2E31A

Structural basis for selection of glycosylated substrate by scffbs1 ubiquitin ligase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
251
structure length
246
Chain Sequence
b'AVEYLAELPEPLLLRVLAELPATELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWSDVEHGGDGWKVEELPGDNGVEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box only protein 2
publication title Structural basis for the selection of glycosylated substrates by SCFFbs1 ubiquitin ligase
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 59
structure length 246
sequence length 251
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00646 F-box F-box domain
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2e31A01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2e31A02
1J84A 3VDCA 2P1MB 2Y6HA 3CZUA 5DMYA 1PX4A 3K4ZA 2VOTA 3T08A 3I2FA 4M4PA 3FN9A 1DYOA 4DEQA 3P1IA 4D8MA 3SKVA 4DUVA 2QQIA 3OB8A 2R7EB 4QDSA 1WCQA 4XVHA 3OGKB 2BZDA 3DECA 4QB1A 2JD9A 1SDDB 2P1OB 1UY2A 1DLCA 3VD5A 1F4AA 1K12A 3GXUA 5CZKA 4ARXA 1UYXA 3FHQA 2X05A 5JMOA 2OVPB 2VZ1A 1F4HA 4ARYA 2ZEXA 4IUGA 3NJXA 4OMDA 3ACFA 3GM8A 3SEPA 5JUVA 2ZEYA 2WO1A 1JZ2A 4QDRA 1JYWA 3BN6A 3UNPA 4PF1A 1XNTA 4MADA 1P22A 3AC0A 4Z2AA 5IHRA 4E8DA 3WF2A 3OBAA 1L7QA 4LQRA 3GDBA 2CDOA 3C8XA 4BK5A 2DCKA 4CUAA 4BDVB 2VO5A 5LCWL 2QQKA 1ULOA 5EJ1B 1JZ4A 5JXHA 3L2OB 4P02B 3SEEA 3C6NB 3LEIA 1XPWA 5G04L 3ACGA 5LA1A 5G05L 5HPOA 2W9XA 3ACHA 2P1QB 1W0NA 5B4NA 5EIYB 2J1EA 2B4KA 3MKSB 3K77A 2W1UA 2XQXA 2BGOA 5IJRA 3HOBA 2JE8A 5FUIA 2EIEA 1UY4A 4UOJA 3JXSA 3WEZA 5IBKB 1PX3A 3GGLA 3VDAA 1K42A 4P5YA 4XURA 2BGPA 3I97A 1L7RA 2RVAA 3WNNA 4DUWA 5IFTA 1JI6A 3THDA 2OKXA 2QQMA 2J1SA 3UETA 1JZ3A 2VJXA 4AG4A 4A3ZA 3T2PA 3I2HA 5DQ0A 3WF3A 1O8PA 2WABA 2C26A 4UAPA 4P08A 2J22A 4XUPA 2WUHA 2HLEA 1KGYA 2W46A 3PUIA 2Y8KA 4A44A 3IAPA 2C4XA 4LKSA 2VC9A 5C71A 3K75B 3HEIA 2W91A 1W9SA 4AAXA 2VM9A 2V5DA 3OG2A 2VR4A 2VCAA 2DCJA 4DXRA 4RYDA 1SG3A 1GQPA 1UY3A 1XNAA 2QQOA 1NEXB 4QX1A 3T09A 3C6OB 4KI5M 2RJ2A 4OUEA 2P1NB 3E1F1 4OMCA 1LNSA 1UYZA 1CIYA 2WYSA 5EJZB 4YPJA 3WQBA 5F7UA 4DEVA 4LPLA 1TVGA 2QQJA 1LDKE 1ULPA 4A42A 1P8JA 3MV11 5JXIA 4W4ZA 1GOGA 2BERA 4TTGA 2J1AA 3SKJE 4XZUG 4CU8A 4CU6A 1UXXX 3LQCA 5LA0A 4ZY9A 1JU3A 2W1SA 2XHNA 3I2JA 2DDUA 2ORXA 1JYXA 3T2QA 3A22A 1PMJX 3IAQA 2VQTA 2W47A 5JXJA 1OF3A 2WQ8A 4BJ0A 3W5MA 2WN2A 4JKKA 2W92A 1K3IA 1H6XA 3BGAA 1UX7A 2XONA 3C7EA 2EIBA 3P6BA 3T2OA 2EICA 1JU4A 3CIHA 3VD7A 3VD9A 2XOMA 3HNBM 4E8CA 4UI9L 4XUNA 5DN2A 1CX1A 1J83A 4PT6A 1JHJA 3C7GA 1UMHA 1O59A 4XUTA 3T0BA 3WNMA 3VD4A 2JDAA 1GMMA 3NJVA 3HNMA 4ZXEA 3K46A 5HXMA 1BHGA 4QDQA 1W99A 2W94A 3J7HA 3IIIA 3FL7A 3MO4A 1JZ5A 2BBAA 4XUOA 1D7PM 1W9WA 2E26A 3I3EA 2VCBA 2VZUA 4P00B 1EUTA 4ZZ8A 2LS6A 3MUY1 5B4XA 3A21A 3LEKA 1TG7A 2WDBA 1JZ6A 2LW8A 3I2GA 3VDBA 3DYOA 2VCCA 2ZXQA 2VZQA 3UESA 4OYUA 1HN1A 4A45A 4CU9A 5IFPA 4QAWA 2P1PB 4QX2A 3K4DA 3ECQA 3CKHA 4DXSA 1NKGA 1RYYA 5J1XA 1EUUA 2W87A 3WNPA 1US2A 4DUXA 2E33A 1KEXA 1SHWB 4TXWA 3A7QA 3K4AA 3VD3A 2B9VA 2VMEA 3V7DB 2YG0A 3EYPA 4A41A 3THCA 2ID4A 5C70A 2WZEA 2KD7A 4W8JA 3ETPA 2W3JA 3LEGA 4RN5A 2VZPA 1US3A 2VZTA 3I2IA 3WF0A 2QQNA 2WZ8A 2WBKA 3FHAA 3I3BA 1GU3A 3IDAA 1W9TA 3ABZA 4JKLA 4KMQA 1FS1A 2CDPA 2QQLA 2HYXA 4CUBA 3WF4A 1JYNA 4LHSA 1CZSA 2X10A 2RV9A 1GOHA 4GWIA 2YC2A 4QX3A 4MGQA 3WNLA 3OGRA 1R64A 1OF4A 3D3AA 1MPXA 3I2KA 5LA2A 1W8NA 2J1UA 3DYMA 3WNOA 3ZM8A 2ZEZA 4JX0A 4XUQA 2YFUA 1NX9A 4KWUA 2Y64A 4HG6B 2W95A 2X09A 2ORZA 2V72A 1UY1A 2WO3A 3OEAA 1W8OA 2W5FA 4L0PA 3MBWA 4CUCA 2VZVA 3C7FA 1WKYA 2C9KA 1UY0A 3HPNA 3EB7A 4CVUA 2VZ3A 5I0DA 1UYYA 3WF1A 5JXGA 4FI9A 3WSOA 1K45A 2PQSA 4PQQA 1OD3A 5JR2A 1PMHX 2VMCA 2OVQB 2VMFA 4QX0A 3HJRA 1UZ0A 2WAOA 3NQHA 4GZ9A 2ZEWA 1JZ8A 4MOAA 1I5PA 1T2XA 4MO3M 3CQOA 2J1VA 3OGVA 2Y6LA 1XC6A 4A4AA 2WN3A 4W50A 3OGLB 3T0AA 2VQUA 3ACIA 2VTFA 1CZVA 1DP0A 3HNYM 1JYVA 3MUZ1 4BK4A 2L9LA 4CU7A 2JKXA 1IQDC 4QB2A 1GUIA 2VMDA 2EIDA 5CYYA 2J1TA 4ET7A 3OGSA 2E32A 2V4VA 4ZZ5A 4QPWA 4MGSA 4JHZA 2Y6JA 1GNYA 3OGMB 5IYYA 2YFZA 3A23A 2VL4A 2WAAA 2WO2A 3NNGA 3MV01 3W5NA 4QB6A 2Y6KA 3LPGA 4BXSV 4OZOA 2J1RA 2VZRA 5C7GA 3T0DA 3LPFA 1OT5A 1UMIA 4A6OA 2OVRB 4GWJA 2YB7A 3OEBA 3CDZB 3F2ZA 2VZSA 1OH4A 3WNKA 3LE0A 4M4RA 2QBXA 1YQ2A 3CZJA 1NAEA 1CZTA 5DPNA 1UWWA 3PUHA 4D0QA 3I3DA 3C6PB 3U37A 1NUKA 5A1AA 1GOFA 2VZOA 2E31A 2YC4A 3C7HA 3IB3A 4JKMA 2J7MA 1O8SA 2Y6GA 1H6YA 1UXZA 3CMGA 4I6JB 2W1QA 2W1WA 3C7OA 3HN3A 4DXTA 3DYPA 3NRUA 2Z4FA 1JZ7A
chains in the Genus database with same CATH superfamily
4WM7B 4OHZA 4TZDA 3K3OA 1PX4A 2VNOA 4IV1A 1LOCA 5EXOA 4BLJA 5AFEA 1C1FA 2FDHA 1QU0A 4M4PA 1AL0G 3FN9A 2PYTA 1EAH1 3PNAA 3VBHC 5AVAA 4KHUA 1JOJA 2P5GA 1GLHA 3IZOA 4CDUC 5JOWA 4D8MA 3M2MA 3VZOA 5FZ0A 2BYVE 4CCEA 4EV0A 2LRPA 4JTNA 4OUSA 1ZRFA 3I59A 5HCAA 2A6XA 4FJIA 2YPJA 4KHWA 3LIGA 3GJBA 1BZWA 3T2TA 1H0BA 4YYOA 3NNJA 1OBNA 1YIPA 1S2BA 1OC1A 3FFQA 4QB1A 4BCUA 4A7YA 4FK0A 2DBNA 1YO8A 4OFGA 2F4LA 2GNDA 2WA3A 3I8TA 1DLCA 5FXVA 5A80A 2E9QA 2PHXA 2IXLA 4D7YA 4J2BA 4ARXA 1UYXA 2JKBA 2WFF1 3AMNA 2X05A 3VL8A 5JMOA 1BCXA 2PN5A 1I6XA 4QQPA 3LSDA 4HPKA 4Y20B 5FLIA 2K0GA 4IQPA 3MFCA 5FOBB 3WW2A 1OOPA 4M0HA 4OMDA 2D93A 3VBFC 4XF9A 4GB32 1PZ7A 5JUVA 1H8TC 1NQDA 4AAPA 3W59A 1VBD2 4D94A 1OPOA 4QQOA 1DQ4A 1V6NA 1RITA 2VTXA 1BBT3 2Q0AA 5FO8B 5CG9A 3NVCA 5A3PA 2GSYA 1JYWA 5EV7A 2JICA 3MGUA 1G6NA 5A6XA 1GQGA 1MQTA 1SLTA 4ISRA 1QMJA 2ARXA 2ZHLA 2C1FA 4EZ4A 2LALA 4GJZA 4Q4V1 4JDNA 5A1FA 5FRAA 5GM0A 4E8DA 3OBAA 4LQRA 4XJ8A 5BY5A 2QZ2A 1AXZA 2MZWB 1XNKA 1CX4A 2QJVA 2PHLA 2BU9A 4OVEA 4QHZA 4ES8A 2BOIA 2KM2A 1DZTA 1HV1A 1MZ5A 2WS91 2LROA 3OUIA 4Q1PA 3OUHA 1YRZA 1ZZCA 4NWVA 3H9AA 3VKLA 4R52A 5JXHA 5L9RA 3C6NB 5EQUA 3OBZA 3SHRA 3ACGA 2H0BA 2HWD3 3GBGA 4FOQA 1V6MA 5KBFA 1S0CA 3RJRA 4BM8A 1W28A 3RSJA 2QXFA 4ADNA 1YFWA 2HWB1 1W0NA 3ACHA 4NUBA 4BQWA 1RUD1 2B4KA 3ZFEB 1B35C 3D5OA 1Q8VA 5K8SA 4HKWA 5CFCA 2H6BA 5BNOC 2XQXA 2R1DA 3BB6A 5HCHA 4XC9A 2BGOA 2VMIA 1GV9A 5D1IA 1KJLA 4R4ZA 1OQEA 2O8OA 3KGLA 2ZZQA 4LBNA 2Y33A 2JPNA 1DLLA 2EIEA 2GMMA 4UOJA 4AVCA 2PAKA 3DPRC 4X6RB 1W6QB 1RUE3 1MS1A 1RUJ3 3QEVA 4IV3A 1JOBA 1PX3A 3DGTA 5DAXA 3TN91 3VDAA 4COUA 4XHBA 1AR93 4XURA 3VHRA 1OKQA 2FD8A 3VDDB 1L7RA 1MS8A 5FQ0A 1NXMA 1RGSA 2A3YA 5FJHA 5FPVA 2XHKA 4C8DA 1H30A 2ZA9A 1GBGA 3THDA 3ZFEA 4KHYA 4Q29A 1FMD1 1JZ3A 3SJJA 4AG4A 5IATA 1BBT2 1IG3A 1S2EA 2EXHA 3DF0A 4MVTA 1H9PA 2B46X 3KV4A 5FO9B 5DQ0A 3MZHA 1RIRA 1JTZX 5FPAA 3OUJA 3VN4A 5JIUA 3BVCA 1X9TA 4DTNA 1PGW2 4K21A 5CIRA 4NRMA 3NAPA 5CFDC 2AACA 3M4FA 5IVFA 1RUI2 3OJBA 1YC61 2JHPA 2B1EA 3QOPA 2BV4A 2DTYA 4QKNA 5L9BA 4URAA 3ON7A 2H0VA 2CAVA 5C71A 3HEIA 2HWF1 2DEBA 2ZJCA 4XHXA 1NCQC 4XYXA 5ERLA 1ST8A 1Y43B 2V5DA 3HT2A 1J3QA 5FTTC 4EYWA 2VR4A 2LF3A 2VCAA 4M3CE 4DU1A 2DCJA 5IVYA 1XNAA 1UY3A 1XE8A 4FJ7A 1OLME 3T4HB 1NEXB 4QX1A 5BNQA 3C6OB 1W8TA 4AI0A 2HWD2 4B1MA 1DGWA 1D4M1 2RJ2A 4OUEA 3J26N 4YW3A 5FYUA 2R043 4OMCA 4CEYB 2ERFA 1Y9MA 3HGKE 1CIYA 3IDCB 1Q9YA 4OULA 4CCOA 1HRI2 1WAFA 1RUH3 4CP1A 1FYZE 1K5JA 2ZMKA 1N1TA 5BPXA 3WV6A 1WLWA 4DEVA 1PM7A 1H4HA 1QDCA 2BBVA 1XVDE 1OLQA 3MV11 4MV2A 4CDWB 5LBFA 4RHV3 4UW3A 5JXIA 5LZ6A 4QX5A 1SBEA 4Z2WA 2JG9B 3AJZA 4TTGA 3CJIA 4NIHA 1HRV1 1RUE2 5ABJA 5A3OA 1SFPA 4MGIE 4XZUG 3WG3A 5C5UA 1E57A 1OXCA 1O4TA 1YI7A 1UXXX 5LA0A 3C95A 3HN1A 3ZSJA 3OBTA 3SUPA 1C8M3 1PZ9A 2XHNA 5LATA 4YW6A 3GYDA 4XEZA 2GALA 4XJWA 4Y1YA 4RD7A 1LHUA 2ZGTA 4L92A 3E6BA 3J2PA 3DKWA 1PK6C 2NM1A 3SCXA 2RS51 4Z07A 1ULEA 3W20A 1YQ8A 1C3HA 4QM8A 1PMJX 3BI3A 4CDWA 2TBVA 4MZUA 3WUCA 5J3UA 3QNOA 5C70A 4Y5Z0 3MF9A 3GZTB 2W47A 4B7KA 1Y3TA 3RZZA 5K7PA 3Q8AA 3UKTA 3VKOA 1QJY3 2WQ8A 4PDWA 4XQDA 1JBCA 1SDWA 1WCSA 3KT7A 3B7MA 2DBIA 4LBLA 4IEXA 4NO4A 1K3IA 3JZVA 4BA6A 4M3RA 4QNCA 5HV4A 3LZZA 2H4TA 1A3KA 1VIWB 2O14A 2EIBA 2OA2A 2XONA 3C3VA 3P6BA 4B4RA 4LIVA 1JU4A 3ROUA 4D6QA 5LY1A 1YNAA 4AR2A 1PO23 5A1LA 3MDPA 1DZRA 1ND3A 4W65A 4XUNA 1RUC2 1GKBA 5D21A 2BVVA 3HL8A 1V00A 1RTVA 3VBRA 2R042 3LZJA 2XG3A 3AKQA 5L36A 4QT6A 4FJ8A 2D44A 4XUTA 1F15A 4PI0A 3WNMA 2MNGA 3M7AA 2VOWA 2OS2A 1W6PA 3CBNA 3NNMA 4QKFA 3U75A 5I91A 1RINA 2R1BA 2UYBA 3ZSEA 4AEDB 3PIGA 4DZGA 4HVQA 4QDQA 5D2AA 2FDGA 4RHV2 1RXGA 3HWJA 4TLGA 4AK3A 3FL7A 2XLFA 2YXSA 4OI2A 5EZWA 5DUVA 4XJUA 2E26A 3I3EA 3MLJA 2C6SA 1KS4A 1C8M2 4JVAA 1R091 3ES1A 4DXZA 4XFBA 1K5MB 5A70A 2BFUS 3MUY1 3RQ0A 5B4XA 2IXKA 3A21A 2DUQA 3NMBA 1LOBA 1JZ6A 4M3XA 1EV11 5FYZA 1C57A 1OA4A 2LW8A 4GB31 3D82A 1TNFA 1OH3A 3DYOA 1KFUL 1Y9QA 3N9NA 1AYM2 4XFHA 4CCCA 4Q8KA 3SH5A 3DEMA 3ZXFA 2PHTA 5JR7B 5A7OA 4XPVA 4FPJA 4H55A 5HXVA 2JG8A 2EAKA 3SNMA 4Y5SA 4BQ5A 1QJY2 2FDKA 1HW5A 4JTOA 4LORA 2CNAA 1CVNA 1C4RA 1NKGA 1UF2C 1POV1 2OQ7A 3NJZA 1FNZA 1GZWB 3ZYRA 2ZGRA 2W87A 5AVPA 5J1XA 1YFUA 1AF9A 5FZEA 5JZGA 4HT1T 4RA0A 3WNPA 5C9AB 4DUXA 1CGPA 4Q0SA 4YSFA 1ULCA 1PO22 1LEDA 5H9RA 2HEYF 2ZHNA 3KQRA 3RZLA 3VD3A 4BPZA 5F9TA 2YG0A 5LBEA 4A41A 2VW2A 3ACLA 3GF6A 4R8HA 3SCHA 2ID4A 2P2KA 3LB9A 5FMDA 1SPPB 2JDUA 2R30A 1YHFA 2I07B 1SFNA 2YHJA 4I0AA 3RZHA 2W3JA 2HEWF 1QOSA 4RN5A 2VZPA 3MIFA 4JRAA 4N9IA 3Q8EA 4F3JA 4ZU5A 5IK8A 1LOFC 3WF0A 4ZXKA 2QQNA 2OZSA 4FP2A 2WBKA 3M3IA 2RCUA 3R4UA 3I3BA 4N7UA 1ULFA 3IDAA 1H2NA 3CNAA 3POIA 4HONA 4JKLA 2QQLA 1D0HA 1POV0 2HYXA 3WG1A 1AUYA 1TNRA 3AZVA 2P3JA 3LA3A 2ZGSA 4P9GA 2JENA 1AR73 5FY7A 2Z5WA 1JYNA 4HK9A 1XMGE 4RQPB 4RR3B 5FK7A 1IHMA 3CO2A 5IUQA 4AGVA 5C4WC 2JHCA 5IK4A 1POQA 4G4FA 4JGZB 1RVF3 4EN7B 2WT0A 1SLAA 2PTMA 4KH9A 4AZZA 5C3QA 3OGRA 1GSLA 3ILNA 4BOWA 5A3TA 1WMFA 4XFIA 2JH8A 3LD8A 3I2KA 4XJAA 3DYMA 3WNOA 3NV2A 2XJSA 2EXJA 3ZXJA 2ZMLA 1BBT1 4QPIB 5B2GB 3LOBA 3E97A 1V6LA 1WWYA 4B08A 2ES3A 2YGMA 1JYIA 1G9BA 4Y1XA 1QF3A 5DXDA 5CBLA 1BK1A 3NJYA 4XUQA 4GH4C 4QKBA 4AYUA 1PGW1 4DO0A 1N3OA 1VBB3 2VD7A 3L9JT 4H7LA 4RR3A 3WLUA 3IPVB 2ORZA 4YVWA 3G7DA 2GN3A 3VGIA 2WO3A 1W8OA 4IE5A 3NCIA 3N7KA 1C5IA 3C7FA 2HBTA 1AL21 1A8DA 1RJ7A 4K20A 1F2NA 2W2IA 2IZWA 3LKJA 1XL3C 1ZBE3 3OYWB 3SQ2A 5IK7A 1CN1A 3KV5A 3AX4A 2EF6A 1AJKA 1KDMA 4R9AA 5GLTA 4LOSA 3I54A 2P5BA 5JXGA 2HWD1 3WSOA 5K4LA 4L8QA 3IN9A 3CHXA 1NCRA 4TWTA 3HT1A 5J48A 3N4MA 5FZAA 3I49A 1R1ZA 2GAUA 5FKCA 2VMCA 3RYKA 4JRPA 2H6CA 5T54A 1CJDA 1FZ2E 3M70A 4LR4A 2RDRA 1UZ0A 4V2VA 5A6QA 2QQVA 1JZ8A 4MHUA 3OPTA 4MOAA 4UXAA 5D8AA 1T2XA 2A1XA 2RDSA 2YU2A 4MO3M 3CQOA 1RUE1 1S4CA 1RUJ1 2Y6LA 2QE3A 2WN3A 1RVF2 4WVZA 1AR91 5IAVA 4F7ZA 2R072 2VQUA 3ACIA 1CWPA 2QZ3A 3SI6A 1CZVA 1MS0A 4BH9A 3S57A 5LBCA 5A7PA 3VBOB 3PU8A 5C8WA 3H3UA 4Q4V3 3HNYM 1LODA 3M3CA 1LJ7A 1O3SA 2FZ1A 4CTEA 5FOJB 3AMQA 3DXTA 3A0NA 4LBQA 3RMAA 4IE6A 1Q3EA 4EROA 3JCIA 2XQRA 5K0UB 2PHRA 2BP6A 2XLAA 1EAH2 5FYVA 4ET7A 2QDRA 1HB3A 3N3HA 2E32A 5CKNA 2WYFA 4J6GA 4ZZ5A 4QPWA 2XLGA 4TYSA 1YCIA 3KGZA 2A73B 4MXWB 1GNYA 3ZXDA 2DVFA 5CEHA 2WAAA 1SLCA 1QOTA 1HB4A 2WWSA 4I3PA 4XETA 1W03A 3LPGA 2D98A 1VPHA 2PHWA 3J9SA 4BXSV 3POFA 3RGBA 4ATFA 4AVTA 5AFBA 3NV1A 3Q8CA 2A7AA 5GALA 2R061 4HN1A 2MEV3 3ZOIA 4GWJA 1AJOA 2LF6A 1VMHA 1ND2B 2Y6FA 3F2ZA 3SPYA 2JJ6A 3I4IA 4URTA 4FPOB 2VZSA 4Y3OA 3UGFA 2D6KA 3RDIA 2R041 2WFF2 3OGGA 3S5QA 1NOVA 1OD5A 5LY2A 2D3SA 5E89A 1RUH1 3D8CA 1NAEA 2JIGA 2BPA2 1A8MA 3Q9OA 1OFNA 4Z8BA 4JDOA 5C3SA 5FMBA 3W9AA 3ZFGA 1UWWA 1XYOA 5FXWA 2HD0A 1CJPA 2WNUB 4QPGB 4RHV1 2DVDA 3C6PB 3PVBB 4E27A 1NUKA 2EIGA 4EZHA 5T5OA 1J3RA 1DHKB 4Q0QA 4Q5OA 1GOFA 2ZHMA 2YC4A 2F6BA 3H7JA 1EP0A 3FE5A 3O12A 1YEWA 1LGBA 1O8SA 4JKMA 5DZGA 4YW5A 4PHZA 1ND2A 1UOFA 1UKGA 3CMGA 4NAMA 4CDXB 1OUXA 1TQ5A 3ZX7A 4XIOA 2BUKA 2FBEA 2Z4FA 1YJKA 3DYPA 1B09A 3NRUA 4NRPA 3K51A 4P9IA 4Q4V2 3LA2A 4ISQA 1QKQA 3VDCA 2P1MB 3NHGA 2Y6HA 2VNVA 3NW4A 3GJAA 4QQ2A 2B8MA 1FZ5E 2OT7A 