2E31A

Structural basis for selection of glycosylated substrate by scffbs1 ubiquitin ligase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
251
structure length
246
Chain Sequence
AVEYLAELPEPLLLRVLAELPATELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWSDVEHGGDGWKVEELPGDNGVEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box only protein 2
publication title Structural basis for the selection of glycosylated substrates by SCFFbs1 ubiquitin ligase
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 59
structure length 246
sequence length 251
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00646 F-box F-box domain
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2e31A01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2e31A02
2YFUA 3BN6A 2HYXA 2W87A 4I6JB 4QPWA 2XQXA 2Y6LA 2DDUA 2ORXA 2VZOA 3CKHA 3LEKA 1W8NA 5LCWL 1GU3A 5JXIA 3DYMA 1CIYA 1PMHX 4LPLA 1O8PA 1W9SA 4A41A 1L7QA 1ULOA 2VTFA 3VDAA 2P1OB 2EIEA 2LW8A 2VZTA 5A1AA 4OYUA 1OH4A 2X10A 3F2ZA 2BZDA 4XUQA 1XNAA 4ZZ5A 4MGSA 1JYNA 4JX0A 2J7MA 3HNBM 1K12A 4QB2A 2QQKA 2QQJA 3FHAA 4JKMA 4JKKA 3J7HA 2W3JA 3LEGA 2W95A 3I2GA 3LPGA 4ARYA 3WEZA 1J83A 3K75B 3T08A 4BDVB 4TTGA 3WNPA 2VZ1A 1H6YA 4GZ9A 3T0DA 4MO3M 4UAPA 4QX0A 4GWIA 1HN1A 3ETPA 5G05L 1GQPA 2VJXA 4XZUG 3VDCA 3FL7A 2BERA 1NX9A 1W9TA 2WZ8A 3CZUA 1I5PA 3CDZB 2J1AA 5DMYA 2XONA 4QDQA 1UY0A 3T2PA 4XUOA 4A3ZA 1JZ2A 4DUVA 3HPNA 1OF3A 4MADA 5C71A 3T0AA 3U37A 1BHGA 1JZ3A 3EB7A 3MV01 2WO1A 4DUWA 5I0DA 4QB1A 4KI5M 1US3A 3BGAA 1KGYA 1UY1A 3ECQA 4DEVA 2HLEA 2PQSA 2Y6HA 2BBAA 3ACGA 4LKSA 1PX4A 2C4XA 1F4AA 2J1TA 2Y6KA 2W1SA 3VD5A 2VMFA 2QQMA 2WN2A 1SG3A 2ZEZA 5C70A 2VZUA 2WO3A 3NQHA 2XHNA 1UWWA 2JDAA 1JZ8A 2E31A 4QDSA 3LPFA 1UXXX 3WF2A 5FUIA 3LQCA 2QQOA 3IIIA 1LNSA 3NRUA 2ZXQA 3WNLA 3NNGA 2W47A 3P6BA 3FN9A 4M4RA 2C9KA 5HXMA 1GUIA 3OGLB 2B4KA 4W8JA 2V4VA 5IFPA 2WN3A 3GXUA 2W9XA 1W8OA 2W92A 2ID4A 3HJRA 2ZEXA 1P22A 2P1NB 4AG4A 1JI6A 3OGMB 2ZEWA 2VMDA 2CDOA 2WYSA 4UOJA 3T0BA 1W9WA 1UZ0A 5DN2A 4DXSA 4LQRA 2OVQB 5JXGA 3OEAA 3IB3A 3SKVA 1GOFA 3GM8A 5C7GA 2W1QA 3DYPA 1UY4A 5CZKA 2Y6JA 1JZ5A 3DECA 2Y8KA 4OZOA 1IQDC 5HPOA 2QBXA 2V5DA 2VR4A 3OGKB 1DP0A 3C7GA 1CZSA 2YB7A 2WABA 2WO2A 3C7HA 3VD7A 