2E31A

Structural basis for selection of glycosylated substrate by scffbs1 ubiquitin ligase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
251
structure length
246
Chain Sequence
AVEYLAELPEPLLLRVLAELPATELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWSDVEHGGDGWKVEELPGDNGVEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box only protein 2
publication title Structural basis for the selection of glycosylated substrates by SCFFbs1 ubiquitin ligase
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 59
structure length 246
sequence length 251
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00646 F-box F-box domain
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2e31A01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2e31A02
1L7RA 4OZOA 3FHAA 1DYOA 2JD9A 2VMEA 3V7DB 1XNTA 3C8XA 1PX3A 3OB8A 5HXMA 2C26A 3OEBA 3ABZA 3IIIA 3J7HA 4JX0A 3NNGA 4ZY9A 4CUBA 4DUVA 3PUHA 3OGMB 5IBKB 3SKVA 2W47A 3VD4A 1UZ0A 4D0QA 4DXTA 4DXRA 2C9KA 2J1UA 3CZUA 2HLEA 2QBXA 1W0NA 3PUIA 2YC4A 2PQSA 3K46A 2QQKA 1CZTA 2YB7A 2E32A 2X09A 5I0DA 4TXWA 2VL4A 2VZ3A 3C7EA 4FI9A 3CZJA 3NQHA 3LQCA 2P1MB 1W8NA 2W94A 2Y64A 5JXHA 4W50A 3OBAA 4KWUA 3THDA 2LW8A 3WNKA 1EUTA 3K4AA 1HN1A 1SHWB 3T0BA 3LEKA 3GGLA 4LKSA 3LPFA 3CIHA 2BGOA 4XUNA 2W9XA 1YQ2A 2P1QB 1T2XA 2VMFA 3ETPA 4QPWA 2WO2A 1JYWA 4A4AA 3K75B 2YFZA 2WABA 1PMHX 4JKLA 3CDZB 3WF0A 3OGRA 2VQTA 1XC6A 1JZ6A 2VQUA 4QX3A 5JR2A 4ZZ5A 3L2OB 4XURA 1CX1A 5LA2A 3GM8A 1UY1A 5C70A 2W5FA 4QB1A 1PMJX 3T2OA 1DLCA 1OF3A 4KMQA 2XHNA 2WUHA 2P1OB 3IAPA 1GMMA 1KEXA 2RVAA 1UY0A 5JUVA 1RYYA 2VZVA 4CU9A 4QDQA 4A44A 3F2ZA 4CU8A 2V5DA 3C6OB 4LQRA 3IAQA 3WF2A 1GOHA 2Y6HA 2Y6GA 1GUIA 3VD7A 1UMIA 2WDBA 4MGSA 1JYNA 3DYPA 2WYSA 3T08A 3ECQA 2V4VA 2VZQA 1UXZA 2E26A 4AAXA 1H6XA 1D7PM 5IJRA 3D3AA 4OMDA 1UYZA 5CYYA 4UOJA 1CZVA 1GOFA 3C6PB 1JZ2A 2VZRA 4P02B 3W5MA 2XQXA 3K77A 1F4HA 2Z4FA 3HJRA 3LEIA 4XUOA 1BHGA 2WN2A 5A1AA 4BK5A 3BN6A 2VZ1A 4LPLA 3C6NB 4CU6A 2W91A 4DUWA 2WAAA 1XNAA 4ZZ8A 3C7FA 1H6YA 2C4XA 3WNLA 5G04L 4E8CA 2VZTA 4QDSA 3VDBA 4XZUG 4W8JA 2J1AA 3WNOA 2E31A 3I2KA 2VR4A 2ZEXA 5DPNA 2JDAA 5JXGA 2ZEWA 1DP0A 5EJZB 3FL7A 3SKJE 3A22A 1NUKA 1UY2A 4M4PA 2WO3A 3ACFA 2RJ2A 3A21A 2QQMA 2X10A 4A6OA 4KI5M 1UYXA 1MPXA 2BBAA 4MOAA 2Y6JA 2EIDA 1JZ3A 3DYMA 2W3JA 4ZXEA 5EIYB 3VDCA 3C7GA 4UAPA 4A41A 3GXUA 2DCJA 4JHZA 3SEEA 3VD5A 2WN3A 2EIEA 3WSOA 1IQDC 4UI9L 2EIBA 2KD7A 1ULOA 4W4ZA 2WBKA 4MGQA 4A3ZA 2L9LA 3NJXA 3IDAA 3THCA 4XUPA 2W46A 2Y6KA 3LE0A 2VMDA 1K45A 3WF4A 3I2JA 3C7OA 3JXSA 1W9TA 5J1XA 2ZEYA 4JKKA 4XVHA 3AC0A 4RYDA 4QB2A 2J7MA 2J1VA 1US3A 1CZSA 2VZPA 4BK4A 2OVRB 3HNBM 5G05L 1I5PA 3MUY1 3ACIA 1WKYA 5FUIA 1K42A 3OG2A 1SDDB 4PQQA 5C7GA 3T0DA 4QX2A 4AG4A 3UETA 3IB3A 3CMGA 3T2PA 2WZEA 5B4XA 1O8PA 4DUXA 3I2IA 4P08A 1GNYA 3WNMA 3OGLB 1UYYA 3U37A 2VZUA 2OVQB 2VZSA 1GU3A 4A45A 2HYXA 4IUGA 2W95A 4LHSA 3UESA 3WF1A 3LPGA 4CVUA 3I3EA 2W1UA 3EB7A 3E1F1 1P8JA 1OD3A 1UY3A 5DN2A 1W9SA 4HG6B 2DCKA 4MADA 4YPJA 2J1SA 3CKHA 3P6BA 1LNSA 4BDVB 5B4NA 1L7QA 4TTGA 3VD3A 1UWWA 5LA1A 1O59A 2LS6A 1K12A 2QQLA 1J84A 2W87A 4P5YA 2W1SA 2QQJA 2QQOA 2DDUA 2BERA 2V72A 5IYYA 2B9VA 2P1NB 2XONA 2EICA 3CQOA 4GZ9A 3I2GA 1CIYA 1R64A 4ARYA 2ZEZA 2RV9A 1TVGA 2WZ8A 3NJVA 2B4KA 5HPOA 3MV01 2VO5A 1NEXB 3SEPA 2ORXA 1PX4A 1JYVA 3OGSA 3OGKB 1UX7A 3OGVA 1JU3A 5JMOA 2VCBA 2YG0A 3ZM8A 2YFUA 1UY4A 2E33A 2ORZA 5F7UA 1F4AA 2QQNA 2CDPA 2WAOA 3UNPA 3ACHA 1JHJA 2J1TA 1OH4A 2J22A 1UXXX 4MO3M 5EJ1B 2VCCA 3GDBA 3MKSB 4GWIA 2OVPB 3ACGA 1JZ4A 4P00B 1JZ7A 2BZDA 2Y8KA 2ZXQA 2WQ8A 1P22A 3K4ZA 5JXJA 1K3IA 2VCAA 2JE8A 2VTFA 3HNYM 1JZ5A 3WNNA 3WF3A 1NKGA 4OMCA 4QAWA 3MO4A 1JU4A 3HEIA 4PT6A 3FHQA 2WO1A 4RN5A 1TG7A 3T0AA 1UMHA 3I2FA 2VOTA 4BJ0A 2J1EA 3A23A 4I6JB 2VM9A 4XUTA 2JKXA 2VC9A 1JI6A 4QDRA 3VDAA 3C7HA 1KGYA 1WCQA 3MV11 3WQBA 2XOMA 3MUZ1 3EYPA 4D8MA 1OF4A 2OKXA 2R7EB 2VJXA 1W9WA 3HOBA 3I3DA 3LEGA 4M4RA 4A42A 4L0PA 1JYXA 2W1QA 1J83A 1FS1A 3MBWA 1ULPA 2ID4A 3FN9A 1W99A 3I2HA 5DQ0A 3NRUA 4CUAA 4DEQA 5DMYA 4JKMA 2BGPA 5CZKA 4ET7A 3HPNA 2YC2A 2P1PB 1EUUA 1US2A 3VD9A 4OUEA 4BXSV 1W8OA 2W92A 2VZOA 4CU7A 5IFPA 4DXSA 5C71A 4XUQA 3DYOA 5LA0A 3T2QA 1O8SA 4QB6A 1JZ8A 2J1RA 1GOGA 3WEZA 3HNMA 3W5NA 5IHRA 2Y6LA 4Z2AA 3K4DA 3WNPA 5LCWL 1LDKE 3T09A 4QX1A 2CDOA 4GWJA 1NX9A 3A7QA 4QX0A 3I3BA 1SG3A 2VMCA 2X05A 3OEAA 3BGAA 4CUCA 4E8DA 3DECA 3HN3A 4ARXA 5IFTA 5JXIA 1XPWA 2W1WA 4OYUA 4PF1A 2QQIA 1GQPA 1OT5A 4DEVA 1NAEA 3I97A 3P1IA
chains in the Genus database with same CATH superfamily
3E6DA 2Q0AA 3M1HA 4HL0A 1L7RA 4L2NA 4OZOA 4JZRA 1DYOA 1Z7S1 3E6BA 2FZ2A 1FV3A 5A32A 1NCRA 4M3XA 3V7DB 3QOPA 4HKLA 4IV1B 1LGCA 2EXJA 5A6QA 2BBVA 3VBRA 1ASJ2 1CLQA 4UW6A 1K5MB 3OF1A 4NHLA 4AVSA 5C9AB 1MMOG 2B5HA 3AJZA 5K9YA 2H0VA 2C26A 4H7LA 3HL8A 4P9XA 1JODA 4GQ7A 3CJIA 4MGZE 2XJSA 4XIOA 3OGMB 1JOPA 3J4UH 5T5OA 1TME3 4AEDA 3MIHA 2ARBA 3VD4A 1QQP2 2Q8CA 2JDYA 3KV9A 4D0QA 4AFDA 4DXRA 3CZUA 2HLEA 4XDPA 3ZYHA 1VMJA 3PUIA 4Q4Y1 1BEV3 4M3CE 2A75A 4XBLA 3AYAA 4NPLA 1ND2A 5LEKA 5JIAA 1H2LA 3OUIA 2OZ6A 4DTXA 5FZHA 1CZTA 3QLQA 4I9QA 2X09A 4XJUA 1AL23 1X82A 5C33A 4YG0A 2VZ3A 1AXKA 4X8PA 2AYHA 4PDWA 3X29B 4LE3A 3OPTA 1DGLA 1QH6A 3E4YA 2O1QA 3NAPC 1RUG3 3P3PA 4DY5A 4Q27A 1HDKA 3KSCA 4MZUA 2OQ7A 5B2GB 3TAFA 2XLGA 3NQHA 4QGLA 3GHNA 3LFIA 4UYBA 2Y64A 1XSRA 3QEIA 2QZ2A 5FAXA 5C8WA 1NXD1 4M3CA 4DU4A 3TN92 1HLCA 2I2SA 1AR62 2FZ1A 3SH3A 4LKFA 5FXZA 4BQ1A 5BNPC 1XNDA 3VBOB 3KGLA 3T0BA 2A71A 3QESA 2ADEA 2PN5A 2X5IB 4AR2A 2QQPA 2HWF2 2JH8A 3LPFA 3AXEA 2HEYF 1OSGA 5FQ0B 2BGOA 5GZFA 4NIHA 3ETPA 3WP4A 4N43B 2WO2A 1LOEA 3U78A 4FJXA 4A4AA 1ASJ1 4NO4A 3T4VA 4FVVA 5A3PA 1PMHX 2F4PA 4JRQA 4AEDC 4YWAA 3HWJA 3ZXLA 3MDPA 4IETA 1XC6A 5C5UA 1AXYA 2DBNA 3KM5A 5FP9A 2HWD3 3C3VA 2K0GA 5JR2A 5DG1A 1OOPB 4MGYE 5T54A 3L2OB 4XJ9A 5FY8A 4YFWA 5FZ9A 2BNOA 1QQP1 1NCQA 5H9PA 3VBFA 1GP4A 3FLPA 3RNSA 3TEYA 2YBKA 4F3JA 1N3OA 1ZYBA 2HWC2 1OVSA 3QACA 4LA3A 1QJX2 5CFCA 1FZHE 4QB1A 4X6QB 3T2OA 1DLCA 1RUJ2 2Z69A 3KHBA 1GMMA 4FSJA 3KV4A 3BTAA 3I3MA 4ITCA 3N9QA 5CB7A 5BNNA 1RYYA 2VZVA 3ORJA 5EZWA 3Q8BA 3F2ZA 2V5DA 2C9AA 3C6OB 4LQRA 4QHBA 3WF2A 1MQTA 1YO8A 4PIZA 3RYKA 4H3WA 3N1BA 1LULA 3DXUA 1G86A 3SLIA 3FHIB 1GUIA 3E6CC 2ZMLA 3R0RA 4RGAA 5GALA 1AR61 3TN91 1JYNA 4K1ZA 3ZSLA 2VD7A 3RZMA 1CD3G 5AVAA 2OA2A 4R9AA 3NE6A 1VBE3 5LB6A 1GZCA 2JKBA 4CXXA 5FZEA 1DDLA 1MEC3 1YIFA 1Y4WA 2SBAA 2HWF1 3N36A 4R9BA 3S5QA 1D7PM 4AAXA 1G9CA 1DZTA 2WO7A 4IE6A 4XFCA 3BIWE 4LHNA 1HRI1 2RDRA 1AX0A 1CZVA 1DYPA 4JDMA 1BXHA 3C6PB 2VUAA 4Y1UA 3ZO0B 5AC91 3VHOA 4XHXA 1WLCA 2JDKA 2PHUA 1N1VA 2QZ3A 4R52A 2Z4FA 1IS4A 1GWKA 2WNEA 3N7MA 3KF5A 5GM0A 4RGGA 3SXWA 4BK5A 3ILNA 3DPRC 3E4WA 1QF3A 1W6NB 1Y3TA 4KU8A 4COYA 4AFMA 1E5RA 3O1RA 4EYWA 1UYPA 2TUNA 4LPLA 3BVOA 4RQPA 5FREA 3TOJA 3JBG3 4E2SA 5SV5A 4LBOA 1V6KA 4FPLA 4CP9A 4QPIA 1S55A 3WNLA 2HWC1 2UYAA 4OVEA 4XAAA 5G04L 4NHMA 3R4UA 1LHVA 1BEV2 5FZFA 5KHJA 2WFPA 3HGKE 4Y4RA 3PMSA 2DYCA 2A6XA 1RUJ1 4YARA 1QEXA 2ZGTA 3W58A 4NOTA 2TBVA 1U5YA 2VR4A 3APBA 3ZFFC 2ZEXA 2G19A 5FZ1A 5FLJA 4FJ5A 5JXGA 4D3WA 1DP0A 2OZJA 1RUG2 2GAUA 1NCQB 3VBFB 1J3RA 5EJZB 3FL7A 2PFVA 1QXJA 2F4LA 3WVJA 3A22A 1R093 2RM23 1W8ZA 1XVDE 5FOBB 2P3KA 5CFCB 5FZ0A 4DNYA 2DUOA 2QQMA 2X10A 5K0UB 2IXIA 1OKQA 2EXKA 4LHKA 5J36A 1QKQA 4J2BA 1A8MA 3AXDA 4KI5M 1KD7A 5SV8A 3ZYGA 4AFCA 2LM3A 1V9U3 3SPYA 1VAVA 2BPA2 1W6PA 3RRDA 5C3RA 3VZMA 3CJXA 1JZ3A 5F5CA 1MACA 3WD5A 3ZMOA 1BYHA 3JQWA 4UAPA 1HQNA 3ZXEA 1C8M3 3GXUA 4A41A 5C9AC 4HETA 3D4KA 2DCJA 2GP5A 4LBQD 3WG4A 5K7PA 2R49A 3BYWA 2MW2A 4E9KA 4DPNA 4CCEA 1SFNA 2HWD2 2EIEA 3TABA 3WSOA 1ZBE2 3AKSA 4UI9L 4YW3A 1Y43B 2WBKA 4MGQA 5BV6A 2WWSA 2GC3A 1J1LA 3ZN6B 1BEV1 5IK7A 4XUPA 1NG0A 4YZ2A 5CFDC 2BTVC 2W46A 2VMIA 1YQ6A 4Q1RA 1HIXA 3ZSMA 5EV7A 4AWDA 3ZXGA 1FZIE 3ZFEA 5J1XA 1AL21 4HK8A 2H0BA 3IDCB 4YGDA 1BJQA 1NE6A 4GH4A 4CDUB 1DQ2A 1ULFA 2ZZJA 3INAA 4Q26A 2E9QA 2J1VA 1RUG1 1US3A 2UWCA 5IREA 2DWRA 4P9JA 5F5QA 3V0BA 2WNUA 4CPBA 5F3EA 5IWFA 4CP9B 3POJA 5BNOA 1JOBA 1ONAA 1T6GC 3PVEA 2VW1A 1YJKA 3KT4A 1MVQA 3HNBM 5FJHA 3M8LA 1I5PA 3HQRA 5I0SA 3UGGA 3PL0A 4Y22A 2CL2A 4HPKA 2ZOEB 3QH6A 2VJ5A 2IC1A 1WKYA 2JDNA 3ACIA 3JUUA 4RR3A 1FNYA 3DF0A 1MEC2 2E63A 5FUIA 3HN1A 4Q4X3 4PQQA 1CJPA 4NHKA 3WCSA 3IB3A 4Q0UA 3CMGA 4QQHA 2B46X 4RFT0 1C3HA 5FRAA 2WZEA 1O8PA 4N90A 5FP7A 4EP9A 3TRSB 3USSA 1A34A 3IIAA 4FQ4A 1WLTA 1VBD2 1EY2A 1KXGA 3WDXA 4KNCA 4MX3A 5FLIA 4AVCA 4QMAA 3S30A 1TE1B 2HWD1 4LA2A 3ZXKA 5E8AA 1ZBE1 2V09A 4ZS3A 4WVMB 4LHSA 2VBDA 3VBHC 3WF1A 2P34A 1OVPA 4FVMA 4CSWA 4KGQA 4CVUA 4Z07A 2W1UA 4C0HA 3EB7A 3E1F1 3QNNA 4CP2A 1I5ZA 2A3WA 2PHXA 4LTAA 4RL7A 3GZTB 1KDKA 3Q8FA 1CVNA 1HKDA 1HV1A 4R8HA 4NHYA 5A7WA 5FFOC 1UW8A 1O6UA 1IQAA 2DCKA 4YGBA 3VUOA 1LEDA 1SBEA 2J1SA 2YC0A 3AX4A 1DHKB 1CPMA 2BNNA 5FO9B 3SCXA 2CGPA 4Q8LA 1U0AA 2QQWA 2E51A 3E5QA 2NMNA 5LBBA 1Z0HA 5B4NA 2FDHA 5FPBA 2HD0A 1C4RA 1UOBA 2QE3A 1O59A 4KBZA 1RHI3 2VQ0A 1Q3EA 2LS6A 2JDHA 3JU9A 1OFSA 2AREA 2QQLA 3T3YA 1TMF3 3HT2A 4EN8B 2GC1A 3SC7X 5BPXA 2O8QA 2O14A 5IVBA 1SCRA 1SFPA 1R092 5T5PA 2DDUA 4K40A 4LKEA 3A4UA 2XONA 1JYIA 2EICA 4NAMA 4MLOA 4MSVA 5F1RA 4ARYA 4ADOA 3L9JT 1XL3C 1TVGA 1O3TA 1VBE1 3NJVA 1PO23 3MV01 2VO5A 1POV0 4IEWA 1MEC1 3J26N 1NEXB 1WW5A 1F15A 4DTUA 3SEPA 4K8FA 4SBVA 5FYSA 1RUNA 2VOWA 2Q30A 1UX7A 4C1WA 4MGIE 4OHXA 1WLDA 1CONA 2FDIA 4CDWA 2A3YA 4YG3A 4AGRA 3KGZA 1F4AA 2QQNA 5BNOB 3S7IA 1VBD1 2OYZA 3ACHA 1JHJA 2J1TA 5F3GA 1TQ5A 4GMP3 1U5XA 2ZGSA 4D7TA 5FTTC 4PLMA 3UJOA 3MI8A 2GMEA 4MO3M 3UO3A 3VBSB 3WDTA 5IVCA 2RS33 1MZ5A 4BQ2A 3W20A 4RR3B 1RUOA 1S0DA 2JG9C 3AFKA 3WQ0A 3AYCA 4FK4A 1JZ7A 2BDRA 1JS9A 2BZDA 4YZ5A 1X8MA 1O3RA 3AZVA 1ZNPA 4I01A 1NOVA 1W8UA 4IE4A 3POWA 4IESA 1XNBA 1VRBA 5FY0A 1A78A 2HJIA 5JIUA 1RMU3 4JQTA 1K3IA 3OTFA 1RUH2 2B7MA 1DZQA 1TNFA 2VCAA 4HN1A 2JE8A 4YW5A 4YW6A 4J1WA 2E53A 2ZZQA 4O61A 4XJ8A 1ST8A 4PI0A 1NKGA 2VUDA 3D8CA 4KG0A 1DBNA 1BLZA 3FHQA 4RN5A 4RS5C 3I2FA 4N9HA 2OYQA 1R091 2WFF3 4YVSB 1CAVB 4UW4A 2G9GA 4XQ4A 4R4ZA 4I6JB 5K0UC 5A70A 2ZGMA 4AI8A 4QWNA 4AXOA 3UO2A 1IG3A 4XF1A 5C3PA 1GYKA 2Y26A 2VUCA 2JQTA 1WCQA 1IPKA 4N7UA 2DTYA 2D5FA 4Q4X2 3MV11 2OIIA 2XOMA 3J27A 3KCCA 3NGIA 1EYBA 1YWKA 1D2QA 2D7FA 3MUZ1 4AGGA 1W6OB 4UF0A 4M4RA 4AEMA 3H8RA 1MS1A 4XF0A 5T52A 2BJSA 1JTZX 5EXOA 1VBB3 1DGWX 1OMIA 4RSUA 2OX0A 4HCCA 4L0PA 1FZ4E 3VZNA 1G9BA 1J83A 2A6YA 1VBC2 2JE7A 2Z2SB 2ZTNA 2ID4A 2IXJA 1JYTA 5T55A 4KL1A 4RGKA 1NY72 4EN7B 2RR12 1NZCA 1LR5A 4CUAA 3U1XA 1BZWA 4DEQA 1MTYG 5KC6A 4XPVA 4NROA 1RUE3 1YYNA 4BLIA 4XQWA 2ETEA 4XCBA 1FATA 5C4WA 1H2NA 3SVIA 2VCMA 4U2AA 3P5BA 2Q1MA 2BFUL 2VOXA 1J58A 4QU1A 5JSOA 5C71A 2YU2A 3LA3A 3DYOA 4XUQA 3SQOA 3NL1A 3DL3A 2CAUA 2QXFA 4QB6A 2B1EA 1DQ4A 1OPMA 1RHI2 4DU3A 3KVAA 5KR7A 3WEZA 3BI3A 3QEXA 2UYBA 2VTXJ 3EJKA 2Y6LA 5A6YA 4CEWA 3SHRA 2QTWB 3GCXA 4HMZA 4FJKA 4JGYC 3TB0A 4K3UA 3WNPA 4B3NA 4FOYA 3AFGA 4NHXA 4QX1A 4E27A 1QOOA 2CHHA 1Q9YA 3PVBB 2VJ4A 2OVUA 4MHRA 5JSPA 2PMWB 4QX0A 1PIV3 4AE2A 4CUCA 4Y24A 4J2AA 3BGAA 3HVDA 3KWVA 1TZOA 3N9PA 1XSQA 2VNRA 1PO22 3R05A 5FPAA 1PGL2 2R16A 3VGIA 1REDA 4PF1A 4UFJA 4ICGC 4Q4X1 4LO7A 5T3NA 1GQPA 1OQ1A 1OT5A 3LEMA 4DEVA 4LO8A 1UQXA 1F9KA 1S0CA 4Q2FA 1Z78A 1W6MA 4KGGA 4FJ7A 4M3UA 4E2GA 4X8NA 2JD9A 3CFOA 3VZKA 2UY9A 2VMEA 3RMAA 3AMQA 1QJEA 1HRV2 1WCUA 1FXZA 1VBC1 4TYSA 2C6SA 4KHWA 1NA1A 2QNKA 1NY71 2RR11 5HXMA 5F6LB 4ASMB 2RS32 3J7HA 4JX0A 3NNGA 4N53A 4NN0A 4DUVA 4QPGB 3USUB 1ENRA 5IBKB 2OQ6A 3MW4A 1S0BA 3M7AA 5D1IA 5JSRA 2RCUA 4YW1A 1F5JA 1LTEA 1UZ0A 1RUI2 2NMOA 2RG4A 3IMMA 4CDXA 4CEYC 2C9KA 2J1UA 5LK7B 3H7YA 3BTYA 4LHLA 1W0NA 4LMFA 2D44A 3FLTA 3O5SA 1VMHA 3ASIA 