5DMYA 1OMIA 1FPN3 1UO9A 5DAWA 1G86A 3T08A 5FY1A 2GZWA 4P9YA 5A32B 2WNUA 4LJHA 1R1A3 1N1VA 2WS92 2XKPA 2ZX1A 1MHZG 4WM8B 2Q5TA 2XXZA 3SMHA 3SKVA 1G9CA 4AE2A 2QQIA 2VVDA 4XF0A 3OB8A 4ONUA 4QQHA 2ZTNA 4K1ZA 2HWB2 3IWZA 1M4WA 2VPVA 1RUD2 4XVHA 3OGKB 2ZKNA 3U11A 3PUQA 3UL2A 3IDBB 4NIDA 4DTSA 1JYCA 2JD9A 4XJZA 5EYXA 3ZN6A 1SDDB 1PO21 2VECA 5L7OA 2AYHA 4AHWA 1K12A 2DF7A 5FYHA 1FT9A 4DS0A 1ZA4A 2QQWA 3FHQA 1O3QA 3KD4A 5F6LB 5BNNC 3NNLA 2IFWA 3VBUC 1F4HA 4ARYA 4UYBA 3TN92 1LOAA 2PFTA 3C94A 1H9WA 1X8EA 2B7YA 2JE7A 2I2SA 3NJXA 4N53C 3AP6A 3WW1A 3GM8A 2D5HA 1GYKA 2OUJA 2WL1A 3SEPA 5A3MA 4X5NA 4EWDA 4CEWB 4NPLA 2ZEYA 3B5LB 4JHTA 1VBE3 1W8HA 2WO1A 4N43B 5J36A 5JDBA 1N3QA 3FBYA 4ZU7A 1ZZ8A 4B7EA 1FMD2 1SFYA 1UU6A 3SQ1A 4QDRA 1NE6A 2YV8A 4YVSA 2PHDA 3VZJA 2JDYA 2VIXA 3ENRA 3BN6A 4LMFA 5DUWA 1S0FA 2GC1A 5FZ8A 3ZFFB 3UNPA 3V0AB 3V0BA 4J2EA 1UCXA 1WZXA 2VUJA 1XNTA 1P22A 3RMCA 4IE4A 4Y1ZA 5IHRA 4DTMA 1L7QA 3V64A 5ANQA 3VBSB 3WHTA 1W04A 3ZO0B 4MG2A 4FSJA 2BWAA 2O1QA 2X5IC 1MZ6A 2DVAA 5GKAC 1FPN2 1IG0A 3QH7A 4BK5A 4BE3A 4CUAA 1IGOA 3IBMA 3WXPA 4LITA 1ULOA 1XB9A 5IVEA 4AFCA 4DQAA 1HN0A 1STMA 3L2OB 4I9QA 3LEIA 2ENRA 5LA1A 3ZR6A 4J2DA 3POYA 3J4UH 3UJOA 4L97A 2LM3A 3R05A 3POWA 1W3XA 2P1QB 1QNYA 2WNVB 4QWNA 3UO2A 1CAVB 1HJGA 1OA3A 3AKRA 1JW2A 1LHOA 3WDVA 5C8CA 5A3NA 3OOXA 3K77A 4FQZA 4K40A 5JWPA 3GHNA 5A6YA 5IJRA 3S30A 2V5YA 4HVOA 4I09A 3KZ4C 5FY4A 3B9IA 5FPXA 1TME3 3DL3A 1YLLA 2VNGA 2TUNA 5I8SA 2RHPA 3MEPA 4XCBA 1C8NA 3THPA 4AVVA 5FYIA 1K42A 5EP9A 3LDKA 4XXPA 1UU4A 1KXGA 1F9KA 2ZAHA 2R0HA 2WNVA 1CAVA 4AF9A 1QJZA 1R093 4GWNA 1JI6A 5FZGA 2CYFA 1VBE2 2J1SA 4RGGA 3SXWA 1BEV1 5FZ6A 2VJXA 3HGLA 4N8MA 4YW1A 3EHKA 3T2PA 3WVJA 2VH9A 3LZIA 1XVBE 2OUHA 2RS52 5JI7A 5FP4A 3QEWA 2OQ6A 2WABA 2VGDA 4QX7A 3VBHB 4EPHA 3NE6A 3EMRA 2J22A 1AR71 4P08A 1PGL1 1O4ZA 4CDUB 2WUHA 2Q4SA 1PO13 2HLEA 2VULA 2W46A 4P5HA 2FYOA 4A44A 1CIWA 4Z92B 2ARCA 3IAPA 3WUDA 1JODA 1RVF1 2C4XA 2GP5A 2XL7A 4AQ6A 2E6VA 1OQ1A 5J96B 1J58A 3K75B 2Z42A 1LRHA 2W91A 4IEQA 1OI6A 4AAXA 4AXOA 5IVBA 5GLWA 1ZZ6A 4QQLA 1HLCA 1IS5A 2XH6A 4XABA 5KWRA 1RJ8A 3AYAA 5FZ1A 3OGJA 4RYDA 1SG3A 1S0JA 3I2DA 1DYPA 4KHNA 1CESA 4YGEA 3PU3A 4XF1A 3E1F1 1S0EA 3PURA 4JS5A 5I0UA 4CDUA 1VBB1 5EFUA 4ZHNA 2BNNA 3AP5A 2NP0A 1D2SA 5FLJA 1NA1C 1OFSA 4DMIA 4JGYC 5FK8A 1JUHA 1SLIA 2UWAA 3HBKA 4W6YA 3UT0A 3ZPYA 1I5ZA 1LR5A 1Q56A 3AL5A 1AZDA 1TME2 4RFT0 3ZXEA 3SUOA 4NROA 3B01A 2XJTA 4UFIA 1IS3A 4CCMA 2WA4A 2OIIA 2OXBA 1ZBE1 3SKJE 4WM7A 4AVBA 4IV1C 4PQ9A 3KHBA 4XBNA 3RMBA 1XXNA 1JU3A 1ZRIA 2E7QA 2EAAA 4KGGA 1BMV2 2XWBB 4K6BA 2GNMA 4HKOA 2XVLA 4BMBA 4NWWA 2RR11 1R092 1W2TA 4COVA 3T2QA 1O7FA 3POBA 3AP4A 1EV12 1O91A 4Y1UA 4HSJA 4COZA 1HX6A 3B94A 4CZSA 5FIXA 1XBFA 3IAQA 2Z79A 1E5SA 4PBPA 2VQTA 1TMF3 3S7IA 4DU3A 2IWGB 5EJ3A 1ENQA 1PO12 2RJKA 5HV0A 5M0TA 1ULGA 1DG6A 2ZX0A 2AZ5A 4M3UA 3AVSA 3KS7A 2C0ZA 4NHYA 4DNYA 4J1WA 4FTSA 4AFAA 1UPIA 1WW7A 4QGLA 2W39A 1B35B 1UX7A 2JXAA 3C7EA 2JE9A 2XUEA 5BNOB 4Y20A 3ZXLA 5LEKA 4M0NA 4AEJA 2BOJA 4C90A 1OOPC 4E4SA 3RJ2X 1X8MA 1U5IA 4UF0B 5SV5A 2VW0A 3AFGA 4WV8A 1KJRA 3D0SA 2ZX3A 1AL23 3RZMA 1ZRRA 1XU5E 3PJYA 3DPRB 3CF6E 1RL3A 4LA2A 3AL6A 2N7GA 3CEWA 5FZFA 4XJ9A 5SV8A 3T0BA 4FFGA 2JQTA 3VD4A 3E4YA 1W2AX 1MQTC 2G4IA 1IOAA 3FMGA 3U4XA 5DDJ3 3KF5A 1DQ0A 4K3UA 1LHNA 5BNPC 2W52A 3FZ3A 4UT5A 4LO7A 3USUB 3TAYA 5KXCA 2FDIA 3SQOA 1W99A 1IZ3A 2D6OX 3AXDA 5FPLA 2BNOA 5JVVA 1XVFE 3MO4A 3NL1A 1JZ5A 2RKHA 2XL9A 4FVVA 1OKOA 3L1NA 2EALA 2HKXA 2MEV1 1XVEE 2A6ZA 2HH9A 2X53S 4D6RA 1X7NA 4JAAA 4RL7A 2VCBA 1AR63 3OPWA 5JOZA 5I0RA 3DPRA 4P00B 5I0TA 3QEPA 1EUTA 5CFDB 2LS6A 3H7YA 4YLZA 5GZDA 2DUPA 4FCAA 1W2NA 1FI2A 2A6WA 1TG7A 2ZACA 3E6DA 1XE7A 5JIAA 2IXCA 4PIYA 3R0RA 1AVBA 2CGOA 3WP3A 1W8WA 2ZXQA 3UESA 3H42B 4OYUA 4IDZA 2B7MA 4CU9A 5A3UA 1FOD1 5CFCC 2P1PB 1UOGA 1V6JA 3B69A 1V9U3 1TMF2 3ECQA 2UY8A 4YFWA 1DBNA 1Y9GA 2ADEA 4FOYA 1RYYA 2IFRA 1EUUA 5FZOB 1XMFE 3FFZA 4OHVA 4EN8B 4IV3C 1W6QA 3WDUA 1S0DA 2QUOA 1UIKA 3KV9A 2E33A 2B9UA 2CY6A 1KEXA 4FVMA 4HANA 5CA6A 3K4AA 3VDDA 1LGNA 1ULDA 3O14A 4UFLA 5KXBA 1FPN1 2B9VA 4NIIA 2VMEA 1CAUB 1ZBA3 5F39A 4CXYA 2QQPA 2G9ZA 1VMJA 3THCA 1AL22 3ZFEC 1R1A1 3J7NA 1GWKA 1PNGA 1REFA 3DN7A 1GICA 2HJIA 2WZEA 4YM2A 2OYZA 1YJLA 4W8JA 3ZYJB 1PVC3 3TAFA 4RNGA 4AKGA 2R063 4GAZA 2FDFA 1Q43A 1G7YA 3WHUA 1NLSA 5F1RA 4QD2A 1OUSA 5FZOA 1A78A 3WCSA 2UWCA 3FHAA 4BU2A 5FP3A 5ACA1 2ZZJA 4NHKA 3NAPC 2A5ZA 3HAGA 1GU3A 1BYHA 1YYNA 1FAYA 4EN9B 5FPBA 1W9TA 4KU8A 2RS13 2CWSA 3QLQA 2CDPA 4J1XA 1PK6B 1YQ6A 2BTVC 3VHNA 2DCZA 2MPFA 2R16A 4FPLA 2ET7A 3MPBA 3WY6A 4CUBA 5HI0A 3M3EA 4IT5A 2WLQA 5CAZA 5I8YA 3NGIA 4LHSA 1OA2A 2PLV3 3BPZA 2X10A 2RV9A 4NAOA 3KD5E 4EP9A 1HQNA 3AYDA 3N9MA 5L19A 1RUJ2 4QX3A 2D6MA 5IVVA 1N47A 1R083 1AYN1 3WNLA 1X36A 1AR92 3KSCA 4HLTA 4WVVA 3BPSA 3ZN6B 5C3RA 1OF4A 1WA6X 2GNTA 3GBFA 4CE8A 3MIDA 4CRQA 1KRIA 5A6ZA 1LECA 2HEVF 5LA2A 2WO7A 4CEYA 5L9VA 5LASA 2JDNA 1VBE1 1BLZA 2ZEZA 3RNSA 4QKDA 4YFZA 2XR4A 5GZFA 1V9U2 5T5LA 1DF0A 3OD0A 2WWJA 2JD4A 5GZGA 2W0XA 5DUUA 1JOPA 5J7MA 3NDKA 1WD4A 2V4AA 5LRSA 4IE7A 4YM3A 4OQ8A 5F2SA 1NX9A 4RG8A 5IVCA 3BOWA 3KT1A 4HG6B 2D5FA 3CJIC 2JG9A 5ABJC 2W95A 3O0WA 3KVBA 1W6MB 3O1VA 1CD3G 1VALA 2DU1A 3EJKA 3OEAA 4KI4A 2ZCWA 4LUKA 1FZ9E 3MBWA 4LKDA 2VZVA 1ZBA2 1WKYA 1N3PA 4H3WA 4I3GA 3OTFA 3D4KA 4BQ1A 5AC93 5JI9A 1ASJ3 2YPDA 5LK7B 4UW5A 2VZ3A 1VRH3 1XSQA 1SBFA 5I0DA 3ITQA 2JEMA 1UYYA 5FZKA 5BXXA 3EXUA 4JQRA 1T6GC 3POEA 2R062 3WG4A 4LHKA 3I2OA 2BFUL 3AP9A 2XVGA 4E4HA 4N7IA 3MLLA 5HCBA 2R32A 5EWSA 1UAIA 1RMU3 2HWE3 3GALA 4QPYA 3RPQA 4AI3A 4O61A 4UBHA 1RUH2 5A33B 1W2OA 1W6MA 4PDWC 3RZJA 2VQ0A 2VMFA 4KGQA 3HJRA 4D3WA 1IQAA 1ZZ9A 2GC0A 2ZEWA 1D0GA 1TME1 2VUDA 4CPBA 1ZREA 4FPKA 1UMZA 4QMAA 2J1VA 2RDQA 3SLIA 2BQPA 1ND3C 4LE3A 4Y4YA 1QXJA 2W68A 4W50A 3OGLB 1R082 3JUUA 4O65A 4SLIA 1GZTA 4XQWA 2VTFA 3AMHA 1VB2A 1BMV1 4Y22B 3VBRC 2CV6A 2XBO3 2XDVA 3QH6A 1JYVA 5T52A 3RZGA 3N7LA 2DY4A 4IETA 4YZ3A 4CU7A 5E6HA 2CAUA 4EN0A 1IQDC 3TABA 4U36A 3BUCA 3QD6A 4QB2A 4LXLA 1GUIA 1ZRCA 4AEDA 4YM0A 1UW8A 1VBA1 2J1TA 2UURA 3OBRA 5CYYA 2C5DA 2G9GA 4XACA 3SH4A 4YM1A 5IVJA 2V4VA 4JZRA 5F3EA 1PO11 1XE0A 3TEWA 4COWA 4J25A 4AI2A 5IYYA 3AXEA 3KB5A 4KHQA 5K9YA 4LBQD 1FZ6E 1QEXA 4FFIA 1C1LA 2Y6KA 4S2GA 2YY1A 1GZCA 1DFQA 1JMUB 1K5MA 3ZIWA 5FWJA 4OZOA 1VRH2 4FJGA 1YXWA 2VZRA 4META 3H0OA 5H9SA 2IXHA 5T5PA 2YB7A 5J37A 4FK4A 2DUOA 1SCSA 3LSEA 3WNKA 4V2WA 1W9FA 2P34A 5CU1A 3LE0A 5C4WB 3WDTA 2DWRA 1BVP1 1YQ2A 3K48A 3CZJA 4AFBA 1W0PA 2AENA 3RWUA 2JG8C 1DQ5A 3W21A 1Z0HA 3KQ4B 4OUMA 1Z78A 4KWKA 4QGNA 5DPNA 3VV1A 4B29A 1WW5A 1MZEA 5FY0A 3UO3A 4L9BA 2UU8A 2XPJA 4MUVA 2YMZA 4RS5B 1FZ1E 1GZWA 1ACCA 1ZX5A 5H9QA 4D0QA 1VLNA 5JZGC 4Q26A 1BVVA 4ICGC 1BEV3 3AZXA 2VBDA 5C9AA 1DQ2A 1G9FA 4HVRA 1ODNA 3TNQA 3KM5A 2E31A 5KHHA 1F8VA 2J7MA 2NLRA 1CR7A 5FXZA 1VBC3 1H6YA 4GH4B 1CQ9A 2W1WA 3LA7A 3HN3A 2E7TA 1RXFA 2F17A 1RUF3 4L11A 1SPPA 3VKNA 4JS4A 5FZHA 2EA7A 2YDEA 2YROA 3K4ZA 2VG9A 2VW1A 4NRQA 4RS5A 1DYOA 5FZ9A 2ADDA 4DEQA 3K2OA 1AX0A 2WZR1 4Q4Y3 3QEXA 2Q8OA 3USSA 5GZEA 1TMF1 1YFYA 2WLPA 1W2UA 2A6YA 1HV0A 2DU0A 1JH5A 4DUVA 1LOEA 2XJUA 1JW6A 4LBJA 4M3CB 5A7WB 4QDSA 2AEYA 1LHVA 1WCQA 5F5IA 3R4DB 4FT8A 3AVRA 4GQ7A 4RQPA 4AI6A 1C28A 2Z69A 3DECA 4C1XA 3PUAA 5A3LA 5FKBA 5FR3A 4JGZA 1BXHA 4LE4A 1OPMA 1ONAA 5KHIA 1UY2A 4M45A 1LTEA 4O9GA 4X8NA 4Q8LA 5CZKA 4RGAA 4LO8A 2OVPB 4IGOA 5FP7A 2MW2A 3ES4A 3QCWA 2ARBA 3JQXA 2ZEXA 3WW4A 3MLKA 3NWKA 1NQJA 3MHZA 4QPIA 3WG2A 4J2AA 2IXIA 3LFMA 4C0HA 1H4GA 5CNAA 1PZ8A 1W6OB 1COV3 4QX8A 4M3CA 4IE0A 4X6QB 5DDJ1 4XMIA 5LWBA 2RR13 1JZ2A 5IZ7A 4JDMA 3IPVA 4DTOA 1BEV2 4YVWC 2VUCA 1CLQA 3SUQA 3MW4A 3H8XA 4AVAA 2VVFA 3BTYA 1VBC2 4M42A 1PGL2 5FPUA 4PF1A 5FZ3A 1AR72 1N1CA 1AR61 1WCDJ 4Z2AA 3WF2A 5BYNA 3OYWA 4QU2A 3R6SA 5JSPA 3NV4A 3LDSA 1VRBA 1LHWA 5IW0A 2DCKA 2JDKA 1WMXA 3KCYA 3RRDA 2VO5A 3LF7A 1NCRC 2QQKA 3CLPA 5LCWL 1S0IA 2WKKA 5DAPA 3PL0A 4OHWA 5EJ1B 2AGSA 1MVEA 5A7NA 3KVAA 4Q4Y2 3ATGA 2GMPA 1XPWA 3LDBA 2G1MA 1NLRA 1V9U1 2Y34A 2DTWA 3OCPA 4Q0VA 2PXJA 1QJX3 4QM9A 5HPOA 3ZIXA 3E4WA 1CPNA 1W06A 2W9XA 2VBPA 2UY9A 1QH6A 1GR3A 1M06G 5F5QA 5B4NA 3TWIA 4U2AA 4NPRA 5D8AC 2PQQA 3WNXA 2BWCA 4IXLA 3X29B 1VBB2 2W1UA 2X8KA 4LHLA 4I30A 4MLOA 2O0OA 3HOBA 4B3NA 3S0MA 2JE8A 3NV3A 3TAGA 1S0GA 4UW6A 1SLBA 1UY4A 4AW7A 4IW3A 1L7LA 3BTAA 3JXSA 1ZBA1 2HWC3 3BU7A 3RYRA 3WEZA 3RWNA 3VBOA 3L0MA 4FJ9A 2VXRA 2D43A 4MYEA 2XKOA 1LCLA 5E88A 5IBKB 3BVOA 1XJAA 2WNEA 3IKWA 5F32A 2VUAA 4P5YA 4AKIA 1ZBE2 1PVC1 1XYNA 2BGPA 3HMYA 3I97A 4LNVA 2RVAA 1X82A 3CU7A 1VP6A 4CUGA 5IFTA 1COV2 5K0UA 4B4QA 3EBRA 4BXFA 2OKXA 2Q1FA 2QQMA 2RR12 4XXAA 4D7SA 2WFPA 4JV4A 4A3ZA 3HQXA 4DPNA 4YW4A 1YIFA 3I2HA 2RS11 3B3QE 4MXWA 4MGZE 3WF3A 1Z7S1 2RG4A 4HETA 1FNYA 4UAPA 3ZSLA 1DGRN 1YFXA 1FOD3 4XDPA 2PLV1 1KGYA 3PUIA 3SCGA 1XQNA 2R6QA 3O1OA 4LKSA 4XE9A 1R081 5KHJA 2Q1ZB 5FZMA 1G8WA 2B42B 5DZFA 3URFA 4NOTA 2EVXA 4P9XA 2VM9A 2Q1MA 2OZ6A 5BV6A 2ZGNA 3O5SA 5F8PA 4LTAA 2IVIB 1GQPA 1REEA 2QQOA 2CTVA 5FY9A 4DTUA 3GCXA 4XBLA 3AM2A 2D6NA 3GCWA 1QJX2 3ZFGC 4EWAA 5FZBA 3SC7X 4FJ5A 1JXNA 3UK9A 4FPGA 1H1IA 1LNSA 1XSRA 5BNNB 4QPGA 3ZKUA 1L3JA 2JB8A 2OW4A 4H2AA 4OZXA 4YPJA 2PFWA 3VBUB 1KDKA 2WQZC 3WX5A 4NIGA 4M3YA 1LOGA 1HQWA 4N53B 4DFSA 2RMU3 1REDA 1W8UA 3JBG3 3RMXA 2QQJA 1LDKE 4XMAA 1UKRA 4OLLA 4M3TA 1P8JA 5FYMA 4CDXA 4DRVA 1WUVA 2OYQA 5GLVA 4DU4A 2HWC2 3M3OA 2QTWB 4LHNA 1GOGA 4CDQC 2BERA 5AC91 1HJFA 2FCVA 1ASJ1 2FCTA 2WQ4A 5C3OA 2A70A 5FREA 1VRH1 5KR7A 2GH2A 4CU8A 4MXVA 1NG0A 4ITCA 4ZY9A 4HKLA 2MEV2 2KXLA 2WNUC 4QNDA 2W1SA 3J27A 5ANNA 5A32A 1QNWA 3UGGA 2PFVA 1KQRA 1RMU1 3VBUA 2HWE1 4WM8A 3LOIA 4QXBA 4OI1A 1NLQA 1AYN3 3FX3A 3NO8A 1NY71 3O0VA 1QJU3 2Y38A 4Q4W1 2X5IB 2Y0OA 1OQDA 1QJFA 3SNNA 5GLUA 5J98B 1RUOA 1KS5A 5CISA 1YQCA 3J7MA 4AI1A 1APNA 3MIHA 1FOD2 5JXJA 1PIV3 1OF3A 2Y0IA 3J8F1 3W5MA 3O7OA 3ZYGA 1HXS3 1URXA 2WN2A 3AMPA 4JKKA 5L7OC 1LESA 1J1LA 1I1EA 1WMEA 4XBQA 5F37A 2W92A 4LBOA 1S55A 2NMNA 2YBKA 2ZGLA 1O6UA 4PIXA 4B4PA 1O5UA 2Q8CA 2HYKA 2XBO1 1NZCA 4ATEA 4Y26A 2B45X 2EICA 2ZABA 2F4PA 3CIHA 3VD7A 3VD9A 3HNBM 4HK8A 3O1SA 3BYWA 4E8CA 2A75A 4UI9L 5DN2A 2WT1A 2ZPXA 2UWBA 3EQEA 4PT6A 3VZKA 1JHJA 4CEWA 3C7GA 3UGHA 4N43A 1R1A2 1UMHA 2K2SA 4ZU4A 2WRAA 2QVSB 3R4SA 1GP5A 2LTNA 4PLMA 1MS9A 5DABA 4YVSC 3GZAA 4XTMA 4P9LA 1H1AA 4NN0A 5HBAA 1DQ6A 4UFJA 2JDHA 2K9ZA 2JDAA 2ZX4A 5JSRA 1GMMA 3FBMA 1S1AA 3NJVA 3VLBB 3ZFFA 1LULA 4HOOA 3RYPA 3V0AA 5ISLA 2OZJA 4M41A 1MACA 2JECA 4HBNA 5FMOS 4B8EA 4EQVA 2XJVA 5JLVA 1OURA 3SH3A 4BYYA 3J7HA 1SLLA 3Q8FA 3VBSA 1C5HA 3KHCA 5FYYA 4KNCA 2BBAA 1QQP3 3BIWE 4GWMA 3U1XA 1V0AA 3LIHA 1O5LA 1W9WA 2XJRA 1X50A 1GP4A 4LULA 3VL9A 4AGRA 5CB7A 4FOWA 1SBDA 3TJYA 4ZZ8A 1Y7BA 1VJ2A 3LEMA 1OVSA 4L99A 3BIEA 3L2YA 3KT4A 3KV6A 1NYWA 2VBBA 2WDBA 3LEKA 1AYN2 5FXXA 5I8TA 2FW3A 3ZN5A 1W9YA 2AC1A 2VCCA 2GN7A 2WINB 4FP3A 1XVGE 1HN1A 4A45A 1FXXA 4C91A 3NKTA 4DTJA 5C8CC 5IFPA 4QAWA 5FDBA 1HDKA 1GP6A 3I3QA 3K4DA 4ZKTB 5JOYA 3PMEA 4LBKA 2OZMA 1UU5A 1HXS2 4ADOA 1SMVA 4AGGA 4XDQA 5FV3A 2BRTA 2X29A 1DGWX 3PUSA 1DZQA 3ZYBA 1VBC1 1VBA3 3N7MA 3KMHA 4OQ9A 2K5SA 4Q0PA 4BQ2A 3ZXGA 4UFMA 2D6PA 1RUF1 4YGCA 4E9KA 4EN6B 1NA1B 3RG0A 1SHWB 4TXWA 3A7QA 4JGYB 4XF3A 3QETA 4DTRA 1MEC3 1NZIA 3G6JB 4I01A 3RWKX 1LU2A 1PHMA 3HR9A 5LB6A 3VZNA 4WBBA 4HZFA 2KD7A 4Q4Y1 3ZSKA 1N1SA 1SQ4A 3SPZA 1ALYA 2ETEA 4MHRA 2FQPA 3LEGA 3S7EA 4IV1B 2PAMA 2YZ4A 4A6SA 5JOXA 3ZMNA 1EYBA 4M00A 5CVRA 3VBHA 1RHI1 3PLQA 4PF5A 3E5QA 2DVGA 1AR81 4G3YC 2FCUA 3HQRA 3V56A 4D69A 2SLIA 3WINE 2VE1A 3D0JA 1UZVA 3ABZA 5LK5A 3FUQA 4JGYA 2RM23 4NPMA 5FBZA 4WVWA 3VBFB 3U14A 4M3CF 1QQP2 4BISA 