A;  5GZF A;  2Y6J A;  3RZL A;  1C5I A;  2K46 A;  2MNG A;  3B69 A;  3EMR A;  1S2K A;  1W8U A;  4LBN A;  4S2H A;  3ZXD A;  1IQD C;  5C6C A;  1LOA A;  4QX1 A;  5FZ1 A;  5FXZ A;  3NO8 A;  1JN2 P;  3AMH A;  4OQ8 A;  5IAX A;  3O5S A;  1ZZ8 A;  2NQY A;  3OEA A;  4X8N A;  2OUJ A;  4YW1 A;  4QMA A;  4AVT A;  1D4M 3;  2BUK A;  4R9D A;  4WM8 C;  5DUV A;  4E2S A;  4QM9 A;  5LA9 A;  1HQN A;  4XUR A;  4K8R B;  2PFV A;  3VD4 A;  1JZ6 A;  4OZO A;  5J3U A;  2FCV A;  2VE1 A;  2R06 2;  4R4Z A;  2B45 X;  1QJX 3;  2B8M A;  3QH7 A;  4XCA A;  4Q0Q A;  4AI8 A;  1A8M A;  1H4H A;  4Q29 A;  1G9A A;  3W58 A;  2BNM A;  3C2U A;  2B4K A;  2D3S A;  3FHA A;  1HQL A;  4LTA A;  2W1Q A;  4JAA A;  4AI9 A;  5CAZ A;  3ZSK A;  2JG9 A;  2WBK A;  2VXR A;  4NPM A;  3UK9 A;  3V64 A;  1RGS A;  1RVF 1;  4U36 A;  3FBY A;  5FKB A;  1Q8S A;  2GDF A;  3OPW A;  4J1X A;  4HET A;  5DZG A;  4XC9 A;  4M4R A;  1UKG A;  4ATE A;  3P5B A;  2DYC A;  2BDR A;  4MUV A;  2ZCW A;  5A33 B;  2QCS B;  1H1M A;  3QES A;  3FE5 A;  3Q9O A;  1VBD 1;  4LK6 A;  3VN4 A;  3O1R A;  1EYB A;  1V00 A;  4UT5 A;  1TME 1;  1JZ4 A;  2QQK A;  3AX4 A;  1T2X A;  2B5H A;  4P9W A;  3T1L A;  5BNN C;  4YZ5 A;  1GZW A;  1MTY G;  4G4F A;  5LRR A;  4XAA A;  3U1X A;  3WNO A;  1GZW B;  3DUI A;  3KT4 A;  1CIY A;  1OUS A;  4GWJ A;  5IRE A;  5F5A A;  3NVC A;  4AFD A;  1PM4 A;  3LPG A;  3LB9 A;  5KHI A;  2P3I A;  2E7A A;  2IWG B;  3ZYR A;  5FP7 A;  1LOG A;  2ZOE B;  1NQD A;  4SLI A;  1U5X A;  4J6G A;  2WO7 A;  2BNN A;  1DYP A;  4FI9 A;  2QNK A;  2ZEY A;  3AFG A;  1N1C A;  1OXC A;  3AYA A;  3T1M A;  3PTY A;  2P1B A;  5C8C B;  4BB3 A;  3I2K A;  5A7W A;  2YY1 A;  1F2N A;  2YDE A;  1REF A;  2Z69 A;  4DRR A;  2WT1 A;  4B4P A;  1VBC 2;  3WDW A;  2ENR A;  1S1A A;  1V6L A;  3AZY A;  4RSU A;  3ES4 A;  4J1W A;  1ZBE 3;  2VMC A;  4UBH A;  4PF1 A;  4AQT A;  1C8N A;  1AR7 1;  2UUR A;  4GQ7 A;  4EE2 A;  5K0U C;  3SJJ A;  3PUI A;  4YM0 A;  2OII A;  2RE9 A;  4ET7 A;  1O5U A;  3SPZ A;  1ONA A;  2JJ6 A;  2VOX A;  1OD5 A;  5FYC A;  3VBU B;  4CU8 A;  4A41 A;  4KBB A;  1TQ5 A;  4BM8 A;  1LR5 A;  4Q0U A;  3K3O A;  4RL7 A;  2D6O X;  5EJ1 B;  5JIU A;  3HPN A;  1W39 A;  1OBN A;  4YPJ A;  2PHD A;  1ZBA 1;  2HWB 3;  2XJT A;  5FOJ B;  4NHM A;  5ABJ B;  3DKQ A;  2YRO A;  1UY2 A;  4HVR A;  2RJ2 A;  2V72 A;  3ZFG B;  1T6B X;  5A7O A;  4P9Y A;  3FJS A;  1R1A 2;  1H8T C;  3FC0 A;  3VBF B;  3SQ0 A;  3Q8C A;  1DGL A;  1HDK A;  3MO4 A;  1URX A;  4QND A;  4QPG A;  5FO7 B;  2F6B A;  5A7Q A;  3H3U A;  4CP9 B;  1R09 3;  2FCT A;  4OUL A;  2WLP A;  1TE1 B;  2RR1 1;  1AZD A;  1U12 A;  2VZV A;  4CEW B;  3UKV A;  2RS1 2;  2W68 A;  3FN9 A;  1AR8 3;  2G9Z A;  4M3Y A;  4KBZ A;  1L3J A;  2D97 A;  1SCS A;  2ARA A;  2LRP A;  4AEM A;  4HVQ A;  1RUG 3;  4JDO A;  2G9F A;  3P1I A;  2R7E B;  1SPP A;  3L8B A;  5GLU A;  3SC7 X;  4PI0 A;  1GP4 A;  5ANN A;  1SAC A;  3WCS A;  4A45 A;  1HRV 3;  1GV9 A;  1PMH X;  1S0D A;  4MX3 A;  4DEV A;  3SHR A;  4JGZ B;  4Y20 A;  4H7M A;  4OUS A;  5DUX A;  2YMZ A;  1JYW A;  1VBB 2;  3CZJ A;  1ENQ A;  3DEC A;  4QXK A;  1KGY A;  2ADE A;  1L7L A;  1AYM 3;  1RB8 G;  2RS5 3;  4E2G A;  2VMG A;  1W0O A;  4LNV A;  2VCB A;  1AL2 1;  4OI4 A;  4QNC A;  2X09 A;  5JSP A;  4XFG A;  1WA6 X;  1CAV A;  2Y64 A;  3AMN A;  1AYM 2;  4JS4 A;  4M42 A;  1C8M 3;  4F3J A;  1KDK A;  1O8S A;  1Q43 A;  1YUD A;  1XBF A;  2BGP A;  2RS3 1;  4GA9 A;  4JGY B;  3VKF C;  1CPM A;  3BAL A;  2GSY A;  2QDN A;  3B7M A;  1C28 A;  3KCC A;  2WWJ A;  4M3X A;  4W8J A;  3U4X A;  4CPB A;  2ERF A;  4AYU A;  2J1T A;  4OUM A;  4IEQ A;  3VBO C;  3QEX A;  4JKM A;  3I59 B;  4JTO A;  4PQ9 A;  4CPB D;  4LBM A;  4N43 A;  4FFH A;  4I30 A;  1BK0 A;  1QJE A;  5L7O C;  4N43 B;  5JXI A;  1GUI A;  4AVB A;  3D0S A;  2P2K A;  4ATF A;  3POG A;  3RYR A;  1SHW B;  2IXK A;  2VMD A;  2ZMK A;  1JYV A;  5K0U A;  4IET A;  1QWR A;  2Z2S B;  4YVW B;  2BZD A;  4BIO A;  1PO1 2;  1H6X A;  2W47 A;  4QX5 A;  4AED B;  4XFA A;  2DDU A;  3WF3 A;  4A44 A;  4CDX B;  2QQO A;  2D3R A;  5TSW A;  3ZYB A;  2XWJ B;  1VP6 A;  4UFH A;  4QX8 A;  4Q0V A;  2V5Y A;  5J98 B;  5T5L A;  4Q4V 1;  1QEX A;  4XCB A;  2RDR A;  4DPN A;  1PNG A;  4IV1 B;  1D0G A;  4LJH A;  5ISL A;  3O0X A;  1YFY A;  3DL3 A;  5T5J A;  1FZ3 E;  5K7P A;  2HEY F;  2I07 B;  1FZ5 E;  1J3P A;  5EFU A;  5HV0 A;  1JTZ X;  1W9W A;  5FTT C;  3RQ0 A;  1W8W A;  3QCW A;  1EUT A;  1COV 1;  1VBE 1;  3NNJ A;  4UFJ A;  5F3G A;  3ZFE C;  2ORX A;  3LWC A;  4CDW B;  3TYJ A;  2XLA A;  4P14 A;  3QEI A;  1WD3 A;  3CO2 A;  2V4V