3K46A 2NZ9A 4CDQA 1RMU2 1UL9A 1XBFA 4IE5A 4B7KA 1YFXA 3RSJA 1EAH3 1RHI1 3WW1A 5H9QA 4M45A 3M3CA 3M3EA 4Z8BA 2CWMA 1WCSA 5FZDA 4AQ6A 3POFA 4AQ2A 4O9EA 1TMF1 5D8AA 5FXWA 4KG8A 5L36A 5L9BA 3MICA 5FPUA 3JB4C 1AR93 3LQCA 4YVWB 1PZ8A 1XU3E 1A8DA 5JXHA 1ENXA 1WA6X 1H1MA 1C5HA 3PURA 1ZA4A 3EHKA 5FPXA 3WNKA 3L1NA 1PO21 1PGL1 1AZDA 4B1MA 1YFYA 1PVXA 1HN1A 3JQXA 2PTMA 5I0RA 4XMIA 3LEKA 3ZYBA 5JOZA 5L7OB 5BXXA 3OY8B 1WD4A 3NV2A 3NMBA 4XUNA 3D0SA 2P37A 1LENA 2P1QB 1YQ2A 4MGKE 1OQDA 1NZIA 1SLAA 2GMPA 3KCYA 1HRV1 1VBB2 4H2AA 5FY5A 3ILRA 3K75B 3VZLA 5EQUA 2YFZA 5H9RA 1D4VB 5J7MA 2D6OX 4JKLA 1D0GA 2H6CA 2R30A 2VXRA 4M3WA 3OGRA 4XAEA 2RS31 1OUSA 4GAZA 2VQUA 5KXDA 4QX3A 5DUWA 3SQ0A 2IZWA 2VXJA 2WNOA 3KD4A 4D6SA 4ZZ5A 1SQ4A 5K4LA 4XURA 2FDJA 3G6JB 3PDQA 3BPSA 5C3SA 3SH4A 1RUE2 3H3ZA 4GMP0 5FMOL 3SUPA 2BEOA 4FPOB 4BPZA 1JYCA 3O1MA 5FYCA 1UY1A 1HQWA 5JR7B 4IGOA 4MXVA 4IXLA 1IH7A 5HV0A 3PNAA 1RMU1 3W9AA 3FMGA 3MHZA 4K9SA 1PMJX 1NA1B 4U36A 3WDYA 3FBMA 3POIA 2JB4A 4KMQA 1DGWA 4JGZC 1PK6B 5DZGA 2VY0A 3ZN4A 1SLIA 2P1OB 3IAPA 4RFRB 4W6WA 5F8PA 2SLIA 1KEXA 3PIJA 4N53B 2RVAA 1SPPB 2K2SA 4GALA 4Q4W3 4UW3A 5ANNA 4AHZA 1UY0A 3NNLA 4WM7B 4YVSC 2CAVA 1H2KA 2Z5WA 5EJ3A 4CU9A 1ODMA 2WNVC 3N4MA 4DFSA 3GF6A 4A7ZA 4AKHA 2P3JA 4CDXB 4D94A 4FK0A 5CFDA 4NIDA 2BOJA 1O7FA 1PIV2 1QH7A 1B09A 4IL7A 4CDQB 4CCMA 2B7YA 4K7JA 4OZXA 2WYSA 1WAFA 5F32A 2ZGNA 2V4VA 1RVF2 1PO13 2ZGUA 1B35C 2E26A 2JDMA 3EO6A 1H6XA 2A6ZA 4O65A 4HSLA 5IJRA 2Q8EA 2MMBA 4DTRA 1WW6A 1YFWA 5D8AB 3WUDA 5LEJA 1GZTA 5CYYA 4CYDA 3FLRA 4Z1VA 5DZEA 2WWJA 1MZEA 4YM2A 4AOCA 5FR3A 1VBB1 2RMU2 1JZ2A 2PLV3 3PU3A 2VZRA 4LXLA 4D6QA 2XQXA 3W5MA 3K77A 2XBO3 4YW7A 1C8NA 2PFTA 3U75A 2D6MA 1ND3A 1G8WA 4PBOA 4DTNA 3AZWA 1Q8OA 4IV3C 3R6SA 1ZZCA 1A3KA 4PF5A 2YU1A 1YQ5A 4QXHA 2KM2A 4CE8A 3SMHA 2VZ1A 1IG9A 1GQGA 5KXCA 2DEBA 2W91A 1W04A 1RUE1 2DU0A 2JHPA 3C7FA 3RWUA 1H8TC 1L3JA 3N3HA 3ZKUA 2GNBA 2WQZC 5FBJA 3T30A 3NVCA 3LDSA 1DCSA 1I3HA 3MPPG 1HB3A 5JWPA 3I3QA 2D6LX 4I02A 5I93A 2VZTA 1UKRA 3CQ8A 5IVVA 1PNFA 2IXCA 2P1BA 1XNCA 4IEUA 4UXAA 1EAH2 3VBHA 3SNNA 2Z79A 3PMEA 1I9RA 1XB9A 5AFBA 3WY6A 4FCAA 3O1OA 3WW3A 3DUIA 2ZGPA 3ZFGC 2QVSB 5KHIA 3I54A 2K5SA 2PAEA 2XKOA 3DEMA 3SKJE 5IATA 4YLZA 1BBT3 3VDDC 2WL1A 1PIV1 4K20A 3ACFA 1UPSA 4IE7A 4WVWA 5F37A 1K5JA 1H4GA 2RJ2A 2WLPA 2ATQA 4AZZA 3A21A 1F2NA 1WCDJ 5CG8A 4A6OA 1RVF1 4FOVA 4OCTA 2D98A 4AI1A 3VV1A 5E6HA 2BBAA 5C3QA 1LHOA 4WM8B 2P3IA 3OUHA 4MOAA 4BQ3A 2Y6JA 1FZ8E 4LE4A 3AYDA 4NWVA 3C94A 2VVDA 5A7SA 4H55A 3O1UA 2RMU1 4M01A 3DYMA 4MH0E 1DQ5A 2W3JA 4ZXEA 3WQ7A 5FZCA 3VDCA 1PHMA 4QGNA 2DFBA 2DU1A 2XJTA 3C7GA 3N9MA 3HQXA 4CCCA 3KD1E 3MIEA 1WD3A 4BCUA 4A6SA 3SJJA 3WHTA 4M3YA 1HRI2 3B9CA 5FP3A 3J7MA 5AC92 5JDBA 3MZHA 1V0AA 1QWRA 5FY9A 5ABJC 2FMYA 1ULOA 3E97A 5FZ3A 4HXCA 1MZFA 1O4YA 2L9LA 4CCDA 2B45X 4FFIA 4GJYA 4WZCA 1HN0A 4B4QA 3EMRA 5FY7A 2JG8C 3AK0A 1CAXB 4ZHNA 3AZYA 4RNGA 2VMHA 1SBDA 4FJ9A 5JZGC 4OQ8A 1ND3B 4HFSA 4M41A 5IUQA 1XU1A 4HCBA 3WF4A 1EAH1 3I2JA 3B69A 3O12A 4C91A 3UYJA 2JG9A 2ZEYA 4JKKA 4XVHA 3AC0A 5A32B 1NCRB 1GANA 4LEJA 4Q4W2 5JI7A 4EN0A 4F7ZA 3B3QE 4QPGA 3CEWA 1CZSA 4GKXA 4MVTA 2WZR3 4TLGA 3VBRB 4RL5A 2ZKLA 5JMCA 4HVOA 1AR91 2VZPA 5EWSA 2JH9A 4BK4A 2Y0OA 2ET1A 2VUJA 2A73B 2GU9A 3RYPA 1W9FA 2D40A 2JDUA 3CJIB 4KWJA 1OLQA 5D2AA 5K8SA 3AMNA 4AEDB 4XDOA 1POV3 5EFUA 2EAKA 4I0WB 2NP0A 4MUVA 5T5JA 2FMDA 1PO12 1K42A 1M4WA 1Y9QA 4E3SA 5GZGA 4FFFA 1CQ9A 2H6BA 5GJ6A 5A33A 1FT9A 3PHMA 3URFA 1MS0A 3T2PA 4ZS2A 2XGXA 2D3RA 2ZMKA 4DQAA 3KLSA 2WQ4A 1ND2B 2CWSA 2PLV2 5LY1A 1AHSA 5E89A 5I8TA 1RUF3 1OUXA 1H0BA 1HXS3 4QT6A 1O5UA 3WNMA 1ENQA 5J09A 4W65A 4AFAA 2TNFA 1FMD3 3U10A 4PDWB 2XVKA 4MV2A 4TSVA 1AJOA 1GU3A 2HYXA 4IUGA 4NIIA 3LAGA 1FPOA 4QNDA 1X33A 1BMV2 4IGQA 5FKBA 1AR83 1OHFA 3I3EA 5FWEA 2ZCWA 4FPGA 3U14A 4AI3A 3RZHA 3S0MA 4BISA 3MW2A 4M3CB 4AYUA 4FJLA 2GSYA 3H7JA 1W9SA 1GWMA 3GZEA 1QDOA 4AI2A 1SCSA 1PK6C 2Q5TA 3CKHA 2K9ZA 3P6BA 4BDVB 4I2OA 1TME2 2YMZA 4KHQA 3ZOIA 3ZLIA 2XJVA 1UWWA 1XE8A 5HBAA 1ZRRA 5LA1A 4WZFA 5A3NA 4Q4W1 4XOGA 2JHCA 1LOFA 1K12A 2G9ZA 2ZKNA 4JVAA 5I91A 3SISA 5LZ6A 1UNBA 1J84A 2JWPA 2W87A 4YRDA 3ZPOA 4ES9A 2ATFA 3CL1A 4FPFA 2JECA 3NV4A 1BBT2 1RXGA 3AKRA 2QQJA 5JCTA 3LZJA 2BERA 2V72A 1SBFA 2VOVA 5IYYA 3RFRA 5C8CC 1IPSA 3CQOA 1AL22 3I2GA 1CIYA 4GZ9A 3TNPB 1N1TA 2BRTA 3M3QA 2PFWA 3U11A 4AFBA 4EN9B 5HPOA 1FV2A 1PO11 4FAGA 2AZ5A 3N35A 3THPA 4EWAA 4FBFA 3CFRA 2DUQA 2ORXA 3OUJA 3RMCA 2GNMA 1QNWA 3OGSA 3OGKB 1EV13 1H1IA 1JU3A 3B02A 3OGVA 4P9YA 1ZM1A 5JMOA 4S2FA 2YG0A 2EF6A 1SACA 2CSGA 2PLV1 2YFUA 5L9VA 2ORZA 5F7UA 2XBO1 1U5ZA 1V6NA 2WAOA 3LA2A 1JW6A 3KB5A 2VNGA 4E4ZA 2KXLA 1N1CA 4UFKA 1C1LA 4DO0A 3IPVA 4ZU7A 1O91A 3VKFC 1S1AA 2E7QA 3NHGA 2OUJA 2YDEA 3LDBA 5BNNB 4J6GA 4B29A 5EJ1B 4IV1C 2LROA 4LBLA 2VCCA 1CWPA 1BMV1 3PU8A 1QDCA 1MQTB 3NNJA 4FP2A 1Q8SA 3LFMA 2OVPB 1K5MC 3C2UA 4BE3A 4CP0A 1LOBA 5LBCA 3VKLA 1W2UA 4P00B 5J98B 2ZXQA 3GYDA 5FYZA 4QNCA 1YCIA 1WW4A 1LODA 2IVIB 3QBQA 1JH5A 1GZWA 3M4FA 2VU9A 3ME2A 3K4ZA 4A2UA 5JXJA 5FZAA 1AR73 1TME1 1W8HA 2FCVA 3HBKA 4KU7A 3GZAA 3S5AA 3HNYM 3WDUA 3UV9A 4ORFA 5DAXA 3WF3A 2Y34A 4BWOA 1FZ2E 1X36A 1R083 2WO1A 3ZSEA 2GH2A 5J48A 4BMBA 2WRAA 1BBT1 4CEYA 4IGPA 4CCOA 3ST7A 4NVPA 3GBFA 4QX5A 4CP1A 3OJBA 3OPWA 1DIWA 3AL6A 1CAWA 2OPWA 2NM1A 3A23A 3ZSKA 3ZMNA 1TEIA 4XF3A 1O4TA 4BQ4A 4JDOA 4OULA 5T5LA 1VJ2A 4RQPB 3UKTA 5H37A 4DTMA 2AH2A 4UFIA 4XF4A 2BNMA 2E7AA 4KHSA 2WSVA 3J8F3 1HV0A 1YI9A 4QPIB 4PIXA 3WQBA 3GJAA 3EYPA 3IKWA 4D8MA 2R7EB 3RG0A 1LECA 1W8TA 2VBBA 3HOBA 3I3DA 4ZKTB 5LWBA 1ZRDA 3PJQA 1ZA7A 4NAOA 1NLRA 5BUVA 2YGLA 3VBOC 3WXPA 1VBE2 4GB33 1PGW2 2LRPA 2X5IC 1HXS2 2NN8A 1G9AA 1QGLA 1UZWA 1KJRA 3FN9A 4UBGA 1H4HA 2IFWA 4R4XA 3I2HA 1OA2A 4N43C 4A3XA 2WINB 1AL0G 5DQ0A 3RWKX 1MS4A 3I4IA 2QFEA 3IZOA 1QU0A 2EXIA 3PIGA 1AR82 3HPNA 2YC2A 3VBUA 3MYXA 5FJKA 2CYFA 1OPOA 3GHMA 1PGSA 3TL8B 1OOPC 4QX7A 4BXSV 4AKIA 2ET7A 3ZYPA 2PXJA 2W92A 2A3XA 3TJYA 4CU7A 4NIGA 4CXYA 2BU9A 1EP0A 4YG6A 3IPVB 5DAPA 5LA0A 1MHYG 3BODA 4IDZA 2E6VA 3VKOA 3JBG2 2ZGOA 1W6PB 1RXFA 2R063 2WA4A 3PUAA 1JZ8A 2J1RA 1GBGA 4BYYA 1GOGA 5GLVA 3HNMA 4AVBA 2ZHNA 5FOJB 2R073 5IHRA 4FFGA 1AX2A 4Q1PA 2B9UA 3H8XA 3TEZA 4Q29A 4OUMA 5FZOA 3FJSA 3OCPA 2CDOA 4DMIA 2GNTA 4XC9A 1OLME 3M70A 2XR4A 3QH7A 3SNMA 1XE7A 3GZUC 2VMCA 1GZWB 3LCPA 3ENRA 5FZMA 2X05A 5GKAC 4AEKA 5DUUA 1W2NA 4YM0A 2RJLA 4JGZA 3HN3A 1OD5A 1POV1 2CGNA 4HBNA 4I09A 5FYBA 4ARXA 3VHRA 3IWZA 4IQPA 1U5IA 2P4EA 3H3UA 4J25A 1IS3A 1V6MA 2JENA 2CGOA 3WG2A 2RM22 2GP3A 4YSFA 1EV12 3MIBA 2WNVA 3P1IA 1QJU3 2EIGA 3FHAA 1DLLA 4YW4A 1XNTA 2ZAAA 1PGW1 1RUF1 2OXBA 1WMFA 1HXS1 2VE1A 3C8XA 3O1SA 3ZFEB 5A1FA 4RA0A 4GWNA 1D0HA 1PX3A 1V9U2 5A1LA 4GH4B 2JHAA 2B39A 3V0BB 5ACA3 4HLTA 2BFUS 3IIIA 2WNUB 4ZY9A 4CUBA 1AR81 4DTOA 5FPVA 1D2SA 1C8M2 1H9PA 4I3GA 4YYOA 4DS0A 2W47A 3AVRA 4FJIA 2QCSB 4DXTA 1XRUA 4Q5OA 4Y22B 2D93A 4HPKB 5A7PA 3ZYJB 2QBXA 3SUOA 2XH6A 1KDMA 4XABA 2YC4A 2PQSA 5I8YA 4IV3A 2ZX1A 1AR72 3G7DA 2VECA 5F2SA 3JBG1 2I45A 5ISLA 3S7EA 3UKNA 4J2EA 2QQKA 5FBZA 4EJRA 1CIWA 1IPJA 3UGHA 3V64A 2HKXA 4XDQA 2YB7A 4JC1A 3LOIA 2E32A 4ADNA 5I0DA 4XFIA 4UFMA 2ZMNA 1IHMA 2VL4A 3LZZA 4GD4A 1R082 4EROA 3VL9A 2ARCA 2HWE3 1N1YA 1AJKA 3K48A 3BU0A 2OW4A 2YPDA 4XTMA 2P1MB 1W8NA 4COUA 3BALA 2JX9A 5CAZA 5FO8B 1J1TA 3TAYA 5I0UA 4QQ2A 1W3XA 2LW8A 3VBFC 1NCQC 3DKQA 2MZWB 3KS7A 1ZRIA 1W0OA 2JJ6A 3K4AA 4CXWA 3J8F2 1SHWB 3VKNA 4ZU4A 5CFCC 2RM21 2R043 1EV11 4DRRA 4LULA 1ZZ8A 3ZPYA 5A7WB 3BIEA 3MEPA 4LKSA 2G4IA 1ZZ7A 3CIHA 2W9XA 5FP8A 1UN1A 1ZZ9A 3MIGA 3VDDA 3H1YA 1E5IA 1ZVFA 2ZS6B 3NNMA 4RHV3 4GB32 2ZGQA 3GNEA 5E88A 5A3MA 3WG1A 4LK6A 1A6CA 2RS13 1V9U1 2WABA 1PNGA 4HANA 5LASA 3TWIA 3CDZB 3SQ1A 3ES4A 3NAPA 3ZR5A 4AVTA 1E5SA 4BU2A 3UIQA 2WR9A 5FZBA 4KHUA 3S6PA 1OXCA 1YJLA 1IKPA 2EA7A 2OT7A 1C8M1 2X29A 4I3PA 1ZX5A 1VRH3 3GALA 2WYFA 2KR2A 3DKWA 4LBJA 5FMBA 3ZX7A 4QM9A 1CX1A 5LA2A 3LZIA 1IZ3A 2O0OA 5CU1A 2ES3A 4HK9A 3WW2A 3FC0A 1RJ7A 5BNPA 3MLJA 2C0ZA 3AMMA 4YZ4A 5E16A 4ASKA 2W5FA 1AR71 2GN7A 3IT8A 4COZA 4B1LA 2IXKA 5A3TA 2RHPA 4JCKA 4QKBA 4QQOA 2BVBA 4DOUA 1XYPA 3POEA 1ULCA 3SQ2A 1HB2A 1JXNA 2R062 4R9CA 4CTEA 1LGBA 4DTJA 1AYM3 3MGUA 4TLFA 4W6XA 4CDWB 5ABJA 1ZZ6A 1DQ0A 1R081 2VOKA 5E1RA 2CU5A 1F8VA 5EYYA 5FLHA 1YC61 4M0NA 1H1AA 3OGJA 3WINE 1GOHA 1DU3D 1HB1A 2ERFA 2Y6HA 5JZGA 2Y6GA 4XQDA 4CDUC 3VD7A 4XZPA 4MGSA 3DYPA 4LK7A 4B4RA 3PVOA 4XXPA 4QPIC 3RPQA 3ECQA 1TMF2 3J8F1 4X5MA 2VZQA 4LKDA 3T08A 1UZVA 2ZPXA 1SLLA 2DCTA 1SDWA 1UD1A 4GXLA 4QU2A 4BQXA 3AB0A 1CR7A 1YQCA 2AR6A 4OMDA 1UYZA 1QJU2 4L97A 1MR5A 2HYKA 4LITA 4HKWA 1UX6A 3ZR6A 1WLWA 4GB31 4JRLA 1YXWA 4WBBA 5FZ7A 3I8TA 1F4HA 3HJRA 3M3IA 2FQPA 3L2YA 3DXTA 2LF3A 1FX5A 3Q9OA 4XUOA 4B4PA 5FZ4A 5JAXA 1GQHA 3B94A 5ACA2 2DBIA 3ZN5A 5A1AA 1CAUA 3W59A 2EVXA 4ISRA 5FY4A 3RGBA 3KT1A 2R1DA 4Y5TA 2B42B 1JMUB 1XNAA 2JB8A 3JCIA 3BTZA 4KWKA 1UF2C 4XFHA 5IVYA 2GC0A 4NRMA 2JXAA 2C4XA 2D97A 4Y4YA 2RS53 1VIWB 1OFNA 4QDSA 4DU1A 5CEHA 1W8WA 3MFCA 1OH3A 4XZUG 2R061 3NAPB 2P6HA 1URXA 4P14A 4UF0B 2J1AA 2CNAA 3WNOA 2R0FA 4SLIA 3IDBB 3IBMA 2XVGA 1NXMA 3H8UA 4BMEA 4C8DA 1XU5E 1NQJA 4XJWA 2HWE2 4FOQA 3KF3A 2YV8A 5FZKA 4PIYA 4KI6A 2VW2A 2DCYA 1RUC3 3DPRA 1PVC3 1UY2A 1VB4A 2DVAA 4EWEA 2UU8A 5BYNA 2JIJA 5HV4A 4B8EA 4BIOA 1KJLA 1QY4A 5GLUA 5DDJ3 1YLLA 3AKQA 3HMYA 1MPXA 2WFF2 4FT8A 3RYRA 1ASJ3 2R042 2BYVE 2Q8DA 4DXZA 5C4WB 1J3PA 3VN4A 1XVEE 1QJU1 1LJ7A 2EIDA 4BB3A 2WT0A 3ZFEC 1X9PA 4XW3A 4RHV2 3ZXDA 5EIYB 1KS4A 3LKJA 5C8CA 4L9BA 4GH4C 3ZFFA 4P5HA 2D43A 2RS12 4RG8A 1QQP3 4ATFA 3MIDA 3ELNA 5ACA1 3V0AA 1W03A 1S2KA 4Y5Z0 2WN3A 4HN0A 4CEWB 5BNOC 3LIHA 1IQDC 3VB9A 2JD4A 2EIBA 1VE0A 1UZZA 4XFBA 2KD7A 1POQA 4CCNA 5FZ6A 3QEVA 1W2AX 2B8MA 2MPFA 3H42B 4GMP1 5JLVA 1VRH2 4A3ZA 3WW4A 3NJXA 3VBSC 3EQEA 3VHNA 3WLUA 3IDAA 4CPBD 3NV1A 1S0JA 1ZRFA 1ZREA 4RR3C 4K8RB 1CJDA 4EE2A 4AW7A 4IEQA 5F6KA 4HZFA 4LBQA 2MHFA 3D0JA 4OI4A 4I9LA 1Q56A 1H8VA 1PM4A 3LE0A 1BKZA 5TSWA 2VMDA 1K45A 3U4XA 4IV1A 3QEWA 2XJUA 1ODNA 3C7OA 1W6MB 1V6JA 4OLLA 1Q8QA 1J59A 4YNIA 1CESA 1K5MA 2ZX4A 4QB2A 5FCCA 1GSLA 3HIFA 5C9AA 3QEPA 1AR63 2J7MA 3TN93 4PHZA 2HWE1 1QIQA 1C57A 1OQEA 5ANQA 5J3UA 3N7LA 1REFA 3R4DB 3PUQA 4QHOA 5HCBA 2WZPP 5FYVA 2DVFA 2C1FA 2XWJB 2XL9A 4Q4V3 2P17A 3T2TA 5G05L 3LD8A 3VLBB 5FK7A 3BB6A 5IK4A 4NJ4A 4EYUA 3J2PA 2XJPA 5HI0A 5JVVA 5JPNB 1RINA 5LATA 1RUD3 2WFF1 2FYOA 3NW4A 5A3OA 2R041 2W39A 5A7OA 3WQ1A 1FXXA 4LUKA 4OI0A 4YZ3A 1BVP1 2DF7A 3CHXA 4LO6B 4AHWA 5C7GA 2IUWA 4QX2A 4AG4A 2VGDA 3UETA 1XQNA 1XU2A 4FTEA 5GZEA 2XJRA 4RHV1 1WA4A 2XLAA 3I2IA 3WG3A 1XVFE 2WT2A 3DPRB 1GFF2 1RJ8A 2V73A 1GNYA 1NE4A 2RS11 4FJJA 2VPVA 4P08A 4QM8A 3BTXA 4M42A 1WUVA 3UL2A 2OVQB 4N7IA 2VZSA 4S2DA 3LB9A 4J1XA 4FOWA 3QETA 3CNAA 3MIFA 4JQRA 1QJX3 3LSDA 4QX8A 3BUCA 1S0IA 1Y9MA 5FP4A 3UESA 3TAGA 1VRH1 5EP9A 2GN3A 1MS8A 4NPRA 5CKMA 3KV5A 3B9IA 4ATEA 4M00A 2OZSA 3VBOA 4QPYA 1OD3A 2FHRA 3NKGA 1CX4A 2X5IA 2FBEA 1V6LA 2RS52 2IFRA 1R1ZA 4Y20A 2VMGA 2QQUA 2FCUA 4MADA 3ZFFB 1S0FA 4EZ4A 1PZ7A 4N43A 1LNSA 1WCKA 4XMAA 4FPCA 4A7KA 4CDWC 1L7QA 3A0NA 3AKTA 1LRHA 4RD7A 3RMBA 4CUGA 2ZX3A 2Y6FA 1V6IA 5L9RA 3GJBA 2PA7A 4AF9A 1SLCA 3K51A 4OUSA 4XTPA 3FX3A 3D5OA 4XBQA 4FFHA 1GR3A 3ETQA 3OSDA 4M3CF 4CRQA 1RUC2 1PVC2 2QDRA 4IEPA 2B9VA 3HBZA 5DAVA 3OBRA 4LBQB 3DV8A 2ILMA 5FMCA 4FJGA 2XUMA 3QD6A 2WZ8A 4MXWA 4XACA 1H30A 5DDJ2 5FXVA 2AC1A 2YY1A 3FUQA 1LEMA 2GC2A 1AR92 1VP6A 1PX4A 2Y0IA 1QNYA 4QQLA 5FYUA 3VL8A 1N1SA 4PQ9A 2VCBA 4QXBA 2E33A 2YBPA 1SMVA 2ZABA 4JTOA 4QKFA 2XL7A 3ALQA 4X5NA 1OH4A 1FYZE 1GLHA 3BVCA 3TNQA 5IK8A 1UU6A 4D69A 1BK0A 5C6CA 3KMHA 1OI6A 5FO7B 3RZJA 1PMIA 1ZRCA 