1GZ9A 1MTYG 1H8TB 2WR9A 3AFKA 4M01A 4BMEA 1DGRA 1CZSA 3M3QA 4HMZA 1FYUA 1ENXA 1WAJA 1VAVA 1GNHA 2V73A 3AK0A 2O8QA 1GOHA 5FZLA 4BZ4A 1VR3A 3SVIA 2W08A 1R64A 5CADA 2NQYA 1TZOA 2B5HA 4GKYA 4MGTA 1COV1 5LRRA 4EJRA 1W8NA 2GC2A 3PTYA 4MH0E 4AI9A 4HPKB 4PJYA 1VMFA 5H37A 5F2WA 3ZM8A 1OOPB 1V6KA 4QXHA 2A3WA 2D3RA 1T6BX 4IEPA 4BB3A 1KFXL 1WLDA 3VBFA 1O4YA 2C24A 4ORFA 1H8TA 5J09A 2TNFA 3POGA 5KC6A 2JDMA 4KBZA 4KWUA 2VU9A 2WZR3 3JD71 1VBA2 2Y64A 1NE4A 1UN1A 3UKNA 4XFCA 3WP6A 4CYDA 4WM7C 2V72A 3LGRA 2ATFA 4FPHA 4E2QA 2ATQA 1LU1A 1TEIA 4GMP3 1MQTB 2P1BA 2JDPA 3FWEA 5JPMB 2KA3A 1QXRA 1ODMA 4GKXA 1MEC2 5BNPB 3QEIA 4D7TA 4JCKA 3WOGA 1JYTA 4JC1A 3U10A 3CFOA 2KR2A 4MSVA 4I2OA 4M3ZA 1DQ1A 4GAMC 5E8AA 4Q0UA 5IK5A 1QJX1 3DXUA 2I45A 5L73A 1K45A 1LGCA 1UD1A 2WC2A 3TB0A 2PQSA 3AZZA 5JR2A 4KL1A 5IREA 2G9FA 3AKPA 1J59A 4KG8A 2VOXA 4X8PA 4A2UA 4ASKA 3AB0A 3RZKA 2OVQB 1YUDA 2XB6C 3KWVA 4QX0A 3O1TA 2RM22 3NQHA 2AUYA 2WAOA 3H1MA 4GZ9A 4FJMA 5BNPA 5APAA 2HWC1 4LO4B 4HCCA 1B35A 3PVNA 1RUI3 5DZEA 1W3VA 4UWDA 1CAXB 5EYYA 4R9CA 5CFCB 2YU1A 5BNOA 1XC6A 2FMDA 4A4AA 1IKQA 4DY5A 4UF0A 3T0AA 4XAAA 3H8UA 2GMEA 4FFHA 1DP0A 3UV9A 3ZPOA 1Q8SA 2BEOA 4LLFA 2YB5A 5I0SA 1LENA 1MVQA 3MIEA 2CU5A 2NN8A 3MUZ1 4IV3B 3BCWA 5CKMA 4CP0A 2VY0A 4CPBD 4LEJA 5LW9A 2ILMA 2MHFA 4LKEA 1WCUA 1HB2A 2JKXA 4P14A 4PCRA 4CCLA 5FQ0B 1ZYBA 4IEVA 4CXXA 1YQ5A 3ETQA 3UIQA 1NCQB 2CSGA 3HBZA 1HRI3 1PMIA 2PELA 3ZVXA 2JH9A 3OY8B 3OGSA 1MS3A 3USUA 1XU3E 4X5MA 2WZR2 1CAXA 3B93A 4ASLA 2NPIA 2B39A 3T4VA 2RJLA 2PHFA 4FJXA 4AL9A 3OGMB 2Q8EA 1H2MA 2YFZA 4LT5A 2A71A 2VL4A 4GD4A 2IC1A 3SISA 2WO2A 3NNGA 1PGSA 3MV01 3QACA 4QB6A 3W5NA 3N1EA 3O1RA 3NAPB 1E5IA 1FZ8E 2ZGPA 2E51A 3EO6A 5CFDA 4AHZA 5C33A 3GBWA 4K9SA 4I0BA 5GLZA 4OI0A 3AJYA 4IESA 4PBOA 5C7GA 3LPFA 1UMIA 3H3LA 3MFAA 4NR1A 3OEBA 4INDA 3BODA 3QNNA 5ACA3 3LFIA 3TOJA 1NCQA 3UJQA 5F3IA 1UZYA 3SITA 4XCAA 3OY8A 1E5HA 4AQTA 4KI6A 1IKPA 2GU9A 4M4RA 3HIFA 1Q8QA 1W05A 2CWMA 3AZWA 1CZTA 1GANA 2GP3A 1QY4A 3QBQA 1FZIE 1BJQA 2WSUA 2XVKA 2RMU1 1EPZA 3AZYA 3ZDVA 3JBG1 1QXPA 1HQLA 2WNOA 4GULA 4P9WA 3B9CA 5DDJ2 3I3DA 1CONA 1FZ0E 5A1AA 2P4EA 5GZCA 3DUIA 2VZOA 3VB9A 3VDDC 3IB3A 1SEFA 1Z7S3 1QWRA 2RDNA 2Y6GA 3VKMA 1CAUA 4BQYA 4I6JB 2ARAA 3U0ZA 4V1PA 1DDLA 3BTZA 1AR62 3CJIB 3KCCA 5ABJB 1JZ7A 1J84A 1O3RA 4XZPA 3CZUA 1RUC3 4M3WA 3FC0A 1FZ7E 2VOTA 1QJU1 1S0BA 3ILRA 3I2FA 5IWFA 3RI8A 4AHXA 3IMNA 4W6XA 2VJ5A 1X33A 4KG0A 3WP4A 3P1IA 3WT3A 3DCQA 4PLOA 2DV9A 3ILFA 4UW4A 3SQ0A 1PIV1 3PHMA 3ZYFA 3ZYHA 1HXS1 1PK6A 4UFHA 1FZHE 2R7EB 4XTPA 5F5CA 3O0XA 1VE0A 5DG2A 4RFRB 5JMCA 5FYTA 4NJ4A 2BZDA 1QDOA 3WP5A 1WLCA 4FPCA 4PDWB 1JN2P 4AHYA 4Q4X1 1D4VB 2P1OB 3VD5A 4BQ4A 1JUIA 1F4AA 2WT2A 1W8FA 3GXUA 5I93A 5E1RA 4NE9A 4A7ZA 2BDRA 4CEYC 4YZ2A 4HXCA 5ACA2 3IIAA 1GWMA 2VZ1A 1FPOA 2VOKA 4H14A 5KHKA 1FZ4E 3N1BA 1WGPA 4IEOA 2OVUA 4IUGA 1KITA 4K8FA 3MYXA 4LO5B 4QHOA 1ND3B 1PVC2 3ACFA 3IM0A 5H9PA 5JCTA 1AYM3 3ZDSA 4BLIA 4H7MA 4CDWC 3VBRB 3H50A 3ST7A 1WCKA 2OX0A 3LWCA 2RE9A 3O1PA 2JG9C 2JWPA 3MPPG 2BNMA 3RS6A 4XDOA 4B1LA 3KLSA 3VHPA 2IVJA 3H8RA 1IS6A 4Q4W3 3TAEA 1W6PB 2VVEA 5FFOC 2RS12 3TEXA 4CP2A 3IT8A 1QQP1 5FY5A 1Z7S2 1XU1A 2RS33 5FZ7A 5IAXA 1J1TA 3T1MA 3E5XA 1RC6A 3M8LA 3OSDA 4MADA 1W90A 2UYAA 3AC0A 2PLV2 4W6WA 4BWOA 3J8F3 4R4XA 4FTBA 2YBSA 3GDBA 2CDOA 2D3PA 2R0FA 3C8XA 5FUNA 2JX9A 3AMMA 4AFMA 4BDVB 1VAMA 5LBBA 3ZLIA 3F95A 4EYUA 5LEJA 3U07A 4AQ2A 1WW4A 4IGQA 1ZM1A 1JZ4A 2QFEA 1OVPA 2GDFA 3T3YA 3SEEA 4P02B 2SBAA 4FPFA 2QQUA 3MIGA 5G04L 5A33A 2WWUA 2QNKA 1PM4A 5G05L 3VZMA 4DTPA 3PIJA 4KQ7A 2GC3A 5FP8A 4UBGA 5T50A 4BQXA 5EIYB 2J1EA 2DCTA 3MKSB 4QHBA 1ZRDA 4YZ1A 1QOOA 4XFGA 4E4DX 5L7OB 2FZ2A 2JG8B 1MS4A 1LB2A 1XMHE 4F8AA 4G9SB 2BJSA 1UOJA 2V09A 5FUIA 4AQSA 3S9HA 3CL1A 4IL7A 5DAVA 5FJKA 5FYSA 1MEC1 4Y22A 2P5OA 1CPMA 3WR0A 2YBPA 2ZMNA 3LDRA 1MR5A 5JZGB 2DYCA 2K46A 3ME2A 4BIFA 3FHIB 3GGLA 3ZMOA 3CFRA 1ASJ2 1UNBA 1TE1B 5AC92 4Y1VA 3BTXA 4TN7A 3WNNA 4DUWA 4KWJA 5KXDA 4NHMA 4AEDC 1U12A 1VBD1 2GNBA 1UZZA 2ZGMA 4Y33A 2B8IA 3FLRA 2D7FA 1N1YA 3PMSA 4CCJA 3TRSB 1RMU2 3UETA 3ZYPA 2HWE2 4JRQA 2QCSB 5A3WA 1NY72 4Q4W2 2RM21 1O8PA 1ZZBA 4Q1RA 2C26A 1LOFA 1WMDA 1BKZA 2RS32 4TSVA 4XUPA 1K5MC 4AKHA 3AYEA 2Y8KA 5LA9A 4E2GA 2CHHA 3L8BA 3CFPA 1A6CA 4WZFA 3J8F2 2VC9A 2YUEA 1UX6A 2PA7A 1H2KA 1ENRA 4I0WB 3WDYA 3QERA 1W9SA 2ZBJA 3NKGA 4FJJA 1U5YA 3ORJA 4TLFA 2AH2A 3OG2A 4ZPIA 2VOVA 4HCBA 5C4WA 2XBO2 3N9PA 1SZBA 4DXRA 4JQTA 3H1WA 4QXCA 4RL5A 4QGMA 3T09A 4LBMA 1OLRA 4IEYA 4KI5M 3UYJA 2G19A 4FBFA 3TEZA 2P1NB 1RUG3 4NHLA 5JSOA 5FZ4A 1UYZA 5FUPA 5JAXA 4DB5A 2YC0A 2WYSA 5EJZB 4YW2A 3RFRA 4F83A 5DUXA 5C9AC 2VTXJ 3CQ8A 5C3PA 3WQBA 5F7UA 4CXWA 2Z2SB 4FXGB 4LPLA 1TVGA 2XWJB 1WA4A 3DKQA 3PDQA 2EXKA 3E6CC 4YG3A 3O1MA 1ULPA 3FUOA 4GMP1 4IEZA 3WQ7A 4A42A 1WD3A 2R49A 2JDZA 2TEPA 4GH4A 1IPKA 4AI8A 1RHI3 4W4ZA 5FYCA 4AEKA 1AR83 4ES9A 1UZWA 2J1AA 4MGKE 4GXLA 4YVWB 5HCFA 4PI2A 3TBDA 3N36A 3ZSMA 1RB8G 2R073 4CU6A 3K3NA 2Y60A 4LLOA 1JS9A 3PVEA 1MHYG 3LQCA 4NVPA 3THTA 3P5BA 1NT0A 4K1YA 4R9BA 4RS5C 4CCKA 5CG8A 3P3NA 4XFAA 3GZEA 2VMGA 2CGPA 2WIIB 2ZGQA 3ZXAC 4LKFA 3HD8B 3I2JA 3WQ0A 5KC5A 1G9AA 2DDUA 2ORXA 3HQUA 1JYXA 3MIBA 2JB4A 4XF4A 5FAXA 2ZHKA 4BQ3A 3A22A 3TNPB 3ZR5A 2ZKLA 1IH7A 2VCMA 3MW3A 1EAH3 1ZZ7A 3U4SA 5FBJA 4DRRA 2ZGUA 1NCRB 3N9QA 1I3HA 1UIJA 4KU7A 4PLNA 5A7WA 4R9DA 1SACA 4RQPC 4RR3C 3WDXA 2XJQA 4NIAA 1OLMA 2VJ4A 5F3GA 1RUI1 4JGZC 4DTXA 5T3NA 4BJ0A 2D6LX 4GMP0 3L2HA 4Z82A 4CCDA 3I7DA 2ZS6B 1U5ZA 4S2HA 1H6XA 3BGAA 1Q9XA 1F5FA 3FJSA 4FQ4A 1BK0A 3JD73 5FPZA 5D8AB 3T2OA 1RUF2 4QPIC 3IDEA 2XOMA 2J42A 1XNBA 4GJYA 1W6OA 4I02A 1CX1A 2WFF3 3ALQA 4SBVA 2ZX2A 1IG9A 1J83A 1RUG2 3MI8A 4S2DA 4EE2A 1G9DA 1HRI1 3WD5A 3NAEA 3WQ1A 4YG0A 5KHGA 1O59A 2QKDA 1XOYA 2ZGKA 4IERA 4A3XA 4YWAA 1U0AA 4LBQB 4AWDA 1ZVFA 4ZS3A 3HNMA 4ZXEA 5KXEA 4YGDA 3K46A 1XVCE 1Q8OA 2ET1A 1AX1A 5HXMA 4BIOA 3SQ4A 1BHGA 3TYJA 2Y26A 1RHI2 4DOUA 1AR82 3H1YA 3WZ1A 2XJPA 2W94A 3PTRB 3P3PA 2P6HA 3IIIA 5FY8A 5CKQA 4LA3A 5FCCA 4XUOA 1D7PM 4FK2A 1DYKA 4GIQA 5A7SA 2I74A 1QJEA 2E53A 3H8OA 3AP7A 3VHOA 2VZUA 4E4ZA 2XMLA 1WBLA 3ELNA 1GFF2 1YWKA 1H1MA 2YGLA 1VAKA 4HL0A 3W58A 4OHYA 1UOBA 3I2GA 3VDBA 1YI9A 4FJKA 2WS93 2VZQA 5FYBA 4EWEA 2HBUA 1ENSA 1UPSA 1IPSA 1CAWB 4PIZA 3FLTA 5EPAA 4QX2A 3ZYIB 1A34A 4D6SA 3CKHA 4DXSA 2A6VA 2IUWA 5TSWA 3ZFGB 2HWB3 1OHFA 2VNRA 2MMBA 3GHMA 1RUNA 1RUD3 4O7XA 5F3CA 3VBOC 3B02A 2C9AA 4JRLA 5FO7B 3JD72 3S6PA 2CGNA 1EPWA 1US2A 2JIJA 4OI4A 4KHSA 3POSA 2EXIA 4O9EA 4GA9A 4DINB 1RUC1 1HKDA 4IEWA 2AREA 3V7DB 1W0OA 1ZNPA 3EYPA 3SUNA 3GNEA 3N35A 5FP9A 4AFDA 4AOCA 3GZUC 1PVXA 4ASMB 4XILA 5K0UC 4Y24A 1UQXA 2PAEA 1XU2A 4FOVA 1CAWA 4LK6A 5GJ6A 3TN93 4CDQB 4HFSA 2XGXA 5BUVA 3ETPA 3C2UA 4FJNA 2P6CA 3N9LA 1OSGA 2P3KA 4LIUA 1J3PA 4XFFA 1US3A 2VZTA 3I2IA 5C6CA 4YRDA 2WZ8A 3N9OA 4YZ4A 1FMD3 1SCRA 2CL2A 1U5XA 1MS5A 3WDWA 4E3SA 2PMWB 4KMQA 1FS1A 1UYPA 4FO9A 4YGBA 1ND2C 3WF4A 3PJQA 5FWEA 3KD1E 1C8M1 3CJXA 4XOGA 4XAEA 4OHXA 4CDQA 4LO6B 2BVBA 2IXJA 3AKTA 3MW2A 3OPZA 2YC2A 1FV3A 4GWIA 3JU9A 1KD7A 3NNFA 3ASIA 4MGQA 1I9RA 4UFKA 4Y5TA 2E63A 1WW6A 2HWF3 3VUOA 1F31A 4LUMA 2Q30A 1DCSA 3D3AA 1AYM1 1MPXA 2OPWA 3N7JA 2DTUA 2DURA 3IMMA 4KWLA 2P3IA 4QPGC 1XNCA 2J1UA 2XUMA 5BNNA 4LOTA 4HN0A 5FMCA 1QHDA 2ZGOA 5C5TA 1QJY1 4N53A 4E2SA 4JX0A 3MF6A 1D4M3 3ZXKA 2VAUA 3NSTA 4OCTA 4CDXC 2FMYA 2RS31 2JHAA 2YFUA 2ZAAA 3RMYA 3O1UA 4AVSA 1MMOG 4S2FA 4GALA 1FX5A 4FPEA 2X09A 4YVSB 1O3TA 5FLHA 4FJHA 3ZN4A 1XRUA 3S5AA 1UY1A 1HB1A 5EHDA 5FMOL 1FZ3E 2W5FA 4L0PA 1BQPA 4DIQA 4YARA 4ZS2A 4KBBA 4CUCA 3V0BB 2AR6A 3HPNA 1F35A 1UY0A 2C9KA 3EB7A 3MICA 4C1WA 1W8ZA 1Y4WA 1HRV3 3APBA 4CVUA 4WM8C 4QU1A 1F5JA 3BKZA 4Q4X3 3U78A 3WF1A 1FATA 4FAHA 3BU0A 4FI9A 3WW3A 2X5IA 1Q8PA 1XNDA 3AYCA 4YZ5A 2NYYA 1WBFA 1OD3A 1QH7A 4K7JA 4PQQA 3BOPA 1AXKA 4XQ4A 1PMHX 4YG6A 1LKNA 4FXKB 1MZFA 5E16A 3Q8BA 3D6EA 4CSWA 2QDNA 4DY3A 4QXKA 5T5JA 2RS53 2DVBA 1HIXA 2NMOA 3TL8B 2RMU2 3JBG2 2D40A 3E5UA 3A0KA 3H3ZA 1I5PA 4FPYA 1AX2A 1PNFA 2GH8A 3HVDA 3SCFA 4CP9B 5C8CB 4MGYE 3OGVA 3JB4C 4XW3A 1V6IA 3WCRA 5T55A 3DV8A 3T1LA 1DIWA 1GNZA 1IS4A 3OF1A 2BGCA 3FLPA 2HWF2 3LCPA 3KF3A 5DG1A 5F5AA 1Q5OA 4CEWC 3T30A 3QESA 3BALA 1X9PA 1DGLA 1H8VA 3M1HA 4N43C 4WVMB 4CCNA 5DAQA 1QGLA 1FV2A 1W6NB 4I9LA 4YNIA 2WZPP 1XYPA 2L9LA 4YW7A 4BK4A 2LUWA 3POJA 4WZCA 1QJU2 1D4M2 3ZFFC 1WLTA 1EY2A 2VMDA 2E7AA 2WJSA 3A4UA 1GQHA 2EIDA 2Q8DA 1QIQA 2FDJA 4FAGA 2ZOEB 4CP9A 4NMIA 2AEZA 2DFBA 4P9JA 3INAA 4MGSA 1PIV2 3VBSC 1W39A 4JHZA 1V70A 2Y6JA 1LEMA 2D97A 4L2NA 3VKFC 3I3MA 3A23A 4BHPA 3AKSA 3VZLA 2VXJA 3B00A 1AHSA 4K8RB 2P37A 4NHXA 4IGPA 4Y4RA 3RVHA 3RI9A 4WVMA 2DCYA 5IT6A 1HRV2 1W6NA 2J1RA 4N9HA 3T0DA 4A6OA 1OT5A 4Q4X2 2OVRB 4AEMA 1UL9A 2BW8A 3JQWA 2WSVA 4FFFA 4FTEA 3CDZB 4A7KA 2WNVC 1VB4A 4HSLA 1RUG1 1JHNA 1OH4A 3PVOA 2PHUA 2OPKA 2VQAA 2QBXA 2FHRA 4IEUA 1GWLA 1DU3D 1EV13 1ZA7A 5FZDA 4GB33 2P17A 2P3YA 4C0BA 1H2LA 4FJLA 2NZ9A 3ZKYA 3PUHA 3HP9A 1VBD3 2A3XA 5F6KA 5JPNB 4RGKA 3J7LA 1D2QA 1AXYA 4RSUA 3U37A 1E5RA 3V65A 4CA9A 4Z1VA 1FXZA 2YYOA 4N90A 3RMDA 2VMHA 4ZONA 4Q27A 1NA1A 3C7HA 1POV3 2R071 3LAGA 3I59B 1S2KA 3JB8A 4Q2FA 5FZCA 4XIKA 1V6OA 1UXZA 2DFCA 4LK7A 5FZIA 1NXD1 3OD4A 4DXTA 2W1QA 4COYA 3C7OA 4E4BA 3KCXA 5A7QA 4MX3A 1LAJA 3UKVA 3TEYA 1IPJA
chains in the Genus database with same CATH topology
1J84A 4JS4A 2P1MB 3NHGA 3VDCA 2Y6HA 3CZUA 5DMYA 1PX4A 1FZ5E 4M3WA 1FZ7E 2VOTA 3K4ZA 3T08A 3I2FA 4M4PA 3FN9A 1DYOA 2VJ5A 4KHUA 3K2OA 4DEQA 2P5GA 3QEXA 1MHZG 3P1IA 4D8MA 3SQ0A 3SKVA 4DUVA 2QQIA 3OB8A 1FZHE 2R7EB 4FJIA 4KHWA 4QDSA 1WCQA 4XVHA 3OGKB 2BZDA 4AI6A 3DECA 4QB1A 4DTSA 4FK0A 2JD9A 1SDDB 2P1OB 4M45A 1DLCA 1UY2A 3VD5A 1F4AA 1K12A 3GXUA 4J2BA 5CZKA 4ARXA 1UYXA 3FHQA 2X05A 5JMOA 2OVPB 2VZ1A 1F4HA 4ARYA 2ZEXA 1FZ4E 3N1BA 4IUGA 2PFTA 3C94A 4J2AA 3NJXA 4OMDA 3ACFA 3GM8A 3SEPA 5JUVA 4X5NA 2ZEYA 2WO1A 1JZ2A 5IZ7A 4DTOA 3SQ1A 4QDRA 1JYWA 1CLQA 3TAEA 2VIXA 3BN6A 3UNPA 3SUQA 4J2EA 4M42A 4PF1A 1XNTA 4MADA 1P22A 3AC0A 3RMCA 4Z2AA 5IHRA 4E8DA 3WF2A 4DTMA 1L7QA 3OBAA 4LQRA 2MZWB 3GDBA 2CDOA 3LDSA 3C8XA 4BK5A 2DCKA 4CUAA 4BDVB 2VO5A 5LCWL 2QQKA 1ULOA 5EJ1B 1JZ4A 5JXHA 3L2OB 4I9QA 4P02B 3C6NB 3LEIA 1XPWA 3LDBA 3SEEA 5G04L 3ACGA 5LA1A 4J2DA 5G05L 5HPOA 3E4WA 2W9XA 4DTPA 2QXFA 4ADNA 2P1QB 3ACHA 1W0NA 5B4NA 5EIYB 2J1EA 2B4KA 3MKSB 3K77A 2W1UA 2XQXA 2BGOA 5IJRA 3HOBA 1XMHE 2JE8A 5FUIA 3S9HA 2JPNA 3TAGA 2EIEA 1UY4A 4UOJA 3JXSA 3WEZA 2P5OA 3L0MA 4FJ9A 3QEVA 5IBKB 1PX3A 3GGLA 3CFRA 3VDAA 4P5YA 1K42A 4AKIA 4XURA 2BGPA 3I97A 1L7RA 2RVAA 3WNNA 4DUWA 5IFTA 1JI6A 3THDA 2B8IA 2OKXA 4KHYA 2J1SA 2QQMA 3UETA 1JZ3A 3SJJA 3HGLA 2VJXA 4A3ZA 4AG4A 3T2PA 4JRQA 3I2HA 3LZIA 1XVBE 5DQ0A 3WF3A 1O8PA 3QEWA 2WABA 2C26A 4UAPA 4EPHA 3NE6A 4P08A 4DTNA 2J22A 4XUPA 2WUHA 4AKHA 2HLEA 1KGYA 2W46A 3PUIA 2FYOA 2Y8KA 4A44A 3L8BA 3CFPA 2JHPA 2B1EA 3IAPA 2C4XA 4LKSA 2VC9A 5C71A 3K75B 3HEIA 2W91A 2DEBA 3QERA 1W9SA 4FJJA 4AAXA 2VM9A 2V5DA 3OG2A 4EYWA 4HCBA 2VR4A 2LF3A 2VCAA 4DU1A 2DCJA 4DXRA 4RYDA 1SG3A 1GQPA 1UY3A 1XNAA 4RL5A 4FJ7A 4DTUA 2QQOA 1NEXB 4KHNA 4QX1A 3C6OB 3T09A 4KI5M 2RJ2A 4OUEA 2P1NB 4FJ5A 3E1F1 4OMCA 1LNSA 1UYZA 3HGKE 1CIYA 4JS5A 1Q9YA 2WYSA 1WAFA 5EJZB 4YPJA 1FYZE 3CQ8A 3WQBA 5F7UA 4M3YA 4DEVA 4LPLA 1TVGA 2QQJA 1LDKE 1ULPA 1XVDE 4M3TA 4A42A 1P8JA 3MV11 2OYQA 5JXIA 4DU4A 4W4ZA 3SUOA 1GOGA 2BERA 4TTGA 2J1AA 3SKJE 4XZUG 4CU8A 4CU6A 1UXXX 1MHYG 3LQCA 5LA0A 3RMBA 3C95A 4ZY9A 1JU3A 4QNDA 3SUPA 3J27A 2W1SA 2XHNA 3I2JA 2PFVA 2DDUA 2ORXA 1JYXA 3J2PA 3T2QA 3SCXA 3A22A 3SNNA 1IH7A 1PMJX 3IAQA 3QNOA 2VQTA 2W47A 5JXJA 4DU3A 2VJ4A 1OF3A 4DTXA 2WQ8A 4BJ0A 3W5MA 2WN2A 4JKKA 4M3UA 2W92A 