A;  1VMJ A;  1HW5 A;  4FPO B;  4KU8 A;  4AKI A;  2PYT A;  4IE5 A;  2MPF A;  4OUE A;  1FZ4 E;  3FLT A;  4MXW B;  4UW5 A;  4DTM A;  1XRU A;  4CP9 A;  3PNA A;  4DY3 A;  2QQP A;  3QNO A;  4LHN A;  1FOD 1;  2X5I A;  1JOP A;  4RR3 C;  2FZ1 A;  3C8X A;  1MZE A;  3VGI A;  1ZZ7 A;  1ZBA 2;  3LZI A;  4FJM A;  3U75 A;  3ZSM A;  4YVW A;  3J7M A;  2NPI A;  3IM0 A;  5IVJ A;  2ZX0 A;  2P1P B;  5IZ7 A;  2ZGS A;  4D6S A;  2DVA A;  1XVC E;  1JXN A;  1TNR A;  4OI0 A;  5JOZ A;  3RS6 A;  4PIZ A;  1V6N A;  4I3G A;  1F35 A;  2CHH A;  1DLC A;  4MGS A;  5DPN A;  1NQJ A;  1SLT A;  2VY0 A;  3SKJ E;  4LXL A;  1VLN A;  3AP7 A;  1FPN 1;  2HEW F;  5EP9 A;  1H6Y A;  3OGR A;  4LPL A;  2VZU A;  3KHB A;  4MVT A;  3U07 A;  2QQJ A;  3OPZ A;  1QF3 A;  5D8A A;  4FVV A;  5BXX A;  5FXV A;  1COV 2;  1VBE 2;  5AFB A;  5J09 A;  3ZO0 B;  3VZK A;  1SDD B;  3E5Q A;  4UXA A;  4CDX C;  4LO8 A;  4IEV A;  1ZVF A;  1QOS A;  2O14 A;  1LDK E;  1UY3 A;  3LKJ A;  3USU A;  1XC6 A;  3RI9 A;  2VZO A;  3DF0 A;  2W95 A;  3AKT A;  1Q3E A;  1CZS A;  1PO2 3;  4N43 C;  4XBL A;  3CIH A;  1XOY A;  3TN9 2;  1FI2 A;  3TL8 B;  1H9W A;  3OYW B;  2I74 A;  5FO9 B;  1E5I A;  2E7Q A;  4GB3 1;  1W6O A;  2VMH A;  3I2D A;  4PIX A;  5FZ9 A;  4IW3 A;  3TAF A;  2XJQ A;  2XVG A;  4B29 A;  2DUR A;  2VUJ A;  1QY4 A;  3MI8 A;  1YHF A;  4C1X A;  3NMB A;  2WZR 2;  2B7Y A;  3ZVX A;  5FZC A;  3R05 A;  2PMW B;  2RJK A;  3ZIW A;  4Q4X 2;  1YIF A;  1OF4 A;  4DTX A;  2V09 A;  3POF A;  4I2O A;  3EXU A;  3ZN6 B;  1R09 1;  2OXB A;  2Y6H A;  4F7Z A;  4OQ9 A;  4XF9 A;  4A7K A;  1YFU A;  4UBG A;  4MV2 A;  4KWK A;  4COZ A;  5IUQ A;  1XL3 C;  4Q4X 3;  2NP0 A;  3WDV A;  3ROU A;  3MIC A;  2ZHL A;  4FPC A;  5JZG A;  3OSD A;  4YLZ A;  2Q1F A;  3IAP A;  3H8O A;  1KJR A;  4G3Y C;  4CEY C;  3AZZ A;  1YYN A;  2KM2 A;  2CGN A;  1D7P M;  3VUO A;  2JH8 A;  4NR1 A;  4HT1 T;  3USS A;  2K2S A;  3X29 B;  2VW0 A;  1RMU 1;  3RMB A;  1GZT A;  3GBF A;  5FAX A;  1APN A;  2GC1 A;  4EJR A;  2VZR A;  3MFC A;  1MS1 A;  3EHK A;  5FMO S;  3RVH A;  1PK6 A;  2A5Z A;  2BNO A;  3SVI A;  4DUX A;  4KHY A;  4IT5 A;  4BYY A;  1AX2 A;  1UY1 A;  2VQ0 A;  3ILN A;  3N9L A;  3WDX A;  4C8D A;  4PT6 A;  3J9S A;  4JHT A;  1H8T B;  1KIT A;  1DF0 A;  2PAE A;  2YC0 A;  5DDJ 3;  3SQ4 A;  1RUJ 1;  1CN1 A;  2ZXQ A;  4GMP 1;  4UFL A;  4XF0 A;  4YG0 A;  4AVA A;  3BTY A;  1LOF A;  2ID4 A;  1NUK A;  4XW3 A;  3OJB A;  1YLL A;  2A6X A;  2IXL A;  1LEM A;  2A3X A;  2JB4 A;  3N9M A;  4OHW A;  4R9B A;  4RS5 C;  1WLD A;  2OQ6 A;  2QJV A;  4GB3 2;  4M01 A;  3VDA A;  4Y1X A;  3VDD C;  1UOJ A;  2QQN A;  1N1S A;  3PVE A;  4D69 A;  1GNZ A;  1FMD 2;  4FPG A;  2OT7 A;  4TLG A;  4XUN A;  4DMI A;  1QNY A;  4WZC A;  5FP3 A;  2G19 A;  3VD5 A;  1PGW 2;  2QQU A;  1AXK A;  1H4G A;  5GZE A;  1WW4 A;  1QDO A;  1FZ9 E;  1J3Q A;  2RS1 1;  2EF6 A;  2ZHM A;  4JKK A;  4LR4 A;  4MLO A;  4DNY A;  4HKO A;  2KD7 A;  2WYF A;  2GME A;  4ZU4 A;  2GC0 A;  4MXW A;  4BME A;  5DDJ 1;  1LGN A;  4RQP B;  3J27 A;  1UU4 A;  2HYX A;  5FMO L;  3T2O A;  2OPW A;  3VBS C;  5C5U A;  4M3W A;  3UGF A;  4A6S A;  3ZKU A;  3MV0 1;  4AHY A;  1I1E A;  1W9S A;  4NHL A;  4ES8 A;  1IKP A;  1G9C A;  2P1N B;  2XKP A;  2EAL A;  2YG0 A;  2FQP A;  1Y9M A;  3DPR A;  4OFG A;  4XMA A;  2PQS A;  4OI2 A;  1CGP A;  4ITC A;  1I5P A;  3J26 N;  4HPK B;  2IFW A;  4RYD A;  3O1U A;  3MGU A;  5L9V A;  4C1W A;  3AP5 A;  1XPW A;  1N1T A;  3DKW A;  1RUJ 3;  3NWK A;  1JU3 A;  3GZT B;  2JDM A;  2VOV A;  3E6D A;  3JZV A;  5FYI A;  1QXP A;  3UT0 A;  1IS6 A;  3GCW A;  1XNA A;  3PVB B;  4DTU A;  3TAE A;  1H30 A;  4AI3 A;  2W87 A;  3D5O A;  1YI9 A;  4NRO A;  2CAV A;  3SIT A;  4X5M A;  2R04 3;  4IEX A;  3PVN A;  1F15 A;  3H3Z A;  4NRP A;  3SIS A;  3S5A A;  2OYQ A;  2WNU C;  3RMC A;  2XJR A;  3B9C A;  3M7A A;  2D43 A;  1JU4 A;  2BBA A;  4OI1 A;  3WZ1 A;  2O0O A;  4J2A A;  2P3K A;  4IE4 A;  3VZO A;  2HWE 1;  4LT5 A;  1AR6 3;  1LEC A;  1DYK A;  4FPH A;  2JB8 A;  4AAX A;  2AEZ A;  4LBO A;  1PVC 3;  2DV9 A;  3W59 A;  4AK3 A;  4Q8K A;  1RHI 2;  2AR6 A;  1DGW X;  4Q1P A;  4P9L A;  4CEY A;  2HWB 2;  4YFW A;  3PTR B;  5F3E A;  1ULO A;  3HQR A;  4ZU5 A;  4E4Z A;  3PIJ A;  5E6H A;  5FKC A;  5KWR A;  1ZM1 A;  4QQO A;  3ZN4 A;  2VZ1 A;  3O1O A;  1C5H A;  1PVC 2;  2DF7 A;  4AFB A;  2K0G A;  4QB2 A;  5A6Q A;  3DYP A;  5GZG A;  2JH9 A;  1F5J A;  2WIN B;  3SQ1 A;  5A3N A;  4YW2 A;  1X36 A;  1UYY A;  4JX0 A;  2VJ4 A;  3VDC A;  5HCB A;  4QX0 A;  4WM8 B;  3MDP A;  3TNQ A;  2BOJ A;  1JYN A;  1WAF A;  4J2D A;  