5GZDA 1KRIA 3GDBA 3MKSB 4GWIA 4PI2A 5JOWA 2UWBA 4LT5A 4DB5A 3AP5A 2Y38A 4GWMA 4NR1A 5CFDB 5KWRA 1RC6A 5FWJA 4JAAA 5J37A 2Y8KA 4IT5A 2WIIB 2RS51 1OBNA 1FYUA 4QPGC 2PHDA 5ERLA 1P22A 1S0EA 3RMXA 3NKTA 5LBFA 2MEV3 4XFAA 1ZBA3 3V56A 4GJZA 5F9TA 4QKNA 3POYA 4AKGA 1DYKA 4WV8A 4V2VA 3O7OA 1JZ5A 1OA4A 1NLQA 2ZHMA 1XYNA 5A80A 4OMCA 4QAWA 4Y1XA 3HEIA 4PT6A 1C5IA 1TG7A 3T0AA 2H4TA 1UMHA 1W6NA 3CF6E 3K3OA 1RUC1 2VOTA 4UFLA 1PVC1 4G3YC 1FOD3 3SITA 2DURA 2MNGA 2J1EA 4Q4V2 3RVHA 4P9GA 5H9SA 2TEPA 1BCXA 4Y20B 1BVVA 5A6XA 1W6QA 4Y1VA 4QDRA 1UPIA 5DDJ1 3VDAA 3H9AA 4L8QA 3SPZA 3SUQA 1RUD2 1W90A 4FPHA 3CLPA 4G4FA 4YVWC 1KGYA 5C4WC 1DQ1A 2JE9A 1UIKA 4OQ9A 4JDNA 3JZVA 4GIQA 4Y3OA 1OF4A 2OKXA 3T1LA 1FZ0E 4EN6B 3AZXA 5C3OA 1ACCA 1GNZA 1XMFE 3OD0A 3B00A 2A6VA 4A42A 1Y9GA 1ZBE3 2EAAA 4KHYA 5L73A 1XJAA 3AP9A 4ONUA 1BK1A 3BCWA 5CADA 4W6YA 5L7OC 3UT0A 3VBHB 1JYXA 4Z92B 3KZ4C 1LCLA 4CEWC 4E4DX 2I07B 1FZ5E 3LIGA 3OOXA 4RS5A 1W99A 4MXWB 1SZBA 5DUXA 1MZ6A 3IMNA 2BW8A 1W05A 2D3PA 3NJZA 4HOOA 1HJGA 5DMYA 3ON7A 2JDZA 4JKMA 2BUKA 2BGPA 2XBO2 2DVDA 5K0UA 1LOGA 4CA9A 3N7JA 4KQ7A 1US2A 1EUUA 1X50A 4JHTA 1UU5A 3O0XA 3FFZA 4YGCA 5AVPA 1W06A 3AP4A 4COVA 5FPZA 5AFEA 5FXXA 1Q8VA 2BQPA 2R32A 3VHPA 5LRRA 1ZZBA 1VALA 1IGOA 2VIXA 1UMZA 3VZJA 2X53S 2QQVA 1G9DA 4AHYA 2BVVA 3VZOA 5IVEA 4G9SB 1LHNA 2XB6C 3T4HB 1DFQA 2YZ4A 2ZA9A 4JS5A 1G6NA 4NRQA 1KQRA 1RB8G 1NA1C 5LCWL 2P5BA 3WDVA 3K4DA 3ZIXA 4Z2AA 2Q4SA 3A0KA 3ZXFA 4AQTA 2VW0A 2YBSA 3ZIWA 1QXRA 3LGRA 5LY2A 4N53C 4Q4V1 1DZRA 1NX9A 2QJVA 4GWJA 5IVJA 1F31A 1VMFA 4WM7C 4AVAA 3O14A 3ZN6A 4Y1YA 3RMDA 1WW7A 4NPMA 3DECA 1JBCA 5EPAA 3RMYA 5IFTA 1RUD1 5JXIA 4FJHA 1XPWA 4LOSA 3KVBA 4CDXC 3HP9A 4MHUA 4OYUA 4X6RB 1VBD3 4XHBA 2QQIA 3WNXA 1N3QA 2OUHA 4OHVA 5HCFA 4TWTA 3QCWA 4DINB 3H1MA 5F3IA 2ZX2A 4CDQC 5DXDA 3I97A 3UJQA 1AUYA 2W08A 1RGSA 4MGTA 1KS5A 1ULDA 1NQDA 4PCRA 4CDUA 3WR0A 4AI0A 4GAMC 1XYOA 1FI2A 5FZGA 3H1WA 3SCFA 2JG9B 5D8AC 1V70A 1MS5A 3OB8A 1AX1A 1LESA 1W6QB 1GKBA 4KHNA 3PUSA 4JGYA 2WSUA 3OEBA 1QJX1 3ABZA 1UOJA 4IE0A 4QD2A 4TN7A 4XFGA 3AMPA 2ZGLA 3AP7A 2R6QA 2VVFA 3BPZA 3PUHA 3L8BA 3JB8A 4Q8KA 4AI6A 4AAPA 3IM0A 3PVNA 2ZHKA 5F3CA 3SKVA 3ZYRA 2DVGA 4BXFA 4FJMA 2RE9A 3K3NA 4FPJA 3LOBA 1W39A 4ES8A 4P9LA 1Q43A 3WV6A 5KHKA 4INDA 1DF0A 4YGEA 4CCLA 3AL5A 1W0PA 3RZZA 1LGNA 4JRPA 1FAYA 2MEV2 1ZBA2 1ALYA 4P9WA 1FZ7E 4M0HA 3KD5E 2O8OA 2HEVF 5A33B 3NJYA 3S9HA 4RS5B 4I30A 1ENSA 2G9FA 4BOWA 4DIQA 2OZMA 1COV3 1OURA 1JUHA 1WMDA 2RDNA 4TXWA 3B01A 4I0AA 2YROA 3Q8AA 2W0XA 4LNVA 3NCIA 1VR3A 3C7EA 1AYN3 1DGRN 1CN1A 4FI9A 4C90A 2W2IA 3CZJA 2P5GA 2ARXA 1S4CA 3B7MA 4WVMA 1DGRA 1FOD2 2YHJA 3NNFA 3RJRA 3WUCA 4YFZA 1F35A 2ZX0A 1LOCA 2W94A 1STMA 2AEZA 4PJYA 2WLQA 4W50A 2OS2A 3OBAA 4KWUA 3Q8EA 3THDA 1VAKA 3BOPA 4EQVA 3KQ4B 1I1EA 4XEZA 1EUTA 3C95A 3CO2A 2WZR2 2Z42A 2VBPA 2WS93 4S2GA 4D7YA 5CA6A 2E7TA 1WZXA 2BOIA 2XMLA 3GGLA 1J3QA 3GBWA 2QUOA 2VMFA 1T2XA 2IXLA 4JV4A 4QPWA 5CISA 2PHTA 4BLJA 5JOXA 1JYWA 3RS6A 4WM8C 4IEZA 3T1MA 2VULA 4CCJA 3PTRB 5JOYA 3S57A 1H2MA 3WF0A 3TEWA 2VQTA 2AENA 2GDFA 4OI2A 4OFGA 1JZ6A 2GH8A 5CKNA 1XVGE 4D7SA 4NWWA 5HCAA 3AVSA 2YB5A 4ISQA 4PLNA 1RUH3 1RUF2 1UKGA 2YUEA 1MVEA 4XCAA 1JHNA 1UAIA 5JPMB 1MHZG 3WP6A 1SFYA 1YNAA 3GM8A 1U12A 1FMD2 2PQQA 3ES1A 1LU2A 1LHUA 5FUPA 4EV0A 2JEMA 5C70A 4DY3A 2XHKA 3RZLA 3NV3A 2MEV1 3N9OA 1ZBA1 2DUPA 3OYWA 4FP3A 5D21A 3THTA 5A7NA 1IOAA 1ULGA 2VG9A 1OF3A 2XHNA 4JGYB 3UGFA 2WUHA 5IAXA 1DQ6A 1JW2A 1ND3C 1E5HA 5CBLA 3O1PA 3CFPA 4LR4A 4H14A 3VBSA 5JUVA 1L7LA 1X9TA 4QDQA 4DTSA 4XILA 4A44A 4CU8A 5FZLA 4WVZA 3IAQA 2IWGB 1FOD1 3IDEA 3MW3A 3UK9A 2HEWF 4Y5SA 1QJZA 1NCRC 4Q0QA 4LIVA 3Q8CA 4HVRA 4HVQA 1UMIA 1O5LA 2WDBA 4UW5A 5KBFA 1XOYA 3TYJA 3VBRC 3AJYA 5FY1A 5LRSA 4URAA 2WZR1 3FE5A 1MS9A 5FK8A 3JD73 5FZIA 1NT0A 2FDFA 1UXZA 2FW3A 3EBRA 3ZXJA 2XUEA 4C1XA 1TNRA 1VBC3 2ZJCA 3CJIC 2Q1FA 3NWKA 4XYXA 3D3AA 4FXKB 4M3RA 2JPNA 3DN7A 4HKOA 4K21A 2RKHA 1GOFA 2RR13 1LOAA 2LF6A 4UOJA 3K2OA 4P02B 4UFHA 1WGPA 4B08A 3GBGA 3LEIA 4FO9A 2HH9A 4MG2A 2AUYA 4YVSA 1BHGA 3WP3A 1CAVA 2WN2A 3HD8B 4K6BA 1IG0A 1ND2C 2C5DA 2VH9A 1YEWA 3KQRA 3BN6A 4OI1A 4BM8A 4MYEA 4CEYB 3N9LA 2VVEA 3C6NB 4QGMA 3D6EA 4A7YA 4CU6A 1SEFA 5HXVA 2WAAA 1CAWB 3SCHA 4DZGA 4DUWA 4ZZ8A 4PDWC 1OLMA 2PAMA 4E4SA 1FMD1 1M06G 1H6YA 4URTA 4ZONA 1FZ9E 1HJFA 1QJY3 2WT1A 2IVJA 4YW2A 5IAVA 1W6OA 4E8CA 3NAEA 5F5AA 5KHGA 1B35A 1QMJA 3MLLA 2PAKA 5CIRA 5KHHA 3U4SA 2VNOA 3J7LA 5F39A 2BGCA 3VDBA 3RZGA 2XQRA 2WA3A 3PJYA 4W8JA 2D6NA 3L0MA 2E31A 1Q9XA 1COV2 1WBFA 3I2KA 4AI9A 5IT6A 2Y33A 5DABA 1R1A3 2RJKA 2OPKA 5DPNA 3VKMA 4BQYA 2JDAA 3O1VA 1LHWA 2ZEWA 3PTYA 1ULEA 1AYN2 3RDIA 1G7YA 4Z2WA 2HWB3 5L19A 4ASLA 2UY8A 5DG2A 3AMHA 1NUKA 4M4PA 2C24A 2WO3A 2YXSA 3MLKA 4Y26A 3OYWB 1N3PA 2PHFA 2AGSA 4DTPA 3SI6A 3N7KA 3KCXA 1H8TA 1CPNA 3NSTA 5CNAA 3FWEA 3VBUB 3NDKA 1HRV3 4F8AA 1UYXA 2WS92 2WWUA 1W9YA 3AM2A 3FUOA 1UO9A 3ZDSA 4HT1T 5CKQA 5LW9A 5LBEA 4XETA 3HR9A 3LDKA 3SQ4A 4AK3A 4FTBA 4QKDA 5FYIA 5FYYA 3ITQA 3ZYIB 3AP6A 2YGMA 1FPN3 3AKPA 3ZYFA 3U0ZA 1LU1A 3SUNA 4JHZA 3I59A 2CV6A 1SLTA 1RUI3 2W68A 3PLQA 4XE9A 3ZFGA 3NO8A 3SEEA 3VD5A 2P6CA 5GZCA 1GNHA 5FZOB 5A7QA 1YRZA 5A3UA 3L2HA 3RQ0A 3HT1A 4LBMA 1VPHA 3I2DA 3ACLA 4LOTA 4W4ZA 4AEJA 1O3QA 2YYOA 4KI4A 5BNNC 4BQWA 3E5XA 3SCGA 3LDRA 3N9NA 5F2WA 4E4HA 4JGZB 2HBUA 4ZXKA 1MQTC 1N47A 3THCA 4Q0SA 4YM1A 5FZ8A 3R4SA 2DFCA 2Y6KA 2ZAHA 4XIKA 1QXPA 2F17A 3RJ2X 1WAJA 4LJHA 3KV6A 3OBZA 2WNVB 1COV1 2J42A 1W9TA 3JXSA 3DCQA 4COWA 2P2KA 4RYDA 2ZGRA 2XG3A 2ADDA 1S2BA 3RI9A 3WZ1A 2IXHA 1AYN1 2VAUA 4FPEA 4H7MA 5FPLA 1EPZA 4OHZA 5A3LA 4BHPA 1O4ZA 4JTNA 5CVRA 1YUDA 1RITA 2DCZA 2OVRB 3USUA 1VAMA 4UBHA 2NQYA 2G1MA 3WOGA 1VLNA 1AXZA 1B35B 2PHWA 3LA7A 5A3WA 4AVVA 4GULA 1GV9A 1Y7BA 2PHLA 3MUY1 2F6BA 2R072 3OD4A 1C28A 1VBA3 3JD72 2LTNA 4AHXA 1HB4A 2WS91 4XXAA 3H3LA 2XWBB 4EZHA 1QOSA 2UURA 3BOWA 1SDDB 2JG8A 3OG2A 4OHYA 3AYEA 4CZSA 4IEOA 3WP5A 5F5IA 4N8MA 3T0DA 1QHDA 2P5OA 4RQPC 2WJSA 2GZWA 1D4M3 4IV3B 4CCKA 1APNA 3HQUA 5B4XA 2A70A 5C5TA 4DUXA 1Z7S3 2LUWA 4R9DA 3LWCA 4Y1ZA 3U07A 3E5UA 4BQ5A 2NYYA 4LBNA 1LOFC 2D6PA 2Q8OA 1PZ9A 3OGLB 1JUIA 2VQAA 1UYYA 1GWLA 3U37A 4YVWA 1V00A 2VZUA 4NRPA 1H8TB 4IEYA 4AGVA 4A45A 1RL3A 2A5ZA 3I7DA 2CTVA 2QKDA 2W95A 4P9IA 3BKZA 1BQPA 1RUH1 2XDVA 1FNZA 3OPZA 1PM7A 3LPGA 4Z82A 1KITA 5FMOS 3O1TA 1DG6A 1W3VA 2DTWA 1G9FA 1P8JA 3LF7A 1QOTA 4KWLA 4Y33A 1UY3A 2A6WA 3BU7A 3P3NA 4FXGB 5DN2A 1QJY2 4HG6B 4L92A 4KBBA 3ZDVA 5L7OA 3OY8A 2VTXA 3WX5A 1O3SA 1IKQA 5GLWA 5IZ7A 4YPJA 4Q4Y3 5FV3A 2BV4A 4ZU5A 3I59B 5I8SA 3WT3A 4B7EA 3KT7A 1NLSA 4NUBA 3ZFGB 4GA9A 5A6ZA 1W2TA 4TTGA 3VD3A 4XFFA 4YM3A 1T6BX 2XPJA 1R1A2 4QXCA 3VDDB 1FZ1E 4AQSA 4TZDA 3ATGA 4P5YA 2BP6A 2W1SA 1RVF3 2HWB2 4XF9A 3RWNA 4D6RA 3SH5A 1W28A 2QQOA 5CG9A 4IEXA 5LA9A 2P1NB 2YPJA 2NPIA 4EWDA 3OGGA 4Q0PA 5IW0A 2ZBJA 2EXHA 1R64A 2R071 2PYTA 2ZEZA 4V1PA 3O0VA 2RV9A 4KH9A 4FPKA 2RMU3 3JD71 3V65A 2B4KA 3H8OA 1GICA 3FZ3A 4HSJA 3ILFA 4QHZA 1JYVA 5BNPB 2XLFA 1PK6A 1REEA 3LSEA 1W8FA 2BWCA 4LORA 4E2QA 1MS3A 3ZM8A 2D3SA 1W2OA 1X7NA 3TEXA 1UY4A 2ENRA 4E4BA 1SPPA 1FPN2 4M3TA 2CDPA 4WM7A 3FFQA 1KFXL 3UNPA 3EXUA 4N9IA 3OBTA 4JRAA 4XJAA 2N7GA 1OC1A 5ABJB 4NMIA 2KA3A 2J22A 1AVBA 4NE9A 1UXXX 4JS4A 3J7NA 4FQZA 4IEVA 4BIFA 5J96B 4BH9A 2FCTA 1H9WA 1GZ9A 2XVLA 1HQLA 1KFUL 1YI7A 2JG8B 5FDBA 3ACGA 5JZGB 1JZ4A 1YIPA 1XE0A 2V4AA 1SLBA 2JICA 4META 2FDGA 5M0TA 5DAWA 1YQ8A 5FKCA 2AACA 1RIRA 2WNUC 1QJY1 3B93A 4I0BA 2WKKA 4IW3A 2R1BA 5GLTA 2WC2A 2WQ8A 3TBDA 3WHUA 2ZHLA 3QERA 3D82A 3H0OA 3M3OA 5FUNA 2XXZA 1XMHE 3ROUA 2I74A 4QQPA 4LBKA 3AZZA 4M3ZA 1Q8PA 3J9SA 3ZKYA 3QNOA 1JN2P 1HX6A 1F5FA 2VTFA 5HCHA 4DRVA 3UKVA 2FD8A 3MF9A 2A1XA 2AEYA 3WNNA 1R1A1 2D5HA 1IS6A 3N1EA 1V6OA 1QJFA 1JU4A 1OLRA 2Q1ZB 3MO4A 3ZSJA 3ZXAC 2HWB1 3B5LB 4L11A 2XKPA 2P3YA 2VNVA 4BZ4A 2DVBA 4J2DA 2GALA 4BJ0A 1XNKA 1FZ3E 3FBYA 5FYTA 1XXNA 2NLRA 5BY5A 5IVFA 1JOJA 1RTVA 1XVCE 5T50A 5APAA 1CAUB 1AYM2 5FMDA 2VM9A 3RI8A 4XUTA 2JKXA 2VC9A 3VBUC 1JI6A 1CGPA 3O0WA 1XMGE 4K1YA 1VBA2 2DY4A 1FZ6E 3C7HA 3I49A 2R0HA 4PLOA 2LALA 3MFAA 4FJ8A 4QXKA 2A7AA 5FYMA 5GLZA 2HWF3 2VJXA 1W9WA 4LO5B 5DZFA 1D4M2 3HAGA 5EHDA 1Q5OA 5EYXA 3I2OA 3LEGA 1UZYA 4YZ1A 4HONA 1HRI3 1VB2A 5BNQA 4Q0VA 1GP5A 1Z7S2 1FPN1 4LLOA 5DUVA 4UT5A 3W21A 5AC93 5KXEA 4UWDA 1LB2A 2W1QA 1C1FA 1RUI1 3DGTA 1FS1A 5FIXA 3KHCA 3MBWA 1ULPA 2ZGKA 3CU7A 2PHRA 1OKOA 1UIJA 1IS5A 1UCXA 4PBPA 1XVBE 2B8IA 3H50A 2EALA 1S2EA 1S0GA 4S2HA 3WCRA 3NRUA 4GKYA 4O9GA 4ZPIA 4C0BA 2HBTA 3MPBA 5CZKA 4ET7A 5JI9A 4OHWA 2P1PB 2X8KA 2JIGA 4F83A 3VD9A 4OUEA 4FTSA 5FYHA 2PELA 1AF9A 2V5YA 5KC5A 3GCWA 2BWAA 4LIUA 2W52A 4WM8A 1W8OA 3IN9A 4NIAA 2VZOA 2HWC3 5I0TA 5IFPA 2JDPA 1UU4A 4Q4Y2 4DXSA 2K46A 1NYWA 1WBLA 1WMEA 2Y60A 5LK5A 3T2QA 4FK2A 2GNDA 1O8SA 1YFUA 2FDKA 1RUJ3 1HW5A 4V2WA 2DTUA 1GP6A 1WWYA 1LKNA 2GMMA 1I6XA 3MF6A 3W5NA 2UWAA 1LAJA 1UOFA 5C8CB 4O7XA 5FQ0A 5KXBA 4FJNA 2DV9A 1LDKE 1X8EA 3CBNA 3M2MA 2D6KA 4LO4B 3T09A 3RZKA 4IERA 4LLFA 3V0AB 4XBNA 5DAQA 5IK5A 1OA3A 3HGLA 3TAEA 1AYM1 2RDSA 4FAHA 3A7QA 3I3BA 1SG3A 2RDQA 4WVVA 3OEAA 1YHFA 3POSA 3WDWA 4AL9A 4E8DA 3POGA 1VBA1 2CY6A 4LUMA 1CAXA 2XJQA 2ARAA 2W1WA 3ZVXA 3POBA 1OOPA 4BA6A 2ZACA 1UOGA 3F95A 4FPYA 4EPHA 4L99A 1NAEA 2QDNA 1EPWA 4XJZA 1WMXA 1D4M1 1E57A
chains in the Genus database with same CATH topology
4FJ7A 1L7RA 4OZOA 4M3UA 3FHAA 1DYOA 3CFOA 2JD9A 2VMEA 3RMAA 4M3XA 3V7DB 4GAMC 1XNTA 3C8XA 1CLQA 4KHWA 1PX3A 3OB8A 2JHAA 1MMOG 4KHNA 5HXMA 2C26A 3OEBA 3ABZA 3HL8A 3IIIA 3J7HA 3NNGA 4JX0A 4ZY9A 4CUBA 4DUVA 3PUHA 3L8BA 3OGMB 4DTOA 5IBKB 4AI6A 2RCUA 3SKVA 4FJMA 2W47A 3VD4A 1UZ0A 4FJIA 4D0QA 4DXTA 4DXRA 2C9KA 2J1UA 3CZUA 2HLEA 2QBXA 3SUOA 1W0NA 3PUIA 2YC4A 2PQSA 4JRPA 3K46A 1FZ7E 3KD5E 4J2EA 2QQKA 3S9HA 4DTXA 1CZTA 2YB7A 2OZMA 4M45A 4I9QA 2E32A 4ADNA 2X09A 5I0DA 4TXWA 2VL4A 2VZ3A 3E4YA 3NCIA 3C7EA 4FI9A 3CZJA 2P5GA 3TAFA 3NQHA 3LQCA 2P1MB 1W8NA 1XU3E 2W94A 2Y64A 5JXHA 3QEIA 4W50A 3OBAA 4KWUA 3THDA 2LW8A 4DU4A 2MZWB 3L1NA 1EUTA 3C95A 3WNKA 3K4AA 1HN1A 1SHWB 3T0BA 3QESA 3LEKA 3GGLA 2JH8A 4LKSA 3LPFA 3CIHA 2BGOA 4XUNA 2W9XA 1YQ2A 2P1QB 1T2XA 2VMFA 3ETPA 4QPWA 2WO2A 1JYWA 4FJXA 4A4AA 3K75B 2YFZA 2WABA 1PMHX 4JKLA 4JRQA 3CDZB 3SQ1A 4M3WA 3OGRA 2VQTA 1XC6A 3WF0A 1JZ6A 2VQUA 4QX3A 3UIQA 5JR2A 1XVGE 3SQ0A 4KHUA 4ZZ5A 2YB5A 3L2OB 4XURA 1CX1A 1MHZG 3SUPA 5LA2A 3LZIA 3GM8A 1UY1A 5C70A 1IH7A 2W5FA 1FZHE 4QB1A 1PMJX 3T2OA 1DLCA 1OF3A 4KMQA 2XHNA 3SQ2A 2WUHA 2P1OB 3IAPA 4DTJA 1GMMA 1KEXA 2RVAA 3CFPA 1UY0A 5JUVA 1RYYA 2VZVA 4CU9A 4QDQA 4A44A 4DTSA 3F2ZA 4CU8A 2V5DA 3C6OB 4LQRA 3IAQA 3WF2A 1GOHA 4AKHA 2Y6HA 3N1BA 4FK0A 2Y6GA 1GUIA 3VD7A 1UMIA 2WDBA 4MGSA 1JYNA 3DYPA 2WYSA 1WAFA 3T08A 3ECQA 2V4VA 4X5MA 2VZQA 3NE6A 1UXZA 2FW3A 2E26A 4AAXA 1H6XA 1D7PM 5IJRA 3D3AA 4OMDA 2MMBA 4DTRA 4M3RA 1UYZA 2JPNA 5CYYA 4UOJA 1CZVA 1GOFA 2LF6A 3C6PB 1JZ2A 3K2OA 2VZRA 4P02B 3W5MA 2XQXA 3K77A 1F4HA 2Z4FA 4B08A 3HJRA 2PFTA 3LEIA 4DTNA 2LF3A 4XUOA 1BHGA 2WN2A 5A1AA 4BK5A 3BN6A 3E4WA 2VZ1A 1IG9A 4EYWA 4LPLA 3C6NB 4CU6A 2DEBA 2W91A 4DUWA 2WAAA 1XNAA 4ZZ8A 2JHPA 3C7FA 3RWUA 1H6YA 3LDSA 1FZ9E 2C4XA 3WNLA 5G04L 4E8CA 3NAEA 3HGKE 2VZTA 3CQ8A 4QDSA 4DU1A 3VDBA 4XZUG 4W8JA 2J1AA 3L0MA 2E31A 3SNNA 1Q9XA 3I2KA 3WNOA 2VR4A 2ZEXA 5DPNA 4FJ5A 1XU5E 2JDAA 5JXGA 2ZEWA 1DP0A 5EJZB 3FL7A 2PFVA 3SKJE 4KI6A 3A22A 1NUKA 1UY2A 4M4PA 1XVDE 2WO3A 3ACFA 2RJ2A 2ATQA 4DTPA 3SI6A 3A21A 2QQMA 2X10A 4A6OA 3NDKA 4J2BA 1UYXA 1MPXA 4KI5M 2BBAA 3SPYA 4MOAA 2Y6JA 1XVEE 1FZ8E 2EIDA 3SQ4A 3C94A 1JZ3A 3DYMA 2W3JA 4ZXEA 5EIYB 3VDCA 3C7GA 4UAPA 4A41A 3GXUA 3KD1E 3SUNA 2DCJA 4JHZA 4RG8A 3SEEA 3VD5A 2WN3A 2EIEA 3SJJA 3TABA 