1K3IA 4M3RA 1H6XA 3BGAA 1Q9XA 4QNCA 2H4TA 1UX7A 2XONA 3C7EA 2EIBA 3P6BA 3T2OA 2EICA 1JU4A 3CIHA 3VD7A 3VD9A 2XOMA 3HNBM 4E8CA 4UI9L 4XUNA 5DN2A 1CX1A 3HL8A 1IG9A 1J83A 1JHJA 4PT6A 1XU5E 3C7GA 3NAEA 3LZJA 1UMHA 4FJ8A 1O59A 4XUTA 3T0BA 3WNMA 3VD4A 3E4YA 2JDAA 1GMMA 3NJVA 3HNMA 4ZXEA 3K46A 1XVCE 5HXMA 4M41A 3SQ4A 1BHGA 4QDQA 1W99A 2W94A 3J7HA 3IIIA 1XVFE 3FL7A 3MO4A 1JZ5A 3L1NA 2BBAA 4XUOA 1D7PM 4FK2A 1W9WA 1XVEE 2E26A 3I3EA 2VCBA 2VZUA 4P00B 3TJYA 3QEPA 1EUTA 4ZZ8A 2LS6A 3MUY1 5B4XA 3A21A 3LEKA 4M3XA 1TG7A 2WDBA 1JZ6A 2LW8A 2FW3A 3I2GA 3VDBA 3DYOA 4FJKA 2VCCA 2VZQA 2ZXQA 4OYUA 1XVGE 1HN1A 2B7MA 3UESA 4A45A 4CU9A 1FXXA 4DTJA 5IFPA 4QAWA 2P1PB 4QX2A 3K4DA 3ECQA 3CKHA 4DXSA 2OZMA 4ADOA 2MMBA 1NKGA 1RYYA 5J1XA 1EUUA 1XMFE 2W87A 3WNPA 1US2A 4DUXA 4KHSA 2E33A 1KEXA 4FVMA 1SHWB 4TXWA 3A7QA 3K4AA 3QETA 2B9VA 4DTRA 2VMEA 3V7DB 2YG0A 3EYPA 3VD3A 3SUNA 4A41A 3THCA 2ID4A 5C70A 2WZEA 2KD7A 4W8JA 3ETPA 3SPZA 3TAFA 2W3JA 4RNGA 4FJNA 4AKGA 3LEGA 4RN5A 2VZPA 1US3A 2VZTA 3I2IA 3WF0A 2QQNA 2WZ8A 2OZSA 2WBKA 3FHAA 2RCUA 3I3BA 1GU3A 3IDAA 4E3SA 1W9TA 3ABZA 4JKLA 4KMQA 1FS1A 2CDPA 2QQLA 2HYXA 4CUBA 3WF4A 1MTYG 3KD1E 1JYNA 3NGIA 4LHSA 1XMGE 1CZSA 2X10A 2RV9A 3KD5E 1WAJA 2JHCA 4EP9A 1GOHA 4GWIA 2YC2A 4QX3A 4MGQA 3WNLA 3SVIA 3OGRA 1R64A 1OF4A 3D3AA 1MPXA 2DTUA 2JH8A 3LD8A 3I2KA 1W8NA 5LA2A 2J1UA 3DYMA 3WNOA 3ZM8A 5H37A 2ZEZA 4JX0A 4B08A 3NDKA 4XUQA 2JHAA 1NX9A 4RG8A 2YFUA 4KWUA 1MMOG 2Y64A 4HG6B 2W95A 2X09A 2ORZA 4FJHA 2V72A 2ATQA 1UY1A 2WO3A 1FZ3E 4KI4A 1W8OA 2W5FA 1FZ9E 3OEAA 4L0PA 3NCIA 3MBWA 4CUCA 2VZVA 3C7FA 1WKYA 3QEIA 1UY0A 2C9KA 3EB7A 3HPNA 4CVUA 1XL3C 2VZ3A 3CFOA 3SQ2A 5I0DA 4M3ZA 1UYYA 4GAMC 3WF1A 5JXGA 4FI9A 3WSOA 1K45A 2PQSA 4PQQA 1OD3A 5JR2A 5IREA 1PMHX 2VMCA 2OVQB 4JRPA 1FZ2E 2VMFA 4QX0A 3TL8B 3HJRA 1UZ0A 2WAOA 3NQHA 4GZ9A 4FJMA 2ZEWA 1JZ8A 4MOAA 1I5PA 4HCCA 1T2XA 4MO3M 3CQOA 2J1VA 3OGVA 2Y6LA 1XC6A 4A4AA 2WN3A 4W50A 3OGLB 3T0AA 2VQUA 3ACIA 2VTFA 3SI6A 1CZVA 1DP0A 2YB5A 3QESA 3HNYM 1JYVA 3MUZ1 4I9LA 4BK4A 2L9LA 4CU7A 2DY4A 2JKXA 1IQDC 3TABA 3RMAA 4QB2A 3UIQA 1GUIA 2VMDA 2EIDA 5CYYA 2JH9A 2J1TA 3OGSA 4ET7A 1XU3E 2E32A 4X5MA 2V4VA 4ZZ5A 4QPWA 4MGSA 4FJXA 4JHZA 2Y6JA 1GNYA 3OGMB 5IYYA 2YFZA 3A23A 2VL4A 4KHQA 2WAAA 1FZ6E 2WO2A 3NNGA 3MV01 3W5NA 4QB6A 2Y6KA 3N1EA 3LPGA 1FZ8E 4BXSV 4OZOA 2J1RA 4FJGA 2VZRA 5C7GA 3T0DA 3LPFA 1OT5A 1UMIA 4A6OA 2OVRB 4GWJA 2YB7A 3OEBA 2LF6A 4FK4A 3CDZB 3QNNA 3F2ZA 3SPYA 2VZSA 1OH4A 3WNKA 3LE0A 4KI6A 4M4RA 2QBXA 1YQ2A 3CZJA 1NAEA 3RWUA 1CZTA 5DPNA 1FZIE 1UWWA 4FJLA 3PUHA 2HD0A 3HP9A 1FZ1E 4D0QA 3I3DA 3C6PB 3U37A 1NUKA 1FZ0E 5A1AA 1GOFA 3RMDA 2VZOA 2E31A 2YC4A 3C7HA 3IB3A 4JKMA 2J7MA 1O8SA 2Y6GA 1H6YA 1UXZA 3CMGA 4I6JB 2W1QA 2W1WA 3C7OA 4E4BA 3HN3A 3DYPA 3NRUA 2Z4FA 4DXTA 1JZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J84 A;  3VDC A;  2P1M B;  2Y6H A;  3CZU A;  5DMY A;  1PX4 A;  3K4Z A;  2VOT A;  3T08 A;  3I2F A;  4M4P A;  3FN9 A;  1DYO A;  4DEQ A;  3P1I A;  4D8M A;  3SKV A;  4DUV A;  2QQI A;  3OB8 A;  2R7E B;  4QDS A;  1WCQ A;  4XVH A;  3OGK B;  2BZD A;  3DEC A;  4QB1 A;  2JD9 A;  1SDD B;  2P1O B;  1UY2 A;  1DLC A;  3VD5 A;  1F4A A;  1K12 A;  3GXU A;  5CZK A;  4ARX A;  1UYX A;  3FHQ A;  2X05 A;  5JMO A;  2OVP B;  2VZ1 A;  1F4H A;  4ARY A;  2ZEX A;  4IUG A;  3NJX A;  4OMD A;  3ACF A;  3GM8 A;  3SEP A;  5JUV A;  2ZEY A;  2WO1 A;  1JZ2 A;  4QDR A;  1JYW A;  3BN6 A;  3UNP A;  4PF1 A;  1XNT A;  4MAD A;  1P22 A;  3AC0 A;  4Z2A A;  5IHR A;  4E8D A;  3WF2 A;  3OBA A;  1L7Q A;  4LQR A;  3GDB A;  2CDO A;  3C8X A;  4BK5 A;  2DCK A;  4CUA A;  4BDV B;  2VO5 A;  5LCW L;  2QQK A;  1ULO A;  5EJ1 B;  1JZ4 A;  5JXH A;  3L2O B;  4P02 B;  3SEE A;  3C6N B;  3LEI A;  1XPW A;  5G04 L;  3ACG A;  5LA1 A;  5G05 L;  5HPO A;  2W9X A;  3ACH A;  2P1Q B;  1W0N A;  5B4N A;  5EIY B;  2J1E A;  2B4K A;  3MKS B;  3K77 A;  2W1U A;  2XQX A;  2BGO A;  5IJR A;  3HOB A;  2JE8 A;  5FUI A;  2EIE A;  1UY4 A;  4UOJ A;  3JXS A;  3WEZ A;  5IBK B;  1PX3 A;  3GGL A;  3VDA A;  1K42 A;  4P5Y A;  4XUR A;  2BGP A;  3I97 A;  1L7R A;  2RVA A;  3WNN A;  4DUW A;  5IFT A;  1JI6 A;  3THD A;  2OKX A;  2QQM A;  2J1S A;  3UET A;  1JZ3 A;  2VJX A;  4AG4 A;  4A3Z A;  3T2P A;  3I2H A;  5DQ0 A;  3WF3 A;  1O8P A;  2WAB A;  2C26 A;  4UAP A;  4P08 A;  2J22 A;  4XUP A;  2WUH A;  2HLE A;  1KGY A;  2W46 A;  3PUI A;  2Y8K A;  4A44 A;  3IAP A;  2C4X A;  4LKS A;  2VC9 A;  5C71 A;  3K75 B;  3HEI A;  2W91 A;  1W9S A;  4AAX A;  2VM9 A;  2V5D A;  3OG2 A;  2VR4 A;  2VCA A;  2DCJ A;  4DXR A;  4RYD A;  1SG3 A;  1GQP A;  1UY3 A;  1XNA A;  2QQO A;  1NEX B;  4QX1 A;  3T09 A;  3C6O B;  4KI5 M;  2RJ2 A;  4OUE A;  2P1N B;  3E1F 1;  4OMC A;  1LNS A;  1UYZ A;  1CIY A;  2WYS A;  5EJZ B;  4YPJ A;  3WQB A;  5F7U A;  4DEV A;  4LPL A;  1TVG A;  2QQJ A;  1LDK E;  1ULP A;  4A42 A;  1P8J A;  3MV1 1;  5JXI A;  4W4Z A;  1GOG A;  2BER A;  4TTG A;  2J1A A;  3SKJ E;  4XZU G;  4CU8 A;  4CU6 A;  1UXX X;  3LQC A;  5LA0 A;  4ZY9 A;  1JU3 A;  2W1S A;  2XHN A;  3I2J A;  2DDU A;  2ORX A;  1JYX A;  3T2Q A;  3A22 A;  1PMJ X;  3IAQ A;  2VQT A;  2W47 A;  5JXJ A;  1OF3 A;  2WQ8 A;  4BJ0 A;  3W5M A;  2WN2 A;  4JKK A;  2W92 A;  1K3I A;  1H6X A;  3BGA A;  1UX7 A;  2XON A;  3C7E A;  2EIB A;  3P6B A;  3T2O A;  2EIC A;  1JU4 A;  3CIH A;  3VD7 A;  3VD9 A;  2XOM A;  3HNB M;  4E8C A;  4UI9 L;  4XUN A;  5DN2 A;  1CX1 A;  1J83 A;  4PT6 A;  1JHJ A;  3C7G A;  1UMH A;  1O59 A;  4XUT A;  3T0B A;  3WNM A;  3VD4 A;  2JDA A;  1GMM A;  3NJV A;  3HNM A;  4ZXE A;  3K46 A;  5HXM A;  1BHG A;  4QDQ A;  1W99 A;  2W94 A;  3J7H A;  3III A;  3FL7 A;  3MO4 A;  1JZ5 A;  2BBA A;  4XUO A;  1D7P M;  1W9W A;  2E26 A;  3I3E A;  2VCB A;  2VZU A;  4P00 B;  1EUT A;  4ZZ8 A;  2LS6 A;  3MUY 1;  5B4X A;  3A21 A;  3LEK A;  1TG7 A;  2WDB A;  1JZ6 A;  2LW8 A;  3I2G A;  3VDB A;  3DYO A;  2VCC A;  2ZXQ A;  2VZQ A;  3UES A;  4OYU A;  1HN1 A;  4A45 A;  4CU9 A;  5IFP A;  4QAW A;  2P1P B;  4QX2 A;  3K4D A;  3ECQ A;  3CKH A;  4DXS A;  1NKG A;  1RYY A;  5J1X A;  1EUU A;  2W87 A;  3WNP A;  1US2 A;  4DUX A;  2E33 A;  1KEX A;  1SHW B;  4TXW A;  3A7Q A;  3K4A A;  3VD3 A;  2B9V A;  2VME A;  3V7D B;  2YG0 A;  3EYP A;  4A41 A;  3THC A;  2ID4 A;  5C70 A;  2WZE A;  2KD7 A;  4W8J A;  3ETP A;  2W3J A;  3LEG A;  4RN5 A;  2VZP A;  1US3 A;  2VZT A;  3I2I A;  3WF0 A;  2QQN A;  2WZ8 A;  2WBK A;  3FHA A;  3I3B A;  1GU3 A;  3IDA A;  1W9T A;  3ABZ A;  4JKL A;  4KMQ A;  1FS1 A;  2CDP A;  2QQL A;  2HYX A;  4CUB A;  3WF4 A;  1JYN A;  4LHS A;  1CZS A;  2X10 A;  2RV9 A;  1GOH A;  4GWI A;  2YC2 A;  4QX3 A;  4MGQ A;  3WNL A;  3OGR A;  1R64 A;  1OF4 A;  3D3A A;  1MPX A;  3I2K A;  5LA2 A;  1W8N A;  2J1U A;  3DYM A;  3WNO A;  3ZM8 A;  2ZEZ A;  4JX0 A;  4XUQ A;  2YFU A;  1NX9 A;  4KWU A;  2Y64 A;  4HG6 B;  2W95 A;  2X09 A;  2ORZ A;  2V72 A;  1UY1 A;  2WO3 A;  3OEA A;  1W8O A;  2W5F A;  4L0P A;  3MBW A;  4CUC A;  2VZV A;  3C7F A;  1WKY A;  2C9K A;  1UY0 A;  3HPN A;  3EB7 A;  4CVU A;  2VZ3 A;  5I0D A;  1UYY A;  3WF1 A;  5JXG A;  4FI9 A;  3WSO A;  1K45 A;  2PQS A;  4PQQ A;  1OD3 A;  5JR2 A;  1PMH X;  2VMC A;  2OVQ B;  2VMF A;  4QX0 A;  3HJR A;  1UZ0 A;  2WAO A;  3NQH A;  4GZ9 A;  2ZEW A;  1JZ8 A;  4MOA A;  1I5P A;  1T2X A;  4MO3 M;  3CQO A;  2J1V A;  3OGV A;  2Y6L A;  1XC6 A;  4A4A A;  2WN3 A;  4W50 A;  3OGL B;  3T0A A;  2VQU A;  3ACI A;  2VTF A;  1CZV A;  1DP0 A;  3HNY M;  1JYV A;  3MUZ 1;  4BK4 A;  2L9L A;  4CU7 A;  2JKX A;  1IQD C;  4QB2 A;  1GUI A;  2VMD A;  2EID A;  5CYY A;  2J1T A;  4ET7 A;  3OGS A;  2E32 A;  2V4V A;  4ZZ5 A;  4QPW A;  4MGS A;  4JHZ A;  2Y6J A;  1GNY A;  3OGM B;  5IYY A;  2YFZ A;  3A23 A;  2VL4 A;  2WAA A;  2WO2 A;  3NNG A;  3MV0 1;  3W5N A;  4QB6 A;  2Y6K A;  3LPG A;  4BXS V;  4OZO A;  2J1R A;  2VZR A;  5C7G A;  3T0D A;  3LPF A;  1OT5 A;  1UMI A;  4A6O A;  2OVR B;  4GWJ A;  2YB7 A;  3OEB A;  3CDZ B;  3F2Z A;  2VZS A;  1OH4 A;  3WNK A;  3LE0 A;  4M4R A;  2QBX A;  1YQ2 A;  3CZJ A;  1NAE A;  1CZT A;  5DPN A;  1UWW A;  3PUH A;  4D0Q A;  3I3D A;  3C6P B;  3U37 A;  1NUK A;  5A1A A;  1GOF A;  2VZO A;  2E31 A;  2YC4 A;  3C7H A;  3IB3 A;  4JKM A;  2J7M A;  1O8S A;  2Y6G A;  1H6Y A;  1UXZ A;  3CMG A;  4I6J B;  2W1Q A;  2W1W A;  3C7O A;  3HN3 A;  4DXT A;  3DYP A;  3NRU A;  2Z4F A;  1JZ7 A; 
#chains in the Genus database with same CATH topology
 4WM7 B;  4OHZ A;  4TZD A;  3K3O A;  1PX4 A;  2VNO A;  4IV1 A;  1LOC A;  5EXO A;  4BLJ A;  5AFE A;  1C1F A;  2FDH A;  1QU0 A;  4M4P A;  1AL0 G;  3FN9 A;  2PYT A;  1EAH 1;  3PNA A;  3VBH C;  5AVA A;  4KHU A;  1JOJ A;  2P5G A;  1GLH A;  3IZO A;  4CDU C;  5JOW A;  4D8M A;  3M2M A;  3VZO A;  5FZ0 A;  2BYV E;  4CCE A;  4EV0 A;  2LRP A;  4JTN A;  4OUS A;  1ZRF A;  3I59 A;  5HCA A;  2A6X A;  4FJI A;  2YPJ A;  4KHW A;  3LIG A;  3GJB A;  1BZW A;  3T2T A;  1H0B A;  4YYO A;  3NNJ A;  1OBN A;  1YIP A;  1S2B A;  1OC1 A;  3FFQ A;  4QB1 A;  4BCU A;  4A7Y A;  4FK0 A;  2DBN A;  1YO8 A;  4OFG A;  2F4L A;  2GND A;  2WA3 A;  3I8T A;  1DLC A;  5FXV A;  5A80 A;  2E9Q A;  2PHX A;  2IXL A;  4D7Y A;  4J2B A;  4ARX A;  1UYX A;  2JKB A;  2WFF 1;  3AMN A;  2X05 A;  3VL8 A;  5JMO A;  1BCX A;  2PN5 A;  1I6X A;  4QQP A;  3LSD A;  4HPK A;  4Y20 B;  5FLI A;  2K0G A;  4IQP A;  3MFC A;  5FOB B;  3WW2 A;  1OOP A;  4M0H A;  4OMD A;  2D93 A;  3VBF C;  4XF9 A;  4GB3 2;  1PZ7 A;  5JUV A;  1H8T C;  1NQD A;  4AAP A;  3W59 A;  1VBD 2;  4D94 A;  1OPO A;  4QQO A;  1DQ4 A;  1V6N A;  1RIT A;  2VTX A;  1BBT 3;  2Q0A A;  5FO8 B;  5CG9 A;  3NVC A;  5A3P A;  2GSY A;  1JYW A;  5EV7 A;  2JIC A;  3MGU A;  1G6N A;  5A6X A;  1GQG A;  1MQT A;  1SLT A;  4ISR A;  1QMJ A;  2ARX A;  2ZHL A;  2C1F A;  4EZ4 A;  2LAL A;  4GJZ A;  4Q4V 1;  4JDN A;  5A1F A;  5FRA A;  5GM0 A;  4E8D A;  3OBA A;  4LQR A;  4XJ8 A;  5BY5 A;  2QZ2 A;  1AXZ A;  2MZW B;  1XNK A;  1CX4 A;  2QJV A;  2PHL A;  2BU9 A;  4OVE A;  4QHZ A;  4ES8 A;  2BOI A;  2KM2 A;  1DZT A;  1HV1 A;  1MZ5 A;  2WS9 1;  2LRO A;  3OUI A;  4Q1P A;  3OUH A;  1YRZ A;  1ZZC A;  4NWV A;  3H9A A;  3VKL A;  4R52 A;  5JXH A;  5L9R A;  3C6N B;  5EQU A;  3OBZ A;  3SHR A;  3ACG A;  2H0B A;  2HWD 3;  3GBG A;  4FOQ A;  1V6M A;  5KBF A;  1S0C A;  3RJR A;  4BM8 A;  1W28 A;  3RSJ A;  2QXF A;  4ADN A;  1YFW A;  2HWB 1;  1W0N A;  3ACH A;  4NUB A;  4BQW A;  1RUD 1;  2B4K A;  3ZFE B;  1B35 C;  3D5O A;  1Q8V A;  5K8S A;  4HKW A;  5CFC A;  2H6B A;  5BNO C;  2XQX A;  2R1D A;  3BB6 A;  5HCH A;  4XC9 A;  2BGO A;  2VMI A;  1GV9 A;  5D1I A;  1KJL A;  4R4Z A;  1OQE A;  2O8O A;  3KGL A;  2ZZQ A;  4LBN A;  2Y33 A;  2JPN A;  1DLL A;  2EIE A;  2GMM A;  4UOJ A;  4AVC A;  2PAK A;  3DPR C;  4X6R B;  1W6Q B;  1RUE 3;  1MS1 A;  1RUJ 3;  3QEV A;  4IV3 A;  1JOB A;  1PX3 A;  3DGT A;  5DAX A;  3TN9 1;  3VDA A;  4COU A;  4XHB A;  1AR9 3;  4XUR A;  3VHR A;  1OKQ A;  2FD8 A;  3VDD B;  1L7R A;  1MS8 A;  5FQ0 A;  1NXM A;  1RGS A;  2A3Y A;  5FJH A;  5FPV A;  2XHK A;  4C8D A;  1H30 A;  2ZA9 A;  1GBG A;  3THD A;  3ZFE A;  4KHY A;  4Q29 A;  1FMD 1;  1JZ3 A;  3SJJ A;  4AG4 A;  5IAT A;  1BBT 2;  1IG3 A;  1S2E A;  2EXH A;  3DF0 A;  4MVT A;  1H9P A;  2B46 X;  3KV4 A;  5FO9 B;  5DQ0 A;  3MZH A;  1RIR A;  1JTZ X;  5FPA A;  3OUJ A;  3VN4 A;  5JIU A;  3BVC A;  1X9T A;  4DTN A;  1PGW 2;  4K21 A;  5CIR A;  4NRM A;  3NAP A;  5CFD C;  2AAC A;  3M4F A;  5IVF A;  1RUI 2;  3OJB A;  1YC6 1;  2JHP A;  2B1E A;  3QOP A;  2BV4 A;  2DTY A;  4QKN A;  5L9B A;  4URA A;  3ON7 A;  2H0V A;  2CAV A;  5C71 A;  3HEI A;  2HWF 1;  2DEB A;  2ZJC A;  4XHX A;  1NCQ C;  