3I2J A;  1FXX A;  3KSC A;  2Q4S A;  2WQ4 A;  3MIG A;  1UYX A;  2I45 A;  2YGL A;  3LIH A;  4LUM A;  4EZ4 A;  1XYO A;  2YUE A;  4ZKT B;  2I2S A;  2DTY A;  3LCP A;  5FMD A;  3GM8 A;  3RNS A;  3SXW A;  5K8S A;  1WA4 A;  2WA4 A;  4I09 A;  4K20 A;  3ZOI A;  3WDT A;  4CCE A;  3KMH A;  3HNM A;  4L8Q A;  4Y1U A;  1VB2 A;  2H0B A;  3H1W A;  5CAD A;  1ULP A;  1CAW A;  4RNG A;  1SG3 A;  1JYI A;  3UGH A;  1OQ1 A;  4PF5 A;  2ZGM A;  2BW8 A;  1HB2 A;  4Q4W 3;  3VBS B;  5I93 A;  3VZN A;  5LA0 A;  4FJN A;  3I2I A;  4U2A A;  3POW A;  2J1S A;  1MS5 A;  3VDB A;  1OPM A;  3M3I A;  1LCL A;  3GZE A;  1WBL A;  2WR9 A;  3WSO A;  3AXD A;  3CKH A;  3KQR A;  3OY8 A;  2C0Z A;  2GND A;  2ZBJ A;  4CCJ A;  2RKH A;  4FP2 A;  5AC9 3;  4UWD A;  4Z2W A;  3VLB B;  5I0S A;  2A71 A;  4COY A;  1DG6 A;  4RGG A;  2XWB B;  4D7S A;  3WNM A;  4NMI A;  2R1B A;  5FQ0 B;  1NZI A;  3LE0 A;  2E9Q A;  5F5C A;  2YHJ A;  4CCM A;  5JR2 A;  4NIG A;  3V0A B;  2QDR A;  1S0F A;  1UIK A;  5LW9 A;  4XUT A;  4Y4R A;  1WUV A;  4TXW A;  2Y6K A;  3H1Y A;  3DYO A;  1OHF A;  1UX6 A;  4YGD A;  1G7Y A;  1ULD A;  5DUU A;  3UV9 A;  1QU0 A;  3VKL A;  4AHZ A;  5KC5 A;  3OF1 A;  2FHR A;  1E57 A;  4QPI B;  1JOB A;  4LHL A;  4ZXE A;  5A33 A;  3UL2 A;  4CU9 A;  3VZL A;  4CP2 A;  4KNC A;  4CDU A;  1R08 2;  5C3R A;  3KGL A;  4LBK A;  4QPI A;  4BQ1 A;  1GP6 A;  2H6B A;  3HL8 A;  2GU9 A;  1MEC 2;  4LBJ A;  3TRS B;  2JEM A;  3KCY A;  2NMO A;  4NHX A;  4LOR A;  3RJ2 X;  5KC6 A;  3RDI A;  5HCA A;  3CJI B;  1R1Z A;  2E63 A;  3AJZ A;  4IL7 A;  4JTN A;  3IMM A;  2RMU 1;  4NVP A;  5CU1 A;  3THC A;  2W46 A;  1NAE A;  1LOF C;  1BEV 1;  4XQ4 A;  1MZ5 A;  4Q8L A;  3CZU A;  3ZMO A;  4OCT A;  1H2L A;  4AL9 A;  4EP9 A;  1G8W A;  2XR4 A;  3IT8 A;  3WR0 A;  5FPX A;  2R30 A;  3T2T A;  1OSG A;  4NRQ A;  1VE0 A;  2C1F A;  4Q5O A;  3KV4 A;  3TAY A;  2GMM A;  4PLM A;  3MIE A;  5DUW A;  3R0R A;  5C3O A;  2DWR A;  1LHV A;  2NYY A;  4TN7 A;  3N7L A;  4K8F A;  5JOX A;  1XSQ A;  4HK9 A;  2WQZ C;  4GJY A;  4BPZ A;  5C5T A;  2WUH A;  3ZXA C;  2PFT A;  3JD7 2;  4S2F A;  2ZGT A;  1UU6 A;  3LA3 A;  4QGN A;  4UFK A;  2FBE A;  2B1E A;  5I0D A;  3ZDV A;  5BPX A;  3E5U A;  1IQA A;  4LIV A;  1GOH A;  1G86 A;  3HGK E;  2OZ6 A;  3HAG A;  3O7O A;  5F8P A;  3NAP B;  5IFT A;  1ZZC A;  2X05 A;  1XMF E;  2VNO A;  4DEQ A;  1GOG A;  3I54 A;  2WO3 A;  3WNK A;  4XJ9 A;  1CWP A;  4FK4 A;  2V4A A;  2VMI A;  2YFZ A;  4CUA A;  3BI3 A;  3LF7 A;  5L7O A;  1J58 A;  5T52 A;  1VAL A;  3OGG A;  3E97 A;  1A8D A;  3C6O B;  3I2O A;  1Z78 A;  4WM7 A;  4LO7 A;  1DDL A;  3BVO A;  3IAQ A;  1ENR A;  2ILM A;  4MHU A;  2LM3 A;  4PCR A;  3T4V A;  3H7Y A;  1E5S A;  1IKQ A;  1WMF A;  4XMI A;  5F2S A;  3ZFE A;  4WM7 B;  2ZGK A;  4DTP A;  2JDN A;  1QJU 3;  1QXR A;  4XHB A;  1GBG A;  1KQR A;  5AVA A;  4AVS A;  4COU A;  3ETQ A;  1CVN A;  2AH2 A;  2F4P A;  4TLF A;  1Q5O A;  1KRI A;  4NPR A;  2BFU S;  1NX9 A;  3A22 A;  4K7J A;  4XUO A;  4OHZ A;  1JYX A;  1OOP B;  4R9A A;  4QAW A;  5I8Y A;  2E53 A;  2JEN A;  3JD7 1;  5FUN A;  5JWP A;  5C8C A;  3I49 A;  1OOP A;  3FUQ A;  4ZHN A;  1RIT A;  4QXH A;  3R4S A;  4DTO A;  4Q4Y 1;  3IZO A;  3ETP A;  3HMY A;  4BXS V;  3GZU C;  1V6O A;  4IV3 A;  3W5M A;  1I6X A;  5F3I A;  2JQT A;  4QM8 A;  2Y6F A;  1TME 2;  3ATG A;  1OVS A;  1LUL A;  1RC6 A;  3L2O B;  4E8D A;  5IHR A;  1ZBA 3;  4PI2 A;  2UWB A;  2G1M A;  1C3H A;  1BYH A;  2ZGU A;  1XMH E;  3H3L A;  5E89 A;  4AFA A;  4QXB A;  3NV2 A;  4IXL A;  1LED A;  3AMQ A;  1IS5 A;  4FJ5 A;  2HWE 2;  4Y22 A;  3NV4 A;  1UO9 A;  2AZ5 A;  1NCQ C;  4XVH A;  1FNY A;  4EWA A;  2EIE A;  4OYU A;  4XQW A;  5A3W A;  5IK5 A;  2D6N A;  3VZM A;  3NJZ A;  5HI0 A;  2DUP A;  3CLP A;  1UMI A;  1VBA 3;  3UES A;  4NIH A;  4Y24 A;  3ZIX A;  3SNN A;  1W2U A;  1SZB A;  3Q8F A;  4Q1R A;  5IAV A;  4KHS A;  2W9X A;  3ZFE B;  4GJZ A;  3TEZ A;  1S0B A;  1H2K A;  1W0P A;  2WO2 A;  2EXH A;  4NJ4 A;  4ZU7 A;  3ACL A;  4RN5 A;  4XAE A;  2E31 A;  5D21 A;  2XJU A;  3WDU A;  4RG8 A;  2Q8E A;  1RXF A;  2B9U A;  4KHQ A;  3WQ0 A;  4D0Q A;  3LFM A;  4IV1 C;  1S0E A;  2RCU A;  4B08 A;  2QE3 A;  4Y20 B;  1S0G A;  2WN2 A;  3N36 A;  4AE2 A;  1PNF A;  4H3W A;  3SH5 A;  4GH4 A;  3VV1 A;  2FYO A;  4XAB A;  5FY4 A;  3BTX A;  1ACC A;  3QLQ A;  1XVG E;  3EB7 A;  3GZA A;  4WV8 A;  3VHP A;  4CCL A;  4CDU B;  5C3S A;  4FJG A;  4EZH A;  3WW2 A;  5FOB B;  3KLS A;  1K45 A;  2ZAC A;  3FX3 A;  5LAS A;  3CFO A;  4MOA A;  1WWY A;  5FYS A;  4BHP A;  1RUF 3;  4IV3 B;  1SEF A;  4PDW C;  3NJY A;  