4M3YA 3WSOA 1IQDC 4UI9L 2EIBA 2KD7A 3QEVA 1ULOA 4W4ZA 2WBKA 4KI4A 4MGQA 4A3ZA 2L9LA 3NJXA 3IDAA 3THCA 4RNGA 4XUPA 4FJ9A 4I9LA 2W46A 2Y6KA 4M41A 3LE0A 1WAJA 1K45A 2VMDA 4HCBA 3QEWA 3WF4A 3I2JA 3C7OA 1FZIE 3JXSA 1W9TA 5J1XA 2ZEYA 4JKKA 4XVHA 3AC0A 4RYDA 4QB2A 3QEPA 2J7MA 2J1VA 1US3A 5IREA 1CZSA 4RL5A 2VZPA 2JH9A 4BK4A 2OVRB 3HNBM 3LD8A 5G05L 1I5PA 3MUY1 3J2PA 2VJ5A 2FYOA 3ACIA 1WKYA 5FUIA 1K42A 1FXXA 3OG2A 1SDDB 4E3SA 4PQQA 5C7GA 3T0DA 2P5OA 4QX2A 4AG4A 3UETA 3IB3A 3CMGA 3T2PA 2WZEA 5B4XA 1O8PA 4DUXA 4EP9A 3I2IA 1XVFE 4P08A 1GNYA 4FJJA 3WNMA 4M42A 3OGLB 1UYYA 3U37A 2VZUA 2OVQB 2VZSA 1GU3A 4A45A 3QETA 2HYXA 4IUGA 2W95A 4QNDA 4LHSA 3UESA 3TAGA 3WF1A 4FVMA 3LPGA 4CVUA 3I3EA 2W1UA 3EB7A 3E1F1 3QNNA 2OZSA 1P8JA 1OD3A 1UY3A 4FJLA 5DN2A 1W9SA 4HG6B 2DCKA 5IZ7A 4MADA 4YPJA 2J1SA 3CKHA 3P6BA 1LNSA 3SCXA 4BDVB 4KHQA 1L7QA 5B4NA 4TTGA 3VD3A 1UWWA 3RMBA 2HD0A 5LA1A 1O59A 2JHCA 1FZ1E 2LS6A 1K12A 2QQLA 1J84A 2W87A 4P5YA 2W1SA 2QQJA 2QQOA 3LZJA 2DDUA 2BERA 2V72A 5IYYA 2B9VA 2P1NB 2XONA 2EICA 3CQOA 4GZ9A 3I2GA 1CIYA 1R64A 4ADOA 4ARYA 2ZEZA 1XL3C 4FJGA 1TVGA 2RV9A 2WZ8A 3NJVA 2B4KA 5HPOA 3MV01 2VO5A 1NEXB 4DTUA 3SEPA 3CFRA 2ORXA 1PX4A 3RMCA 1JYVA 3OGSA 3OGKB 1UX7A 3OGVA 1JU3A 5JMOA 2VCBA 2YG0A 3ZM8A 2YFUA 1UY4A 4E4BA 2E33A 2ORZA 5F7UA 1F4AA 2QQNA 2CDPA 4M3TA 2WAOA 3UNPA 3ACHA 1JHJA 2J1TA 4X5NA 1OH4A 1FYZE 2J22A 1UXXX 4JS4A 3NHGA 4MO3M 3LDBA 5EJ1B 2VCCA 3GDBA 3MKSB 4GWIA 2OVPB 3ACGA 1JZ4A 4P00B 4FK4A 1JZ7A 2BZDA 2Y8KA 2ZXQA 4QNCA 2WQ8A 1P22A 3QERA 1XMHE 3K4ZA 5JXJA 4M3ZA 1K3IA 2B7MA 3QNOA 2VCAA 4AKGA 2JE8A 2VTFA 3HNYM 1JZ5A 3WNNA 3WF3A 1NKGA 4OMCA 1FZ2E 3N1EA 4QAWA 3MO4A 1JU4A 3HEIA 4PT6A 3FHQA 2WO1A 4RN5A 1TG7A 3T0AA 2H4TA 1UMHA 3I2FA 2OYQA 2VOTA 4J2DA 4BJ0A 1FZ3E 2J1EA 1XVCE 3A23A 4I6JB 2VM9A 4XUTA 2JKXA 2VC9A 1JI6A 4QDRA 5H37A 4DTMA 1XMGE 3VDAA 2DY4A 1FZ6E 3SUQA 3SPZA 4KHSA 3C7HA 1KGYA 1WCQA 4FJ8A 3MV11 3WQBA 2XOMA 3J27A 3MUZ1 3NGIA 3EYPA 4D8MA 1OF4A 2OKXA 2R7EB 2VJXA 1W9WA 1FZ0E 3HOBA 1XMFE 3I3DA 3LEGA 4M4RA 4A42A 4KHYA 4HCCA 4L0PA 1FZ4E 1JYXA 2W1QA 1J83A 1FS1A 3MBWA 1ULPA 2ID4A 3FN9A 1FZ5E 1W99A 3I2HA 1XVBE 5DQ0A 2B8IA 3NRUA 4CUAA 4DEQA 5DMYA 4JKMA 1MTYG 2BGPA 5CZKA 4ET7A 3HPNA 2YC2A 2P1PB 1EUUA 1US2A 3VD9A 4OUEA 4BXSV 3TL8B 4AKIA 1W8OA 3SVIA 2W92A 2VZOA 3TJYA 4CU7A 2VIXA 5IFPA 4DXSA 5C71A 4XUQA 3DYOA 5LA0A 1MHYG 3T2QA 4FK2A 1O8SA 2QXFA 4QB6A 2B1EA 2J1RA 2DTUA 1JZ8A 4JS5A 4DU3A 1GOGA 3WEZA 3HNMA 3W5NA 3QEXA 5IHRA 2Y6LA 4Z2AA 3K4DA 3WNPA 4FJNA 5LCWL 1LDKE 4FJKA 3T09A 4QX1A 2CDOA 4GWJA 1NX9A 1Q9YA 3HGLA 3TAEA 2VJ4A 3A7QA 4QX0A 3I3BA 1SG3A 2VMCA 2X05A 3OEAA 4J2AA 3BGAA 4CUCA 4E8DA 3RMDA 3DECA 3HN3A 4ARXA 5IFTA 5JXIA 4FJHA 1XPWA 2W1WA 3HP9A 4OYUA 4PF1A 2QQIA 1GQPA 1OT5A 4EPHA 4DEVA 1NAEA 3I97A 3P1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L7R A;  4OZO A;  3FHA A;  1DYO A;  2JD9 A;  2VME A;  3V7D B;  1XNT A;  3C8X A;  1PX3 A;  3OB8 A;  5HXM A;  2C26 A;  3OEB A;  3ABZ A;  3III A;  3J7H A;  4JX0 A;  3NNG A;  4ZY9 A;  4CUB A;  4DUV A;  3PUH A;  3OGM B;  5IBK B;  3SKV A;  2W47 A;  3VD4 A;  1UZ0 A;  4D0Q A;  4DXT A;  4DXR A;  2C9K A;  2J1U A;  3CZU A;  2HLE A;  2QBX A;  1W0N A;  3PUI A;  2YC4 A;  2PQS A;  3K46 A;  2QQK A;  1CZT A;  2YB7 A;  2E32 A;  2X09 A;  5I0D A;  4TXW A;  2VL4 A;  2VZ3 A;  3C7E A;  4FI9 A;  3CZJ A;  3NQH A;  3LQC A;  2P1M B;  1W8N A;  2W94 A;  2Y64 A;  5JXH A;  4W50 A;  3OBA A;  4KWU A;  3THD A;  2LW8 A;  3WNK A;  1EUT A;  3K4A A;  1HN1 A;  1SHW B;  3T0B A;  3LEK A;  3GGL A;  4LKS A;  3LPF A;  3CIH A;  2BGO A;  4XUN A;  2W9X A;  1YQ2 A;  2P1Q B;  1T2X A;  2VMF A;  3ETP A;  4QPW A;  2WO2 A;  1JYW A;  4A4A A;  3K75 B;  2YFZ A;  2WAB A;  1PMH X;  4JKL A;  3CDZ B;  3WF0 A;  3OGR A;  2VQT A;  1XC6 A;  1JZ6 A;  2VQU A;  4QX3 A;  5JR2 A;  4ZZ5 A;  3L2O B;  4XUR A;  1CX1 A;  5LA2 A;  3GM8 A;  1UY1 A;  5C70 A;  2W5F A;  4QB1 A;  1PMJ X;  3T2O A;  1DLC A;  1OF3 A;  4KMQ A;  2XHN A;  2WUH A;  2P1O B;  3IAP A;  1GMM A;  1KEX A;  2RVA A;  1UY0 A;  5JUV A;  1RYY A;  2VZV A;  4CU9 A;  4QDQ A;  4A44 A;  3F2Z A;  4CU8 A;  2V5D A;  3C6O B;  4LQR A;  3IAQ A;  3WF2 A;  1GOH A;  2Y6H A;  2Y6G A;  1GUI A;  3VD7 A;  1UMI A;  2WDB A;  4MGS A;  1JYN A;  3DYP A;  2WYS A;  3T08 A;  3ECQ A;  2V4V A;  2VZQ A;  1UXZ A;  2E26 A;  4AAX A;  1H6X A;  1D7P M;  5IJR A;  3D3A A;  4OMD A;  1UYZ A;  5CYY A;  4UOJ A;  1CZV A;  1GOF A;  3C6P B;  1JZ2 A;  2VZR A;  4P02 B;  3W5M A;  2XQX A;  3K77 A;  1F4H A;  2Z4F A;  3HJR A;  3LEI A;  4XUO A;  1BHG A;  2WN2 A;  5A1A A;  4BK5 A;  3BN6 A;  2VZ1 A;  4LPL A;  3C6N B;  4CU6 A;  2W91 A;  4DUW A;  2WAA A;  1XNA A;  4ZZ8 A;  3C7F A;  1H6Y A;  2C4X A;  3WNL A;  5G04 L;  4E8C A;  2VZT A;  4QDS A;  3VDB A;  4XZU G;  4W8J A;  2J1A A;  3WNO A;  2E31 A;  3I2K A;  2VR4 A;  2ZEX A;  5DPN A;  2JDA A;  5JXG A;  2ZEW A;  1DP0 A;  5EJZ B;  3FL7 A;  3SKJ E;  3A22 A;  1NUK A;  1UY2 A;  4M4P A;  2WO3 A;  3ACF A;  2RJ2 A;  3A21 A;  2QQM A;  2X10 A;  4A6O A;  4KI5 M;  1UYX A;  1MPX A;  2BBA A;  4MOA A;  2Y6J A;  2EID A;  1JZ3 A;  3DYM A;  2W3J A;  4ZXE A;  5EIY B;  3VDC A;  3C7G A;  4UAP A;  4A41 A;  3GXU A;  2DCJ A;  4JHZ A;  3SEE A;  3VD5 A;  2WN3 A;  2EIE A;  3WSO A;  1IQD C;  4UI9 L;  2EIB A;  2KD7 A;  1ULO A;  4W4Z A;  2WBK A;  4MGQ A;  4A3Z A;  2L9L A;  3NJX A;  3IDA A;  3THC A;  4XUP A;  2W46 A;  2Y6K A;  3LE0 A;  2VMD A;  1K45 A;  3WF4 A;  3I2J A;  3C7O A;  3JXS A;  1W9T A;  5J1X A;  2ZEY A;  4JKK A;  4XVH A;  3AC0 A;  4RYD A;  4QB2 A;  2J7M A;  2J1V A;  1US3 A;  1CZS A;  2VZP A;  4BK4 A;  2OVR B;  3HNB M;  5G05 L;  1I5P A;  3MUY 1;  3ACI A;  1WKY A;  5FUI A;  1K42 A;  3OG2 A;  1SDD B;  4PQQ A;  5C7G A;  3T0D A;  4QX2 A;  4AG4 A;  3UET A;  3IB3 A;  3CMG A;  3T2P A;  2WZE A;  5B4X A;  1O8P A;  4DUX A;  3I2I A;  4P08 A;  1GNY A;  3WNM A;  3OGL B;  1UYY A;  3U37 A;  2VZU A;  2OVQ B;  2VZS A;  1GU3 A;  4A45 A;  2HYX A;  4IUG A;  2W95 A;  4LHS A;  3UES A;  3WF1 A;  3LPG A;  4CVU A;  3I3E A;  2W1U A;  3EB7 A;  3E1F 1;  1P8J A;  1OD3 A;  1UY3 A;  5DN2 A;  1W9S A;  4HG6 B;  2DCK A;  4MAD A;  4YPJ A;  2J1S A;  3CKH A;  3P6B A;  1LNS A;  4BDV B;  5B4N A;  1L7Q A;  4TTG A;  3VD3 A;  1UWW A;  5LA1 A;  1O59 A;  2LS6 A;  1K12 A;  2QQL A;  1J84 A;  2W87 A;  4P5Y A;  2W1S A;  2QQJ A;  2QQO A;  2DDU A;  2BER A;  2V72 A;  5IYY A;  2B9V A;  2P1N B;  2XON A;  2EIC A;  3CQO A;  4GZ9 A;  3I2G A;  1CIY A;  1R64 A;  4ARY A;  2ZEZ A;  2RV9 A;  1TVG A;  2WZ8 A;  3NJV A;  2B4K A;  5HPO A;  3MV0 1;  2VO5 A;  1NEX B;  3SEP A;  2ORX A;  1PX4 A;  1JYV A;  3OGS A;  3OGK B;  1UX7 A;  3OGV A;  1JU3 A;  5JMO A;  2VCB A;  2YG0 A;  3ZM8 A;  2YFU A;  1UY4 A;  2E33 A;  2ORZ A;  5F7U A;  1F4A A;  2QQN A;  2CDP A;  2WAO A;  3UNP A;  3ACH A;  1JHJ A;  2J1T A;  1OH4 A;  2J22 A;  1UXX X;  4MO3 M;  5EJ1 B;  2VCC A;  3GDB A;  3MKS B;  4GWI A;  2OVP B;  3ACG A;  1JZ4 A;  4P00 B;  1JZ7 A;  2BZD A;  2Y8K A;  2ZXQ A;  2WQ8 A;  1P22 A;  3K4Z A;  5JXJ A;  1K3I A;  2VCA A;  2JE8 A;  2VTF A;  3HNY M;  1JZ5 A;  3WNN A;  3WF3 A;  1NKG A;  4OMC A;  4QAW A;  3MO4 A;  1JU4 A;  3HEI A;  4PT6 A;  3FHQ A;  2WO1 A;  4RN5 A;  1TG7 A;  3T0A A;  1UMH A;  3I2F A;  2VOT A;  4BJ0 A;  2J1E A;  3A23 A;  4I6J B;  2VM9 A;  4XUT A;  2JKX A;  2VC9 A;  1JI6 A;  4QDR A;  3VDA A;  3C7H A;  1KGY A;  1WCQ A;  3MV1 1;  3WQB A;  2XOM A;  3MUZ 1;  3EYP A;  4D8M A;  1OF4 A;  2OKX A;  2R7E B;  2VJX A;  1W9W A;  3HOB A;  3I3D A;  3LEG A;  4M4R A;  4A42 A;  4L0P A;  1JYX A;  2W1Q A;  1J83 A;  1FS1 A;  3MBW A;  1ULP A;  2ID4 A;  3FN9 A;  1W99 A;  3I2H A;  5DQ0 A;  3NRU A;  4CUA A;  4DEQ A;  5DMY A;  4JKM A;  2BGP A;  5CZK A;  4ET7 A;  3HPN A;  2YC2 A;  2P1P B;  1EUU A;  1US2 A;  3VD9 A;  4OUE A;  4BXS V;  1W8O A;  2W92 A;  2VZO A;  4CU7 A;  5IFP A;  4DXS A;  5C71 A;  4XUQ A;  3DYO A;  5LA0 A;  3T2Q A;  1O8S A;  4QB6 A;  1JZ8 A;  2J1R A;  1GOG A;  3WEZ A;  3HNM A;  3W5N A;  5IHR A;  2Y6L A;  4Z2A A;  3K4D A;  3WNP A;  5LCW L;  1LDK E;  3T09 A;  4QX1 A;  2CDO A;  4GWJ A;  1NX9 A;  3A7Q A;  4QX0 A;  3I3B A;  1SG3 A;  2VMC A;  2X05 A;  3OEA A;  3BGA A;  4CUC A;  4E8D A;  3DEC A;  3HN3 A;  4ARX A;  5IFT A;  5JXI A;  1XPW A;  2W1W A;  4OYU A;  4PF1 A;  2QQI A;  1GQP A;  1OT5 A;  4DEV A;  1NAE A;  3I97 A;  3P1I A; 
#chains in the Genus database with same CATH topology
 3E6D A;  2Q0A A;  3M1H A;  4HL0 A;  1L7R A;  4L2N A;  4OZO A;  4JZR A;  1DYO A;  1Z7S 1;  3E6B A;  2FZ2 A;  1FV3 A;  5A32 A;  1NCR A;  4M3X A;  3V7D B;  3QOP A;  4HKL A;  4IV1 B;  1LGC A;  2EXJ A;  5A6Q A;  2BBV A;  3VBR A;  1ASJ 2;  1CLQ A;  4UW6 A;  1K5M B;  3OF1 A;  4NHL A;  4AVS A;  5C9A B;  1MMO G;  2B5H A;  3AJZ A;  5K9Y A;  2H0V A;  2C26 A;  4H7L A;  3HL8 A;  4P9X A;  1JOD A;  4GQ7 A;  3CJI A;  4MGZ E;  2XJS A;  4XIO A;  3OGM B;  1JOP A;  3J4U H;  5T5O A;  1TME 3;  4AED A;  3MIH A;  2ARB A;  3VD4 A;  1QQP 2;  2Q8C A;  2JDY A;  3KV9 A;  4D0Q A;  4AFD A;  4DXR A;  3CZU A;  2HLE A;  4XDP A;  3ZYH A;  1VMJ A;  3PUI A;  4Q4Y 1;  1BEV 3;  4M3C E;  2A75 A;  4XBL A;  3AYA A;  4NPL A;  1ND2 A;  5LEK A;  5JIA A;  1H2L A;  3OUI A;  2OZ6 A;  4DTX A;  5FZH A;  1CZT A;  3QLQ A;  4I9Q A;  2X09 A;  4XJU A;  1AL2 3;  1X82 A;  5C33 A;  4YG0 A;  2VZ3 A;  1AXK A;  4X8P A;  2AYH A;  4PDW A;  3X29 B;  4LE3 A;  3OPT A;  1DGL A;  1QH6 A;  3E4Y A;  2O1Q A;  3NAP C;  1RUG 3;  3P3P A;  4DY5 A;  4Q27 A;  1HDK A;  3KSC A;  4MZU A;  2OQ7 A;  5B2G B;  3TAF A;  2XLG A;  3NQH A;  4QGL A;  3GHN A;  3LFI A;  4UYB A;  2Y64 A;  1XSR A;  3QEI A;  2QZ2 A;  5FAX A;  5C8W A;  1NXD 1;  4M3C A;  4DU4 A;  3TN9 2;  1HLC A;  2I2S A;  1AR6 2;  2FZ1 A;  3SH3 A;  4LKF A;  5FXZ A;  4BQ1 A;  5BNP C;  1XND A;  3VBO B;  3KGL A;  3T0B A;  2A71 A;  3QES A;  2ADE A;  2PN5 A;  2X5I B;  4AR2 A;  2QQP A;  2HWF 2;  2JH8 A;  3LPF A;  3AXE A;  2HEY F;  1OSG A;  5FQ0 B;  2BGO A;  5GZF A;  4NIH A;  3ETP A;  3WP4 A;  4N43 B;  2WO2 A;  1LOE A;  3U78 A;  4FJX A;  4A4A A;  1ASJ 1;  4NO4 A;  3T4V A;  4FVV A;  5A3P A;  1PMH X;  2F4P A;  4JRQ A;  4AED C;  4YWA A;  3HWJ A;  3ZXL A;  3MDP A;  4IET A;  1XC6 A;  5C5U A;  1AXY A;  2DBN A;  3KM5 A;  5FP9 A;  2HWD 3;  3C3V A;  2K0G A;  5JR2 A;  5DG1 A;  1OOP B;  4MGY E;  5T54 A;  3L2O B;  4XJ9 A;  5FY8 A;  4YFW A;  5FZ9 A;  2BNO A;  1QQP 1;  1NCQ A;  5H9P A;  3VBF A;  1GP4 A;  3FLP A;  3RNS A;  3TEY A;  2YBK A;  4F3J A;  1N3O A;  1ZYB A;  2HWC 2;  1OVS A;  3QAC A;  4LA3 A;  1QJX 2;  5CFC A;  1FZH E;  4QB1 A;  4X6Q B;  3T2O A;  1DLC A;  1RUJ 2;  2Z69 A;  3KHB A;  1GMM A;  4FSJ A;  3KV4 A;  3BTA A;  3I3M A;  4ITC A;  3N9Q A;  5CB7 A;  5BNN A;  1RYY A;  2VZV A;  3ORJ A;  5EZW A;  3Q8B A;  3F2Z A;  2V5D A;  2C9A A;  3C6O B;  4LQR A;  4QHB A;  3WF2 A;  1MQT A;  1YO8 A;  4PIZ A;  3RYK A;  4H3W A;  3N1B A;  1LUL A;  3DXU A;  1G86 A;  3SLI A;  3FHI B;  1GUI A;  3E6C C;  2ZML A;  3R0R A;  4RGA A;  5GAL A;  1AR6 1;  3TN9 1;  1JYN A;  4K1Z A;  3ZSL A;  2VD7 A;  3RZM A;  1CD3 G;  5AVA A;  2OA2 A;  4R9A A;  3NE6 A;  1VBE 3;  5LB6 A;  1GZC A;  2JKB A;  4CXX A;  5FZE A;  1DDL A;  1MEC 3;  1YIF A;  1Y4W A;  2SBA A;  2HWF 1;  3N36 A;  4R9B A;  3S5Q A;  1D7P M;  4AAX A;  1G9C A;  1DZT A;  2WO7 A;  4IE6 A;  4XFC A;  3BIW E;  4LHN A;  1HRI 1;  2RDR A;  1AX0 A;  1CZV A;  1DYP A;  4JDM A;  1BXH A;  3C6P B;  2VUA A;  4Y1U A;  3ZO0 B;  5AC9 1;  3VHO A;  4XHX A;  1WLC A;  2JDK A;  2PHU A;  1N1V A;  2QZ3 A;  4R52 A;  2Z4F A;  1IS4 A;  1GWK A;  2WNE A;  3N7M A;  3KF5 A;  5GM0 A;  4RGG A;  3SXW A;  4BK5 A;  3ILN A;  