5EJZB 1NAEA 4CU8A 2EICA 4CU9A 3K4AA 3I97A 3P1IA 4UI9L 3WF4A 2DCJA 1CZVA 1TG7A 4DXTA 3OGRA 3I2JA 3CMGA 4A4AA 1MPXA 3FHQA 3WQBA 1P8JA 2B9VA 3DYOA 4OMCA 2BGPA 2W1UA 1OF4A 3MKSB 3WNNA 4CU7A 1UXZA 1R64A 2E32A 2WAAA 3CZJA 1NKGA 4CVUA 4XURA 3C7OA 2JD9A 1L7RA 3UESA 1GMMA 4A44A 4DXRA 1D7PM 2W91A 3MO4A 3NJXA 3C6PB 5IJRA 2J1RA 1GOGA 5LA2A 3I2KA 2RJ2A 2J1UA 3HNMA 3UETA 3SEPA 4AAXA 4W4ZA 1K42A 1JZ7A 2P1PB 2DCKA 2KD7A 3WF1A 2VZRA 4P5YA 4CUAA 4E8CA 2LS6A 1CZTA 3T2QA 3HN3A 1UX7A 4DUXA 1JHJA 4QB6A 2YC2A 2L9LA 2V72A 2J1VA 4P08A 1ULPA 1XPWA 3I3DA 3ACIA 1J84A 3WSOA 1SHWB 1OD3A 1JZ4A 2YC4A 3HEIA 3HOBA 1NEXB 3SEEA 3ZM8A 4HG6B 4QX2A 1JYXA 2VMEA 4E8DA 1JYVA 3GDBA 1XC6A 2Y64A 3T2OA 1H6XA 4MGQA 2VQUA 3CIHA 2EIDA 3A21A 2Z4FA 2VZPA 5IHRA 4PQQA 3WF0A 1W0NA 4BJ0A 1JU4A 3AC0A 3C6OB 1GOHA 2VC9A 4XUTA 3K4DA 3MUZ1 3OGSA 5JR2A 2J1SA 2WBKA 3PUHA 4A6OA 4GWJA 2VOTA 3VD4A 3MBWA 5IYYA 1UMIA 5JXHA 4LHSA 4PF1A 4RYDA 1NUKA 1WCQA 3A23A 3SKJE 3ABZA 2JKXA 2Y6GA 4BK4A 2XOMA 1RYYA 3C7EA 1UYYA 4OMDA 1WKYA 2E33A 3EYPA 2C26A 1KEXA 4D0QA 1O8SA 4ET7A 5LA0A 4CU6A 2VZ3A 2VCAA 1F4HA 5EIYB 4QAWA 4OUEA 3THDA 4M4PA 5IFTA 4TXWA 4RN5A 3GGLA 4Z2AA 3PUIA 3WNMA 2QQLA 3OGVA 1TVGA 3WF3A 2VQTA 5DPNA 1YQ2A 3NJVA 4A45A 4FI9A 1PX3A 3OEBA 3OB8A 2X05A 1O59A 4W50A 2OVPB 2WZEA 4KMQA 5G04L 3W5NA 2W46A 1EUTA 1K45A 2R7EB 4P02B 5EJ1B 1JYWA 4QX1A 1W99A 4ZZ8A 2ORZA 1XNTA 4A42A 1UYXA 3K4ZA 4JHZA 1UY2A 1US2A 4QDRA 3W5MA 1DYOA 1OT5A 3A22A 2RVAA 2X09A 1UY3A 2WQ8A 3I2HA 4ARXA 5JUVA 1UYZA 2ZEYA 5DQ0A 5J1XA 3V7DB 2BGOA 3A7QA 4CUBA 5JMOA 4BK5A 3C7FA 5B4XA 1K3IA 3MV11 3WNOA 3LEIA 1GNYA 2QQNA 2YFZA 2J1EA 3VDBA 3C6NB 5IBKB 2VCBA 3IAQA 2OKXA 2VCCA 2VZSA 4XVHA 4XUPA 1UMHA 3OBAA 1CX1A 3K77A 5CYYA 3D3AA 1EUUA 4IUGA 1PMJX 2VMCA 4BXSV 4L0PA 3K46A 4KWUA 4ZY9A 3CQOA 1JU3A 3ACHA 2WUHA 5F7UA 2OVRB 1SDDB 4MOAA 4XUNA 4YPJA 3HNYM 2W5FA 2W94A 3E1F1 4DEQA 3L2OB 3VD9A 1LDKE 2RV9A 2EIBA 3MUY1 2JE8A 4D8MA 2VM9A 2WDBA 2VZVA 3IDAA 3JXSA 1T2XA 4P00B 5LA1A 3C8XA 3THCA 3LE0A 3OG2A 4ZXEA 4PT6A 2QQIA 2P1QB 3I3EA 2P1MB 1FS1A 3ACFA 2CDPA 1DLCA 3I2FA 2VZQA 4JKLA 5JXJA 2VO5A 3WNKA 4QX3A 3I3BA 2WAOA 1JZ6A 2E26A 3VD3A 2YG0A 5B4NA 2J22A 3IAPA 3T09A 3UNPA 2VL4A 3I2IA 2W1WA 4CUCA
chains in the Genus database with same CATH superfamily