3KZ4 C;  3OCP A;  3WQB A;  4AQ6 A;  1N3O A;  2DVG A;  1H8V A;  3IDA A;  4XF1 A;  4YZ4 A;  4NRM A;  3W20 A;  4EWD A;  5HCF A;  2XON A;  3VBO A;  1BMV 1;  2RDS A;  1JMU B;  5BYN A;  1L7R A;  3AJY A;  5FY5 A;  3PU8 A;  3OPT A;  4KWU A;  1POQ A;  3BU7 A;  3VBO B;  4DRV A;  4YZ2 A;  1W9F A;  3B9I A;  4FPY A;  3RMD A;  1QOT A;  1H9P A;  1Q8O A;  2EXK A;  4HXC A;  3AYE A;  3L0M A;  3VBH C;  5FY9 A;  5H9Q A;  2VL4 A;  2A6V A;  1VBD 2;  3VBF A;  1ZA7 A;  5LBB A;  1OUX A;  4V2W A;  4V1P A;  3A0N A;  1EPZ A;  3J7L A;  3V7D B;  1IH7 A;  1SLI A;  2ZGN A;  1ZRF A;  4QD2 A;  4P9X A;  2Y60 A;  1ULE A;  3C7H A;  4DU3 A;  1CZV A;  2H4T A;  4LKS A;  1QQP 2;  5LBF A;  2JIC A;  4FSJ A;  1SCR A;  2W3J A;  4P5Y A;  4UOJ A;  1FPO A;  2CAU A;  3L2Y A;  3AZV A;  2VQT A;  3LPF A;  1XU5 E;  3I3M A;  1DFQ A;  1BBT 1;  1UKR A;  1COV 3;  1VBE 3;  4YM1 A;  1RL3 A;  4JGZ C;  4Q2F A;  3AVR A;  1E5R A;  3KVA A;  4UF0 A;  4IV1 A;  5T5O A;  1PMI A;  4N9H A;  2P5B A;  1F31 A;  2VZP A;  2JPN A;  1NCQ A;  5FRA A;  5A7S A;  5I91 A;  1H2M A;  4JVA A;  4RL5 A;  2ZGP A;  4Y1V A;  4CUC A;  3H8U A;  4BOW A;  3E6C C;  5FPA A;  1PO2 1;  1ND2 A;  5EYY A;  2WWS A;  3JB4 C;  5JLV A;  3U0Z A;  2WSV A;  4HLT A;  4QU2 A;  5A80 A;  1MVQ A;  2JKX A;  3AM2 A;  3K48 A;  2D40 A;  1W6M B;  2BEO A;  2VGD A;  1ND3 A;  2GZW A;  5ACA 2;  1BVV A;  3NCI A;  4E4H A;  3NHG A;  5KXB A;  1DQ5 A;  2MZW B;  1OA4 A;  1XQN A;  2A75 A;  3CDZ B;  1LTE A;  1MS0 A;  3HVD A;  4CDW A;  5ABJ C;  1ULF A;  4YRD A;  5A3U A;  2OVQ B;  4HOO A;  4M3R A;  5JI9 A;  5FYY A;  5JXH A;  2PHX A;  3DXU A;  4QB1 A;  4XFH A;  2JWP A;  5C7G A;  1STM A;  2ETE A;  3VBU C;  5KXC A;  2QTW B;  4GD4 A;  1ULC A;  4LLF A;  2JDZ A;  5F6L B;  3VBH A;  1NT0 A;  5B4N A;  1X9T A;  4XUQ A;  5F39 A;  5K0U B;  4HPK A;  2BFU L;  4I3P A;  5H37 A;  2JDY A;  3ZXK A;  4A7Y A;  4HN1 A;  5B2G B;  2JDH A;  3S0M A;  1WMD A;  2A7A A;  3AVS A;  3J8F 1;  2CV6 A;  4X8P A;  5LA1 A;  3LD8 A;  1JHN A;  1Q8P A;  3BOD A;  2XML A;  4CXW A;  4QKD A;  3TJY A;  1YEW A;  4IEY A;  1MS8 A;  4QX3 A;  3B94 A;  5CKM A;  2PHR A;  1PGS A;  4Y1Y A;  4ZZ5 A;  3J8F 2;  4QWN A;  5C3Q A;  3WW4 A;  1AVB A;  2VTX A;  4YW5 A;  3NAP C;  5LEK A;  2NMN A;  3POE A;  3UKN A;  1YC6 1;  1RUH 1;  1JS9 A;  5FIX A;  2LS6 A;  3OD0 A;  1QJY 3;  1ZRR A;  2WNV B;  5FYZ A;  1GU3 A;  3MZH A;  3WV6 A;  2A6Y A;  4Q4V 3;  2P17 A;  5FYU A;  4UYB A;  5FY1 A;  5IVE A;  3M70 A;  4JRA A;  2CNA A;  2GAU A;  3OUJ A;  5KR7 A;  5HXV A;  4K21 A;  3S57 A;  5IK4 A;  1UYP A;  4NOT A;  3GCX A;  1O59 A;  4XOG A;  5K9Y A;  4FCA A;  5DAV A;  2JDP A;  1HJF A;  2JG9 C;  4DXR A;  2D5F A;  2VTX J;  2GP5 A;  4EN6 B;  1BVP 1;  5HBA A;  3ZR5 A;  1KDM A;  2W1S A;  4NPL A;  3ECQ A;  3ILR A;  1UY4 A;  1JUI A;  3DGT A;  1R64 A;  1VBC 1;  2ARX A;  2PLV 3;  1YI7 A;  2B46 X;  2RS3 2;  3S6P A;  4FQZ A;  4DTJ A;  5LZ6 A;  3HJR A;  2RS1 3;  4RFT 0;  3N9P A;  2P5O A;  1GWL A;  1W05 A;  3NNG A;  4JHZ A;  4QHO A;  3SCH A;  2FCU A;  4GKX A;  5CIR A;  1WLT A;  1ZZ6 A;  1W6N B;  3A7Q A;  3CEW A;  4ORF A;  4AVC A;  4IE7 A;  3ZYI B;  1OUR A;  4A6O A;  4DUV A;  5D2A A;  3WF0 A;  5A32 A;  5KHK A;  3GJB A;  4LLO A;  2XG3 A;  4I9Q A;  2BQP A;  2IUW A;  2RM2 3;  5DQ0 A;  1DQ0 A;  2ZEZ A;  1QQP 1;  2YC2 A;  3JB8 A;  1ZZ9 A;  1POV 1;  5FYV A;  4EYU A;  2VQA A;  4KL1 A;  4QPI C;  1V6M A;  3WLU A;  4AAP A;  1RUC 3;  5BNP A;  2VCA A;  1XNT A;  3K46 A;  2JG8 C;  4N53 C;  1WW5 A;  4WVM B;  5CG9 A;  4IEZ A;  3D0J A;  4TTG A;  2YZ4 A;  2HYK A;  4JS5 A;  2ZAH A;  3DN7 A;  4IGP A;  2RS3 3;  1HRI 1;  1O3S A;  4D7T A;  2RR1 2;  2YPD A;  5HCH A;  1RUI 3;  2DUO A;  4AI1 A;  3THT A;  1BHG A;  1RUG 1;  2F17 A;  4XJW A;  1RMU 3;  1Y43 B;  2R04 1;  4K1Y A;  2AEY A;  3TN9 1;  1OLM A;  3LAG A;  4ES9 A;  1SFN A;  4AFM A;  4HON A;  4ZON A;  3WG1 A;  1W8Z A;  5EIY B;  1ODM A;  5F37 A;  1QJZ A;  4QXC A;  3NQH A;  5CYY A;  1BCX A;  2R06 1;  4CDQ A;  4AR2 A;  2VM9 A;  4NHK A;  3AZX A;  1RUD 3;  5CA6 A;  3NGI A;  1SFY A;  4IE0 A;  1K5M B;  1ZRD A;  3ACH A;  2BWC A;  3ZN5 A;  1EAH 3;  1OLM E;  1QKQ A;  4DS0 A;  2HWC 2;  1AR8 1;  2JX9 A;  4RFR B;  3LOI A;  4AI6 A;  2QQV A;  4LKD A;  1LRH A;  4LO4 B;  2JDK A;  4RGA A;  4EWE A;  5HV4 A;  5M0T A;  2XQX A;  1HB1 A;  2ET7 A;  3BVC A;  3CU7 A;  3M3O A;  4N53 B;  2VG9 A;  3UET A;  2LRO A;  3QEV A;  5JPN B;  5FPL A;  3WG3 A;  5KBF A;  4UAP A;  5JXJ A;  2AEN A;  1C8M 2;  1ZBE 1;  4X5N A;  2YFU A;  4PQQ A;  3RMA A;  3NW4 A;  1AR8 2;  3MLL A;  1O8P A;  3NL1 