3DPR C;  3E4W A;  1QF3 A;  1W6N B;  1Y3T A;  4KU8 A;  4COY A;  4AFM A;  1E5R A;  3O1R A;  4EYW A;  1UYP A;  2TUN A;  4LPL A;  3BVO A;  4RQP A;  5FRE A;  3TOJ A;  3JBG 3;  4E2S A;  5SV5 A;  4LBO A;  1V6K A;  4FPL A;  4CP9 A;  4QPI A;  1S55 A;  3WNL A;  2HWC 1;  2UYA A;  4OVE A;  4XAA A;  5G04 L;  4NHM A;  3R4U A;  1LHV A;  1BEV 2;  5FZF A;  5KHJ A;  2WFP A;  3HGK E;  4Y4R A;  3PMS A;  2DYC A;  2A6X A;  1RUJ 1;  4YAR A;  1QEX A;  2ZGT A;  3W58 A;  4NOT A;  2TBV A;  1U5Y A;  2VR4 A;  3APB A;  3ZFF C;  2ZEX A;  2G19 A;  5FZ1 A;  5FLJ A;  4FJ5 A;  5JXG A;  4D3W A;  1DP0 A;  2OZJ A;  1RUG 2;  2GAU A;  1NCQ B;  3VBF B;  1J3R A;  5EJZ B;  3FL7 A;  2PFV A;  1QXJ A;  2F4L A;  3WVJ A;  3A22 A;  1R09 3;  2RM2 3;  1W8Z A;  1XVD E;  5FOB B;  2P3K A;  5CFC B;  5FZ0 A;  4DNY A;  2DUO A;  2QQM A;  2X10 A;  5K0U B;  2IXI A;  1OKQ A;  2EXK A;  4LHK A;  5J36 A;  1QKQ A;  4J2B A;  1A8M A;  3AXD A;  4KI5 M;  1KD7 A;  5SV8 A;  3ZYG A;  4AFC A;  2LM3 A;  1V9U 3;  3SPY A;  1VAV A;  2BPA 2;  1W6P A;  3RRD A;  5C3R A;  3VZM A;  3CJX A;  1JZ3 A;  5F5C A;  1MAC A;  3WD5 A;  3ZMO A;  1BYH A;  3JQW A;  4UAP A;  1HQN A;  3ZXE A;  1C8M 3;  3GXU A;  4A41 A;  5C9A C;  4HET A;  3D4K A;  2DCJ A;  2GP5 A;  4LBQ D;  3WG4 A;  5K7P A;  2R49 A;  3BYW A;  2MW2 A;  4E9K A;  4DPN A;  4CCE A;  1SFN A;  2HWD 2;  2EIE A;  3TAB A;  3WSO A;  1ZBE 2;  3AKS A;  4UI9 L;  4YW3 A;  1Y43 B;  2WBK A;  4MGQ A;  5BV6 A;  2WWS A;  2GC3 A;  1J1L A;  3ZN6 B;  1BEV 1;  5IK7 A;  4XUP A;  1NG0 A;  4YZ2 A;  5CFD C;  2BTV C;  2W46 A;  2VMI A;  1YQ6 A;  4Q1R A;  1HIX A;  3ZSM A;  5EV7 A;  4AWD A;  3ZXG A;  1FZI E;  3ZFE A;  5J1X A;  1AL2 1;  4HK8 A;  2H0B A;  3IDC B;  4YGD A;  1BJQ A;  1NE6 A;  4GH4 A;  4CDU B;  1DQ2 A;  1ULF A;  2ZZJ A;  3INA A;  4Q26 A;  2E9Q A;  2J1V A;  1RUG 1;  1US3 A;  2UWC A;  5IRE A;  2DWR A;  4P9J A;  5F5Q A;  3V0B A;  2WNU A;  4CPB A;  5F3E A;  5IWF A;  4CP9 B;  3POJ A;  5BNO A;  1JOB A;  1ONA A;  1T6G C;  3PVE A;  2VW1 A;  1YJK A;  3KT4 A;  1MVQ A;  3HNB M;  5FJH A;  3M8L A;  1I5P A;  3HQR A;  5I0S A;  3UGG A;  3PL0 A;  4Y22 A;  2CL2 A;  4HPK A;  2ZOE B;  3QH6 A;  2VJ5 A;  2IC1 A;  1WKY A;  2JDN A;  3ACI A;  3JUU A;  4RR3 A;  1FNY A;  3DF0 A;  1MEC 2;  2E63 A;  5FUI A;  3HN1 A;  4Q4X 3;  4PQQ A;  1CJP A;  4NHK A;  3WCS A;  3IB3 A;  4Q0U A;  3CMG A;  4QQH A;  2B46 X;  4RFT 0;  1C3H A;  5FRA A;  2WZE A;  1O8P A;  4N90 A;  5FP7 A;  4EP9 A;  3TRS B;  3USS A;  1A34 A;  3IIA A;  4FQ4 A;  1WLT A;  1VBD 2;  1EY2 A;  1KXG A;  3WDX A;  4KNC A;  4MX3 A;  5FLI A;  4AVC A;  4QMA A;  3S30 A;  1TE1 B;  2HWD 1;  4LA2 A;  3ZXK A;  5E8A A;  1ZBE 1;  2V09 A;  4ZS3 A;  4WVM B;  4LHS A;  2VBD A;  3VBH C;  3WF1 A;  2P34 A;  1OVP A;  4FVM A;  4CSW A;  4KGQ A;  4CVU A;  4Z07 A;  2W1U A;  4C0H A;  3EB7 A;  3E1F 1;  3QNN A;  4CP2 A;  1I5Z A;  2A3W A;  2PHX A;  4LTA A;  4RL7 A;  3GZT B;  1KDK A;  3Q8F A;  1CVN A;  1HKD A;  1HV1 A;  4R8H A;  4NHY A;  5A7W A;  5FFO C;  1UW8 A;  1O6U A;  1IQA A;  2DCK A;  4YGB A;  3VUO A;  1LED A;  1SBE A;  2J1S A;  2YC0 A;  3AX4 A;  1DHK B;  1CPM A;  2BNN A;  5FO9 B;  3SCX A;  2CGP A;  4Q8L A;  1U0A A;  2QQW A;  2E51 A;  3E5Q A;  2NMN A;  5LBB A;  1Z0H A;  5B4N A;  2FDH A;  5FPB A;  2HD0 A;  1C4R A;  1UOB A;  2QE3 A;  1O59 A;  4KBZ A;  1RHI 3;  2VQ0 A;  1Q3E A;  2LS6 A;  2JDH A;  3JU9 A;  1OFS A;  2ARE A;  2QQL A;  3T3Y A;  1TMF 3;  3HT2 A;  4EN8 B;  2GC1 A;  3SC7 X;  5BPX A;  2O8Q A;  2O14 A;  5IVB A;  1SCR A;  1SFP A;  1R09 2;  5T5P A;  2DDU A;  4K40 A;  4LKE A;  3A4U A;  2XON A;  1JYI A;  2EIC A;  4NAM A;  4MLO A;  4MSV A;  5F1R A;  4ARY A;  4ADO A;  3L9J T;  1XL3 C;  1TVG A;  1O3T A;  1VBE 1;  3NJV A;  1PO2 3;  3MV0 1;  2VO5 A;  1POV 0;  4IEW A;  1MEC 1;  3J26 N;  1NEX B;  1WW5 A;  1F15 A;  4DTU A;  3SEP A;  4K8F A;  4SBV A;  5FYS A;  1RUN A;  2VOW A;  2Q30 A;  1UX7 A;  4C1W A;  4MGI E;  4OHX A;  1WLD A;  1CON A;  2FDI A;  4CDW A;  2A3Y A;  4YG3 A;  4AGR A;  3KGZ A;  1F4A A;  2QQN A;  5BNO B;  3S7I A;  1VBD 1;  2OYZ A;  3ACH A;  1JHJ A;  2J1T A;  5F3G A;  1TQ5 A;  4GMP 3;  1U5X A;  2ZGS A;  4D7T A;  5FTT C;  4PLM A;  3UJO A;  3MI8 A;  2GME A;  4MO3 M;  3UO3 A;  3VBS B;  3WDT A;  5IVC A;  2RS3 3;  1MZ5 A;  4BQ2 A;  3W20 A;  4RR3 B;  1RUO A;  1S0D A;  2JG9 C;  3AFK A;  3WQ0 A;  3AYC A;  4FK4 A;  1JZ7 A;  2BDR A;  1JS9 A;  2BZD A;  4YZ5 A;  1X8M A;  1O3R A;  3AZV A;  1ZNP A;  4I01 A;  1NOV A;  1W8U A;  4IE4 A;  3POW A;  4IES A;  1XNB A;  1VRB A;  5FY0 A;  1A78 A;  2HJI A;  5JIU A;  1RMU 3;  4JQT A;  1K3I A;  3OTF A;  1RUH 2;  2B7M A;  1DZQ A;  1TNF A;  2VCA A;  4HN1 A;  2JE8 A;  4YW5 A;  4YW6 A;  4J1W A;  2E53 A;  2ZZQ A;  4O61 A;  4XJ8 A;  1ST8 A;  4PI0 A;  1NKG A;  2VUD A;  3D8C A;  4KG0 A;  1DBN A;  1BLZ A;  3FHQ A;  4RN5 A;  4RS5 C;  3I2F A;  4N9H A;  2OYQ A;  1R09 1;  2WFF 3;  4YVS B;  1CAV B;  4UW4 A;  2G9G A;  4XQ4 A;  4R4Z A;  4I6J B;  5K0U C;  5A70 A;  2ZGM A;  4AI8 A;  4QWN A;  4AXO A;  3UO2 A;  1IG3 A;  4XF1 A;  5C3P A;  1GYK A;  2Y26 A;  2VUC A;  2JQT A;  1WCQ A;  1IPK A;  4N7U A;  2DTY A;  2D5F A;  4Q4X 2;  3MV1 1;  2OII A;  2XOM A;  3J27 A;  3KCC A;  3NGI A;  1EYB A;  1YWK A;  1D2Q A;  2D7F A;  3MUZ 1;  4AGG A;  1W6O B;  4UF0 A;  4M4R A;  4AEM A;  3H8R A;  1MS1 A;  4XF0 A;  5T52 A;  2BJS A;  1JTZ X;  5EXO A;  1VBB 3;  1DGW X;  1OMI A;  4RSU A;  2OX0 A;  4HCC A;  4L0P A;  1FZ4 E;  3VZN A;  1G9B A;  1J83 A;  2A6Y A;  1VBC 2;  2JE7 A;  2Z2S B;  2ZTN A;  2ID4 A;  2IXJ A;  1JYT A;  5T55 A;  4KL1 A;  4RGK A;  1NY7 2;  4EN7 B;  2RR1 2;  1NZC A;  1LR5 A;  4CUA A;  3U1X A;  1BZW A;  4DEQ A;  1MTY G;  5KC6 A;  4XPV A;  4NRO A;  1RUE 3;  1YYN A;  4BLI A;  4XQW A;  2ETE A;  4XCB A;  1FAT A;  5C4W A;  1H2N A;  3SVI A;  2VCM A;  4U2A A;  3P5B A;  2Q1M A;  2BFU L;  2VOX A;  1J58 A;  4QU1 A;  5JSO A;  5C71 A;  2YU2 A;  3LA3 A;  3DYO A;  4XUQ A;  3SQO A;  3NL1 A;  3DL3 A;  2CAU A;  2QXF A;  4QB6 A;  2B1E A;  1DQ4 A;  1OPM A;  1RHI 2;  4DU3 A;  3KVA A;  5KR7 A;  3WEZ A;  3BI3 A;  3QEX A;  2UYB A;  2VTX J;  3EJK A;  2Y6L A;  5A6Y A;  4CEW A;  3SHR A;  2QTW B;  3GCX A;  4HMZ A;  4FJK A;  4JGY C;  3TB0 A;  4K3U A;  3WNP A;  4B3N A;  4FOY A;  3AFG A;  4NHX A;  4QX1 A;  4E27 A;  1QOO A;  2CHH A;  1Q9Y A;  3PVB B;  2VJ4 A;  2OVU A;  4MHR A;  5JSP A;  2PMW B;  4QX0 A;  1PIV 3;  4AE2 A;  4CUC A;  4Y24 A;  4J2A A;  3BGA A;  3HVD A;  3KWV A;  1TZO A;  3N9P A;  1XSQ A;  2VNR A;  1PO2 2;  3R05 A;  5FPA A;  1PGL 2;  2R16 A;  3VGI A;  1RED A;  4PF1 A;  4UFJ A;  4ICG C;  4Q4X 1;  4LO7 A;  5T3N A;  1GQP A;  1OQ1 A;  1OT5 A;  3LEM A;  4DEV A;  4LO8 A;  1UQX A;  1F9K A;  1S0C A;  4Q2F A;  1Z78 A;  1W6M A;  4KGG A;  4FJ7 A;  4M3U A;  4E2G A;  4X8N A;  2JD9 A;  3CFO A;  3VZK A;  2UY9 A;  2VME A;  3RMA A;  3AMQ A;  1QJE A;  1HRV 2;  1WCU A;  1FXZ A;  1VBC 1;  4TYS A;  2C6S A;  4KHW A;  1NA1 A;  2QNK A;  1NY7 1;  2RR1 1;  5HXM A;  5F6L B;  4ASM B;  2RS3 2;  3J7H A;  4JX0 A;  3NNG A;  4N53 A;  4NN0 A;  4DUV A;  4QPG B;  3USU B;  1ENR A;  5IBK B;  2OQ6 A;  3MW4 A;  1S0B A;  3M7A A;  5D1I A;  5JSR A;  2RCU A;  4YW1 A;  1F5J A;  1LTE A;  1UZ0 A;  1RUI 2;  2NMO A;  2RG4 A;  3IMM A;  4CDX A;  4CEY C;  2C9K A;  2J1U A;  5LK7 B;  3H7Y A;  3BTY A;  4LHL A;  1W0N A;  4LMF A;  2D44 A;  3FLT A;  3O5S A;  1VMH A;  3ASI A;  3K46 A;  2NZ9 A;  4CDQ A;  1RMU 2;  1UL9 A;  1XBF A;  4IE5 A;  4B7K A;  1YFX A;  3RSJ A;  1EAH 3;  1RHI 1;  3WW1 A;  5H9Q A;  4M45 A;  3M3C A;  3M3E A;  4Z8B A;  2CWM A;  1WCS A;  5FZD A;  4AQ6 A;  3POF A;  4AQ2 A;  4O9E A;  1TMF 1;  5D8A A;  5FXW A;  4KG8 A;  5L36 A;  5L9B A;  3MIC A;  5FPU A;  3JB4 C;  1AR9 3;  3LQC A;  4YVW B;  1PZ8 A;  1XU3 E;  1A8D A;  5JXH A;  1ENX A;  1WA6 X;  1H1M A;  1C5H A;  3PUR A;  1ZA4 A;  3EHK A;  5FPX A;  3WNK A;  3L1N A;  1PO2 1;  1PGL 1;  1AZD A;  4B1M A;  1YFY A;  1PVX A;  1HN1 A;  3JQX A;  2PTM A;  5I0R A;  4XMI A;  3LEK A;  3ZYB A;  5JOZ A;  5L7O B;  5BXX A;  3OY8 B;  1WD4 A;  3NV2 A;  3NMB A;  4XUN A;  3D0S A;  2P37 A;  1LEN A;  2P1Q B;  1YQ2 A;  4MGK E;  1OQD A;  1NZI A;  1SLA A;  2GMP A;  3KCY A;  1HRV 1;  1VBB 2;  4H2A A;  5FY5 A;  3ILR A;  3K75 B;  3VZL A;  5EQU A;  2YFZ A;  5H9R A;  1D4V B;  5J7M A;  2D6O X;  4JKL A;  1D0G A;  2H6C A;  2R30 A;  2VXR A;  4M3W A;  3OGR A;  4XAE A;  2RS3 1;  1OUS A;  4GAZ A;  2VQU A;  5KXD A;  4QX3 A;  5DUW A;  3SQ0 A;  2IZW A;  2VXJ A;  2WNO A;  3KD4 A;  4D6S A;  4ZZ5 A;  1SQ4 A;  5K4L A;  4XUR A;  2FDJ A;  3G6J B;  3PDQ A;  3BPS A;  5C3S A;  3SH4 A;  1RUE 2;  3H3Z A;  4GMP 0;  5FMO L;  3SUP A;  2BEO A;  4FPO B;  4BPZ A;  1JYC A;  3O1M A;  5FYC A;  1UY1 A;  1HQW A;  5JR7 B;  4IGO A;  4MXV A;  4IXL A;  1IH7 A;  5HV0 A;  3PNA A;  1RMU 1;  3W9A A;  3FMG A;  3MHZ A;  4K9S A;  1PMJ X;  1NA1 B;  4U36 A;  3WDY A;  3FBM A;  3POI A;  2JB4 A;  4KMQ A;  1DGW A;  4JGZ C;  1PK6 B;  5DZG A;  2VY0 A;  3ZN4 A;  1SLI A;  2P1O B;  3IAP A;  4RFR B;  4W6W A;  5F8P A;  2SLI A;  1KEX A;  3PIJ A;  4N53 B;  2RVA A;  1SPP B;  2K2S A;  4GAL A;  4Q4W 3;  4UW3 A;  5ANN A;  4AHZ A;  1UY0 A;  3NNL A;  4WM7 B;  4YVS C;  2CAV A;  1H2K A;  2Z5W A;  5EJ3 A;  4CU9 A;  1ODM A;  2WNV C;  3N4M A;  4DFS A;  3GF6 A;  4A7Z A;  4AKH A;  2P3J A;  4CDX B;  4D94 A;  4FK0 A;  5CFD A;  4NID A;  2BOJ A;  1O7F A;  1PIV 2;  1QH7 A;  1B09 A;  4IL7 A;  4CDQ B;  4CCM A;  2B7Y A;  4K7J A;  4OZX A;  2WYS A;  1WAF A;  5F32 A;  2ZGN A;  2V4V A;  1RVF 2;  1PO1 3;  2ZGU A;  1B35 C;  2E26 A;  2JDM A;  3EO6 A;  1H6X A;  2A6Z A;  4O65 A;  4HSL A;  5IJR A;  2Q8E A;  2MMB A;  4DTR A;  1WW6 A;  1YFW A;  5D8A B;  3WUD A;  5LEJ A;  1GZT A;  5CYY A;  4CYD A;  3FLR A;  4Z1V A;  5DZE A;  2WWJ A;  1MZE A;  4YM2 A;  4AOC A;  5FR3 A;  1VBB 1;  2RMU 2;  1JZ2 A;  2PLV 3;  3PU3 A;  2VZR A;  4LXL A;  4D6Q A;  2XQX A;  3W5M A;  3K77 A;  2XBO 3;  4YW7 A;  1C8N A;  2PFT A;  3U75 A;  2D6M A;  1ND3 A;  1G8W A;  4PBO A;  4DTN A;  3AZW A;  1Q8O A;  4IV3 C;  3R6S A;  1ZZC A;  1A3K A;  4PF5 A;  2YU1 A;  1YQ5 A;  4QXH A;  2KM2 A;  4CE8 A;  3SMH A;  2VZ1 A;  1IG9 A;  1GQG A;  5KXC A;  2DEB A;  2W91 A;  1W04 A;  1RUE 1;  2DU0 A;  2JHP A;  3C7F A;  3RWU A;  1H8T C;  1L3J A;  3N3H A;  3ZKU A;  2GNB A;  2WQZ C;  5FBJ A;  3T30 A;  3NVC A;  3LDS A;  1DCS A;  1I3H A;  3MPP G;  1HB3 A;  5JWP A;  3I3Q A;  2D6L X;  4I02 A;  5I93 A;  2VZT A;  1UKR A;  3CQ8 A;  5IVV A;  1PNF A;  2IXC A;  2P1B A;  1XNC A;  4IEU A;  4UXA A;  1EAH 2;  3VBH A;  3SNN A;  2Z79 A;  3PME A;  1I9R A;  1XB9 A;  5AFB A;  3WY6 A;  4FCA A;  3O1O A;  3WW3 A;  3DUI A;  2ZGP A;  3ZFG C;  2QVS B;  5KHI A;  3I54 A;  2K5S A;  2PAE A;  2XKO A;  3DEM A;  3SKJ E;  5IAT A;  4YLZ A;  1BBT 3;  3VDD C;  2WL1 A;  1PIV 1;  4K20 A;  3ACF A;  1UPS A;  4IE7 A;  4WVW A;  5F37 A;  1K5J A;  1H4G A;  2RJ2 A;  2WLP A;  2ATQ A;  4AZZ A;  3A21 A;  1F2N A;  1WCD J;  5CG8 A;  4A6O A;  1RVF 1;  4FOV A;  4OCT A;  2D98 A;  4AI1 A;  3VV1 A;  5E6H A;  2BBA A;  5C3Q A;  1LHO A;  4WM8 B;  2P3I A;  3OUH A;  4MOA A;  4BQ3 A;  2Y6J A;  1FZ8 E;  4LE4 A;  3AYD A;  4NWV A;  3C94 A;  2VVD A;  5A7S A;  4H55 A;  3O1U A;  2RMU 1;  4M01 A;  3DYM A;  4MH0 E;  1DQ5 A;  2W3J A;  4ZXE A;  3WQ7 A;  5FZC A;  3VDC A;  1PHM A;  4QGN A;  2DFB A;  2DU1 A;  2XJT A;  3C7G A;  3N9M A;  3HQX A;  4CCC A;  3KD1 E;  3MIE A;  1WD3 A;  4BCU A;  4A6S A;  3SJJ A;  3WHT A;  4M3Y A;  1HRI 2;  3B9C A;  5FP3 A;  3J7M A;  5AC9 2;  5JDB A;  3MZH A;  1V0A A;  1QWR A;  5FY9 A;  5ABJ C;  2FMY A;  1ULO A;  3E97 A;  5FZ3 A;  