4XYX A;  5ERL A;  1ST8 A;  1Y43 B;  2V5D A;  3HT2 A;  1J3Q A;  5FTT C;  4EYW A;  2VR4 A;  2LF3 A;  2VCA A;  4M3C E;  4DU1 A;  2DCJ A;  5IVY A;  1XNA A;  1UY3 A;  1XE8 A;  4FJ7 A;  1OLM E;  3T4H B;  1NEX B;  4QX1 A;  5BNQ A;  3C6O B;  1W8T A;  4AI0 A;  2HWD 2;  4B1M A;  1DGW A;  1D4M 1;  2RJ2 A;  4OUE A;  3J26 N;  4YW3 A;  5FYU A;  2R04 3;  4OMC A;  4CEY B;  2ERF A;  1Y9M A;  3HGK E;  1CIY A;  3IDC B;  1Q9Y A;  4OUL A;  4CCO A;  1HRI 2;  1WAF A;  1RUH 3;  4CP1 A;  1FYZ E;  1K5J A;  2ZMK A;  1N1T A;  5BPX A;  3WV6 A;  1WLW A;  4DEV A;  1PM7 A;  1H4H A;  1QDC A;  2BBV A;  1XVD E;  1OLQ A;  3MV1 1;  4MV2 A;  4CDW B;  5LBF A;  4RHV 3;  4UW3 A;  5JXI A;  5LZ6 A;  4QX5 A;  1SBE A;  4Z2W A;  2JG9 B;  3AJZ A;  4TTG A;  3CJI A;  4NIH A;  1HRV 1;  1RUE 2;  5ABJ A;  5A3O A;  1SFP A;  4MGI E;  4XZU G;  3WG3 A;  5C5U A;  1E57 A;  1OXC A;  1O4T A;  1YI7 A;  1UXX X;  5LA0 A;  3C95 A;  3HN1 A;  3ZSJ A;  3OBT A;  3SUP A;  1C8M 3;  1PZ9 A;  2XHN A;  5LAT A;  4YW6 A;  3GYD A;  4XEZ A;  2GAL A;  4XJW A;  4Y1Y A;  4RD7 A;  1LHU A;  2ZGT A;  4L92 A;  3E6B A;  3J2P A;  3DKW A;  1PK6 C;  2NM1 A;  3SCX A;  2RS5 1;  4Z07 A;  1ULE A;  3W20 A;  1YQ8 A;  1C3H A;  4QM8 A;  1PMJ X;  3BI3 A;  4CDW A;  2TBV A;  4MZU A;  3WUC A;  5J3U A;  3QNO A;  5C70 A;  4Y5Z 0;  3MF9 A;  3GZT B;  2W47 A;  4B7K A;  1Y3T A;  3RZZ A;  5K7P A;  3Q8A A;  3UKT A;  3VKO A;  1QJY 3;  2WQ8 A;  4PDW A;  4XQD A;  1JBC A;  1SDW A;  1WCS A;  3KT7 A;  3B7M A;  2DBI A;  4LBL A;  4IEX A;  4NO4 A;  1K3I A;  3JZV A;  4BA6 A;  4M3R A;  4QNC A;  5HV4 A;  3LZZ A;  2H4T A;  1A3K A;  1VIW B;  2O14 A;  2EIB A;  2OA2 A;  2XON A;  3C3V A;  3P6B A;  4B4R A;  4LIV A;  1JU4 A;  3ROU A;  4D6Q A;  5LY1 A;  1YNA A;  4AR2 A;  1PO2 3;  5A1L A;  3MDP A;  1DZR A;  1ND3 A;  4W65 A;  4XUN A;  1RUC 2;  1GKB A;  5D21 A;  2BVV A;  3HL8 A;  1V00 A;  1RTV A;  3VBR A;  2R04 2;  3LZJ A;  2XG3 A;  3AKQ A;  5L36 A;  4QT6 A;  4FJ8 A;  2D44 A;  4XUT A;  1F15 A;  4PI0 A;  3WNM A;  2MNG A;  3M7A A;  2VOW A;  2OS2 A;  1W6P A;  3CBN A;  3NNM A;  4QKF A;  3U75 A;  5I91 A;  1RIN A;  2R1B A;  2UYB A;  3ZSE A;  4AED B;  3PIG A;  4DZG A;  4HVQ A;  4QDQ A;  5D2A A;  2FDG A;  4RHV 2;  1RXG A;  3HWJ A;  4TLG A;  4AK3 A;  3FL7 A;  2XLF A;  2YXS A;  4OI2 A;  5EZW A;  5DUV A;  4XJU A;  2E26 A;  3I3E A;  3MLJ A;  2C6S A;  1KS4 A;  1C8M 2;  4JVA A;  1R09 1;  3ES1 A;  4DXZ A;  4XFB A;  1K5M B;  5A70 A;  2BFU S;  3MUY 1;  3RQ0 A;  5B4X A;  2IXK A;  3A21 A;  2DUQ A;  3NMB A;  1LOB A;  1JZ6 A;  4M3X A;  1EV1 1;  5FYZ A;  1C57 A;  1OA4 A;  2LW8 A;  4GB3 1;  3D82 A;  1TNF A;  1OH3 A;  3DYO A;  1KFU L;  1Y9Q A;  3N9N A;  1AYM 2;  4XFH A;  4CCC A;  4Q8K A;  3SH5 A;  3DEM A;  3ZXF A;  2PHT A;  5JR7 B;  5A7O A;  4XPV A;  4FPJ A;  4H55 A;  5HXV A;  2JG8 A;  2EAK A;  3SNM A;  4Y5S A;  4BQ5 A;  1QJY 2;  2FDK A;  1HW5 A;  4JTO A;  4LOR A;  2CNA A;  1CVN A;  1C4R A;  1NKG A;  1UF2 C;  1POV 1;  2OQ7 A;  3NJZ A;  1FNZ A;  1GZW B;  3ZYR A;  2ZGR A;  2W87 A;  5AVP A;  5J1X A;  1YFU A;  1AF9 A;  5FZE A;  5JZG A;  4HT1 T;  4RA0 A;  3WNP A;  5C9A B;  4DUX A;  1CGP A;  4Q0S A;  4YSF A;  1ULC A;  1PO2 2;  1LED A;  5H9R A;  2HEY F;  2ZHN A;  3KQR A;  3RZL A;  3VD3 A;  4BPZ A;  5F9T A;  2YG0 A;  5LBE A;  4A41 A;  2VW2 A;  3ACL A;  3GF6 A;  4R8H A;  3SCH A;  2ID4 A;  2P2K A;  3LB9 A;  5FMD A;  1SPP B;  2JDU A;  2R30 A;  1YHF A;  2I07 B;  1SFN A;  2YHJ A;  4I0A A;  3RZH A;  2W3J A;  2HEW F;  1QOS A;  4RN5 A;  2VZP A;  3MIF A;  4JRA A;  4N9I A;  3Q8E A;  4F3J A;  4ZU5 A;  5IK8 A;  1LOF C;  3WF0 A;  4ZXK A;  2QQN A;  2OZS A;  4FP2 A;  2WBK A;  3M3I A;  2RCU A;  3R4U A;  3I3B A;  4N7U A;  1ULF A;  3IDA A;  1H2N A;  3CNA A;  3POI A;  4HON A;  4JKL A;  2QQL A;  1D0H A;  1POV 0;  2HYX A;  3WG1 A;  1AUY A;  1TNR A;  3AZV A;  2P3J A;  3LA3 A;  2ZGS A;  4P9G A;  2JEN A;  1AR7 3;  5FY7 A;  2Z5W A;  1JYN A;  4HK9 A;  1XMG E;  4RQP B;  4RR3 B;  5FK7 A;  1IHM A;  3CO2 A;  5IUQ A;  4AGV A;  5C4W C;  2JHC A;  5IK4 A;  1POQ A;  4G4F A;  4JGZ B;  1RVF 3;  4EN7 B;  2WT0 A;  1SLA A;  2PTM A;  4KH9 A;  4AZZ A;  5C3Q A;  3OGR A;  1GSL A;  3ILN A;  4BOW A;  5A3T A;  1WMF A;  4XFI A;  2JH8 A;  3LD8 A;  3I2K A;  4XJA A;  3DYM A;  3WNO A;  3NV2 A;  2XJS A;  2EXJ A;  3ZXJ A;  2ZML A;  1BBT 1;  4QPI B;  5B2G B;  3LOB A;  3E97 A;  1V6L A;  1WWY A;  4B08 A;  2ES3 A;  2YGM A;  1JYI A;  1G9B A;  4Y1X A;  1QF3 A;  5DXD A;  5CBL A;  1BK1 A;  3NJY A;  4XUQ A;  4GH4 C;  4QKB A;  4AYU A;  1PGW 1;  4DO0 A;  1N3O A;  1VBB 3;  2VD7 A;  3L9J T;  4H7L A;  4RR3 A;  3WLU A;  3IPV B;  2ORZ A;  4YVW A;  3G7D A;  2GN3 A;  3VGI A;  2WO3 A;  1W8O A;  4IE5 A;  3NCI A;  3N7K A;  1C5I A;  3C7F A;  2HBT A;  1AL2 1;  1A8D A;  1RJ7 A;  4K20 A;  1F2N A;  2W2I A;  2IZW A;  3LKJ A;  1XL3 C;  1ZBE 3;  3OYW B;  3SQ2 A;  5IK7 A;  1CN1 A;  3KV5 A;  3AX4 A;  2EF6 A;  1AJK A;  1KDM A;  4R9A A;  5GLT A;  4LOS A;  3I54 A;  2P5B A;  5JXG A;  2HWD 1;  3WSO A;  5K4L A;  4L8Q A;  3IN9 A;  3CHX A;  1NCR A;  4TWT A;  3HT1 A;  5J48 A;  3N4M A;  5FZA A;  3I49 A;  1R1Z A;  2GAU A;  5FKC A;  2VMC A;  3RYK A;  4JRP A;  2H6C A;  5T54 A;  1CJD A;  1FZ2 E;  3M70 A;  4LR4 A;  2RDR A;  1UZ0 A;  4V2V A;  5A6Q A;  2QQV A;  1JZ8 A;  4MHU A;  3OPT A;  4MOA A;  4UXA A;  5D8A A;  1T2X A;  2A1X A;  2RDS A;  2YU2 A;  4MO3 M;  3CQO A;  1RUE 1;  1S4C A;  1RUJ 1;  2Y6L A;  2QE3 A;  2WN3 A;  1RVF 2;  4WVZ A;  1AR9 1;  5IAV A;  4F7Z A;  2R07 2;  2VQU A;  3ACI A;  1CWP A;  2QZ3 A;  3SI6 A;  1CZV A;  1MS0 A;  4BH9 A;  3S57 A;  5LBC A;  5A7P A;  3VBO B;  3PU8 A;  5C8W A;  3H3U A;  4Q4V 3;  3HNY M;  1LOD A;  3M3C A;  1LJ7 A;  1O3S A;  2FZ1 A;  4CTE A;  5FOJ B;  3AMQ A;  3DXT A;  3A0N A;  4LBQ A;  3RMA A;  4IE6 A;  1Q3E A;  4ERO A;  3JCI A;  2XQR A;  5K0U B;  2PHR A;  2BP6 A;  2XLA A;  1EAH 2;  5FYV A;  4ET7 A;  2QDR A;  1HB3 A;  3N3H A;  2E32 A;  5CKN A;  2WYF A;  4J6G A;  4ZZ5 A;  4QPW A;  2XLG A;  4TYS A;  1YCI A;  3KGZ A;  2A73 B;  4MXW B;  1GNY A;  3ZXD A;  2DVF A;  5CEH A;  2WAA A;  1SLC A;  1QOT A;  1HB4 A;  2WWS A;  4I3P A;  4XET A;  1W03 A;  3LPG A;  2D98 A;  1VPH A;  2PHW A;  3J9S A;  4BXS V;  3POF A;  3RGB A;  4ATF A;  4AVT A;  5AFB A;  3NV1 A;  3Q8C A;  2A7A A;  5GAL A;  2R06 1;  4HN1 A;  2MEV 3;  3ZOI A;  4GWJ A;  1AJO A;  2LF6 A;  1VMH A;  1ND2 B;  2Y6F A;  3F2Z A;  3SPY A;  2JJ6 A;  3I4I A;  4URT A;  4FPO B;  2VZS A;  4Y3O A;  3UGF A;  2D6K A;  3RDI A;  2R04 1;  2WFF 2;  3OGG A;  3S5Q A;  1NOV A;  1OD5 A;  5LY2 A;  2D3S A;  5E89 A;  1RUH 1;  3D8C A;  1NAE A;  2JIG A;  2BPA 2;  1A8M A;  3Q9O A;  1OFN A;  4Z8B A;  4JDO A;  5C3S A;  5FMB A;  3W9A A;  3ZFG A;  1UWW A;  1XYO A;  5FXW A;  2HD0 A;  1CJP A;  2WNU B;  4QPG B;  4RHV 1;  2DVD A;  3C6P B;  3PVB B;  4E27 A;  1NUK A;  2EIG A;  4EZH A;  5T5O A;  1J3R A;  1DHK B;  4Q0Q A;  4Q5O A;  1GOF A;  2ZHM A;  2YC4 A;  2F6B A;  3H7J A;  1EP0 A;  3FE5 A;  3O12 A;  1YEW A;  1LGB A;  1O8S A;  4JKM A;  5DZG A;  4YW5 A;  4PHZ A;  1ND2 A;  1UOF A;  1UKG A;  3CMG A;  4NAM A;  4CDX B;  1OUX A;  1TQ5 A;  3ZX7 A;  4XIO A;  2BUK A;  2FBE A;  2Z4F A;  1YJK A;  3DYP A;  1B09 A;  3NRU A;  4NRP A;  3K51 A;  4P9I A;  4Q4V 2;  3LA2 A;  4ISQ A;  1QKQ A;  3VDC A;  2P1M B;  3NHG A;  2Y6H A;  2VNV A;  3NW4 A;  3GJA A;  4QQ2 A;  2B8M A;  1FZ5 E;  2OT7 A;  5DMY A;  1OMI A;  1FPN 3;  1UO9 A;  5DAW A;  1G86 A;  3T08 A;  5FY1 A;  2GZW A;  4P9Y A;  5A32 B;  2WNU A;  4LJH A;  1R1A 3;  1N1V A;  2WS9 2;  2XKP A;  2ZX1 A;  1MHZ G;  4WM8 B;  2Q5T A;  2XXZ A;  3SMH A;  3SKV A;  1G9C A;  4AE2 A;  2QQI A;  2VVD A;  4XF0 A;  3OB8 A;  4ONU A;  4QQH A;  2ZTN A;  4K1Z A;  2HWB 2;  3IWZ A;  1M4W A;  2VPV A;  1RUD 2;  4XVH A;  3OGK B;  2ZKN A;  3U11 A;  3PUQ A;  3UL2 A;  3IDB B;  4NID A;  4DTS A;  1JYC A;  2JD9 A;  4XJZ A;  5EYX A;  3ZN6 A;  1SDD B;  1PO2 1;  2VEC A;  5L7O A;  2AYH A;  4AHW A;  1K12 A;  2DF7 A;  5FYH A;  1FT9 A;  4DS0 A;  1ZA4 A;  2QQW A;  3FHQ A;  1O3Q A;  3KD4 A;  5F6L B;  5BNN C;  3NNL A;  2IFW A;  3VBU C;  1F4H A;  4ARY A;  4UYB A;  3TN9 2;  1LOA A;  2PFT A;  3C94 A;  1H9W A;  1X8E A;  2B7Y A;  2JE7 A;  2I2S A;  3NJX A;  4N53 C;  3AP6 A;  3WW1 A;  3GM8 A;  2D5H A;  1GYK A;  2OUJ A;  2WL1 A;  3SEP A;  5A3M A;  4X5N A;  4EWD A;  4CEW B;  4NPL A;  2ZEY A;  3B5L B;  4JHT A;  1VBE 3;  1W8H A;  2WO1 A;  4N43 B;  5J36 A;  5JDB A;  1N3Q A;  3FBY A;  4ZU7 A;  1ZZ8 A;  4B7E A;  1FMD 2;  1SFY A;  1UU6 A;  3SQ1 A;  4QDR A;  1NE6 A;  2YV8 A;  4YVS A;  2PHD A;  3VZJ A;  2JDY A;  2VIX A;  3ENR A;  3BN6 A;  4LMF A;  5DUW A;  1S0F A;  2GC1 A;  5FZ8 A;  3ZFF B;  3UNP A;  3V0A B;  3V0B A;  4J2E A;  1UCX A;  1WZX A;  2VUJ A;  1XNT A;  1P22 A;  3RMC A;  4IE4 A;  4Y1Z A;  5IHR A;  4DTM A;  1L7Q A;  3V64 A;  5ANQ A;  3VBS B;  3WHT A;  1W04 A;  3ZO0 B;  4MG2 A;  4FSJ A;  2BWA A;  2O1Q A;  2X5I C;  1MZ6 A;  2DVA A;  5GKA C;  1FPN 2;  1IG0 A;  3QH7 A;  4BK5 A;  4BE3 A;  4CUA A;  1IGO A;  3IBM A;  3WXP A;  4LIT A;  1ULO A;  1XB9 A;  5IVE A;  4AFC A;  4DQA A;  1HN0 A;  1STM A;  3L2O B;  4I9Q A;  3LEI A;  2ENR A;  5LA1 A;  3ZR6 A;  4J2D A;  3POY A;  3J4U H;  3UJO A;  4L97 A;  2LM3 A;  3R05 A;  3POW A;  1W3X A;  2P1Q B;  1QNY A;  2WNV B;  4QWN A;  3UO2 A;  1CAV B;  1HJG A;  1OA3 A;  3AKR A;  1JW2 A;  1LHO A;  3WDV A;  5C8C A;  5A3N A;  3OOX A;  3K77 A;  4FQZ A;  4K40 A;  5JWP A;  3GHN A;  5A6Y A;  5IJR A;  3S30 A;  2V5Y A;  4HVO A;  4I09 A;  3KZ4 C;  5FY4 A;  3B9I A;  5FPX A;  1TME 3;  3DL3 A;  1YLL A;  2VNG A;  2TUN A;  5I8S A;  2RHP A;  3MEP A;  4XCB A;  1C8N A;  3THP A;  4AVV A;  5FYI A;  1K42 A;  5EP9 A;  3LDK A;  4XXP A;  1UU4 A;  1KXG A;  1F9K A;  2ZAH A;  2R0H A;  2WNV A;  1CAV A;  4AF9 A;  1QJZ A;  1R09 3;  4GWN A;  1JI6 A;  5FZG A;  2CYF A;  1VBE 2;  2J1S A;  4RGG A;  3SXW A;  1BEV 1;  5FZ6 A;  2VJX A;  3HGL A;  4N8M A;  4YW1 A;  3EHK A;  3T2P A;  3WVJ A;  2VH9 A;  3LZI A;  1XVB E;  2OUH A;  2RS5 2;  5JI7 A;  5FP4 A;  3QEW A;  2OQ6 A;  2WAB A;  2VGD A;  4QX7 A;  3VBH B;  4EPH A;  3NE6 A;  3EMR A;  2J22 A;  1AR7 1;  4P08 A;  1PGL 1;  1O4Z A;  4CDU B;  2WUH A;  2Q4S A;  1PO1 3;  2HLE A;  2VUL A;  2W46 A;  4P5H A;  2FYO A;  4A44 A;  1CIW A;  4Z92 B;  2ARC A;  3IAP A;  3WUD A;  1JOD A;  1RVF 1;  2C4X A;  2GP5 A;  2XL7 A;  4AQ6 A;  2E6V A;  1OQ1 A;  5J96 B;  1J58 A;  3K75 B;  2Z42 A;  1LRH A;  2W91 A;  4IEQ A;  1OI6 A;  4AAX A;  4AXO A;  5IVB A;  5GLW A;  1ZZ6 A;  4QQL A;  1HLC A;  1IS5 A;  2XH6 A;  4XAB A;  5KWR A;  1RJ8 A;  3AYA A;  5FZ1 A;  3OGJ A;  4RYD A;  1SG3 A;  1S0J A;  3I2D A;  1DYP A;  4KHN A;  1CES A;  4YGE A;  3PU3 A;  4XF1 A;  3E1F 1;  1S0E A;  3PUR A;  4JS5 A;  5I0U A;  4CDU A;  1VBB 1;  5EFU A;  4ZHN A;  2BNN A;  3AP5 A;  2NP0 A;  1D2S A;  5FLJ A;  1NA1 C;  1OFS A;  4DMI A;  4JGY C;  5FK8 A;  1JUH A;  1SLI A;  2UWA A;  3HBK A;  4W6Y A;  3UT0 A;  3ZPY A;  1I5Z A;  1LR5 A;  1Q56 A;  3AL5 A;  1AZD A;  1TME 2;  4RFT 0;  3ZXE A;  3SUO A;  4NRO A;  3B01 A;  2XJT A;  4UFI A;  1IS3 A;  4CCM A;  2WA4 A;  2OII A;  2OXB A;  1ZBE 1;  3SKJ E;  4WM7 A;  4AVB A;  4IV1 C;  4PQ9 A;  3KHB A;  4XBN A;  3RMB A;  1XXN A;  1JU3 A;  1ZRI A;  2E7Q A;  2EAA A;  4KGG A;  1BMV 2;  2XWB B;  4K6B A;  2GNM A;  4HKO A;  2XVL A;  4BMB A;  4NWW A;  2RR1 1;  1R09 2;  1W2T A;  4COV A;  3T2Q A;  1O7F A;  3POB A;  3AP4 A;  1EV1 2;  1O91 A;  4Y1U A;  4HSJ A;  4COZ A;  1HX6 A;  3B94 A;  4CZS A;  5FIX A;  1XBF A;  3IAQ A;  2Z79 A;  1E5S A;  4PBP A;  2VQT A;  1TMF 3;  3S7I A;  4DU3 A;  2IWG B;  