A;  5FZE A;  5T55 A;  5BNP B;  1XMG E;  2XB6 C;  2HD0 A;  5LB6 A;  4HSJ A;  1XSR A;  5FYB A;  1NCR C;  2D44 A;  1X8E A;  1Q8V A;  3WVJ A;  2WAO A;  1HQW A;  4EV0 A;  2B8I A;  3HT2 A;  4B1M A;  1XYP A;  4BH9 A;  1DCS A;  5DDJ 2;  4BU2 A;  2GC3 A;  4KMQ A;  3WX5 A;  5G04 L;  3E4W A;  2R32 A;  3KV6 A;  3BB6 A;  3TNP B;  3SH3 A;  3UNP A;  4ARY A;  2DY4 A;  4B7K A;  5FYH A;  4I02 A;  1BEV 2;  2E51 A;  3E5X A;  1RUG 2;  4NWV A;  4UFM A;  5A6X A;  2QVS B;  1HRV 2;  2PHT A;  1EV1 1;  1UW8 A;  3D4K A;  3TOJ A;  3QEW A;  3WW1 A;  3W21 A;  1UMZ A;  2Q8C A;  2WNU B;  2JE7 A;  2TUN A;  2OZS A;  1NCR A;  5A1F A;  1HX6 A;  3FMG A;  3NNL A;  4MO3 M;  3AYC A;  1OQD A;  5D8A B;  2VO5 A;  3CJI A;  4HN0 A;  2WNV A;  4UW4 A;  4AI0 A;  1D2S A;  1QJU 1;  5JZG B;  3JXS A;  2ZTN A;  3VKO A;  5EV7 A;  1OA2 A;  4YAR A;  2IXI A;  1FX5 A;  2WNV C;  3GAL A;  4P9G A;  2Q1Z B;  2V5D A;  2ZEX A;  1FPN 3;  1POV 3;  2ZPX A;  1FOD 3;  4FJL A;  1R08 3;  3WXP A;  5F2W A;  4LUK A;  2ZJC A;  4M3C B;  2EVX A;  1FT9 A;  1M4W A;  3AL6 A;  1F8V A;  3BIE A;  5C9A A;  3JQW A;  4FP3 A;  1ZBE 2;  2NLR A;  2VAU A;  3ZXE A;  1G9B A;  4BK4 A;  3V0A A;  4YGB A;  1NLR A;  3RZJ A;  5FZ7 A;  3LZJ A;  2ARB A;  1HV1 A;  2JD4 A;  4BZ4 A;  3FHI B;  3IDC B;  1HB3 A;  1ENX A;  2BWA A;  1LJ7 A;  1PO2 2;  3SI6 A;  1A6C A;  3GGL A;  3NV1 A;  4A42 A;  3VZJ A;  4F83 A;  4J25 A;  1YIP A;  2BGC A;  2PHF A;  1KFX L;  1FZH E;  1MEC 3;  3KT7 A;  4L0P A;  1X50 A;  3CL1 A;  3LA7 A;  2ADD A;  3ZXL A;  5T54 A;  2J42 A;  1LB2 A;  1MZF A;  3VDD B;  1ZX5 A;  2JDA A;  3M3E A;  2WNU A;  4N8M A;  1NA1 A;  2WZE A;  5FZL A;  2WJS A;  4XFC A;  4FOQ A;  4MZU A;  5BNQ A;  4A4A A;  3OTF A;  1RUH 2;  3OY8 B;  3WD5 A;  1AHS A;  2D6K A;  4GIQ A;  5KHJ A;  5GLW A;  2A6Z A;  1GZ9 A;  1PZ8 A;  1JW6 A;  4MG2 A;  5JUV A;  4K40 A;  1FV2 A;  5FLI A;  2P4E A;  1W2O A;  1DHK B;  4CDQ C;  3B02 A;  4D7Y A;  1NE4 A;  2VUC A;  1AX1 A;  1RUE 1;  4QKB A;  3MW4 A;  3WW3 A;  3ZX7 A;  1QJY 1;  1YQC A;  1TZO A;  3HN1 A;  2VUA A;  4DB5 A;  2J1A A;  2HH9 A;  1SLB A;  4Z07 A;  4DXS A;  3FUO A;  4ISR A;  4MXV A;  2ARC A;  1UOB A;  2WLQ A;  2IVJ A;  3ZYJ B;  3VBR B;  2VQU A;  4X6R B;  5JR7 B;  1GQP A;  1NLS A;  1X33 A;  5LY2 A;  2VOW A;  4CU7 A;  5LEJ A;  4M00 A;  3TWI A;  1TNF A;  4B4Q A;  4FPJ A;  4LEJ A;  2DUQ A;  4HKL A;  4V2V A;  4YFZ A;  3UJO A;  1OPO A;  4E4S A;  3J2P A;  1DQ1 A;  3FHQ A;  4W6Y A;  1V9U 3;  2HWF 3;  1FPN 2;  1NOV A;  3W5N A;  1P8J A;  1PX4 A;  3T2Q A;  2ZML A;  2C9K A;  1HLC A;  1UZW A;  4R8H A;  2YC4 A;  1KXG A;  4D6R A;  3IBM A;  3INA A;  1WAJ A;  1CQ9 A;  3A23 A;  4XXA A;  4C0H A;  5F5I A;  2JXA A;  3T0B A;  4ICG C;  1U5Y A;  3SCG A;  4LE4 A;  3C94 A;  2X5I C;  4QDR A;  4RR3 A;  5C4W A;  3PUH A;  1CAV B;  4ARX A;  3TBD A;  3OBA A;  1O4Y A;  3BIW E;  4R4X A;  1AR9 3;  2HWD 3;  1UZ0 A;  3OB8 A;  3POY A;  3T3Y A;  1NEX B;  2ZKL A;  5FBJ A;  4M0H A;  4M41 A;  2DBN A;  1AYN 1;  1CAX B;  3B5L B;  4JQR A;  3MIH A;  4LBL A;  4FK2 A;  1WLC A;  3IMN A;  2XOM A;  2GNT A;  2GP3 A;  3CFP A;  3I3D A;  2XLG A;  4XZP A;  5EJZ B;  5CEH A;  1WGP A;  4RHV 2;  1UAI A;  3K2O A;  1YXW A;  3WNL A;  4MAD A;  2FDI A;  1J1L A;  3VKM A;  4BQ4 A;  4TWT A;  1FS1 A;  1AL2 2;  4OLL A;  4DXT A;  5C8W A;  4Y5Z 0;  2ZHK A;  5FZH A;  4XFB A;  1YRZ A;  3KF3 A;  5C9A B;  1AYM 1;  5APA A;  1W8H A;  4OHV A;  4LHS A;  1DLL A;  5A3O A;  1QJU 2;  1O4T A;  2FW3 A;  2OS2 A;  4MGI E;  4DOU A;  4Y5T A;  3MPB A;  4NII A;  3M4F A;  3WT3 A;  3AP4 A;  4I9L A;  3I2F A;  2OZJ A;  1PGW 1;  3LEI A;  1Q56 A;  1OFS A;  5JIA A;  3VBU A;  3ORJ A;  1W6Q A;  2RVA A;  2DBI A;  3GHM A;  2PA7 A;  1RIR A;  1UPI A;  4I01 A;  4LBQ B;  1WD4 A;  5FYM A;  1YFW A;  2GAL A;  3RZM A;  2R16 A;  5FZK A;  4RD7 A;  2HJI A;  1R08 1;  5FZ0 A;  1KFU L;  3SEE A;  4B1L A;  1CIW A;  3SKV A;  5LCW L;  2RS5 1;  1UOG A;  5F9T A;  3SUP A;  5EWS A;  1W6M A;  1HIX A;  1H1A A;  4I0B A;  4B8E A;  1Z7S 2;  2ZGL A;  4IE6 A;  1UIJ A;  4Q4V 2;  4P08 A;  5EZW A;  4BWO A;  3AC0 A;  1MR5 A;  4FJK A;  4Y4Y A;  4NAO A;  1SBF A;  1MS9 A;  4QQL A;  5ERL A;  1DQ6 A;  2ORZ A;  1C1F A;  5E1R A;  4BK5 A;  2VME A;  5IFP A;  3LEM A;  2DVF A;  5A7N A;  4FOV A;  5IW0 A;  3UJQ A;  4RHV 1;  5ACA 3;  2CWS A;  3N9Q A;  4CE8 A;  1UL9 A;  2ZX2 A;  3LDR A;  5DXD A;  4DTR A;  2RJL A;  5CFD A;  2VBD A;  5FP8 A;  5DAW A;  5A7W B;  4JGZ A;  4A3Z A;  1ULG A;  4BXF A;  2NZ9 A;  4FJI A;  1O4Z A;  3C6N B;  3VHR A;  4BIS A;  3HIF A;  4CDW C;  1N1Y A;  4FFF A;  2PLV 