4HXC A;  1MZF A;  1O4Y A;  2L9L A;  4CCD A;  2B45 X;  4FFI A;  4GJY A;  4WZC A;  1HN0 A;  4B4Q A;  3EMR A;  5FY7 A;  2JG8 C;  3AK0 A;  1CAX B;  4ZHN A;  3AZY A;  4RNG A;  2VMH A;  1SBD A;  4FJ9 A;  5JZG C;  4OQ8 A;  1ND3 B;  4HFS A;  4M41 A;  5IUQ A;  1XU1 A;  4HCB A;  3WF4 A;  1EAH 1;  3I2J A;  3B69 A;  3O12 A;  4C91 A;  3UYJ A;  2JG9 A;  2ZEY A;  4JKK A;  4XVH A;  3AC0 A;  5A32 B;  1NCR B;  1GAN A;  4LEJ A;  4Q4W 2;  5JI7 A;  4EN0 A;  4F7Z A;  3B3Q E;  4QPG A;  3CEW A;  1CZS A;  4GKX A;  4MVT A;  2WZR 3;  4TLG A;  3VBR B;  4RL5 A;  2ZKL A;  5JMC A;  4HVO A;  1AR9 1;  2VZP A;  5EWS A;  2JH9 A;  4BK4 A;  2Y0O A;  2ET1 A;  2VUJ A;  2A73 B;  2GU9 A;  3RYP A;  1W9F A;  2D40 A;  2JDU A;  3CJI B;  4KWJ A;  1OLQ A;  5D2A A;  5K8S A;  3AMN A;  4AED B;  4XDO A;  1POV 3;  5EFU A;  2EAK A;  4I0W B;  2NP0 A;  4MUV A;  5T5J A;  2FMD A;  1PO1 2;  1K42 A;  1M4W A;  1Y9Q A;  4E3S A;  5GZG A;  4FFF A;  1CQ9 A;  2H6B A;  5GJ6 A;  5A33 A;  1FT9 A;  3PHM A;  3URF A;  1MS0 A;  3T2P A;  4ZS2 A;  2XGX A;  2D3R A;  2ZMK A;  4DQA A;  3KLS A;  2WQ4 A;  1ND2 B;  2CWS A;  2PLV 2;  5LY1 A;  1AHS A;  5E89 A;  5I8T A;  1RUF 3;  1OUX A;  1H0B A;  1HXS 3;  4QT6 A;  1O5U A;  3WNM A;  1ENQ A;  5J09 A;  4W65 A;  4AFA A;  2TNF A;  1FMD 3;  3U10 A;  4PDW B;  2XVK A;  4MV2 A;  4TSV A;  1AJO A;  1GU3 A;  2HYX A;  4IUG A;  4NII A;  3LAG A;  1FPO A;  4QND A;  1X33 A;  1BMV 2;  4IGQ A;  5FKB A;  1AR8 3;  1OHF A;  3I3E A;  5FWE A;  2ZCW A;  4FPG A;  3U14 A;  4AI3 A;  3RZH A;  3S0M A;  4BIS A;  3MW2 A;  4M3C B;  4AYU A;  4FJL A;  2GSY A;  3H7J A;  1W9S A;  1GWM A;  3GZE A;  1QDO A;  4AI2 A;  1SCS A;  1PK6 C;  2Q5T A;  3CKH A;  2K9Z A;  3P6B A;  4BDV B;  4I2O A;  1TME 2;  2YMZ A;  4KHQ A;  3ZOI A;  3ZLI A;  2XJV A;  1UWW A;  1XE8 A;  5HBA A;  1ZRR A;  5LA1 A;  4WZF A;  5A3N A;  4Q4W 1;  4XOG A;  2JHC A;  1LOF A;  1K12 A;  2G9Z A;  2ZKN A;  4JVA A;  5I91 A;  3SIS A;  5LZ6 A;  1UNB A;  1J84 A;  2JWP A;  2W87 A;  4YRD A;  3ZPO A;  4ES9 A;  2ATF A;  3CL1 A;  4FPF A;  2JEC A;  3NV4 A;  1BBT 2;  1RXG A;  3AKR A;  2QQJ A;  5JCT A;  3LZJ A;  2BER A;  2V72 A;  1SBF A;  2VOV A;  5IYY A;  3RFR A;  5C8C C;  1IPS A;  3CQO A;  1AL2 2;  3I2G A;  1CIY A;  4GZ9 A;  3TNP B;  1N1T A;  2BRT A;  3M3Q A;  2PFW A;  3U11 A;  4AFB A;  4EN9 B;  5HPO A;  1FV2 A;  1PO1 1;  4FAG A;  2AZ5 A;  3N35 A;  3THP A;  4EWA A;  4FBF A;  3CFR A;  2DUQ A;  2ORX A;  3OUJ A;  3RMC A;  2GNM A;  1QNW A;  3OGS A;  3OGK B;  1EV1 3;  1H1I A;  1JU3 A;  3B02 A;  3OGV A;  4P9Y A;  1ZM1 A;  5JMO A;  4S2F A;  2YG0 A;  2EF6 A;  1SAC A;  2CSG A;  2PLV 1;  2YFU A;  5L9V A;  2ORZ A;  5F7U A;  2XBO 1;  1U5Z A;  1V6N A;  2WAO A;  3LA2 A;  1JW6 A;  3KB5 A;  2VNG A;  4E4Z A;  2KXL A;  1N1C A;  4UFK A;  1C1L A;  4DO0 A;  3IPV A;  4ZU7 A;  1O91 A;  3VKF C;  1S1A A;  2E7Q A;  3NHG A;  2OUJ A;  2YDE A;  3LDB A;  5BNN B;  4J6G A;  4B29 A;  5EJ1 B;  4IV1 C;  2LRO A;  4LBL A;  2VCC A;  1CWP A;  1BMV 1;  3PU8 A;  1QDC A;  1MQT B;  3NNJ A;  4FP2 A;  1Q8S A;  3LFM A;  2OVP B;  1K5M C;  3C2U A;  4BE3 A;  4CP0 A;  1LOB A;  5LBC A;  3VKL A;  1W2U A;  4P00 B;  5J98 B;  2ZXQ A;  3GYD A;  5FYZ A;  4QNC A;  1YCI A;  1WW4 A;  1LOD A;  2IVI B;  3QBQ A;  1JH5 A;  1GZW A;  3M4F A;  2VU9 A;  3ME2 A;  3K4Z A;  4A2U A;  5JXJ A;  5FZA A;  1AR7 3;  1TME 1;  1W8H A;  2FCV A;  3HBK A;  4KU7 A;  3GZA A;  3S5A A;  3HNY M;  3WDU A;  3UV9 A;  4ORF A;  5DAX A;  3WF3 A;  2Y34 A;  4BWO A;  1FZ2 E;  1X36 A;  1R08 3;  2WO1 A;  3ZSE A;  2GH2 A;  5J48 A;  4BMB A;  2WRA A;  1BBT 1;  4CEY A;  4IGP A;  4CCO A;  3ST7 A;  4NVP A;  3GBF A;  4QX5 A;  4CP1 A;  3OJB A;  3OPW A;  1DIW A;  3AL6 A;  1CAW A;  2OPW A;  2NM1 A;  3A23 A;  3ZSK A;  3ZMN A;  1TEI A;  4XF3 A;  1O4T A;  4BQ4 A;  4JDO A;  4OUL A;  5T5L A;  1VJ2 A;  4RQP B;  3UKT A;  5H37 A;  4DTM A;  2AH2 A;  4UFI A;  4XF4 A;  2BNM A;  2E7A A;  4KHS A;  2WSV A;  3J8F 3;  1HV0 A;  1YI9 A;  4QPI B;  4PIX A;  3WQB A;  3GJA A;  3EYP A;  3IKW A;  4D8M A;  2R7E B;  3RG0 A;  1LEC A;  1W8T A;  2VBB A;  3HOB A;  3I3D A;  4ZKT B;  5LWB A;  1ZRD A;  3PJQ A;  1ZA7 A;  4NAO A;  1NLR A;  5BUV A;  2YGL A;  3VBO C;  3WXP A;  1VBE 2;  4GB3 3;  1PGW 2;  2LRP A;  2X5I C;  1HXS 2;  2NN8 A;  1G9A A;  1QGL A;  1UZW A;  1KJR A;  3FN9 A;  4UBG A;  1H4H A;  2IFW A;  4R4X A;  3I2H A;  1OA2 A;  4N43 C;  4A3X A;  2WIN B;  1AL0 G;  5DQ0 A;  3RWK X;  1MS4 A;  3I4I A;  2QFE A;  3IZO A;  1QU0 A;  2EXI A;  3PIG A;  1AR8 2;  3HPN A;  2YC2 A;  3VBU A;  3MYX A;  5FJK A;  2CYF A;  1OPO A;  3GHM A;  1PGS A;  3TL8 B;  1OOP C;  4QX7 A;  4BXS V;  4AKI A;  2ET7 A;  3ZYP A;  2PXJ A;  2W92 A;  2A3X A;  3TJY A;  4CU7 A;  4NIG A;  4CXY A;  2BU9 A;  1EP0 A;  4YG6 A;  3IPV B;  5DAP A;  5LA0 A;  1MHY G;  3BOD A;  4IDZ A;  2E6V A;  3VKO A;  3JBG 2;  2ZGO A;  1W6P B;  1RXF A;  2R06 3;  2WA4 A;  3PUA A;  1JZ8 A;  2J1R A;  1GBG A;  4BYY A;  1GOG A;  5GLV A;  3HNM A;  4AVB A;  2ZHN A;  5FOJ B;  2R07 3;  5IHR A;  4FFG A;  1AX2 A;  4Q1P A;  2B9U A;  3H8X A;  3TEZ A;  4Q29 A;  4OUM A;  5FZO A;  3FJS A;  3OCP A;  2CDO A;  4DMI A;  2GNT A;  4XC9 A;  1OLM E;  3M70 A;  2XR4 A;  3QH7 A;  3SNM A;  1XE7 A;  3GZU C;  2VMC A;  1GZW B;  3LCP A;  3ENR A;  5FZM A;  2X05 A;  5GKA C;  4AEK A;  5DUU A;  1W2N A;  4YM0 A;  2RJL A;  4JGZ A;  3HN3 A;  1OD5 A;  1POV 1;  2CGN A;  4HBN A;  4I09 A;  5FYB A;  4ARX A;  3VHR A;  3IWZ A;  4IQP A;  1U5I A;  2P4E A;  3H3U A;  4J25 A;  1IS3 A;  1V6M A;  2JEN A;  2CGO A;  3WG2 A;  2RM2 2;  2GP3 A;  4YSF A;  1EV1 2;  3MIB A;  2WNV A;  3P1I A;  1QJU 3;  2EIG A;  3FHA A;  1DLL A;  4YW4 A;  1XNT A;  2ZAA A;  1PGW 1;  1RUF 1;  2OXB A;  1WMF A;  1HXS 1;  2VE1 A;  3C8X A;  3O1S A;  3ZFE B;  5A1F A;  4RA0 A;  4GWN A;  1D0H A;  1PX3 A;  1V9U 2;  5A1L A;  4GH4 B;  2JHA A;  2B39 A;  3V0B B;  5ACA 3;  4HLT A;  2BFU S;  3III A;  2WNU B;  4ZY9 A;  4CUB A;  1AR8 1;  4DTO A;  5FPV A;  1D2S A;  1C8M 2;  1H9P A;  4I3G A;  4YYO A;  4DS0 A;  2W47 A;  3AVR A;  4FJI A;  2QCS B;  4DXT A;  1XRU A;  4Q5O A;  4Y22 B;  2D93 A;  4HPK B;  5A7P A;  3ZYJ B;  2QBX A;  3SUO A;  2XH6 A;  1KDM A;  4XAB A;  2YC4 A;  2PQS A;  5I8Y A;  4IV3 A;  2ZX1 A;  1AR7 2;  3G7D A;  2VEC A;  5F2S A;  3JBG 1;  2I45 A;  5ISL A;  3S7E A;  3UKN A;  4J2E A;  2QQK A;  5FBZ A;  4EJR A;  1CIW A;  1IPJ A;  3UGH A;  3V64 A;  2HKX A;  4XDQ A;  2YB7 A;  4JC1 A;  3LOI A;  2E32 A;  4ADN A;  5I0D A;  4XFI A;  4UFM A;  2ZMN A;  1IHM A;  2VL4 A;  3LZZ A;  4GD4 A;  1R08 2;  4ERO A;  3VL9 A;  2ARC A;  2HWE 3;  1N1Y A;  1AJK A;  3K48 A;  3BU0 A;  2OW4 A;  2YPD A;  4XTM A;  2P1M B;  1W8N A;  4COU A;  3BAL A;  2JX9 A;  5CAZ A;  5FO8 B;  1J1T A;  3TAY A;  5I0U A;  4QQ2 A;  1W3X A;  2LW8 A;  3VBF C;  1NCQ C;  3DKQ A;  2MZW B;  3KS7 A;  1ZRI A;  1W0O A;  2JJ6 A;  3K4A A;  4CXW A;  3J8F 2;  1SHW B;  3VKN A;  4ZU4 A;  5CFC C;  2RM2 1;  2R04 3;  1EV1 1;  4DRR A;  4LUL A;  1ZZ8 A;  3ZPY A;  5A7W B;  3BIE A;  3MEP A;  4LKS A;  2G4I A;  1ZZ7 A;  3CIH A;  2W9X A;  5FP8 A;  1UN1 A;  1ZZ9 A;  3MIG A;  3VDD A;  3H1Y A;  1E5I A;  1ZVF A;  2ZS6 B;  3NNM A;  4RHV 3;  4GB3 2;  2ZGQ A;  3GNE A;  5E88 A;  5A3M A;  3WG1 A;  4LK6 A;  1A6C A;  2RS1 3;  1V9U 1;  2WAB A;  1PNG A;  4HAN A;  5LAS A;  3TWI A;  3CDZ B;  3SQ1 A;  3ES4 A;  3NAP A;  3ZR5 A;  4AVT A;  1E5S A;  4BU2 A;  3UIQ A;  2WR9 A;  5FZB A;  4KHU A;  3S6P A;  1OXC A;  1YJL A;  1IKP A;  2EA7 A;  2OT7 A;  1C8M 1;  2X29 A;  4I3P A;  1ZX5 A;  1VRH 3;  3GAL A;  2WYF A;  2KR2 A;  3DKW A;  4LBJ A;  5FMB A;  3ZX7 A;  4QM9 A;  1CX1 A;  5LA2 A;  3LZI A;  1IZ3 A;  2O0O A;  5CU1 A;  2ES3 A;  4HK9 A;  3WW2 A;  3FC0 A;  1RJ7 A;  5BNP A;  3MLJ A;  2C0Z A;  3AMM A;  4YZ4 A;  5E16 A;  4ASK A;  2W5F A;  1AR7 1;  2GN7 A;  3IT8 A;  4COZ A;  4B1L A;  2IXK A;  5A3T A;  2RHP A;  4JCK A;  4QKB A;  4QQO A;  2BVB A;  4DOU A;  1XYP A;  3POE A;  1ULC A;  3SQ2 A;  1HB2 A;  1JXN A;  2R06 2;  4R9C A;  4CTE A;  1LGB A;  4DTJ A;  1AYM 3;  3MGU A;  4TLF A;  4W6X A;  4CDW B;  5ABJ A;  1ZZ6 A;  1DQ0 A;  1R08 1;  2VOK A;  5E1R A;  2CU5 A;  1F8V A;  5EYY A;  5FLH A;  1YC6 1;  4M0N A;  1H1A A;  3OGJ A;  3WIN E;  1GOH A;  1DU3 D;  1HB1 A;  2ERF A;  2Y6H A;  5JZG A;  2Y6G A;  4XQD A;  4CDU C;  3VD7 A;  4XZP A;  4MGS A;  3DYP A;  4LK7 A;  4B4R A;  3PVO A;  4XXP A;  4QPI C;  3RPQ A;  3ECQ A;  1TMF 2;  3J8F 1;  4X5M A;  2VZQ A;  4LKD A;  3T08 A;  1UZV A;  2ZPX A;  1SLL A;  2DCT A;  1SDW A;  1UD1 A;  4GXL A;  4QU2 A;  4BQX A;  3AB0 A;  1CR7 A;  1YQC A;  2AR6 A;  4OMD A;  1UYZ A;  1QJU 2;  4L97 A;  1MR5 A;  2HYK A;  4LIT A;  4HKW A;  1UX6 A;  3ZR6 A;  1WLW A;  4GB3 1;  4JRL A;  1YXW A;  4WBB A;  5FZ7 A;  3I8T A;  1F4H A;  3HJR A;  3M3I A;  2FQP A;  3L2Y A;  3DXT A;  2LF3 A;  1FX5 A;  3Q9O A;  4XUO A;  4B4P A;  5FZ4 A;  5JAX A;  1GQH A;  3B94 A;  5ACA 2;  2DBI A;  3ZN5 A;  5A1A A;  1CAU A;  3W59 A;  2EVX A;  4ISR A;  5FY4 A;  3RGB A;  3KT1 A;  2R1D A;  4Y5T A;  2B42 B;  1JMU B;  1XNA A;  2JB8 A;  3JCI A;  3BTZ A;  4KWK A;  1UF2 C;  4XFH A;  5IVY A;  2GC0 A;  4NRM A;  2JXA A;  2C4X A;  2D97 A;  4Y4Y A;  2RS5 3;  1VIW B;  1OFN A;  4QDS A;  4DU1 A;  5CEH A;  1W8W A;  3MFC A;  1OH3 A;  4XZU G;  2R06 1;  3NAP B;  2P6H A;  1URX A;  4P14 A;  4UF0 B;  2J1A A;  2CNA A;  3WNO A;  2R0F A;  4SLI A;  3IDB B;  3IBM A;  2XVG A;  1NXM A;  3H8U A;  4BME A;  4C8D A;  1XU5 E;  1NQJ A;  4XJW A;  2HWE 2;  4FOQ A;  3KF3 A;  2YV8 A;  5FZK A;  4PIY A;  4KI6 A;  2VW2 A;  2DCY A;  1RUC 3;  3DPR A;  1PVC 3;  1UY2 A;  1VB4 A;  2DVA A;  4EWE A;  2UU8 A;  5BYN A;  2JIJ A;  5HV4 A;  4B8E A;  4BIO A;  1KJL A;  1QY4 A;  5GLU A;  5DDJ 3;  1YLL A;  3AKQ A;  3HMY A;  1MPX A;  2WFF 2;  4FT8 A;  3RYR A;  1ASJ 3;  2R04 2;  2BYV E;  2Q8D A;  4DXZ A;  5C4W B;  1J3P A;  3VN4 A;  1XVE E;  1QJU 1;  1LJ7 A;  2EID A;  4BB3 A;  2WT0 A;  3ZFE C;  1X9P A;  4XW3 A;  4RHV 2;  3ZXD A;  5EIY B;  1KS4 A;  3LKJ A;  5C8C A;  4L9B A;  4GH4 C;  3ZFF A;  4P5H A;  2D43 A;  2RS1 2;  4RG8 A;  1QQP 3;  4ATF A;  3MID A;  3ELN A;  5ACA 1;  3V0A A;  1W03 A;  1S2K A;  4Y5Z 0;  2WN3 A;  4HN0 A;  4CEW B;  5BNO C;  3LIH A;  1IQD C;  3VB9 A;  2JD4 A;  2EIB A;  1VE0 A;  1UZZ A;  4XFB A;  2KD7 A;  1POQ A;  4CCN A;  5FZ6 A;  3QEV A;  1W2A X;  2B8M A;  2MPF A;  3H42 B;  4GMP 1;  5JLV A;  1VRH 2;  4A3Z A;  3WW4 A;  3NJX A;  3VBS C;  3EQE A;  3VHN A;  3WLU A;  3IDA A;  4CPB D;  3NV1 A;  1S0J A;  1ZRF A;  1ZRE A;  4RR3 C;  4K8R B;  1CJD A;  4EE2 A;  4AW7 A;  4IEQ A;  5F6K A;  4HZF A;  4LBQ A;  2MHF A;  3D0J A;  4OI4 A;  4I9L A;  1Q56 A;  1H8V A;  1PM4 A;  3LE0 A;  1BKZ A;  5TSW A;  2VMD A;  1K45 A;  3U4X A;  4IV1 A;  3QEW A;  2XJU A;  1ODN A;  3C7O A;  1W6M B;  1V6J A;  4OLL A;  1Q8Q A;  1J59 A;  4YNI A;  1CES A;  1K5M A;  2ZX4 A;  4QB2 A;  5FCC A;  1GSL A;  3HIF A;  5C9A A;  3QEP A;  1AR6 3;  2J7M A;  3TN9 3;  4PHZ A;  2HWE 1;  1QIQ A;  1C57 A;  1OQE A;  5ANQ A;  5J3U A;  3N7L A;  1REF A;  3R4D B;  3PUQ A;  4QHO A;  5HCB A;  2WZP P;  5FYV A;  2DVF A;  2C1F A;  2XWJ B;  2XL9 A;  4Q4V 3;  2P17 A;  3T2T A;  5G05 L;  3LD8 A;  3VLB B;  5FK7 A;  3BB6 A;  5IK4 A;  4NJ4 A;  4EYU A;  3J2P A;  2XJP A;  5HI0 A;  5JVV A;  5JPN B;  1RIN A;  5LAT A;  1RUD 3;  2WFF 1;  2FYO A;  3NW4 A;  5A3O A;  2R04 1;  2W39 A;  5A7O A;  3WQ1 A;  1FXX A;  4LUK A;  4OI0 A;  4YZ3 A;  1BVP 1;  2DF7 A;  3CHX A;  4LO6 B;  4AHW A;  5C7G A;  2IUW A;  4QX2 A;  4AG4 A;  2VGD A;  3UET A;  1XQN A;  1XU2 A;  4FTE A;  5GZE A;  2XJR A;  4RHV 1;  1WA4 A;  2XLA A;  3I2I A;  