5EJ3 A;  1ENQ A;  1PO1 2;  2RJK A;  5HV0 A;  5M0T A;  1ULG A;  1DG6 A;  2ZX0 A;  2AZ5 A;  4M3U A;  3AVS A;  3KS7 A;  2C0Z A;  4NHY A;  4DNY A;  4J1W A;  4FTS A;  4AFA A;  1UPI A;  1WW7 A;  4QGL A;  2W39 A;  1B35 B;  1UX7 A;  2JXA A;  3C7E A;  2JE9 A;  2XUE A;  5BNO B;  4Y20 A;  3ZXL A;  5LEK A;  4M0N A;  4AEJ A;  2BOJ A;  4C90 A;  1OOP C;  4E4S A;  3RJ2 X;  1X8M A;  1U5I A;  4UF0 B;  5SV5 A;  2VW0 A;  3AFG A;  4WV8 A;  1KJR A;  3D0S A;  2ZX3 A;  1AL2 3;  3RZM A;  1ZRR A;  1XU5 E;  3PJY A;  3DPR B;  3CF6 E;  1RL3 A;  4LA2 A;  3AL6 A;  2N7G A;  3CEW A;  5FZF A;  4XJ9 A;  5SV8 A;  3T0B A;  4FFG A;  2JQT A;  3VD4 A;  3E4Y A;  1W2A X;  1MQT C;  2G4I A;  1IOA A;  3FMG A;  3U4X A;  5DDJ 3;  3KF5 A;  1DQ0 A;  4K3U A;  1LHN A;  5BNP C;  2W52 A;  3FZ3 A;  4UT5 A;  4LO7 A;  3USU B;  3TAY A;  5KXC A;  2FDI A;  3SQO A;  1W99 A;  1IZ3 A;  2D6O X;  3AXD A;  5FPL A;  2BNO A;  5JVV A;  1XVF E;  3MO4 A;  3NL1 A;  1JZ5 A;  2RKH A;  2XL9 A;  4FVV A;  1OKO A;  3L1N A;  2EAL A;  2HKX A;  2MEV 1;  1XVE E;  2A6Z A;  2HH9 A;  2X53 S;  4D6R A;  1X7N A;  4JAA A;  4RL7 A;  2VCB A;  1AR6 3;  3OPW A;  5JOZ A;  5I0R A;  3DPR A;  4P00 B;  5I0T A;  3QEP A;  1EUT A;  5CFD B;  2LS6 A;  3H7Y A;  4YLZ A;  5GZD A;  2DUP A;  4FCA A;  1W2N A;  1FI2 A;  2A6W A;  1TG7 A;  2ZAC A;  3E6D A;  1XE7 A;  5JIA A;  2IXC A;  4PIY A;  3R0R A;  1AVB A;  2CGO A;  3WP3 A;  1W8W A;  2ZXQ A;  3UES A;  3H42 B;  4OYU A;  4IDZ A;  2B7M A;  4CU9 A;  5A3U A;  1FOD 1;  5CFC C;  2P1P B;  1UOG A;  1V6J A;  3B69 A;  1V9U 3;  1TMF 2;  3ECQ A;  2UY8 A;  4YFW A;  1DBN A;  1Y9G A;  2ADE A;  4FOY A;  1RYY A;  2IFR A;  1EUU A;  5FZO B;  1XMF E;  3FFZ A;  4OHV A;  4EN8 B;  4IV3 C;  1W6Q A;  3WDU A;  1S0D A;  2QUO A;  1UIK A;  3KV9 A;  2E33 A;  2B9U A;  2CY6 A;  1KEX A;  4FVM A;  4HAN A;  5CA6 A;  3K4A A;  3VDD A;  1LGN A;  1ULD A;  3O14 A;  4UFL A;  5KXB A;  1FPN 1;  2B9V A;  4NII A;  2VME A;  1CAU B;  1ZBA 3;  5F39 A;  4CXY A;  2QQP A;  2G9Z A;  1VMJ A;  3THC A;  1AL2 2;  3ZFE C;  1R1A 1;  3J7N A;  1GWK A;  1PNG A;  1REF A;  3DN7 A;  1GIC A;  2HJI A;  2WZE A;  4YM2 A;  2OYZ A;  1YJL A;  4W8J A;  3ZYJ B;  1PVC 3;  3TAF A;  4RNG A;  4AKG A;  2R06 3;  4GAZ A;  2FDF A;  1Q43 A;  1G7Y A;  3WHU A;  1NLS A;  5F1R A;  4QD2 A;  1OUS A;  5FZO A;  1A78 A;  3WCS A;  2UWC A;  3FHA A;  4BU2 A;  5FP3 A;  5ACA 1;  2ZZJ A;  4NHK A;  3NAP C;  2A5Z A;  3HAG A;  1GU3 A;  1BYH A;  1YYN A;  1FAY A;  4EN9 B;  5FPB A;  1W9T A;  4KU8 A;  2RS1 3;  2CWS A;  3QLQ A;  2CDP A;  4J1X A;  1PK6 B;  1YQ6 A;  2BTV C;  3VHN A;  2DCZ A;  2MPF A;  2R16 A;  4FPL A;  2ET7 A;  3MPB A;  3WY6 A;  4CUB A;  5HI0 A;  3M3E A;  4IT5 A;  2WLQ A;  5CAZ A;  5I8Y A;  3NGI A;  4LHS A;  1OA2 A;  2PLV 3;  3BPZ A;  2X10 A;  2RV9 A;  4NAO A;  3KD5 E;  4EP9 A;  1HQN A;  3AYD A;  3N9M A;  5L19 A;  1RUJ 2;  4QX3 A;  2D6M A;  5IVV A;  1N47 A;  1R08 3;  1AYN 1;  3WNL A;  1X36 A;  1AR9 2;  3KSC A;  4HLT A;  4WVV A;  3BPS A;  3ZN6 B;  5C3R A;  1OF4 A;  1WA6 X;  2GNT A;  3GBF A;  4CE8 A;  3MID A;  4CRQ A;  1KRI A;  5A6Z A;  1LEC A;  2HEV F;  5LA2 A;  2WO7 A;  4CEY A;  5L9V A;  5LAS A;  2JDN A;  1VBE 1;  1BLZ A;  2ZEZ A;  3RNS A;  4QKD A;  4YFZ A;  2XR4 A;  5GZF A;  1V9U 2;  5T5L A;  1DF0 A;  3OD0 A;  2WWJ A;  2JD4 A;  5GZG A;  2W0X A;  5DUU A;  1JOP A;  5J7M A;  3NDK A;  1WD4 A;  2V4A A;  5LRS A;  4IE7 A;  4YM3 A;  4OQ8 A;  5F2S A;  1NX9 A;  4RG8 A;  5IVC A;  3BOW A;  3KT1 A;  4HG6 B;  2D5F A;  3CJI C;  2JG9 A;  5ABJ C;  2W95 A;  3O0W A;  3KVB A;  1W6M B;  3O1V A;  1CD3 G;  1VAL A;  2DU1 A;  3EJK A;  3OEA A;  4KI4 A;  2ZCW A;  4LUK A;  1FZ9 E;  3MBW A;  4LKD A;  2VZV A;  1ZBA 2;  1WKY A;  1N3P A;  4H3W A;  4I3G A;  3OTF A;  3D4K A;  4BQ1 A;  5AC9 3;  5JI9 A;  1ASJ 3;  2YPD A;  5LK7 B;  4UW5 A;  2VZ3 A;  1VRH 3;  1XSQ A;  1SBF A;  5I0D A;  3ITQ A;  2JEM A;  1UYY A;  5FZK A;  5BXX A;  3EXU A;  4JQR A;  1T6G C;  3POE A;  2R06 2;  3WG4 A;  4LHK A;  3I2O A;  2BFU L;  3AP9 A;  2XVG A;  4E4H A;  4N7I A;  3MLL A;  5HCB A;  2R32 A;  5EWS A;  1UAI A;  1RMU 3;  2HWE 3;  3GAL A;  4QPY A;  3RPQ A;  4AI3 A;  4O61 A;  4UBH A;  1RUH 2;  5A33 B;  1W2O A;  1W6M A;  4PDW C;  3RZJ A;  2VQ0 A;  2VMF A;  4KGQ A;  3HJR A;  4D3W A;  1IQA A;  1ZZ9 A;  2GC0 A;  2ZEW A;  1D0G A;  1TME 1;  2VUD A;  4CPB A;  1ZRE A;  4FPK A;  1UMZ A;  4QMA A;  2J1V A;  2RDQ A;  3SLI A;  2BQP A;  1ND3 C;  4LE3 A;  4Y4Y A;  1QXJ A;  2W68 A;  4W50 A;  3OGL B;  1R08 2;  3JUU A;  4O65 A;  4SLI A;  1GZT A;  4XQW A;  2VTF A;  3AMH A;  1VB2 A;  1BMV 1;  4Y22 B;  3VBR C;  2CV6 A;  2XBO 3;  2XDV A;  3QH6 A;  1JYV A;  5T52 A;  3RZG A;  3N7L A;  2DY4 A;  4IET A;  4YZ3 A;  4CU7 A;  5E6H A;  2CAU A;  4EN0 A;  1IQD C;  3TAB A;  4U36 A;  3BUC A;  3QD6 A;  4QB2 A;  4LXL A;  1GUI A;  1ZRC A;  4AED A;  4YM0 A;  1UW8 A;  1VBA 1;  2J1T A;  2UUR A;  3OBR A;  5CYY A;  2C5D A;  2G9G A;  4XAC A;  3SH4 A;  4YM1 A;  5IVJ A;  2V4V A;  4JZR A;  5F3E A;  1PO1 1;  1XE0 A;  3TEW A;  4COW A;  4J25 A;  4AI2 A;  5IYY A;  3AXE A;  3KB5 A;  4KHQ A;  5K9Y A;  4LBQ D;  1FZ6 E;  1QEX A;  4FFI A;  1C1L A;  2Y6K A;  4S2G A;  2YY1 A;  1GZC A;  1DFQ A;  1JMU B;  1K5M A;  3ZIW A;  5FWJ A;  4OZO A;  1VRH 2;  4FJG A;  1YXW A;  2VZR A;  4MET A;  3H0O A;  5H9S A;  2IXH A;  5T5P A;  2YB7 A;  5J37 A;  4FK4 A;  2DUO A;  1SCS A;  3LSE A;  3WNK A;  4V2W A;  1W9F A;  2P34 A;  5CU1 A;  3LE0 A;  5C4W B;  3WDT A;  2DWR A;  1BVP 1;  1YQ2 A;  3K48 A;  3CZJ A;  4AFB A;  1W0P A;  2AEN A;  3RWU A;  2JG8 C;  1DQ5 A;  3W21 A;  1Z0H A;  3KQ4 B;  4OUM A;  1Z78 A;  4KWK A;  4QGN A;  5DPN A;  3VV1 A;  4B29 A;  1WW5 A;  1MZE A;  5FY0 A;  3UO3 A;  4L9B A;  2UU8 A;  2XPJ A;  4MUV A;  2YMZ A;  4RS5 B;  1FZ1 E;  1GZW A;  1ACC A;  1ZX5 A;  5H9Q A;  4D0Q A;  1VLN A;  5JZG C;  4Q26 A;  1BVV A;  4ICG C;  1BEV 3;  3AZX A;  2VBD A;  5C9A A;  1DQ2 A;  1G9F A;  4HVR A;  1ODN A;  3TNQ A;  3KM5 A;  2E31 A;  5KHH A;  1F8V A;  2J7M A;  2NLR A;  1CR7 A;  5FXZ A;  1VBC 3;  1H6Y A;  4GH4 B;  1CQ9 A;  2W1W A;  3LA7 A;  3HN3 A;  2E7T A;  1RXF A;  2F17 A;  1RUF 3;  4L11 A;  1SPP A;  3VKN A;  4JS4 A;  5FZH A;  2EA7 A;  2YDE A;  2YRO A;  3K4Z A;  2VG9 A;  2VW1 A;  4NRQ A;  4RS5 A;  1DYO A;  5FZ9 A;  2ADD A;  4DEQ A;  3K2O A;  1AX0 A;  2WZR 1;  4Q4Y 3;  3QEX A;  2Q8O A;  3USS A;  5GZE A;  1TMF 1;  1YFY A;  2WLP A;  1W2U A;  2A6Y A;  1HV0 A;  2DU0 A;  1JH5 A;  4DUV A;  1LOE A;  2XJU A;  1JW6 A;  4LBJ A;  4M3C B;  5A7W B;  4QDS A;  2AEY A;  1LHV A;  1WCQ A;  5F5I A;  3R4D B;  4FT8 A;  3AVR A;  4GQ7 A;  4RQP A;  4AI6 A;  1C28 A;  2Z69 A;  3DEC A;  4C1X A;  3PUA A;  5A3L A;  5FKB A;  5FR3 A;  4JGZ A;  1BXH A;  4LE4 A;  1OPM A;  1ONA A;  5KHI A;  1UY2 A;  4M45 A;  1LTE A;  4O9G A;  4X8N A;  4Q8L A;  5CZK A;  4RGA A;  4LO8 A;  2OVP B;  4IGO A;  5FP7 A;  2MW2 A;  3ES4 A;  3QCW A;  2ARB A;  3JQX A;  2ZEX A;  3WW4 A;  3MLK A;  3NWK A;  1NQJ A;  3MHZ A;  4QPI A;  3WG2 A;  4J2A A;  2IXI A;  3LFM A;  4C0H A;  1H4G A;  5CNA A;  1PZ8 A;  1W6O B;  1COV 3;  4QX8 A;  4M3C A;  4IE0 A;  4X6Q B;  5DDJ 1;  4XMI A;  5LWB A;  2RR1 3;  1JZ2 A;  5IZ7 A;  4JDM A;  3IPV A;  4DTO A;  1BEV 2;  4YVW C;  2VUC A;  1CLQ A;  3SUQ A;  3MW4 A;  3H8X A;  4AVA A;  2VVF A;  3BTY A;  1VBC 2;  4M42 A;  1PGL 2;  5FPU A;  4PF1 A;  5FZ3 A;  1AR7 2;  1N1C A;  1AR6 1;  1WCD J;  4Z2A A;  3WF2 A;  5BYN A;  3OYW A;  4QU2 A;  3R6S A;  5JSP A;  3NV4 A;  3LDS A;  1VRB A;  1LHW A;  5IW0 A;  2DCK A;  2JDK A;  1WMX A;  3KCY A;  3RRD A;  2VO5 A;  3LF7 A;  1NCR C;  2QQK A;  3CLP A;  5LCW L;  1S0I A;  2WKK A;  5DAP A;  3PL0 A;  4OHW A;  5EJ1 B;  2AGS A;  1MVE A;  5A7N A;  3KVA A;  4Q4Y 2;  3ATG A;  2GMP A;  1XPW A;  3LDB A;  2G1M A;  1NLR A;  1V9U 1;  2Y34 A;  2DTW A;  3OCP A;  4Q0V A;  2PXJ A;  1QJX 3;  4QM9 A;  5HPO A;  3ZIX A;  3E4W A;  1CPN A;  1W06 A;  2W9X A;  2VBP A;  2UY9 A;  1QH6 A;  1GR3 A;  1M06 G;  5F5Q A;  5B4N A;  3TWI A;  4U2A A;  4NPR A;  5D8A C;  2PQQ A;  3WNX A;  2BWC A;  4IXL A;  3X29 B;  1VBB 2;  2W1U A;  2X8K A;  4LHL A;  4I30 A;  4MLO A;  2O0O A;  3HOB A;  4B3N A;  3S0M A;  2JE8 A;  3NV3 A;  3TAG A;  1S0G A;  4UW6 A;  1SLB A;  1UY4 A;  4AW7 A;  4IW3 A;  1L7L A;  3BTA A;  3JXS A;  1ZBA 1;  2HWC 3;  3BU7 A;  3RYR A;  3WEZ A;  3RWN A;  3VBO A;  3L0M A;  4FJ9 A;  2VXR A;  2D43 A;  4MYE A;  2XKO A;  1LCL A;  5E88 A;  5IBK B;  3BVO A;  1XJA A;  2WNE A;  3IKW A;  5F32 A;  2VUA A;  4P5Y A;  4AKI A;  1ZBE 2;  1PVC 1;  1XYN A;  2BGP A;  3HMY A;  3I97 A;  4LNV A;  2RVA A;  1X82 A;  3CU7 A;  1VP6 A;  4CUG A;  5IFT A;  1COV 2;  5K0U A;  4B4Q A;  3EBR A;  4BXF A;  2OKX A;  2Q1F A;  2QQM A;  2RR1 2;  4XXA A;  4D7S A;  2WFP A;  4JV4 A;  4A3Z A;  3HQX A;  4DPN A;  4YW4 A;  1YIF A;  3I2H A;  2RS1 1;  3B3Q E;  4MXW A;  4MGZ E;  3WF3 A;  1Z7S 1;  2RG4 A;  4HET A;  1FNY A;  4UAP A;  3ZSL A;  1DGR N;  1YFX A;  1FOD 3;  4XDP A;  2PLV 1;  1KGY A;  3PUI A;  3SCG A;  1XQN A;  2R6Q A;  3O1O A;  4LKS A;  4XE9 A;  1R08 1;  5KHJ A;  2Q1Z B;  5FZM A;  1G8W A;  2B42 B;  5DZF A;  3URF A;  4NOT A;  2EVX A;  4P9X A;  2VM9 A;  2Q1M A;  2OZ6 A;  5BV6 A;  2ZGN A;  3O5S A;  5F8P A;  4LTA A;  2IVI B;  1GQP A;  1REE A;  2QQO A;  2CTV A;  5FY9 A;  4DTU A;  3GCX A;  4XBL A;  3AM2 A;  2D6N A;  3GCW A;  1QJX 2;  3ZFG C;  4EWA A;  5FZB A;  3SC7 X;  4FJ5 A;  1JXN A;  3UK9 A;  4FPG A;  1H1I A;  1LNS A;  1XSR A;  5BNN B;  4QPG A;  3ZKU A;  1L3J A;  2JB8 A;  2OW4 A;  4H2A A;  4OZX A;  4YPJ A;  2PFW A;  3VBU B;  1KDK A;  2WQZ C;  3WX5 A;  4NIG A;  4M3Y A;  1LOG A;  1HQW A;  4N53 B;  4DFS A;  2RMU 3;  1RED A;  1W8U A;  3JBG 3;  3RMX A;  2QQJ A;  1LDK E;  4XMA A;  1UKR A;  4OLL A;  4M3T A;  1P8J A;  5FYM A;  4CDX A;  4DRV A;  1WUV A;  2OYQ A;  5GLV A;  4DU4 A;  2HWC 2;  3M3O A;  2QTW B;  4LHN A;  1GOG A;  4CDQ C;  2BER A;  5AC9 1;  1HJF A;  2FCV A;  1ASJ 1;  2FCT A;  2WQ4 A;  5C3O A;  2A70 A;  5FRE A;  1VRH 1;  5KR7 A;  2GH2 A;  4CU8 A;  4MXV A;  1NG0 A;  4ITC A;  4ZY9 A;  4HKL A;  2MEV 2;  2KXL A;  2WNU C;  4QND A;  2W1S A;  3J27 A;  5ANN A;  5A32 A;  1QNW A;  3UGG A;  2PFV A;  1KQR A;  1RMU 1;  3VBU A;  2HWE 1;  4WM8 A;  3LOI A;  4QXB A;  4OI1 A;  1NLQ A;  1AYN 3;  3FX3 A;  3NO8 A;  1NY7 1;  3O0V A;  1QJU 3;  2Y38 A;  4Q4W 1;  2X5I B;  2Y0O A;  1OQD A;  1QJF A;  3SNN A;  5GLU A;  5J98 B;  1RUO A;  1KS5 A;  5CIS A;  1YQC A;  3J7M A;  4AI1 A;  1APN A;  3MIH A;  1FOD 2;  5JXJ A;  1PIV 3;  1OF3 A;  2Y0I A;  3J8F 1;  3W5M A;  3O7O A;  3ZYG A;  1HXS 3;  1URX A;  2WN2 A;  3AMP A;  4JKK A;  5L7O C;  1LES A;  1J1L A;  1I1E A;  1WME A;  4XBQ A;  5F37 A;  2W92 A;  4LBO A;  1S55 A;  2NMN A;  2YBK A;  2ZGL A;  1O6U A;  4PIX A;  4B4P A;  1O5U A;  2Q8C A;  2HYK A;  2XBO 1;  1NZC A;  4ATE A;  4Y26 A;  2B45 X;  2EIC A;  2ZAB A;  2F4P A;  3CIH A;  3VD7 A;  3VD9 A;  3HNB M;  4HK8 A;  3O1S A;  3BYW A;  4E8C A;  2A75 A;  4UI9 L;  5DN2 A;  2WT1 A;  2ZPX A;  2UWB A;  3EQE A;  4PT6 A;  3VZK A;  1JHJ A;  4CEW A;  3C7G A;  3UGH A;  4N43 A;  1R1A 2;  1UMH A;  2K2S A;  4ZU4 A;  2WRA A;  2QVS B;  3R4S A;  1GP5 A;  2LTN A;  4PLM A;  1MS9 A;  5DAB A;  4YVS C;  3GZA A;  4XTM A;  4P9L A;  1H1A A;  4NN0 A;  5HBA A;  1DQ6 A;  4UFJ A;  2JDH A;  2K9Z A;  2JDA A;  2ZX4 A;  5JSR A;  1GMM A;  3FBM A;  1S1A A;  3NJV A;  3VLB B;  3ZFF A;  1LUL A;  4HOO A;  3RYP A;  3V0A A;  5ISL A;  2OZJ A;  4M41 A;  1MAC A;  2JEC A;  4HBN A;  5FMO S;  4B8E A;  4EQV A;  2XJV A;  5JLV A;  1OUR A;  3SH3 A;  4BYY A;  3J7H A;  1SLL A;  3Q8F A;  3VBS A;  1C5H A;  