2;  4FJX A;  4LKF A;  2VTF A;  5FMB A;  2XXZ A;  1BZW A;  1I5Z A;  4UF0 B;  2SBA A;  2CY6 A;  1ND3 C;  2VW2 A;  5FCC A;  4KGQ A;  3MID A;  2FMY A;  1C1L A;  4CUB A;  4NE9 A;  1W8T A;  4DUW A;  4FTB A;  4LO5 B;  3VDD A;  1OOP C;  4BQY A;  1C57 A;  4IGO A;  3C95 A;  2BVV A;  3OUH A;  3Q8E A;  4FFG A;  3MLJ A;  3FWE A;  3OD4 A;  4A3X A;  5C4W B;  3AMP A;  4PIY A;  4C0B A;  3OGK B;  1B35 B;  1IOA A;  1JYC A;  3JBG 2;  3M3Q A;  3V65 A;  2EXI A;  1YQ8 A;  3MF9 A;  4AGR A;  2RM2 2;  2P1O B;  2W1W A;  1UPS A;  2WZR 3;  3C3V A;  4M4P A;  1AR7 3;  5A1A A;  4CXY A;  3M1H A;  4AED C;  2XUM A;  1AR6 2;  1VRB A;  4LE3 A;  5H9R A;  2YBS A;  3NNM A;  1ND2 C;  2WT0 A;  4LMF A;  1US2 A;  2QZ2 A;  4PBO A;  5EHD A;  1RED A;  5H9S A;  2MMB A;  2RDN A;  5FZD A;  5FQ0 A;  2XHK A;  4BE3 A;  2N7G A;  4COV A;  2PTM A;  2Z42 A;  4LK7 A;  1VRH 3;  2E26 A;  1LOE A;  1EAH 1;  3ITQ A;  4GWN A;  4KQ7 A;  4CUG A;  2PAK A;  1OH3 A;  1RJ7 A;  1WCQ A;  2QQW A;  4TYS A;  1K3I A;  1US3 A;  2Y6G A;  3KT1 A;  4YG6 A;  5IVY A;  1CJP A;  2VZQ A;  3RI8 A;  4H55 A;  2MW2 A;  4HZF A;  2DFB A;  4XF4 A;  4GB3 3;  2D6M A;  3QH6 A;  4GXL A;  4IDZ A;  3QET A;  3E6B A;  1EAH 2;  4GH4 B;  5FZM A;  3T0D A;  1UNB A;  1AXZ A;  1AX0 A;  1BK1 A;  1UU5 A;  1QNW A;  1DZR A;  3K77 A;  1W6Q B;  2Y0I A;  5FJK A;  2ZZQ A;  1Q8Q A;  1RUD 2;  3HR9 A;  2VCM A;  2UYB A;  3MIB A;  1Z7S 3;  1W90 A;  3K3N A;  1HXS 3;  5LBC A;  1POV 0;  3O1V A;  2DVD A;  3ME2 A;  4N7I A;  2C9A A;  3I8T A;  4Z1V A;  2BU9 A;  2W5F A;  5T5P A;  2W52 A;  4PDW A;  5FRE A;  3POI A;  4AG4 A;  3NV3 A;  4UW6 A;  1VBD 3;  3M3C A;  3LOB A;  4QGL A;  3F2Z A;  3NJV A;  2GMP A;  1JI6 A;  3WF4 A;  1DGR N;  1W9T A;  2WO1 A;  1UXZ A;  1W8N A;  3RPQ A;  1LES A;  3CFR A;  5J36 A;  2LF3 A;  1GWM A;  1H1I A;  4FFI A;  5IBK B;  2AGS A;  5KHH A;  2XUE A;  3B93 A;  2VXJ A;  2P1Q B;  1FMD 3;  1Y3T A;  2MEV 1;  2VVD A;  3I2G A;  1ASJ 1;  3HN3 A;  3I59 A;  4K1Z A;  3F95 A;  2AC1 A;  1AJO A;  3OBR A;  4QB6 A;  4FOY A;  3D8C A;  4XDO A;  4XDQ A;  3MUY 1;  4YW7 A;  1QJX 1;  2DU0 A;  1PHM A;  5CNA A;  2YB7 A;  1DIW A;  1RUC 2;  4EN9 B;  3ASI A;  2EIC A;  3LEG A;  4YNI A;  3H50 A;  4I0W B;  1IGO A;  1LHW A;  5FY7 A;  2VJX A;  2KR2 A;  3VBF C;  3VB9 A;  5FZF A;  2XL9 A;  2HWF 1;  1MAC A;  4ERO A;  1SPP B;  4P9I A;  2GH8 A;  3ZFG C;  3RJR A;  1A34 A;  1XYN A;  3H9A A;  3OBT A;  3FL7 A;  1BKZ A;  3JBG 3;  2ZKN A;  2EAK A;  2FZ2 A;  2ZX4 A;  4KI6 A;  1HRI 2;  1VPH A;  1O91 A;  3D82 A;  5LK7 B;  4JZR A;  3ZFF B;  1JZ5 A;  5BNO A;  3THD A;  3DCQ A;  2Y33 A;  2DTW A;  4O9E A;  2JHP A;  4FJ9 A;  1RUE 3;  2VBB A;  2R04 2;  3I3B A;  4W50 A;  1S0C A;  3DV8 A;  5CZK A;  3TEX A;  1IZ3 A;  2W0X A;  4YZ1 A;  3N4M A;  1W8F A;  5CIS A;  4AOC A;  4LIT A;  3D6E A;  3POJ A;  2D3P A;  4M3C E;  3GNE A;  1LAJ A;  2BRT A;  1GSL A;  2PXJ A;  3AKR A;  2AAC A;  4CP0 A;  3AFK A;  4JCK A;  1AYN 3;  4CTE A;  3H7J A;  5JSR A;  5BV6 A;  1AXY A;  1RVF 2;  5C8C C;  2YYO A;  4XIK A;  3WCR A;  3LEK A;  5C70 A;  1FMD 1;  2MEV 3;  2R07 2;  3VD7 A;  2PN5 A;  1DGW A;  1AL0 G;  2IVI B;  1K5J A;  3JBG 1;  3ZN6 A;  1I3H A;  3MPP G;  3RYP A;  1EP0 A;  4LO6 B;  1JBC A;  3U14 A;  1PIV 3;  4Y1Z A;  3PVO A;  4RA0 A;  4QPY A;  3PIG A;  1ZNP A;  4XDP A;  3OGM B;  1W99 A;  2VMF A;  4AED A;  2OYZ A;  4E4D X;  1QH7 A;  3SUO A;  5FPZ A;  2G4I A;  2R07 1;  5FZO B;  3NAE A;  3J8F 3;  3L9J T;  4XFI A;  5SV8 A;  4XE9 A;  3RWU A;  1TMF 2;  3CHX A;  3K4A A;  5FZ8 A;  1FNZ A;  4XTP A;  4BQW A;  3POB A;  4YW4 A;  4Q4W 1;  2EID A;  2V73 A;  2Q30 A;  3ILF A;  5KHG A;  2HLE A;  2ZGR A;  4E3S A;  3APB A;  1BBT 2;  3KQ4 B;  4OVE A;  4B7E A;  5BNN B;  2VOT A;  2YBK A;  2XBO 2;  4TSV A;  3SQO A;  3SH4 A;  1OT5 A;  4MET A;  3LSD A;  4NO4 A;  4IQP A;  2CDO A;  4OMC A;  3V0B A;  4NID A;  3N1B A;  3EBR A;  3N9N A;  3ZFG A;  2RS5 2;  5LAT A;  3POS A;  3WUD A;  5J1X A;  3ELN A;  1GQG A;  2ATQ A;  1SMV A;  4LA3 A;  4FJ7 A;  4WZF A;  2X8K A;  1VBB 1;  4L92 A;  5J96 B;  4JV4 A;  1W3V A;  2AYH A;  2VVF A;  4JC1 A;  2QQM A;  3OOX A;  4YVS A;  4M3U A;  1FYZ E;  1V6I A;  1VB4 A;  3MLK A;  1AUY A;  2LUW A;  3IPV A;  4CSW A;  1GWK A;  3OG2 A;  1V0A A;  4CU6 A;  1CX4 A;  1ZRC A;  3N1E A;  2JDU A;  1TMF 3;  1LOC A;  2B9V A;  1IG3 A;  5T3N A;  3T0A A;  2EA7 A;  1HB4 A;  2CL2 A;  1ST8 A;  2Y34 A;  4QDS A;  2XJP A;  1ZRI A;  2OPK A;  1OLQ A;  2WT2 A;  3S7I A;  3WNN A;  1CAU B;  4L9B A;  1GZC A;  2PAM A;  3TEW A;  3U78 A;  4EQV A;  4RGK A;  4Z2A A;  1E5H A;  