3WG3 A;  1XVF E;  2WT2 A;  3DPR B;  1GFF 2;  1RJ8 A;  2V73 A;  1GNY A;  1NE4 A;  2RS1 1;  4FJJ A;  2VPV A;  4P08 A;  4QM8 A;  3BTX A;  4M42 A;  1WUV A;  3UL2 A;  2OVQ B;  4N7I A;  2VZS A;  4S2D A;  3LB9 A;  4J1X A;  4FOW A;  3QET A;  3CNA A;  3MIF A;  4JQR A;  1QJX 3;  3LSD A;  4QX8 A;  3BUC A;  1S0I A;  1Y9M A;  5FP4 A;  3UES A;  3TAG A;  1VRH 1;  5EP9 A;  2GN3 A;  1MS8 A;  4NPR A;  5CKM A;  3KV5 A;  3B9I A;  4ATE A;  4M00 A;  2OZS A;  3VBO A;  4QPY A;  1OD3 A;  2FHR A;  3NKG A;  1CX4 A;  2X5I A;  2FBE A;  1V6L A;  2RS5 2;  2IFR A;  1R1Z A;  4Y20 A;  2VMG A;  2QQU A;  2FCU A;  4MAD A;  3ZFF B;  1S0F A;  4EZ4 A;  1PZ7 A;  4N43 A;  1LNS A;  1WCK A;  4XMA A;  4FPC A;  4A7K A;  4CDW C;  1L7Q A;  3A0N A;  3AKT A;  1LRH A;  4RD7 A;  3RMB A;  4CUG A;  2ZX3 A;  2Y6F A;  1V6I A;  5L9R A;  3GJB A;  2PA7 A;  4AF9 A;  1SLC A;  3K51 A;  4OUS A;  4XTP A;  3FX3 A;  3D5O A;  4XBQ A;  4FFH A;  1GR3 A;  3ETQ A;  3OSD A;  4M3C F;  4CRQ A;  1RUC 2;  1PVC 2;  2QDR A;  4IEP A;  2B9V A;  3HBZ A;  5DAV A;  3OBR A;  4LBQ B;  3DV8 A;  2ILM A;  5FMC A;  4FJG A;  2XUM A;  3QD6 A;  2WZ8 A;  4MXW A;  4XAC A;  1H30 A;  5DDJ 2;  5FXV A;  2AC1 A;  2YY1 A;  3FUQ A;  1LEM A;  2GC2 A;  1AR9 2;  1VP6 A;  1PX4 A;  2Y0I A;  1QNY A;  4QQL A;  5FYU A;  3VL8 A;  1N1S A;  4PQ9 A;  2VCB A;  4QXB A;  2E33 A;  2YBP A;  1SMV A;  2ZAB A;  4JTO A;  4QKF A;  2XL7 A;  3ALQ A;  4X5N A;  1OH4 A;  1FYZ E;  1GLH A;  3BVC A;  3TNQ A;  5IK8 A;  1UU6 A;  4D69 A;  1BK0 A;  5C6C A;  3KMH A;  1OI6 A;  5FO7 B;  3RZJ A;  1PMI A;  1ZRC A;  5GZD A;  1KRI A;  3GDB A;  3MKS B;  4GWI A;  4PI2 A;  5JOW A;  2UWB A;  4LT5 A;  4DB5 A;  3AP5 A;  2Y38 A;  4GWM A;  4NR1 A;  5CFD B;  5KWR A;  1RC6 A;  5FWJ A;  4JAA A;  5J37 A;  2Y8K A;  4IT5 A;  2WII B;  2RS5 1;  1OBN A;  1FYU A;  4QPG C;  2PHD A;  5ERL A;  1P22 A;  1S0E A;  3RMX A;  3NKT A;  5LBF A;  2MEV 3;  4XFA A;  1ZBA 3;  3V56 A;  4GJZ A;  5F9T A;  4QKN A;  3POY A;  4AKG A;  1DYK A;  4WV8 A;  4V2V A;  3O7O A;  1JZ5 A;  1OA4 A;  1NLQ A;  2ZHM A;  1XYN A;  5A80 A;  4OMC A;  4QAW A;  4Y1X A;  3HEI A;  4PT6 A;  1C5I A;  1TG7 A;  3T0A A;  2H4T A;  1UMH A;  1W6N A;  3CF6 E;  3K3O A;  1RUC 1;  2VOT A;  4UFL A;  1PVC 1;  4G3Y C;  1FOD 3;  3SIT A;  2DUR A;  2MNG A;  2J1E A;  4Q4V 2;  3RVH A;  4P9G A;  5H9S A;  2TEP A;  1BCX A;  4Y20 B;  1BVV A;  5A6X A;  1W6Q A;  4Y1V A;  4QDR A;  1UPI A;  5DDJ 1;  3VDA A;  3H9A A;  4L8Q A;  3SPZ A;  3SUQ A;  1RUD 2;  1W90 A;  4FPH A;  3CLP A;  4G4F A;  4YVW C;  1KGY A;  5C4W C;  1DQ1 A;  2JE9 A;  1UIK A;  4OQ9 A;  4JDN A;  3JZV A;  4GIQ A;  4Y3O A;  1OF4 A;  2OKX A;  3T1L A;  1FZ0 E;  4EN6 B;  3AZX A;  5C3O A;  1ACC A;  1GNZ A;  1XMF E;  3OD0 A;  3B00 A;  2A6V A;  4A42 A;  1Y9G A;  1ZBE 3;  2EAA A;  4KHY A;  5L73 A;  1XJA A;  3AP9 A;  4ONU A;  1BK1 A;  3BCW A;  5CAD A;  4W6Y A;  5L7O C;  3UT0 A;  3VBH B;  1JYX A;  4Z92 B;  3KZ4 C;  1LCL A;  4CEW C;  4E4D X;  2I07 B;  1FZ5 E;  3LIG A;  3OOX A;  4RS5 A;  1W99 A;  4MXW B;  1SZB A;  5DUX A;  1MZ6 A;  3IMN A;  2BW8 A;  1W05 A;  2D3P A;  3NJZ A;  4HOO A;  1HJG A;  5DMY A;  3ON7 A;  2JDZ A;  4JKM A;  2BUK A;  2BGP A;  2XBO 2;  2DVD A;  5K0U A;  1LOG A;  4CA9 A;  3N7J A;  4KQ7 A;  1US2 A;  1EUU A;  1X50 A;  4JHT A;  1UU5 A;  3O0X A;  3FFZ A;  4YGC A;  5AVP A;  1W06 A;  3AP4 A;  4COV A;  5FPZ A;  5AFE A;  5FXX A;  1Q8V A;  2BQP A;  2R32 A;  3VHP A;  5LRR A;  1ZZB A;  1VAL A;  1IGO A;  2VIX A;  1UMZ A;  3VZJ A;  2X53 S;  2QQV A;  1G9D A;  4AHY A;  2BVV A;  3VZO A;  5IVE A;  4G9S B;  1LHN A;  2XB6 C;  3T4H B;  1DFQ A;  2YZ4 A;  2ZA9 A;  4JS5 A;  1G6N A;  4NRQ A;  1KQR A;  1RB8 G;  1NA1 C;  5LCW L;  2P5B A;  3WDV A;  3K4D A;  3ZIX A;  4Z2A A;  2Q4S A;  3A0K A;  3ZXF A;  4AQT A;  2VW0 A;  2YBS A;  3ZIW A;  1QXR A;  3LGR A;  5LY2 A;  4N53 C;  4Q4V 1;  1DZR A;  1NX9 A;  2QJV A;  4GWJ A;  5IVJ A;  1F31 A;  1VMF A;  4WM7 C;  4AVA A;  3O14 A;  3ZN6 A;  4Y1Y A;  3RMD A;  1WW7 A;  4NPM A;  3DEC A;  1JBC A;  5EPA A;  3RMY A;  5IFT A;  1RUD 1;  5JXI A;  4FJH A;  1XPW A;  4LOS A;  3KVB A;  4CDX C;  3HP9 A;  4MHU A;  4OYU A;  4X6R B;  1VBD 3;  4XHB A;  2QQI A;  3WNX A;  1N3Q A;  2OUH A;  4OHV A;  5HCF A;  4TWT A;  3QCW A;  4DIN B;  3H1M A;  5F3I A;  2ZX2 A;  4CDQ C;  5DXD A;  3I97 A;  3UJQ A;  1AUY A;  2W08 A;  1RGS A;  4MGT A;  1KS5 A;  1ULD A;  1NQD A;  4PCR A;  4CDU A;  3WR0 A;  4AI0 A;  4GAM C;  1XYO A;  1FI2 A;  5FZG A;  3H1W A;  3SCF A;  2JG9 B;  5D8A C;  1V70 A;  1MS5 A;  3OB8 A;  1AX1 A;  1LES A;  1W6Q B;  1GKB A;  4KHN A;  3PUS A;  4JGY A;  2WSU A;  3OEB A;  1QJX 1;  3ABZ A;  1UOJ A;  4IE0 A;  4QD2 A;  4TN7 A;  4XFG A;  3AMP A;  2ZGL A;  3AP7 A;  2R6Q A;  2VVF A;  3BPZ A;  3PUH A;  3L8B A;  3JB8 A;  4Q8K A;  4AI6 A;  4AAP A;  3IM0 A;  3PVN A;  2ZHK A;  5F3C A;  3SKV A;  3ZYR A;  2DVG A;  4BXF A;  4FJM A;  2RE9 A;  3K3N A;  4FPJ A;  3LOB A;  1W39 A;  4ES8 A;  4P9L A;  1Q43 A;  3WV6 A;  5KHK A;  4IND A;  1DF0 A;  4YGE A;  4CCL A;  3AL5 A;  1W0P A;  3RZZ A;  1LGN A;  4JRP A;  1FAY A;  2MEV 2;  1ZBA 2;  1ALY A;  4P9W A;  1FZ7 E;  4M0H A;  3KD5 E;  2O8O A;  2HEV F;  5A33 B;  3NJY A;  3S9H A;  4RS5 B;  4I30 A;  1ENS A;  2G9F A;  4BOW A;  4DIQ A;  2OZM A;  1COV 3;  1OUR A;  1JUH A;  1WMD A;  2RDN A;  4TXW A;  3B01 A;  4I0A A;  2YRO A;  3Q8A A;  2W0X A;  4LNV A;  3NCI A;  1VR3 A;  3C7E A;  1AYN 3;  1DGR N;  1CN1 A;  4FI9 A;  4C90 A;  2W2I A;  3CZJ A;  2P5G A;  2ARX A;  1S4C A;  3B7M A;  4WVM A;  1DGR A;  1FOD 2;  2YHJ A;  3NNF A;  3RJR A;  3WUC A;  4YFZ A;  1F35 A;  2ZX0 A;  1LOC A;  2W94 A;  1STM A;  2AEZ A;  4PJY A;  2WLQ A;  4W50 A;  2OS2 A;  3OBA A;  4KWU A;  3Q8E A;  3THD A;  1VAK A;  3BOP A;  4EQV A;  3KQ4 B;  1I1E A;  4XEZ A;  1EUT A;  3C95 A;  3CO2 A;  2WZR 2;  2Z42 A;  2VBP A;  2WS9 3;  4S2G A;  4D7Y A;  5CA6 A;  2E7T A;  1WZX A;  2BOI A;  2XML A;  3GGL A;  1J3Q A;  3GBW A;  2QUO A;  2VMF A;  1T2X A;  2IXL A;  4JV4 A;  4QPW A;  5CIS A;  2PHT A;  4BLJ A;  5JOX A;  1JYW A;  3RS6 A;  4WM8 C;  4IEZ A;  3T1M A;  2VUL A;  4CCJ A;  3PTR B;  5JOY A;  3S57 A;  1H2M A;  3WF0 A;  3TEW A;  2VQT A;  2AEN A;  2GDF A;  4OI2 A;  4OFG A;  1JZ6 A;  2GH8 A;  5CKN A;  1XVG E;  4D7S A;  4NWW A;  5HCA A;  3AVS A;  2YB5 A;  4ISQ A;  4PLN A;  1RUH 3;  1RUF 2;  1UKG A;  2YUE A;  1MVE A;  4XCA A;  1JHN A;  1UAI A;  5JPM B;  1MHZ G;  3WP6 A;  1SFY A;  1YNA A;  3GM8 A;  1U12 A;  1FMD 2;  2PQQ A;  3ES1 A;  1LU2 A;  1LHU A;  5FUP A;  4EV0 A;  2JEM A;  5C70 A;  4DY3 A;  2XHK A;  3RZL A;  3NV3 A;  2MEV 1;  3N9O A;  1ZBA 1;  2DUP A;  3OYW A;  4FP3 A;  5D21 A;  3THT A;  5A7N A;  1IOA A;  1ULG A;  2VG9 A;  1OF3 A;  2XHN A;  4JGY B;  3UGF A;  2WUH A;  5IAX A;  1DQ6 A;  1JW2 A;  1ND3 C;  1E5H A;  5CBL A;  3O1P A;  3CFP A;  4LR4 A;  4H14 A;  3VBS A;  5JUV A;  1L7L A;  1X9T A;  4QDQ A;  4DTS A;  4XIL A;  4A44 A;  4CU8 A;  5FZL A;  4WVZ A;  3IAQ A;  2IWG B;  1FOD 1;  3IDE A;  3MW3 A;  3UK9 A;  2HEW F;  4Y5S A;  1QJZ A;  1NCR C;  4Q0Q A;  4LIV A;  3Q8C A;  4HVR A;  4HVQ A;  1UMI A;  1O5L A;  2WDB A;  4UW5 A;  5KBF A;  1XOY A;  3TYJ A;  3VBR C;  3AJY A;  5FY1 A;  5LRS A;  4URA A;  2WZR 1;  3FE5 A;  1MS9 A;  5FK8 A;  3JD7 3;  5FZI A;  1NT0 A;  2FDF A;  1UXZ A;  2FW3 A;  3EBR A;  3ZXJ A;  2XUE A;  4C1X A;  1TNR A;  1VBC 3;  2ZJC A;  3CJI C;  2Q1F A;  3NWK A;  4XYX A;  3D3A A;  4FXK B;  4M3R A;  2JPN A;  3DN7 A;  4HKO A;  4K21 A;  2RKH A;  1GOF A;  2RR1 3;  1LOA A;  2LF6 A;  4UOJ A;  3K2O A;  4P02 B;  4UFH A;  1WGP A;  4B08 A;  3GBG A;  3LEI A;  4FO9 A;  2HH9 A;  4MG2 A;  2AUY A;  4YVS A;  1BHG A;  3WP3 A;  1CAV A;  2WN2 A;  3HD8 B;  4K6B A;  1IG0 A;  1ND2 C;  2C5D A;  2VH9 A;  1YEW A;  3KQR A;  3BN6 A;  4OI1 A;  4BM8 A;  4MYE A;  4CEY B;  3N9L A;  2VVE A;  3C6N B;  4QGM A;  3D6E A;  4A7Y A;  4CU6 A;  1SEF A;  5HXV A;  2WAA A;  1CAW B;  3SCH A;  4DZG A;  4DUW A;  4ZZ8 A;  4PDW C;  1OLM A;  2PAM A;  4E4S A;  1FMD 1;  1M06 G;  1H6Y A;  4URT A;  4ZON A;  1FZ9 E;  1HJF A;  1QJY 3;  2WT1 A;  2IVJ A;  4YW2 A;  5IAV A;  1W6O A;  4E8C A;  3NAE A;  5F5A A;  5KHG A;  1B35 A;  1QMJ A;  3MLL A;  2PAK A;  5CIR A;  5KHH A;  3U4S A;  2VNO A;  3J7L A;  5F39 A;  2BGC A;  3VDB A;  3RZG A;  2XQR A;  2WA3 A;  3PJY A;  4W8J A;  2D6N A;  3L0M A;  2E31 A;  1Q9X A;  1COV 2;  1WBF A;  3I2K A;  4AI9 A;  5IT6 A;  2Y33 A;  5DAB A;  1R1A 3;  2RJK A;  2OPK A;  5DPN A;  3VKM A;  4BQY A;  2JDA A;  3O1V A;  1LHW A;  2ZEW A;  3PTY A;  1ULE A;  1AYN 2;  3RDI A;  1G7Y A;  4Z2W A;  2HWB 3;  5L19 A;  4ASL A;  2UY8 A;  5DG2 A;  3AMH A;  1NUK A;  4M4P A;  2C24 A;  2WO3 A;  2YXS A;  3MLK A;  4Y26 A;  3OYW B;  1N3P A;  2PHF A;  2AGS A;  4DTP A;  3SI6 A;  3N7K A;  3KCX A;  1H8T A;  1CPN A;  3NST A;  5CNA A;  3FWE A;  3VBU B;  3NDK A;  1HRV 3;  4F8A A;  1UYX A;  2WS9 2;  2WWU A;  1W9Y A;  3AM2 A;  3FUO A;  1UO9 A;  3ZDS A;  4HT1 T;  5CKQ A;  5LW9 A;  5LBE A;  4XET A;  3HR9 A;  3LDK A;  3SQ4 A;  4AK3 A;  4FTB A;  4QKD A;  5FYI A;  5FYY A;  3ITQ A;  3ZYI B;  3AP6 A;  2YGM A;  1FPN 3;  3AKP A;  3ZYF A;  3U0Z A;  1LU1 A;  3SUN A;  4JHZ A;  3I59 A;  2CV6 A;  1SLT A;  1RUI 3;  2W68 A;  3PLQ A;  4XE9 A;  3ZFG A;  3NO8 A;  3SEE A;  3VD5 A;  2P6C A;  5GZC A;  1GNH A;  5FZO B;  5A7Q A;  1YRZ A;  5A3U A;  3L2H A;  3RQ0 A;  3HT1 A;  4LBM A;  1VPH A;  3I2D A;  3ACL A;  4LOT A;  4W4Z A;  4AEJ A;  1O3Q A;  2YYO A;  4KI4 A;  5BNN C;  4BQW A;  3E5X A;  3SCG A;  3LDR A;  3N9N A;  5F2W A;  4E4H A;  4JGZ B;  2HBU A;  4ZXK A;  1MQT C;  1N47 A;  3THC A;  4Q0S A;  4YM1 A;  5FZ8 A;  3R4S A;  2DFC A;  2Y6K A;  2ZAH A;  4XIK A;  1QXP A;  2F17 A;  3RJ2 X;  1WAJ A;  4LJH A;  3KV6 A;  3OBZ A;  2WNV B;  1COV 1;  2J42 A;  1W9T A;  3JXS A;  3DCQ A;  4COW A;  2P2K A;  4RYD A;  2ZGR A;  2XG3 A;  2ADD A;  1S2B A;  3RI9 A;  3WZ1 A;  2IXH A;  1AYN 1;  2VAU A;  4FPE A;  4H7M A;  5FPL A;  1EPZ A;  4OHZ A;  5A3L A;  4BHP A;  1O4Z A;  4JTN A;  5CVR A;  1YUD A;  1RIT A;  2DCZ A;  2OVR B;  3USU A;  1VAM A;  4UBH A;  2NQY A;  2G1M A;  3WOG A;  1VLN A;  1AXZ A;  1B35 B;  2PHW A;  3LA7 A;  5A3W A;  4AVV A;  4GUL A;  1GV9 A;  1Y7B A;  2PHL A;  3MUY 1;  2F6B A;  2R07 2;  3OD4 A;  1C28 A;  1VBA 3;  3JD7 2;  2LTN A;  4AHX A;  1HB4 A;  2WS9 1;  4XXA A;  3H3L A;  2XWB B;  4EZH A;  1QOS A;  2UUR A;  3BOW A;  1SDD B;  2JG8 A;  3OG2 A;  4OHY A;  3AYE A;  4CZS A;  4IEO A;  3WP5 A;  5F5I A;  4N8M A;  3T0D A;  1QHD A;  2P5O A;  4RQP C;  2WJS A;  2GZW A;  1D4M 3;  4IV3 B;  4CCK A;  1APN A;  3HQU A;  5B4X A;  2A70 A;  5C5T A;  4DUX A;  1Z7S 3;  2LUW A;  4R9D A;  3LWC A;  4Y1Z A;  3U07 A;  3E5U A;  4BQ5 A;  2NYY A;  4LBN A;  1LOF C;  2D6P A;  2Q8O A;  1PZ9 A;  3OGL B;  1JUI A;  2VQA A;  1UYY A;  1GWL A;  3U37 A;  4YVW A;  1V00 A;  2VZU A;  4NRP A;  1H8T B;  4IEY A;  4AGV A;  4A45 A;  1RL3 A;  2A5Z A;  3I7D A;  2CTV A;  2QKD A;  2W95 A;  4P9I A;  3BKZ A;  1BQP A;  1RUH 1;  2XDV A;  1FNZ A;  3OPZ A;  1PM7 A;  3LPG A;  4Z82 A;  1KIT A;  5FMO S;  3O1T A;  1DG6 A;  1W3V A;  2DTW A;  1G9F A;  1P8J A;  3LF7 A;  1QOT A;  4KWL A;  4Y33 A;  1UY3 A;  2A6W A;  3BU7 A;  3P3N A;  4FXG B;  5DN2 A;  1QJY 2;  4HG6 B;  4L92 A;  4KBB A;  3ZDV A;  5L7O A;  3OY8 A;  2VTX A;  3WX5 A;  1O3S A;  1IKQ A;  5GLW A;  5IZ7 A;  4YPJ A;  4Q4Y 3;  5FV3 A;  2BV4 A;  4ZU5 A;  3I59 B;  5I8S A;  3WT3 A;  4B7E A;  3KT7 A;  1NLS A;  4NUB A;  3ZFG B;  4GA9 A;  5A6Z A;  1W2T A;  4TTG A;  3VD3 A;  4XFF A;  4YM3 A;  1T6B X;  2XPJ A;  1R1A 2;  4QXC A;  3VDD B;  1FZ1 E;  4AQS A;  4TZD