3KHC A;  5FYY A;  4KNC A;  2BBA A;  1QQP 3;  3BIW E;  4GWM A;  3U1X A;  1V0A A;  3LIH A;  1O5L A;  1W9W A;  2XJR A;  1X50 A;  1GP4 A;  4LUL A;  3VL9 A;  4AGR A;  5CB7 A;  4FOW A;  1SBD A;  3TJY A;  4ZZ8 A;  1Y7B A;  1VJ2 A;  3LEM A;  1OVS A;  4L99 A;  3BIE A;  3L2Y A;  3KT4 A;  3KV6 A;  1NYW A;  2VBB A;  2WDB A;  3LEK A;  1AYN 2;  5FXX A;  5I8T A;  2FW3 A;  3ZN5 A;  1W9Y A;  2AC1 A;  2VCC A;  2GN7 A;  2WIN B;  4FP3 A;  1XVG E;  1HN1 A;  4A45 A;  1FXX A;  4C91 A;  3NKT A;  4DTJ A;  5C8C C;  5IFP A;  4QAW A;  5FDB A;  1HDK A;  1GP6 A;  3I3Q A;  3K4D A;  4ZKT B;  5JOY A;  3PME A;  4LBK A;  2OZM A;  1UU5 A;  1HXS 2;  4ADO A;  1SMV A;  4AGG A;  4XDQ A;  5FV3 A;  2BRT A;  2X29 A;  1DGW X;  3PUS A;  1DZQ A;  3ZYB A;  1VBC 1;  1VBA 3;  3N7M A;  3KMH A;  4OQ9 A;  2K5S A;  4Q0P A;  4BQ2 A;  3ZXG A;  4UFM A;  2D6P A;  1RUF 1;  4YGC A;  4E9K A;  4EN6 B;  1NA1 B;  3RG0 A;  1SHW B;  4TXW A;  3A7Q A;  4JGY B;  4XF3 A;  3QET A;  4DTR A;  1MEC 3;  1NZI A;  3G6J B;  4I01 A;  3RWK X;  1LU2 A;  1PHM A;  3HR9 A;  5LB6 A;  3VZN A;  4WBB A;  4HZF A;  2KD7 A;  4Q4Y 1;  3ZSK A;  1N1S A;  1SQ4 A;  3SPZ A;  1ALY A;  2ETE A;  4MHR A;  2FQP A;  3LEG A;  3S7E A;  4IV1 B;  2PAM A;  2YZ4 A;  4A6S A;  5JOX A;  3ZMN A;  1EYB A;  4M00 A;  5CVR A;  3VBH A;  1RHI 1;  3PLQ A;  4PF5 A;  3E5Q A;  2DVG A;  1AR8 1;  4G3Y C;  2FCU A;  3HQR A;  3V56 A;  4D69 A;  2SLI A;  3WIN E;  2VE1 A;  3D0J A;  1UZV A;  3ABZ A;  5LK5 A;  3FUQ A;  4JGY A;  2RM2 3;  4NPM A;  5FBZ A;  4WVW A;  3VBF B;  3U14 A;  4M3C F;  1QQP 2;  4BIS A;  1GZ9 A;  1MTY G;  1H8T B;  2WR9 A;  3AFK A;  4M01 A;  4BME A;  1DGR A;  1CZS A;  3M3Q A;  4HMZ A;  1FYU A;  1ENX A;  1WAJ A;  1VAV A;  1GNH A;  2V73 A;  3AK0 A;  2O8Q A;  1GOH A;  5FZL A;  4BZ4 A;  1VR3 A;  3SVI A;  2W08 A;  1R64 A;  5CAD A;  2NQY A;  1TZO A;  2B5H A;  4GKY A;  4MGT A;  1COV 1;  5LRR A;  4EJR A;  1W8N A;  2GC2 A;  3PTY A;  4MH0 E;  4AI9 A;  4HPK B;  4PJY A;  1VMF A;  5H37 A;  5F2W A;  3ZM8 A;  1OOP B;  1V6K A;  4QXH A;  2A3W A;  2D3R A;  1T6B X;  4IEP A;  4BB3 A;  1KFX L;  1WLD A;  3VBF A;  1O4Y A;  2C24 A;  4ORF A;  1H8T A;  5J09 A;  2TNF A;  3POG A;  5KC6 A;  2JDM A;  4KBZ A;  4KWU A;  2VU9 A;  2WZR 3;  3JD7 1;  1VBA 2;  2Y64 A;  1NE4 A;  1UN1 A;  3UKN A;  4XFC A;  3WP6 A;  4CYD A;  4WM7 C;  2V72 A;  3LGR A;  2ATF A;  4FPH A;  4E2Q A;  2ATQ A;  1LU1 A;  1TEI A;  4GMP 3;  1MQT B;  2P1B A;  2JDP A;  3FWE A;  5JPM B;  2KA3 A;  1QXR A;  1ODM A;  4GKX A;  1MEC 2;  5BNP B;  3QEI A;  4D7T A;  4JCK A;  3WOG A;  1JYT A;  4JC1 A;  3U10 A;  3CFO A;  2KR2 A;  4MSV A;  4I2O A;  4M3Z A;  1DQ1 A;  4GAM C;  5E8A A;  4Q0U A;  5IK5 A;  1QJX 1;  3DXU A;  2I45 A;  5L73 A;  1K45 A;  1LGC A;  1UD1 A;  2WC2 A;  3TB0 A;  2PQS A;  3AZZ A;  5JR2 A;  4KL1 A;  5IRE A;  2G9F A;  3AKP A;  1J59 A;  4KG8 A;  2VOX A;  4X8P A;  4A2U A;  4ASK A;  3AB0 A;  3RZK A;  2OVQ B;  1YUD A;  2XB6 C;  3KWV A;  4QX0 A;  3O1T A;  2RM2 2;  3NQH A;  2AUY A;  2WAO A;  3H1M A;  4GZ9 A;  4FJM A;  5BNP A;  5APA A;  2HWC 1;  4LO4 B;  4HCC A;  1B35 A;  3PVN A;  1RUI 3;  5DZE A;  1W3V A;  4UWD A;  1CAX B;  5EYY A;  4R9C A;  5CFC B;  2YU1 A;  5BNO A;  1XC6 A;  2FMD A;  4A4A A;  1IKQ A;  4DY5 A;  4UF0 A;  3T0A A;  4XAA A;  3H8U A;  2GME A;  4FFH A;  1DP0 A;  3UV9 A;  3ZPO A;  1Q8S A;  2BEO A;  4LLF A;  2YB5 A;  5I0S A;  1LEN A;  1MVQ A;  3MIE A;  2CU5 A;  2NN8 A;  3MUZ 1;  4IV3 B;  3BCW A;  5CKM A;  4CP0 A;  2VY0 A;  4CPB D;  4LEJ A;  5LW9 A;  2ILM A;  2MHF A;  4LKE A;  1WCU A;  1HB2 A;  2JKX A;  4P14 A;  4PCR A;  4CCL A;  5FQ0 B;  1ZYB A;  4IEV A;  4CXX A;  1YQ5 A;  3ETQ A;  3UIQ A;  1NCQ B;  2CSG A;  3HBZ A;  1HRI 3;  1PMI A;  2PEL A;  3ZVX A;  2JH9 A;  3OY8 B;  3OGS A;  1MS3 A;  3USU A;  1XU3 E;  4X5M A;  2WZR 2;  1CAX A;  3B93 A;  4ASL A;  2NPI A;  2B39 A;  3T4V A;  2RJL A;  2PHF A;  4FJX A;  4AL9 A;  3OGM B;  2Q8E A;  1H2M A;  2YFZ A;  4LT5 A;  2A71 A;  2VL4 A;  4GD4 A;  2IC1 A;  3SIS A;  2WO2 A;  3NNG A;  1PGS A;  3MV0 1;  3QAC A;  4QB6 A;  3W5N A;  3N1E A;  3O1R A;  3NAP B;  1E5I A;  1FZ8 E;  2ZGP A;  2E51 A;  3EO6 A;  5CFD A;  4AHZ A;  5C33 A;  3GBW A;  4K9S A;  4I0B A;  5GLZ A;  4OI0 A;  3AJY A;  4IES A;  4PBO A;  5C7G A;  3LPF A;  1UMI A;  3H3L A;  3MFA A;  4NR1 A;  3OEB A;  4IND A;  3BOD A;  3QNN A;  5ACA 3;  3LFI A;  3TOJ A;  1NCQ A;  3UJQ A;  5F3I A;  1UZY A;  3SIT A;  4XCA A;  3OY8 A;  1E5H A;  4AQT A;  4KI6 A;  1IKP A;  2GU9 A;  4M4R A;  3HIF A;  1Q8Q A;  1W05 A;  2CWM A;  3AZW A;  1CZT A;  1GAN A;  2GP3 A;  1QY4 A;  3QBQ A;  1FZI E;  1BJQ A;  2WSU A;  2XVK A;  2RMU 1;  1EPZ A;  3AZY A;  3ZDV A;  3JBG 1;  1QXP A;  1HQL A;  2WNO A;  4GUL A;  4P9W A;  3B9C A;  5DDJ 2;  3I3D A;  1CON A;  1FZ0 E;  5A1A A;  2P4E A;  5GZC A;  3DUI A;  2VZO A;  3VB9 A;  3VDD C;  3IB3 A;  1SEF A;  1Z7S 3;  1QWR A;  2RDN A;  2Y6G A;  3VKM A;  1CAU A;  4BQY A;  4I6J B;  2ARA A;  3U0Z A;  4V1P A;  1DDL A;  3BTZ A;  1AR6 2;  3CJI B;  3KCC A;  5ABJ B;  1JZ7 A;  1J84 A;  1O3R A;  4XZP A;  3CZU A;  1RUC 3;  4M3W A;  3FC0 A;  1FZ7 E;  2VOT A;  1QJU 1;  1S0B A;  3ILR A;  3I2F A;  5IWF A;  3RI8 A;  4AHX A;  3IMN A;  4W6X A;  2VJ5 A;  1X33 A;  4KG0 A;  3WP4 A;  3P1I A;  3WT3 A;  3DCQ A;  4PLO A;  2DV9 A;  3ILF A;  4UW4 A;  3SQ0 A;  1PIV 1;  3PHM A;  3ZYF A;  3ZYH A;  1HXS 1;  1PK6 A;  4UFH A;  1FZH E;  2R7E B;  4XTP A;  5F5C A;  3O0X A;  1VE0 A;  5DG2 A;  4RFR B;  5JMC A;  5FYT A;  4NJ4 A;  2BZD A;  1QDO A;  3WP5 A;  1WLC A;  4FPC A;  4PDW B;  1JN2 P;  4AHY A;  4Q4X 1;  1D4V B;  2P1O B;  3VD5 A;  4BQ4 A;  1JUI A;  1F4A A;  2WT2 A;  1W8F A;  3GXU A;  5I93 A;  5E1R A;  4NE9 A;  4A7Z A;  2BDR A;  4CEY C;  4YZ2 A;  4HXC A;  5ACA 2;  3IIA A;  1GWM A;  2VZ1 A;  1FPO A;  2VOK A;  4H14 A;  5KHK A;  1FZ4 E;  3N1B A;  1WGP A;  4IEO A;  2OVU A;  4IUG A;  1KIT A;  4K8F A;  3MYX A;  4LO5 B;  4QHO A;  1ND3 B;  1PVC 2;  3ACF A;  3IM0 A;  5H9P A;  5JCT A;  1AYM 3;  3ZDS A;  4BLI A;  4H7M A;  4CDW C;  3VBR B;  3H50 A;  3ST7 A;  1WCK A;  2OX0 A;  3LWC A;  2RE9 A;  3O1P A;  2JG9 C;  2JWP A;  3MPP G;  2BNM A;  3RS6 A;  4XDO A;  4B1L A;  3KLS A;  3VHP A;  2IVJ A;  3H8R A;  1IS6 A;  4Q4W 3;  3TAE A;  1W6P B;  2VVE A;  5FFO C;  2RS1 2;  3TEX A;  4CP2 A;  3IT8 A;  1QQP 1;  5FY5 A;  1Z7S 2;  1XU1 A;  2RS3 3;  5FZ7 A;  5IAX A;  1J1T A;  3T1M A;  3E5X A;  1RC6 A;  3M8L A;  3OSD A;  4MAD A;  1W90 A;  2UYA A;  3AC0 A;  2PLV 2;  4W6W A;  4BWO A;  3J8F 3;  4R4X A;  4FTB A;  2YBS A;  3GDB A;  2CDO A;  2D3P A;  2R0F A;  3C8X A;  5FUN A;  2JX9 A;  3AMM A;  4AFM A;  4BDV B;  1VAM A;  5LBB A;  3ZLI A;  3F95 A;  4EYU A;  5LEJ A;  3U07 A;  4AQ2 A;  1WW4 A;  4IGQ A;  1ZM1 A;  1JZ4 A;  2QFE A;  1OVP A;  2GDF A;  3T3Y A;  3SEE A;  4P02 B;  2SBA A;  4FPF A;  2QQU A;  3MIG A;  5G04 L;  5A33 A;  2WWU A;  2QNK A;  1PM4 A;  5G05 L;  3VZM A;  4DTP A;  3PIJ A;  4KQ7 A;  2GC3 A;  5FP8 A;  4UBG A;  5T50 A;  4BQX A;  5EIY B;  2J1E A;  2DCT A;  3MKS B;  4QHB A;  1ZRD A;  4YZ1 A;  1QOO A;  4XFG A;  4E4D X;  5L7O B;  2FZ2 A;  2JG8 B;  1MS4 A;  1LB2 A;  1XMH E;  4F8A A;  4G9S B;  2BJS A;  1UOJ A;  2V09 A;  5FUI A;  4AQS A;  3S9H A;  3CL1 A;  4IL7 A;  5DAV A;  5FJK A;  5FYS A;  1MEC 1;  4Y22 A;  2P5O A;  1CPM A;  3WR0 A;  2YBP A;  2ZMN A;  3LDR A;  1MR5 A;  5JZG B;  2DYC A;  2K46 A;  3ME2 A;  4BIF A;  3FHI B;  3GGL A;  3ZMO A;  3CFR A;  1ASJ 2;  1UNB A;  1TE1 B;  5AC9 2;  4Y1V A;  3BTX A;  4TN7 A;  3WNN A;  4DUW A;  4KWJ A;  5KXD A;  4NHM A;  4AED C;  1U12 A;  1VBD 1;  2GNB A;  1UZZ A;  2ZGM A;  4Y33 A;  2B8I A;  3FLR A;  2D7F A;  1N1Y A;  3PMS A;  4CCJ A;  3TRS B;  1RMU 2;  3UET A;  3ZYP A;  2HWE 2;  4JRQ A;  2QCS B;  5A3W A;  1NY7 2;  4Q4W 2;  2RM2 1;  1O8P A;  1ZZB A;  4Q1R A;  2C26 A;  1LOF A;  1WMD A;  1BKZ A;  2RS3 2;  4TSV A;  4XUP A;  1K5M C;  4AKH A;  3AYE A;  2Y8K A;  5LA9 A;  4E2G A;  2CHH A;  3L8B A;  3CFP A;  1A6C A;  4WZF A;  3J8F 2;  2VC9 A;  2YUE A;  1UX6 A;  2PA7 A;  1H2K A;  1ENR A;  4I0W B;  3WDY A;  3QER A;  1W9S A;  2ZBJ A;  3NKG A;  4FJJ A;  1U5Y A;  3ORJ A;  4TLF A;  2AH2 A;  3OG2 A;  4ZPI A;  2VOV A;  4HCB A;  5C4W A;  2XBO 2;  3N9P A;  1SZB A;  4DXR A;  4JQT A;  3H1W A;  4QXC A;  4RL5 A;  4QGM A;  3T09 A;  4LBM A;  1OLR A;  4IEY A;  4KI5 M;  3UYJ A;  2G19 A;  4FBF A;  3TEZ A;  2P1N B;  1RUG 3;  4NHL A;  5JSO A;  5FZ4 A;  1UYZ A;  5FUP A;  5JAX A;  4DB5 A;  2YC0 A;  2WYS A;  5EJZ B;  4YW2 A;  3RFR A;  4F83 A;  5DUX A;  5C9A C;  2VTX J;  3CQ8 A;  5C3P A;  3WQB A;  5F7U A;  4CXW A;  2Z2S B;  4FXG B;  4LPL A;  1TVG A;  2XWJ B;  1WA4 A;  3DKQ A;  3PDQ A;  2EXK A;  3E6C C;  4YG3 A;  3O1M A;  1ULP A;  3FUO A;  4GMP 1;  4IEZ A;  3WQ7 A;  4A42 A;  1WD3 A;  2R49 A;  2JDZ A;  2TEP A;  4GH4 A;  1IPK A;  4AI8 A;  1RHI 3;  4W4Z A;  5FYC A;  4AEK A;  1AR8 3;  4ES9 A;  1UZW A;  2J1A A;  4MGK E;  4GXL A;  4YVW B;  5HCF A;  4PI2 A;  3TBD A;  3N36 A;  3ZSM A;  1RB8 G;  2R07 3;  4CU6 A;  3K3N A;  2Y60 A;  4LLO A;  1JS9 A;  3PVE A;  1MHY G;  3LQC A;  4NVP A;  3THT A;  3P5B A;  1NT0 A;  4K1Y A;  4R9B A;  4RS5 C;  4CCK A;  5CG8 A;  3P3N A;  4XFA A;  3GZE A;  2VMG A;  2CGP A;  2WII B;  2ZGQ A;  3ZXA C;  4LKF A;  3HD8 B;  3I2J A;  3WQ0 A;  5KC5 A;  1G9A A;  2DDU A;  2ORX A;  3HQU A;  1JYX A;  3MIB A;  2JB4 A;  4XF4 A;  5FAX A;  2ZHK A;  4BQ3 A;  3A22 A;  3TNP B;  3ZR5 A;  2ZKL A;  1IH7 A;  2VCM A;  3MW3 A;  1EAH 3;  1ZZ7 A;  3U4S A;  5FBJ A;  4DRR A;  2ZGU A;  1NCR B;  3N9Q A;  1I3H A;  1UIJ A;  4KU7 A;  4PLN A;  5A7W A;  4R9D A;  1SAC A;  4RQP C;  4RR3 C;  3WDX A;  2XJQ A;  4NIA A;  1OLM A;  2VJ4 A;  5F3G A;  1RUI 1;  4JGZ C;  4DTX A;  5T3N A;  4BJ0 A;  2D6L X;  4GMP 0;  3L2H A;  4Z82 A;  4CCD A;  3I7D A;  2ZS6 B;  1U5Z A;  4S2H A;  1H6X A;  3BGA A;  1Q9X A;  1F5F A;  3FJS A;  4FQ4 A;  1BK0 A;  3JD7 3;  5FPZ A;  5D8A B;  3T2O A;  1RUF 2;  4QPI C;  3IDE A;  2XOM A;  2J42 A;  1XNB A;  4GJY A;  1W6O A;  4I02 A;  1CX1 A;  2WFF 3;  3ALQ A;  4SBV A;  2ZX2 A;  1IG9 A;  1J83 A;  1RUG 2;  3MI8 A;  4S2D A;  4EE2 A;  1G9D A;  1HRI 1;  3WD5 A;  3NAE A;  3WQ1 A;  4YG0 A;  5KHG A;  1O59 A;  2QKD A;  1XOY A;  2ZGK A;  4IER A;  4A3X A;  4YWA A;  1U0A A;  4LBQ B;  4AWD A;  1ZVF A;  4ZS3 A;  3HNM A;  4ZXE A;  5KXE A;  4YGD A;  3K46 A;  1XVC E;  1Q8O A;  2ET1 A;  1AX1 A;  5HXM A;  4BIO A;  3SQ4 A;  1BHG A;  3TYJ A;  2Y26 A;  1RHI 2;  4DOU A;  1AR8 2;  3H1Y A;  3WZ1 A;  2XJP A;  2W94 A;  3PTR B;  3P3P A;  2P6H A;  3III A;  5FY8 A;  5CKQ A;  4LA3 A;  5FCC A;  4XUO A;  1D7P M;  4FK2 A;  1DYK A;  4GIQ A;  5A7S A;  2I74 A;  1QJE A;  2E53 A;  3H8O A;  3AP7 A;  3VHO A;  2VZU A;  4E4Z A;  2XML A;  1WBL A;  3ELN A;  1GFF 2;  1YWK A;  1H1M A;  2YGL A;  1VAK A;  4HL0 A;  3W58 A;  4OHY A;  1UOB A;  3I2G A;  3VDB A;  1YI9 A;  4FJK A;  2WS9 3;  2VZQ A;  5FYB A;  4EWE A;  2HBU A;  1ENS A;  1UPS A;  1IPS A;  1CAW B;  4PIZ A;  3FLT A;  5EPA A;  4QX2 A;  3ZYI B;  1A34 A;  4D6S A;  3CKH A;  4DXS A;  2A6V A;  2IUW A;  5TSW A;  3ZFG B;  2HWB 3;  1OHF A;  2VNR A;  2MMB A;  3GHM A;  1RUN A;  1RUD 3;  4O7X A;  5F3C A;  3VBO C;  3B02 A;  2C9A A;  4JRL A;  5FO7 B;  3JD7 2;  3S6P A;  2CGN A;  1EPW A;  1US2 A;  2JIJ A;  4OI4 A;  4KHS A;  3POS A;  2EXI A;  4O9E A;  4GA9 A;  4DIN B;  1RUC 1;  1HKD A;  4IEW A;  2ARE A;  3V7D B;  1W0O A;  1ZNP A;  3EYP A;  3SUN A;  3GNE A;  3N35 A;  5FP9 A;  4AFD A;  4AOC A;  3GZU C;  1PVX A;  4ASM B;  4XIL A;  5K0U C;  4Y24 A;  1UQX A;  2PAE A;  1XU2 A;  4FOV A;  1CAW A;  4LK6 A;  5GJ6 A;  3TN9 