4ISQ A;  1OFN A;  2FDK A;  3T08 A;  1MQT B;  3S30 A;  1PVC 1;  4YZ3 A;  4BA6 A;  3U37 A;  1WLW A;  1CAU A;  1CPN A;  2MEV 2;  3J4U H;  3O12 A;  1UMH A;  1PMJ X;  2OVR B;  4E2Q A;  5GM0 A;  1PO1 3;  2G9G A;  1FAT A;  2GN7 A;  4PHZ A;  2IXJ A;  4FT8 A;  2K9Z A;  1VMF A;  4RQP C;  2JD9 A;  1G9F A;  1XNB A;  4YG3 A;  1VBA 1;  1N1V A;  4IES A;  3NKG A;  2D98 A;  1EV1 3;  3I7D A;  1ALY A;  3I2H A;  1FZ1 E;  3BYW A;  2WNE A;  3MIF A;  4OHX A;  4CA9 A;  5FV3 A;  1W9Y A;  2DCZ A;  1MS3 A;  4KG8 A;  3PUA A;  5DZF A;  2R49 A;  3GBG A;  3GDB A;  4K9S A;  2CSG A;  3KB5 A;  1VAK A;  1W06 A;  3WOG A;  1U0A A;  1NYW A;  2UY8 A;  1VAV A;  4CXX A;  3ZXJ A;  2W91 A;  2DEB A;  1ZA4 A;  3CMG A;  3PME A;  3DPR B;  4IEU A;  4URA A;  4RS5 B;  2DU1 A;  2CDP A;  3IB3 A;  3ZLI A;  1CES A;  2IXC A;  4CYD A;  3RFR A;  4GMP 3;  5A6Z A;  2UYA A;  2DCY A;  4WM8 A;  1W6P B;  1RUF 1;  1PK6 B;  2BVB A;  4HVO A;  4QQ2 A;  3C7O A;  4DQA A;  5FZG A;  4MH0 E;  2FD8 A;  3ZR6 A;  2CTV A;  4D94 A;  3N7M A;  1O5L A;  4X6Q B;  4O7X A;  3Q8B A;  2P6C A;  2QQI A;  3N7J A;  1UF2 C;  5GJ6 A;  1W04 A;  4DIN B;  5FFO C;  1YFX A;  4FTE A;  1GR3 A;  1YNA A;  5FLH A;  1F5F A;  3JU9 A;  5IYY A;  4FQ4 A;  4C90 A;  4BQ3 A;  5EPA A;  1Z0H A;  1EPW A;  1OKO A;  1BMV 2;  2A3W A;  2WYS A;  2B39 A;  4KU7 A;  4XTM A;  4Z8B A;  5LRS A;  1ND3 B;  4IEW A;  4CEY B;  4XIL A;  1PX3 A;  2BP6 A;  1L7Q A; 
#chains in the Genus database with same CATH homology
 4PQQ A;  4M3T A;  2YFU A;  3RMA A;  3OGS A;  1O8P A;  1XVF E;  1OD3 A;  3J27 A;  1FZ7 E;  1XMG E;  2HYX A;  3OGV A;  3T2O A;  2HD0 A;  4M3W A;  3SPY A;  3MV0 1;  1FZ2 E;  3CQ8 A;  1W9S A;  3KD5 E;  2B8I A;  2WAO A;  3HNB M;  2P1N B;  1MHZ G;  2YG0 A;  2Z4F A;  2VZS A;  2PQS A;  3K4Z A;  1I5P A;  4KMQ A;  5G04 L;  3E4W A;  4RYD A;  3UNP A;  4MGQ A;  4ARY A;  2DY4 A;  4BDV B;  3CQO A;  1XPW A;  2WQ8 A;  1JU3 A;  1IG9 A;  2WZ8 A;  1XNA A;  4DTU A;  3TAE A;  2W87 A;  3QEW A;  2XHN A;  4X5M A;  3QER A;  2OZS A;  2OYQ A;  3RMC A;  4MO3 M;  3I97 A;  4GZ9 A;  1JU4 A;  2BBA A;  2VO5 A;  4DTN A;  4J2A A;  2DCK A;  4P02 B;  4E4B A;  1EUU A;  4E8C A;  4AAX A;  1MMO G;  4CVU A;  3III A;  2J1U A;  3JXS A;  2QBX A;  4EPH A;  1ULO A;  3MUZ 1;  4XUP A;  2V5D A;  2VZ1 A;  2ZEX A;  1UWW A;  4QB2 A;  3DYP A;  4FJL A;  1J84 A;  2JH9 A;  3SQ1 A;  2DTU A;  3OEB A;  2P1M B;  1UYY A;  4JX0 A;  4BK4 A;  2VJ4 A;  1JZ2 A;  3VDC A;  3WEZ A;  3LZJ A;  4P00 B;  1Q9X A;  4QX0 A;  1HN1 A;  4ZZ8 A;  1LNS A;  4FJ8 A;  1WAF A;  3QNN A;  4J2D A;  1FXX A;  3I2J A;  1JYN A;  2W1U A;  4JKL A;  1UYX A;  3WF2 A;  3SI6 A;  3GGL A;  4A42 A;  2W92 A;  2ZEW A;  1FZH E;  4L0P A;  3GM8 A;  3HNM A;  1JZ8 A;  3WNP A;  2JDA A;  2P5G A;  1ULP A;  1UYZ A;  3L1N A;  5B4X A;  1FZ8 E;  2WZE A;  4RNG A;  1SG3 A;  3OGL B;  2J1R A;  4OMD A;  3E1F 1;  4A4A A;  5IJR A;  1UXX X;  4FJN A;  2VZ3 A;  3I2I A;  5LA0 A;  2J1S A;  3VDB A;  1XVE E;  2RV9 A;  4D8M A;  5JUV A;  1JZ3 A;  3MBW A;  3CKH A;  3WSO A;  2LF6 A;  4AKG A;  1FZ6 E;  2B7M A;  4I6J B;  2DCJ A;  2J1A A;  3WNM A;  3LDS A;  4DXS A;  4QX2 A;  2W94 A;  2VQU A;  3LE0 A;  1GQP A;  4CU7 A;  3P6B A;  2OKX A;  5JR2 A;  4HG6 B;  2C4X A;  4M3Z A;  4DU4 A;  3NJX A;  4XUT A;  3ACG A;  4TXW A;  2Y6K A;  3DYO A;  3J2P A;  3FHQ A;  4J2E A;  4ZXE A;  4CU9 A;  3W5N A;  1P8J A;  1PX4 A;  3T2Q A;  2OZM A;  4FJJ A;  2C9K A;  3HGL A;  1CZT A;  2YC4 A;  4ADO A;  5F7U A;  3HOB A;  1WAJ A;  3A23 A;  3HL8 A;  3DYM A;  3T0B A;  3ZM8 A;  3EYP A;  4KHU A;  3C94 A;  4QDR A;  2E32 A;  3PUH A;  4ARX A;  5JXG A;  3K75 B;  3WF1 A;  3OBA A;  4M45 A;  3BGA A;  1P22 A;  4KI4 A;  1UZ0 A;  2Y6J A;  3OB8 A;  3THC A;  1NEX B;  4M41 A;  2W46 A;  1IQD C;  2VJ5 A;  3SUN A;  1NAE A;  2Y6L A;  4FK2 A;  2XOM A;  3I3D A;  3CFP A;  4QX1 A;  5EJZ B;  3CZU A;  4FVM A;  3K2O A;  3OEA A;  4EP9 A;  4MAD A;  3WNL A;  1FS1 A;  4DXT A;  4XUR A;  3T09 A;  2PFV A;  1UY0 A;  3MV1 1;  3GXU A;  4QDQ A;  3VD4 A;  1JZ6 A;  4OZO A;  3KD1 E;  1FZI E;  2WUH A;  4LHS A;  2PFT A;  2B4K A;  3FHA A;  2W1Q A;  2FW3 A;  2WBK A;  2J1E A;  1XVD E;  2B1E A;  5I0D A;  1OH4 A;  4EYW A;  4M4R A;  1GOH A;  4I9L A;  3I2F A;  3HGK E;  1F4H A;  3LEI A;  3QES A;  1JZ4 A;  2RVA A;  2QQK A;  5IFT A;  1T2X A;  1XMF E;  2X05 A;  4DEQ A;  1GOG A;  1K42 A;  1GMM A;  1MTY G;  4DTS A;  2WO3 A;  3WNK A;  4FK4 A;  2YFZ A;  3NDK A;  3HNY M;  4CUA A;  3WNO A;  1CIY A;  3SEE A;  3NE6 A;  3SKV A;  4GWJ A;  5LCW L;  5IRE A;  2JE8 A;  3C6O B;  3LPG A;  2QXF A;  3SUP A;  