A;  3ATG A;  4P5Y A;  2BP6 A;  2W1S A;  1RVF 3;  2HWB 2;  4XF9 A;  3RWN A;  4D6R A;  3SH5 A;  1W28 A;  2QQO A;  5CG9 A;  4IEX A;  5LA9 A;  2P1N B;  2YPJ A;  2NPI A;  4EWD A;  3OGG A;  4Q0P A;  5IW0 A;  2ZBJ A;  2EXH A;  1R64 A;  2R07 1;  2PYT A;  2ZEZ A;  4V1P A;  3O0V A;  2RV9 A;  4KH9 A;  4FPK A;  2RMU 3;  3JD7 1;  3V65 A;  2B4K A;  3H8O A;  1GIC A;  3FZ3 A;  4HSJ A;  3ILF A;  4QHZ A;  1JYV A;  5BNP B;  2XLF A;  1PK6 A;  1REE A;  3LSE A;  1W8F A;  2BWC A;  4LOR A;  4E2Q A;  1MS3 A;  3ZM8 A;  2D3S A;  1W2O A;  1X7N A;  3TEX A;  1UY4 A;  2ENR A;  4E4B A;  1SPP A;  1FPN 2;  4M3T A;  2CDP A;  4WM7 A;  3FFQ A;  1KFX L;  3UNP A;  3EXU A;  4N9I A;  3OBT A;  4JRA A;  4XJA A;  2N7G A;  1OC1 A;  5ABJ B;  4NMI A;  2KA3 A;  2J22 A;  1AVB A;  4NE9 A;  1UXX X;  4JS4 A;  3J7N A;  4FQZ A;  4IEV A;  4BIF A;  5J96 B;  4BH9 A;  2FCT A;  1H9W A;  1GZ9 A;  2XVL A;  1HQL A;  1KFU L;  1YI7 A;  2JG8 B;  5FDB A;  3ACG A;  5JZG B;  1JZ4 A;  1YIP A;  1XE0 A;  2V4A A;  1SLB A;  2JIC A;  4MET A;  2FDG A;  5M0T A;  5DAW A;  1YQ8 A;  5FKC A;  2AAC A;  1RIR A;  2WNU C;  1QJY 1;  3B93 A;  4I0B A;  2WKK A;  4IW3 A;  2R1B A;  5GLT A;  2WC2 A;  2WQ8 A;  3TBD A;  3WHU A;  2ZHL A;  3QER A;  3D82 A;  3H0O A;  3M3O A;  5FUN A;  2XXZ A;  1XMH E;  3ROU A;  2I74 A;  4QQP A;  4LBK A;  3AZZ A;  4M3Z A;  1Q8P A;  3J9S A;  3ZKY A;  3QNO A;  1JN2 P;  1HX6 A;  1F5F A;  2VTF A;  5HCH A;  4DRV A;  3UKV A;  2FD8 A;  3MF9 A;  2A1X A;  2AEY A;  3WNN A;  1R1A 1;  2D5H A;  1IS6 A;  3N1E A;  1V6O A;  1QJF A;  1JU4 A;  1OLR A;  2Q1Z B;  3MO4 A;  3ZSJ A;  3ZXA C;  2HWB 1;  3B5L B;  4L11 A;  2XKP A;  2P3Y A;  2VNV A;  4BZ4 A;  2DVB A;  4J2D A;  2GAL A;  4BJ0 A;  1XNK A;  1FZ3 E;  3FBY A;  5FYT A;  1XXN A;  2NLR A;  5BY5 A;  5IVF A;  1JOJ A;  1RTV A;  1XVC E;  5T50 A;  5APA A;  1CAU B;  1AYM 2;  5FMD A;  2VM9 A;  3RI8 A;  4XUT A;  2JKX A;  2VC9 A;  3VBU C;  1JI6 A;  1CGP A;  3O0W A;  1XMG E;  4K1Y A;  1VBA 2;  2DY4 A;  1FZ6 E;  3C7H A;  3I49 A;  2R0H A;  4PLO A;  2LAL A;  3MFA A;  4FJ8 A;  4QXK A;  2A7A A;  5FYM A;  5GLZ A;  2HWF 3;  2VJX A;  1W9W A;  4LO5 B;  5DZF A;  1D4M 2;  3HAG A;  5EHD A;  1Q5O A;  5EYX A;  3I2O A;  3LEG A;  1UZY A;  4YZ1 A;  4HON A;  1HRI 3;  1VB2 A;  5BNQ A;  4Q0V A;  1GP5 A;  1Z7S 2;  1FPN 1;  4LLO A;  5DUV A;  4UT5 A;  3W21 A;  5AC9 3;  5KXE A;  4UWD A;  1LB2 A;  2W1Q A;  1C1F A;  1RUI 1;  3DGT A;  1FS1 A;  5FIX A;  3KHC A;  3MBW A;  1ULP A;  2ZGK A;  3CU7 A;  2PHR A;  1OKO A;  1UIJ A;  1IS5 A;  1UCX A;  4PBP A;  1XVB E;  2B8I A;  3H50 A;  2EAL A;  1S2E A;  1S0G A;  4S2H A;  3WCR A;  3NRU A;  4GKY A;  4O9G A;  4ZPI A;  4C0B A;  2HBT A;  3MPB A;  5CZK A;  4ET7 A;  5JI9 A;  4OHW A;  2P1P B;  2X8K A;  2JIG A;  4F83 A;  3VD9 A;  4OUE A;  4FTS A;  5FYH A;  2PEL A;  1AF9 A;  2V5Y A;  5KC5 A;  3GCW A;  2BWA A;  4LIU A;  2W52 A;  4WM8 A;  1W8O A;  3IN9 A;  4NIA A;  2VZO A;  2HWC 3;  5I0T A;  5IFP A;  2JDP A;  1UU4 A;  4Q4Y 2;  4DXS A;  2K46 A;  1NYW A;  1WBL A;  1WME A;  2Y60 A;  5LK5 A;  3T2Q A;  4FK2 A;  2GND A;  1O8S A;  1YFU A;  2FDK A;  1RUJ 3;  1HW5 A;  4V2W A;  2DTU A;  1GP6 A;  1WWY A;  1LKN A;  2GMM A;  1I6X A;  3MF6 A;  3W5N A;  2UWA A;  1LAJ A;  1UOF A;  5C8C B;  4O7X A;  5FQ0 A;  5KXB A;  4FJN A;  2DV9 A;  1LDK E;  1X8E A;  3CBN A;  3M2M A;  2D6K A;  4LO4 B;  3T09 A;  3RZK A;  4IER A;  4LLF A;  3V0A B;  4XBN A;  5DAQ A;  5IK5 A;  1OA3 A;  3HGL A;  3TAE A;  1AYM 1;  2RDS A;  4FAH A;  3A7Q A;  3I3B A;  1SG3 A;  2RDQ A;  4WVV A;  3OEA A;  1YHF A;  3POS A;  3WDW A;  4AL9 A;  4E8D A;  3POG A;  1VBA 1;  2CY6 A;  4LUM A;  1CAX A;  2XJQ A;  2ARA A;  2W1W A;  3ZVX A;  3POB A;  1OOP A;  4BA6 A;  2ZAC A;  1UOG A;  3F95 A;  4FPY A;  4EPH A;  4L99 A;  1NAE A;  2QDN A;  1EPW A;  4XJZ A;  1WMX A;  1D4M 1;  1E57 A; 
#chains in the Genus database with same CATH homology
 4FJ7 A;  1L7R A;  4OZO A;  4M3U A;  3FHA A;  1DYO A;  3CFO A;  2JD9 A;  2VME A;  3RMA A;  4M3X A;  3V7D B;  4GAM C;  1XNT A;  3C8X A;  1CLQ A;  4KHW A;  1PX3 A;  3OB8 A;  2JHA A;  1MMO G;  4KHN A;  5HXM A;  2C26 A;  3OEB A;  3ABZ A;  3HL8 A;  3III A;  3J7H A;  3NNG A;  4JX0 A;  4ZY9 A;  4CUB A;  4DUV A;  3PUH A;  3L8B A;  3OGM B;  4DTO A;  5IBK B;  4AI6 A;  2RCU A;  3SKV A;  4FJM A;  2W47 A;  3VD4 A;  1UZ0 A;  4FJI A;  4D0Q A;  4DXT A;  4DXR A;  2C9K A;  2J1U A;  3CZU A;  2HLE A;  2QBX A;  3SUO A;  1W0N A;  3PUI A;  2YC4 A;  2PQS A;  4JRP A;  3K46 A;  1FZ7 E;  3KD5 E;  4J2E A;  2QQK A;  3S9H A;  4DTX A;  1CZT A;  2YB7 A;  2OZM A;  4M45 A;  4I9Q A;  2E32 A;  4ADN A;  2X09 A;  5I0D A;  4TXW A;  2VL4 A;  2VZ3 A;  3E4Y A;  3NCI A;  3C7E A;  4FI9 A;  3CZJ A;  2P5G A;  3TAF A;  3NQH A;  3LQC A;  2P1M B;  1W8N A;  1XU3 E;  2W94 A;  2Y64 A;  5JXH A;  3QEI A;  4W50 A;  3OBA A;  4KWU A;  3THD A;  2LW8 A;  4DU4 A;  2MZW B;  3L1N A;  1EUT A;  3C95 A;  3WNK A;  3K4A A;  1HN1 A;  1SHW B;  3T0B A;  3QES A;  3LEK A;  3GGL A;  2JH8 A;  4LKS A;  3LPF A;  3CIH A;  2BGO A;  4XUN A;  2W9X A;  1YQ2 A;  2P1Q B;  1T2X A;  2VMF A;  3ETP A;  4QPW A;  2WO2 A;  1JYW A;  4FJX A;  4A4A A;  3K75 B;  2YFZ A;  2WAB A;  1PMH X;  4JKL A;  4JRQ A;  3CDZ B;  3SQ1 A;  4M3W A;  3OGR A;  2VQT A;  1XC6 A;  3WF0 A;  1JZ6 A;  2VQU A;  4QX3 A;  3UIQ A;  5JR2 A;  1XVG E;  3SQ0 A;  4KHU A;  4ZZ5 A;  2YB5 A;  3L2O B;  4XUR A;  1CX1 A;  1MHZ G;  3SUP A;  5LA2 A;  3LZI A;  3GM8 A;  1UY1 A;  5C70 A;  1IH7 A;  2W5F A;  1FZH E;  4QB1 A;  1PMJ X;  3T2O A;  1DLC A;  1OF3 A;  4KMQ A;  2XHN A;  3SQ2 A;  2WUH A;  2P1O B;  3IAP A;  4DTJ A;  1GMM A;  1KEX A;  2RVA A;  3CFP A;  1UY0 A;  5JUV A;  1RYY A;  2VZV A;  4CU9 A;  4QDQ A;  4A44 A;  4DTS A;  3F2Z A;  4CU8 A;  2V5D A;  3C6O B;  4LQR A;  3IAQ A;  3WF2 A;  1GOH A;  4AKH A;  2Y6H A;  3N1B A;  4FK0 A;  2Y6G A;  1GUI A;  3VD7 A;  1UMI A;  2WDB A;  4MGS A;  1JYN A;  3DYP A;  2WYS A;  1WAF A;  3T08 A;  3ECQ A;  2V4V A;  4X5M A;  2VZQ A;  3NE6 A;  1UXZ A;  2FW3 A;  2E26 A;  4AAX A;  1H6X A;  1D7P M;  5IJR A;  3D3A A;  4OMD A;  2MMB A;  4DTR A;  4M3R A;  1UYZ A;  2JPN A;  5CYY A;  4UOJ A;  1CZV A;  1GOF A;  2LF6 A;  3C6P B;  1JZ2 A;  3K2O A;  2VZR A;  4P02 B;  3W5M A;  2XQX A;  3K77 A;  1F4H A;  2Z4F A;  4B08 A;  3HJR A;  2PFT A;  3LEI A;  4DTN A;  2LF3 A;  4XUO A;  1BHG A;  2WN2 A;  5A1A A;  4BK5 A;  3BN6 A;  3E4W A;  2VZ1 A;  1IG9 A;  4EYW A;  4LPL A;  3C6N B;  4CU6 A;  2DEB A;  2W91 A;  4DUW A;  2WAA A;  1XNA A;  4ZZ8 A;  2JHP A;  3C7F A;  3RWU A;  1H6Y A;  3LDS A;  1FZ9 E;  2C4X A;  3WNL A;  5G04 L;  4E8C A;  3NAE A;  3HGK E;  2VZT A;  3CQ8 A;  4QDS A;  4DU1 A;  3VDB A;  4XZU G;  4W8J A;  2J1A A;  3L0M A;  2E31 A;  3SNN A;  1Q9X A;  3I2K A;  3WNO A;  2VR4 A;  2ZEX A;  5DPN A;  4FJ5 A;  1XU5 E;  2JDA A;  5JXG A;  2ZEW A;  1DP0 A;  5EJZ B;  3FL7 A;  2PFV A;  3SKJ E;  4KI6 A;  3A22 A;  1NUK A;  1UY2 A;  4M4P A;  1XVD E;  2WO3 A;  3ACF A;  2RJ2 A;  2ATQ A;  4DTP A;  3SI6 A;  3A21 A;  2QQM A;  2X10 A;  4A6O A;  3NDK A;  4J2B A;  1UYX A;  1MPX A;  4KI5 M;  2BBA A;  3SPY A;  4MOA A;  2Y6J A;  1XVE E;  1FZ8 E;  2EID A;  3SQ4 A;  3C94 A;  1JZ3 A;  3DYM A;  2W3J A;  4ZXE A;  5EIY B;  3VDC A;  3C7G A;  4UAP A;  4A41 A;  3GXU A;  3KD1 E;  3SUN A;  2DCJ A;  4JHZ A;  4RG8 A;  3SEE A;  3VD5 A;  2WN3 A;  2EIE A;  3SJJ A;  3TAB A;  4M3Y A;  3WSO A;  1IQD C;  4UI9 L;  2EIB A;  2KD7 A;  3QEV A;  1ULO A;  4W4Z A;  2WBK A;  4KI4 A;  4MGQ A;  4A3Z A;  2L9L A;  3NJX A;  3IDA A;  3THC A;  4RNG A;  4XUP A;  4FJ9 A;  4I9L A;  2W46 A;  2Y6K A;  4M41 A;  3LE0 A;  1WAJ A;  1K45 A;  2VMD A;  4HCB A;  3QEW A;  3WF4 A;  3I2J A;  3C7O A;  1FZI E;  3JXS A;  1W9T A;  5J1X A;  2ZEY A;  4JKK A;  4XVH A;  3AC0 A;  4RYD A;  4QB2 A;  3QEP A;  2J7M A;  2J1V A;  1US3 A;  5IRE A;  1CZS A;  4RL5 A;  2VZP A;  2JH9 A;  4BK4 A;  2OVR B;  3HNB M;  3LD8 A;  5G05 L;  1I5P A;  3MUY 1;  3J2P A;  2VJ5 A;  2FYO A;  3ACI A;  1WKY A;  5FUI A;  1K42 A;  1FXX A;  3OG2 A;  1SDD B;  4E3S A;  4PQQ A;  5C7G A;  3T0D A;  2P5O A;  4QX2 A;  4AG4 A;  3UET A;  3IB3 A;  3CMG A;  3T2P A;  2WZE A;  5B4X A;  1O8P A;  4DUX A;  4EP9 A;  3I2I A;  1XVF E;  4P08 A;  1GNY A;  4FJJ A;  3WNM A;  4M42 A;  3OGL B;  1UYY A;  3U37 A;  2VZU A;  2OVQ B;  2VZS A;  1GU3 A;  4A45 A;  3QET A;  2HYX A;  4IUG A;  2W95 A;  4QND A;  4LHS A;  3UES A;  3TAG A;  3WF1 A;  4FVM A;  3LPG A;  4CVU A;  3I3E A;  2W1U A;  3EB7 A;  3E1F 1;  3QNN A;  2OZS A;  1P8J A;  1OD3 A;  1UY3 A;  4FJL A;  5DN2 A;  1W9S A;  4HG6 B;  2DCK A;  5IZ7 A;  4MAD A;  4YPJ A;  2J1S A;  3CKH A;  3P6B A;  1LNS A;  3SCX A;  4BDV B;  4KHQ A;  1L7Q A;  5B4N A;  4TTG A;  3VD3 A;  1UWW A;  3RMB A;  2HD0 A;  5LA1 A;  1O59 A;  2JHC A;  1FZ1 E;  2LS6 A;  1K12 A;  2QQL A;  1J84 A;  2W87 A;  4P5Y A;  2W1S A;  2QQJ A;  2QQO A;  3LZJ A;  2DDU A;  2BER A;  2V72 A;  5IYY A;  2B9V A;  2P1N B;  2XON A;  2EIC A;  3CQO A;  4GZ9 A;  3I2G A;  1CIY A;  1R64 A;  4ADO A;  4ARY A;  2ZEZ A;  1XL3 C;  4FJG A;  1TVG A;  2RV9 A;  2WZ8 A;  3NJV A;  2B4K A;  5HPO A;  3MV0 1;  2VO5 A;  1NEX B;  4DTU A;  3SEP A;  3CFR A;  2ORX A;  1PX4 A;  3RMC A;  1JYV A;  3OGS A;  3OGK B;  1UX7 A;  3OGV A;  1JU3 A;  5JMO A;  2VCB A;  2YG0 A;  3ZM8 A;  2YFU A;  1UY4 A;  4E4B A;  2E33 A;  2ORZ A;  5F7U A;  1F4A A;  2QQN A;  2CDP A;  4M3T A;  2WAO A;  3UNP A;  3ACH A;  1JHJ A;  2J1T A;  4X5N A;  1OH4 A;  1FYZ E;  2J22 A;  1UXX X;  4JS4 A;  3NHG A;  4MO3 M;  3LDB A;  5EJ1 B;  2VCC A;  3GDB A;  3MKS B;  4GWI A;  2OVP B;  3ACG A;  1JZ4 A;  4P00 B;  4FK4 A;  1JZ7 A;  2BZD A;  2Y8K A;  2ZXQ A;  4QNC A;  2WQ8 A;  1P22 A;  3QER A;  1XMH E;  3K4Z A;  5JXJ A;  4M3Z A;  1K3I A;  2B7M A;  3QNO A;  2VCA A;  4AKG A;  2JE8 A;  2VTF A;  3HNY M;  1JZ5 A;  3WNN A;  3WF3 A;  1NKG A;  4OMC A;  1FZ2 E;  3N1E A;  4QAW A;  3MO4 A;  1JU4 A;  3HEI A;  4PT6 A;  3FHQ A;  2WO1 A;  4RN5 A;  1TG7 A;  3T0A A;  2H4T A;  1UMH A;  3I2F A;  2OYQ A;  2VOT A;  4J2D A;  4BJ0 A;  1FZ3 E;  2J1E A;  1XVC E;  3A23 A;  4I6J B;  2VM9 A;  4XUT A;  2JKX A;  2VC9 A;  1JI6 A;  4QDR A;  5H37 A;  4DTM A;  1XMG E;  3VDA A;  2DY4 A;  1FZ6 E;  3SUQ A;  3SPZ A;  4KHS A;  3C7H A;  1KGY A;  1WCQ A;  4FJ8 A;  3MV1 1;  3WQB A;  2XOM A;  3J27 A;  3MUZ 1;  3NGI A;  3EYP A;  4D8M A;  1OF4 A;  2OKX A;  2R7E B;  2VJX A;  1W9W A;  1FZ0 E;  3HOB A;  1XMF E;  3I3D A;  3LEG A;  4M4R A;  4A42 A;  4KHY A;  4HCC A;  4L0P A;  1FZ4 E;  1JYX A;  2W1Q A;  1J83 A;  1FS1 A;  3MBW A;  1ULP A;  2ID4 A;  3FN9 A;  1FZ5 E;  1W99 A;  3I2H A;  1XVB E;  5DQ0 A;  2B8I A;  3NRU A;  4CUA A;  4DEQ A;  5DMY A;  4JKM A;  1MTY G;  2BGP A;  5CZK A;  4ET7 A;  3HPN A;  2YC2 A;  2P1P B;  1EUU A;  1US2 A;  3VD9 A;  4OUE A;  4BXS V;  3TL8 B;  4AKI A;  1W8O A;  3SVI A;  2W92 A;  2VZO A;  3TJY A;  4CU7 A;  2VIX A;  5IFP A;  4DXS A;  5C71 A;  4XUQ A;  3DYO A;  5LA0 A;  1MHY G;  3T2Q A;  4FK2 A;  1O8S A;  2QXF A;  4QB6 A;  2B1E A;  2J1R A;  2DTU A;  1JZ8 A;  4JS5 A;  4DU3 A;  1GOG A;  3WEZ A;  3HNM A;  3W5N A;  3QEX A;  5IHR A;  2Y6L A;  4Z2A A;  3K4D A;  3WNP A;  4FJN A;  5LCW L;  1LDK E;  4FJK A;  3T09 A;  4QX1 A;  2CDO A;  4GWJ A;  1NX9 A;  1Q9Y A;  3HGL A;  3TAE A;  2VJ4 A;  3A7Q A;  4QX0 A;  3I3B A;  1SG3 A;  2VMC A;  2X05 A;  3OEA A;  4J2A A;  3BGA A;  4CUC A;  4E8D A;  3RMD A;  3DEC A;  3HN3 A;  4ARX A;  5IFT A;  5JXI A;  4FJH A;  1XPW A;  2W1W A;  3HP9 A;  4OYU A;  4PF1 A;  2QQI A;  1GQP A;  1OT5 A;  4EPH A;  4DEV A;  1NAE A;  3I97 A;  3P1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...