3;  4CDQ B;  4HFS A;  2XGX A;  5BUV A;  3ETP A;  3C2U A;  4FJN A;  2P6C A;  3N9L A;  1OSG A;  2P3K A;  4LIU A;  1J3P A;  4XFF A;  1US3 A;  2VZT A;  3I2I A;  5C6C A;  4YRD A;  2WZ8 A;  3N9O A;  4YZ4 A;  1FMD 3;  1SCR A;  2CL2 A;  1U5X A;  1MS5 A;  3WDW A;  4E3S A;  2PMW B;  4KMQ A;  1FS1 A;  1UYP A;  4FO9 A;  4YGB A;  1ND2 C;  3WF4 A;  3PJQ A;  5FWE A;  3KD1 E;  1C8M 1;  3CJX A;  4XOG A;  4XAE A;  4OHX A;  4CDQ A;  4LO6 B;  2BVB A;  2IXJ A;  3AKT A;  3MW2 A;  3OPZ A;  2YC2 A;  1FV3 A;  4GWI A;  3JU9 A;  1KD7 A;  3NNF A;  3ASI A;  4MGQ A;  1I9R A;  4UFK A;  4Y5T A;  2E63 A;  1WW6 A;  2HWF 3;  3VUO A;  1F31 A;  4LUM A;  2Q30 A;  1DCS A;  3D3A A;  1AYM 1;  1MPX A;  2OPW A;  3N7J A;  2DTU A;  2DUR A;  3IMM A;  4KWL A;  2P3I A;  4QPG C;  1XNC A;  2J1U A;  2XUM A;  5BNN A;  4LOT A;  4HN0 A;  5FMC A;  1QHD A;  2ZGO A;  5C5T A;  1QJY 1;  4N53 A;  4E2S A;  4JX0 A;  3MF6 A;  1D4M 3;  3ZXK A;  2VAU A;  3NST A;  4OCT A;  4CDX C;  2FMY A;  2RS3 1;  2JHA A;  2YFU A;  2ZAA A;  3RMY A;  3O1U A;  4AVS A;  1MMO G;  4S2F A;  4GAL A;  1FX5 A;  4FPE A;  2X09 A;  4YVS B;  1O3T A;  5FLH A;  4FJH A;  3ZN4 A;  1XRU A;  3S5A A;  1UY1 A;  1HB1 A;  5EHD A;  5FMO L;  1FZ3 E;  2W5F A;  4L0P A;  1BQP A;  4DIQ A;  4YAR A;  4ZS2 A;  4KBB A;  4CUC A;  3V0B B;  2AR6 A;  3HPN A;  1F35 A;  1UY0 A;  2C9K A;  3EB7 A;  3MIC A;  4C1W A;  1W8Z A;  1Y4W A;  1HRV 3;  3APB A;  4CVU A;  4WM8 C;  4QU1 A;  1F5J A;  3BKZ A;  4Q4X 3;  3U78 A;  3WF1 A;  1FAT A;  4FAH A;  3BU0 A;  4FI9 A;  3WW3 A;  2X5I A;  1Q8P A;  1XND A;  3AYC A;  4YZ5 A;  2NYY A;  1WBF A;  1OD3 A;  1QH7 A;  4K7J A;  4PQQ A;  3BOP A;  1AXK A;  4XQ4 A;  1PMH X;  4YG6 A;  1LKN A;  4FXK B;  1MZF A;  5E16 A;  3Q8B A;  3D6E A;  4CSW A;  2QDN A;  4DY3 A;  4QXK A;  5T5J A;  2RS5 3;  2DVB A;  1HIX A;  2NMO A;  3TL8 B;  2RMU 2;  3JBG 2;  2D40 A;  3E5U A;  3A0K A;  3H3Z A;  1I5P A;  4FPY A;  1AX2 A;  1PNF A;  2GH8 A;  3HVD A;  3SCF A;  4CP9 B;  5C8C B;  4MGY E;  3OGV A;  3JB4 C;  4XW3 A;  1V6I A;  3WCR A;  5T55 A;  3DV8 A;  3T1L A;  1DIW A;  1GNZ A;  1IS4 A;  3OF1 A;  2BGC A;  3FLP A;  2HWF 2;  3LCP A;  3KF3 A;  5DG1 A;  5F5A A;  1Q5O A;  4CEW C;  3T30 A;  3QES A;  3BAL A;  1X9P A;  1DGL A;  1H8V A;  3M1H A;  4N43 C;  4WVM B;  4CCN A;  5DAQ A;  1QGL A;  1FV2 A;  1W6N B;  4I9L A;  4YNI A;  2WZP P;  1XYP A;  2L9L A;  4YW7 A;  4BK4 A;  2LUW A;  3POJ A;  4WZC A;  1QJU 2;  1D4M 2;  3ZFF C;  1WLT A;  1EY2 A;  2VMD A;  2E7A A;  2WJS A;  3A4U A;  1GQH A;  2EID A;  2Q8D A;  1QIQ A;  2FDJ A;  4FAG A;  2ZOE B;  4CP9 A;  4NMI A;  2AEZ A;  2DFB A;  4P9J A;  3INA A;  4MGS A;  1PIV 2;  3VBS C;  1W39 A;  4JHZ A;  1V70 A;  2Y6J A;  1LEM A;  2D97 A;  4L2N A;  3VKF C;  3I3M A;  3A23 A;  4BHP A;  3AKS A;  3VZL A;  2VXJ A;  3B00 A;  1AHS A;  4K8R B;  2P37 A;  4NHX A;  4IGP A;  4Y4R A;  3RVH A;  3RI9 A;  4WVM A;  2DCY A;  5IT6 A;  1HRV 2;  1W6N A;  2J1R A;  4N9H A;  3T0D A;  4A6O A;  1OT5 A;  4Q4X 2;  2OVR B;  4AEM A;  1UL9 A;  2BW8 A;  3JQW A;  2WSV A;  4FFF A;  4FTE A;  3CDZ B;  4A7K A;  2WNV C;  1VB4 A;  4HSL A;  1RUG 1;  1JHN A;  1OH4 A;  3PVO A;  2PHU A;  2OPK A;  2VQA A;  2QBX A;  2FHR A;  4IEU A;  1GWL A;  1DU3 D;  1EV1 3;  1ZA7 A;  5FZD A;  4GB3 3;  2P17 A;  2P3Y A;  4C0B A;  1H2L A;  4FJL A;  2NZ9 A;  3ZKY A;  3PUH A;  3HP9 A;  1VBD 3;  2A3X A;  5F6K A;  5JPN B;  4RGK A;  3J7L A;  1D2Q A;  1AXY A;  4RSU A;  3U37 A;  1E5R A;  3V65 A;  4CA9 A;  4Z1V A;  1FXZ A;  2YYO A;  4N90 A;  3RMD A;  2VMH A;  4ZON A;  4Q27 A;  1NA1 A;  3C7H A;  1POV 3;  2R07 1;  3LAG A;  3I59 B;  1S2K A;  3JB8 A;  4Q2F A;  5FZC A;  4XIK A;  1V6O A;  1UXZ A;  2DFC A;  4LK7 A;  5FZI A;  1NXD 1;  3OD4 A;  4DXT A;  2W1Q A;  4COY A;  3C7O A;  4E4B A;  3KCX A;  5A7Q A;  4MX3 A;  1LAJ A;  3UKV A;  3TEY A;  1IPJ A; 
#chains in the Genus database with same CATH homology
 1J84 A;  4JS4 A;  2P1M B;  3NHG A;  3VDC A;  2Y6H A;  3CZU A;  5DMY A;  1PX4 A;  1FZ5 E;  4M3W A;  1FZ7 E;  2VOT A;  3K4Z A;  3T08 A;  3I2F A;  4M4P A;  3FN9 A;  1DYO A;  2VJ5 A;  4KHU A;  3K2O A;  4DEQ A;  2P5G A;  3QEX A;  1MHZ G;  3P1I A;  4D8M A;  3SQ0 A;  3SKV A;  4DUV A;  2QQI A;  3OB8 A;  1FZH E;  2R7E B;  4FJI A;  4KHW A;  4QDS A;  1WCQ A;  4XVH A;  3OGK B;  2BZD A;  4AI6 A;  3DEC A;  4QB1 A;  4DTS A;  4FK0 A;  2JD9 A;  1SDD B;  2P1O B;  4M45 A;  1DLC A;  1UY2 A;  3VD5 A;  1F4A A;  1K12 A;  3GXU A;  4J2B A;  5CZK A;  4ARX A;  1UYX A;  3FHQ A;  2X05 A;  5JMO A;  2OVP B;  2VZ1 A;  1F4H A;  4ARY A;  2ZEX A;  1FZ4 E;  3N1B A;  4IUG A;  2PFT A;  3C94 A;  4J2A A;  3NJX A;  4OMD A;  3ACF A;  3GM8 A;  3SEP A;  5JUV A;  4X5N A;  2ZEY A;  2WO1 A;  1JZ2 A;  5IZ7 A;  4DTO A;  3SQ1 A;  4QDR A;  1JYW A;  1CLQ A;  3TAE A;  2VIX A;  3BN6 A;  3UNP A;  3SUQ A;  4J2E A;  4M42 A;  4PF1 A;  1XNT A;  4MAD A;  1P22 A;  3AC0 A;  3RMC A;  4Z2A A;  5IHR A;  4E8D A;  3WF2 A;  4DTM A;  1L7Q A;  3OBA A;  4LQR A;  2MZW B;  3GDB A;  2CDO A;  3LDS A;  3C8X A;  4BK5 A;  2DCK A;  4CUA A;  4BDV B;  2VO5 A;  5LCW L;  2QQK A;  1ULO A;  5EJ1 B;  1JZ4 A;  5JXH A;  3L2O B;  4I9Q A;  4P02 B;  3C6N B;  3LEI A;  1XPW A;  3LDB A;  3SEE A;  5G04 L;  3ACG A;  5LA1 A;  4J2D A;  5G05 L;  5HPO A;  3E4W A;  2W9X A;  4DTP A;  2QXF A;  4ADN A;  2P1Q B;  3ACH A;  1W0N A;  5B4N A;  5EIY B;  2J1E A;  2B4K A;  3MKS B;  3K77 A;  2W1U A;  2XQX A;  2BGO A;  5IJR A;  3HOB A;  1XMH E;  2JE8 A;  5FUI A;  3S9H A;  2JPN A;  3TAG A;  2EIE A;  1UY4 A;  4UOJ A;  3JXS A;  3WEZ A;  2P5O A;  3L0M A;  4FJ9 A;  3QEV A;  5IBK B;  1PX3 A;  3GGL A;  3CFR A;  3VDA A;  4P5Y A;  1K42 A;  4AKI A;  4XUR A;  2BGP A;  3I97 A;  1L7R A;  2RVA A;  3WNN A;  4DUW A;  5IFT A;  1JI6 A;  3THD A;  2B8I A;  2OKX A;  4KHY A;  2J1S A;  2QQM A;  3UET A;  1JZ3 A;  3SJJ A;  3HGL A;  2VJX A;  4A3Z A;  4AG4 A;  3T2P A;  4JRQ A;  3I2H A;  3LZI A;  1XVB E;  5DQ0 A;  3WF3 A;  1O8P A;  3QEW A;  2WAB A;  2C26 A;  4UAP A;  4EPH A;  3NE6 A;  4P08 A;  4DTN A;  2J22 A;  4XUP A;  2WUH A;  4AKH A;  2HLE A;  1KGY A;  2W46 A;  3PUI A;  2FYO A;  2Y8K A;  4A44 A;  3L8B A;  3CFP A;  2JHP A;  2B1E A;  3IAP A;  2C4X A;  4LKS A;  2VC9 A;  5C71 A;  3K75 B;  3HEI A;  2W91 A;  2DEB A;  3QER A;  1W9S A;  4FJJ A;  4AAX A;  2VM9 A;  2V5D A;  3OG2 A;  4EYW A;  4HCB A;  2VR4 A;  2LF3 A;  2VCA A;  4DU1 A;  2DCJ A;  4DXR A;  4RYD A;  1SG3 A;  1GQP A;  1UY3 A;  1XNA A;  4RL5 A;  4FJ7 A;  4DTU A;  2QQO A;  1NEX B;  4KHN A;  4QX1 A;  3C6O B;  3T09 A;  4KI5 M;  2RJ2 A;  4OUE A;  2P1N B;  4FJ5 A;  3E1F 1;  4OMC A;  1LNS A;  1UYZ A;  3HGK E;  1CIY A;  4JS5 A;  1Q9Y A;  2WYS A;  1WAF A;  5EJZ B;  4YPJ A;  1FYZ E;  3CQ8 A;  3WQB A;  5F7U A;  4M3Y A;  4DEV A;  4LPL A;  1TVG A;  2QQJ A;  1LDK E;  1ULP A;  1XVD E;  4M3T A;  4A42 A;  1P8J A;  3MV1 1;  2OYQ A;  5JXI A;  4DU4 A;  4W4Z A;  3SUO A;  1GOG A;  2BER A;  4TTG A;  2J1A A;  3SKJ E;  4XZU G;  4CU8 A;  4CU6 A;  1UXX X;  1MHY G;  3LQC A;  5LA0 A;  3RMB A;  3C95 A;  4ZY9 A;  1JU3 A;  4QND A;  3SUP A;  3J27 A;  2W1S A;  2XHN A;  3I2J A;  2PFV A;  2DDU A;  2ORX A;  1JYX A;  3J2P A;  3T2Q A;  3SCX A;  3A22 A;  3SNN A;  1IH7 A;  1PMJ X;  3IAQ A;  3QNO A;  2VQT A;  2W47 A;  5JXJ A;  4DU3 A;  2VJ4 A;  1OF3 A;  4DTX A;  2WQ8 A;  4BJ0 A;  3W5M A;  2WN2 A;  4JKK A;  4M3U A;  2W92 A;  1K3I A;  4M3R A;  1H6X A;  3BGA A;  1Q9X A;  4QNC A;  2H4T A;  1UX7 A;  2XON A;  3C7E A;  2EIB A;  3P6B A;  3T2O A;  2EIC A;  1JU4 A;  3CIH A;  3VD7 A;  3VD9 A;  2XOM A;  3HNB M;  4E8C A;  4UI9 L;  4XUN A;  5DN2 A;  1CX1 A;  3HL8 A;  1IG9 A;  1J83 A;  1JHJ A;  4PT6 A;  1XU5 E;  3C7G A;  3NAE A;  3LZJ A;  1UMH A;  4FJ8 A;  1O59 A;  4XUT A;  3T0B A;  3WNM A;  3VD4 A;  3E4Y A;  2JDA A;  1GMM A;  3NJV A;  3HNM A;  4ZXE A;  3K46 A;  1XVC E;  5HXM A;  4M41 A;  3SQ4 A;  1BHG A;  4QDQ A;  1W99 A;  2W94 A;  3J7H A;  3III A;  1XVF E;  3FL7 A;  3MO4 A;  1JZ5 A;  3L1N A;  2BBA A;  4XUO A;  1D7P M;  4FK2 A;  1W9W A;  1XVE E;  2E26 A;  3I3E A;  2VCB A;  2VZU A;  4P00 B;  3TJY A;  3QEP A;  1EUT A;  4ZZ8 A;  2LS6 A;  3MUY 1;  5B4X A;  3A21 A;  3LEK A;  4M3X A;  1TG7 A;  2WDB A;  1JZ6 A;  2LW8 A;  2FW3 A;  3I2G A;  3VDB A;  3DYO A;  4FJK A;  2VCC A;  2VZQ A;  2ZXQ A;  4OYU A;  1XVG E;  1HN1 A;  2B7M A;  3UES A;  4A45 A;  4CU9 A;  1FXX A;  4DTJ A;  5IFP A;  4QAW A;  2P1P B;  4QX2 A;  3K4D A;  3ECQ A;  3CKH A;  4DXS A;  2OZM A;  4ADO A;  2MMB A;  1NKG A;  1RYY A;  5J1X A;  1EUU A;  1XMF E;  2W87 A;  3WNP A;  1US2 A;  4DUX A;  4KHS A;  2E33 A;  1KEX A;  4FVM A;  1SHW B;  4TXW A;  3A7Q A;  3K4A A;  3QET A;  2B9V A;  4DTR A;  2VME A;  3V7D B;  2YG0 A;  3EYP A;  3VD3 A;  3SUN A;  4A41 A;  3THC A;  2ID4 A;  5C70 A;  2WZE A;  2KD7 A;  4W8J A;  3ETP A;  3SPZ A;  3TAF A;  2W3J A;  4RNG A;  4FJN A;  4AKG A;  3LEG A;  4RN5 A;  2VZP A;  1US3 A;  2VZT A;  3I2I A;  3WF0 A;  2QQN A;  2WZ8 A;  2OZS A;  2WBK A;  3FHA A;  2RCU A;  3I3B A;  1GU3 A;  3IDA A;  4E3S A;  1W9T A;  3ABZ A;  4JKL A;  4KMQ A;  1FS1 A;  2CDP A;  2QQL A;  2HYX A;  4CUB A;  3WF4 A;  1MTY G;  3KD1 E;  1JYN A;  3NGI A;  4LHS A;  1XMG E;  1CZS A;  2X10 A;  2RV9 A;  3KD5 E;  1WAJ A;  2JHC A;  4EP9 A;  1GOH A;  4GWI A;  2YC2 A;  4QX3 A;  4MGQ A;  3WNL A;  3SVI A;  3OGR A;  1R64 A;  1OF4 A;  3D3A A;  1MPX A;  2DTU A;  2JH8 A;  3LD8 A;  3I2K A;  1W8N A;  5LA2 A;  2J1U A;  3DYM A;  3WNO A;  3ZM8 A;  5H37 A;  2ZEZ A;  4JX0 A;  4B08 A;  3NDK A;  4XUQ A;  2JHA A;  1NX9 A;  4RG8 A;  2YFU A;  4KWU A;  1MMO G;  2Y64 A;  4HG6 B;  2W95 A;  2X09 A;  2ORZ A;  4FJH A;  2V72 A;  2ATQ A;  1UY1 A;  2WO3 A;  1FZ3 E;  4KI4 A;  1W8O A;  2W5F A;  1FZ9 E;  3OEA A;  4L0P A;  3NCI A;  3MBW A;  4CUC A;  2VZV A;  3C7F A;  1WKY A;  3QEI A;  1UY0 A;  2C9K A;  3EB7 A;  3HPN A;  4CVU A;  1XL3 C;  2VZ3 A;  3CFO A;  3SQ2 A;  5I0D A;  4M3Z A;  1UYY A;  4GAM C;  3WF1 A;  5JXG A;  4FI9 A;  3WSO A;  1K45 A;  2PQS A;  4PQQ A;  1OD3 A;  5JR2 A;  5IRE A;  1PMH X;  2VMC A;  2OVQ B;  4JRP A;  1FZ2 E;  2VMF A;  4QX0 A;  3TL8 B;  3HJR A;  1UZ0 A;  2WAO A;  3NQH A;  4GZ9 A;  4FJM A;  2ZEW A;  1JZ8 A;  4MOA A;  1I5P A;  4HCC A;  1T2X A;  4MO3 M;  3CQO A;  2J1V A;  3OGV A;  2Y6L A;  1XC6 A;  4A4A A;  2WN3 A;  4W50 A;  3OGL B;  3T0A A;  2VQU A;  3ACI A;  2VTF A;  3SI6 A;  1CZV A;  1DP0 A;  2YB5 A;  3QES A;  3HNY M;  1JYV A;  3MUZ 1;  4I9L A;  4BK4 A;  2L9L A;  4CU7 A;  2DY4 A;  2JKX A;  1IQD C;  3TAB A;  3RMA A;  4QB2 A;  3UIQ A;  1GUI A;  2VMD A;  2EID A;  5CYY A;  2JH9 A;  2J1T A;  3OGS A;  4ET7 A;  1XU3 E;  2E32 A;  4X5M A;  2V4V A;  4ZZ5 A;  4QPW A;  4MGS A;  4FJX A;  4JHZ A;  2Y6J A;  1GNY A;  3OGM B;  5IYY A;  2YFZ A;  3A23 A;  2VL4 A;  4KHQ A;  2WAA A;  1FZ6 E;  2WO2 A;  3NNG A;  3MV0 1;  3W5N A;  4QB6 A;  2Y6K A;  3N1E A;  3LPG A;  1FZ8 E;  4BXS V;  4OZO A;  2J1R A;  4FJG A;  2VZR A;  5C7G A;  3T0D A;  3LPF A;  1OT5 A;  1UMI A;  4A6O A;  2OVR B;  4GWJ A;  2YB7 A;  3OEB A;  2LF6 A;  4FK4 A;  3CDZ B;  3QNN A;  3F2Z A;  3SPY A;  2VZS A;  1OH4 A;  3WNK A;  3LE0 A;  4KI6 A;  4M4R A;  2QBX A;  1YQ2 A;  3CZJ A;  1NAE A;  3RWU A;  1CZT A;  5DPN A;  1FZI E;  1UWW A;  4FJL A;  3PUH A;  2HD0 A;  3HP9 A;  1FZ1 E;  4D0Q A;  3I3D A;  3C6P B;  3U37 A;  1NUK A;  1FZ0 E;  5A1A A;  1GOF A;  3RMD A;  2VZO A;  2E31 A;  2YC4 A;  3C7H A;  3IB3 A;  4JKM A;  2J7M A;  1O8S A;  2Y6G A;  1H6Y A;  1UXZ A;  3CMG A;  4I6J B;  2W1Q A;  2W1W A;  3C7O A;  4E4B A;  3HN3 A;  3DYP A;  3NRU A;  2Z4F A;  4DXT A;  1JZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...