3IAQ A;  1GNY A;  4P08 A;  3AC0 A;  4DTP A;  4FJK A;  2ORZ A;  4FI9 A;  5C71 A;  2ZEY A;  4BK5 A;  2VME A;  5IFP A;  3I3E A;  1NX9 A;  3A22 A;  4XUO A;  1JYX A;  3I2K A;  4QAW A;  2X10 A;  4W4Z A;  4DTR A;  4A3Z A;  1KEX A;  4FJI A;  4DTO A;  3C6N B;  3SUQ A;  3ETP A;  4BXS V;  4FJX A;  2VMC A;  2VTF A;  4PF1 A;  1MPX A;  3C7F A;  3W5M A;  4XZU G;  4JRP A;  3SJJ A;  4UI9 L;  4CUB A;  3PUI A;  4DUW A;  4E8D A;  5IHR A;  1UX7 A;  4ET7 A;  3L2O B;  3SPZ A;  3C95 A;  4CU8 A;  3HP9 A;  4A41 A;  1XMH E;  5EJ1 B;  3OGK B;  3HPN A;  1XVB E;  4YPJ A;  4FJ5 A;  4XVH A;  2P1O B;  2W1W A;  1UY2 A;  2EIE A;  2RJ2 A;  4OYU A;  4ZY9 A;  4M4P A;  2V72 A;  5A1A A;  1UMI A;  3UES A;  4GWI A;  4FJH A;  3SNN A;  3SQ0 A;  3MO4 A;  4KHS A;  4QND A;  1US2 A;  2W9X A;  1XU3 E;  2WO2 A;  2MMB A;  4RN5 A;  2VZV A;  2E31 A;  1DP0 A;  3FN9 A;  4RG8 A;  4KHW A;  2E26 A;  4M3Y A;  2VZT A;  4KHQ A;  2WAB A;  4D0Q A;  5HXM A;  1WCQ A;  3P1I A;  2RCU A;  4B08 A;  1K3I A;  1US3 A;  2R7E B;  3L8B A;  2WN2 A;  2VZQ A;  2Y6G A;  4A45 A;  3C6P B;  1PMH X;  2FYO A;  4DEV A;  1XVG E;  3EB7 A;  1K12 A;  3QET A;  4J2B A;  1JYW A;  4FJG A;  4KHN A;  3T0D A;  1K45 A;  3CZJ A;  3CFO A;  3DEC A;  4MOA A;  1JHJ A;  1KGY A;  3K77 A;  1MHY G;  2VCB A;  3WQB A;  3K4D A;  4QNC A;  2X09 A;  3IDA A;  4IUG A;  2Y64 A;  3J7H A;  4JS4 A;  4M42 A;  4QPW A;  2XON A;  1GOF A;  5FUI A;  1O8S A;  2WDB A;  3S9H A;  2BGP A;  2W5F A;  1L7R A;  4AG4 A;  4W8J A;  4M3X A;  4KWU A;  2J1V A;  3F2Z A;  3NJV A;  1JI6 A;  2J1T A;  3WF4 A;  3RMD A;  1W9T A;  1UXZ A;  4FK0 A;  1DYO A;  1W8N A;  3CFR A;  3QEX A;  2WO1 A;  4JKM A;  2L9L A;  2LF3 A;  3L0M A;  5IBK B;  2VL4 A;  1JZ7 A;  4HCB A;  2P1Q B;  3I2G A;  3HN3 A;  4QB6 A;  2E33 A;  3VD3 A;  5JXI A;  3V7D B;  1IH7 A;  1GUI A;  3LQC A;  3MUY 1;  2YB7 A;  1SHW B;  3D3A A;  3ACI A;  3C7H A;  2VMD A;  4DU3 A;  2EIC A;  1CZV A;  3LEG A;  2H4T A;  1JYV A;  4LKS A;  3SQ2 A;  2BGO A;  2VJX A;  2W3J A;  2BZD A;  4P5Y A;  4UOJ A;  1H6X A;  2W47 A;  2VQT A;  3LPF A;  1XU5 E;  2DDU A;  3C7E A;  3WF3 A;  4A44 A;  2QQO A;  2J7M A;  4DU1 A;  3FL7 A;  4BJ0 A;  3HEI A;  2VZP A;  2JPN A;  4KI6 A;  4RL5 A;  2VC9 A;  2BER A;  4CUC A;  1JZ5 A;  3THD A;  3BN6 A;  1FZ3 E;  4W50 A;  2JHP A;  4FJ9 A;  3I3B A;  1FZ5 E;  5CZK A;  2J22 A;  1W9W A;  1EUT A;  2JKX A;  2ORX A;  3TAB A;  3QEI A;  2JHA A;  3NCI A;  2V4V A;  3NHG A;  2MZW B;  4AKI A;  3CDZ B;  4OUE A;  1FZ4 E;  4DTM A;  3MKS B;  2VIX A;  2OVQ B;  2Y8K A;  4M3R A;  3LEK A;  5C70 A;  3QNO A;  5JXH A;  5JMO A;  4QB1 A;  3VD7 A;  5C7G A;  1J83 A;  3C8X A;  2JHC A;  3LZI A;  3SEP A;  5B4N A;  4XUQ A;  4FJM A;  5H37 A;  3TAG A;  4UAP A;  3OGM B;  1W99 A;  2VMF A;  2VCC A;  5DQ0 A;  3LDB A;  2P1P B;  3SUO A;  5IZ7 A;  5LA1 A;  3LD8 A;  3NAE A;  1XVC E;  3RWU A;  1NKG A;  3K4A A;  3TJY A;  1F4A A;  4QX3 A;  4MGS A;  1DLC A;  2LW8 A;  5DPN A;  4ZZ5 A;  2EID A;  3SKJ E;  2HLE A;  4E3S A;  1H6Y A;  2VOT A;  3OGR A;  4LPL A;  2VZU A;  1OT5 A;  1WKY A;  2QQJ A;  2OVP B;  2CDO A;  2LS6 A;  4OMC A;  3N1B A;  1GU3 A;  5DMY A;  3ABZ A;  1SDD B;  5J1X A;  2WAA A;  2ATQ A;  1YQ2 A;  4FJ7 A;  1LDK E;  1FZ0 E;  1O59 A;  1UY3 A;  4KI5 M;  2QQM A;  1RYY A;  4M3U A;  1FYZ E;  1XC6 A;  4DXR A;  2VZO A;  2W95 A;  2EIB A;  1CZS A;  2W1S A;  3OG2 A;  4CU6 A;  5JXJ A;  3ECQ A;  3N1E A;  1UY4 A;  3CIH A;  2B9V A;  3T0A A;  3TL8 B;  1R64 A;  4QDS A;  4DTJ A;  3WNN A;  3HJR A;  3TAF A;  2P5O A;  3NNG A;  4JHZ A;  3E4Y A;  4Z2A A;  3A7Q A;  1TVG A;  5DN2 A;  3QEP A;  3T08 A;  3U37 A;  4A6O A;  4DUV A;  3ACF A;  1OF4 A;  1UMH A;  4DTX A;  1PMJ X;  3WF0 A;  2OVR B;  2Y6H A;  4I9Q A;  2YB5 A;  3C7G A;  1XL3 C;  2ZEZ A;  2YC2 A;  2JD9 A;  5LA2 A;  5HPO A;  3I2H A;  3IAP A;  1FZ1 E;  2VCA A;  1XNT A;  2WN3 A;  3K46 A;  1D7P M;  2JH8 A;  4TTG A;  3UIQ A;  4JS5 A;  3GDB A;  1W8O A;  3RMB A;  2W91 A;  2DEB A;  1BHG A;  2VZR A;  3CMG A;  2CDP A;  3SVI A;  3IB3 A;  4DUX A;  4KHY A;  1UY1 A;  2QQL A;  4PT6 A;  5EIY B;  3NRU A;  1OF3 A;  4ADN A;  2C26 A;  3A21 A;  3C7O A;  4GAM C;  3SQ4 A;  2ZXQ A;  3NQH A;  5CYY A;  3VD9 A;  4AKH A;  2VM9 A;  1CLQ A;  1Q9Y A;  2ID4 A;  4LQR A;  1NUK A;  3NGI A;  3SCX A;  2QQI A;  2VR4 A;  1CX1 A;  3T2P A;  3ACH A;  3VDA A;  2QQN A;  5IYY A;  4XUN A;  5G05 L;  4AI6 A;  3VD5 A;  2XQX A;  4HCC A;  2WYS A;  1TG7 A;  1W0N A;  1FZ9 E;  4JKK A;  3UET A;  4JRQ A;  3QEV A;  1PX3 A;  2KD7 A;  4X5N A;  1L7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...