2B8IA 2R062 2HYXA 4IXLA 4L92A 1HJGA 4XFFA 3HGLA 2RR11 3ZDVA 1CAUA 4BIOA 4Q4W3 2FCUA 4I6JB 1LJ7A 3AXEA 3PUQA 5A7WB 2ORXA 2VZOA 3CKHA 1RMU2 3LEKA 2ZX2A 3BPSA 3ORJA 4C91A 3B7MA 1W6PB 2D6LX 4MV2A 4Y26A 2WWUA 3IWZA 1PMHX 4LKEA 4PJYA 4CXXA 3TEWA 3ZFGC 2O8OA 3DEMA 3SXWA 1W9SA 5C3OA 1FMD3 2XKPA 4IEOA 1F9KA 4OCTA 4YLZA 4KHWA 4EYUA 4OHVA 3JU9A 4O7XA 3KF5A 4Y1UA 3NV2A 3NJZA 3JQXA 1QJU2 1JW6A 2VZTA 3M3IA 4FPEA 2E9QA 4AEJA 3ZYPA 1VMJA 4YZ5A 2BUKA 3F2ZA 4QMAA 1TMF2 3HL8A 4ES9A 5FY1A 4ZZ5A 1XNAA 3USSA 2B7MA 3R0RA 4GJYA 4CRQA 1BYHA 4XW3A 4F8AA 3V0AB 1TQ5A 5ACA1 4JX0A 4RHV3 1K12A 1BEV2 3TAYA 3TEZA 1QJFA 2QQJA 3O1PA 4JKKA 4CP9B 1KDKA 1HW5A 1D2SA 4QPGC 1Q9XA 5SV5A 1V00A 1G9DA 3M1HA 1X82A 4K6BA 3LPGA 5EZWA 4PQ9A 1C8M2 5FZHA 2BWCA 5FQ0B 1LGCA 1XVGE 3K3NA 4C1XA 4QPIA 3VKMA 1ENQA 4YGDA 3SVIA 4MGYE 3WNPA 3SQ1A 1H6YA 3R05A 2W52A 3SI6A 3NNJA 1QWRA 4UAPA 3J8F1 4L11A 4UBGA 4KU8A 5DUUA 1G9FA 5I0TA 2H6BA 3TN93 2D97A 3ZN6A 3WP6A 5M0TA 1GQHA 4O65A 4LT5A 2JDNA 3OBZA 2AC1A 4HXCA 4D6QA 1I5PA 1VBA2 1Q8VA 1NOVA 2WSVA 5DMYA 4CCEA 1JYTA 1QOSA 3QEIA 2PFWA 4XIOA 3T2PA 3ZXLA 5D2AA 1JZ2A 2GN7A 1OA4A 4EN7B 5LBFA 4MGZE 4XTPA 4DUVA 1Q8SA 3VBOC 3UO3A 1XJAA 5JIUA 4B29A 2Q1FA 1OF3A 4IV3B 1W3VA 4ZKTB 5LA9A 4UWDA 4YZ1A 4LUMA 4EN0A 3U37A 1AXYA 1BHGA 1J58A 3UNPA 4YW5A 2R071 4COWA 4MGKE 4YW1A 4OVEA 4DUWA 1UOFA 2OX0A 5C5TA 4CEWA 1JS9A 4UW5A 4WM8A 5FZEA 4UW4A 4PCRA 1IPKA 1NYWA 2RKHA 3AZXA 4NHYA 2K46A 2PQSA 4CSWA 1MS5A 1IH7A 2DYCA 3ASIA 4YYOA 5L9VA 2JHPA 2D6KA 4SBVA 5BPXA 2P6HA 4Y4RA 3IZOA 3LZIA 4YFZA 2J1TA 2Y6KA 5JOZA 1NZCA 5C3RA 2V4AA 2CU5A 1BMV2 1SQ4A 4UFMA 4IV1A 2VXRA 1C1LA 1SG3A 3KQ4B 2EXIA 2XBO3 4YVSA 5E8AA 5L73A 3OD0A 1NCQA 1GNHA 5FPBA 2ZA9A 3NQHA 2PHLA 2MNGA 5A3PA 1NA1C 1LULA 2FDIA 4R9AA 3LZZA 3USUA 1XSRA 1WA4A 4XE9A 4YZ3A 1JN2P 1C5IA 1OPMA 1FZHE 1OI6A 2BDRA 2Y26A 2ZMKA 3EXUA 4CUGA 2PLV1 1BQPA 4Q4X1 3GNEA 2VE1A 3CFPA 4FFHA 3SC7X 2CNAA 5IVEA 5T54A 5FZLA 1BJQA 4M3WA 3HQRA 5FUIA 2QQOA 2RHPA 1VBD3 4AGVA 1VB4A 1LNSA 2HWC3 4GH4A 2A3WA 2JQTA 1GBGA 3WNLA 2W47A 3UK9A 5FOBB 3FN9A 2XUMA 1HJFA 2C9KA 2WA3A 4HCCA 2B4KA 4DQAA 4AEDC 4XDOA 4CA9A 1QOOA 3LZJA 2ADEA 2ZS6B 1HQWA 3GXUA 2W9XA 3VBRB 1H1MA 1PIV1 3VKFC 2W92A 1OC1A 1YO8A 5DAWA 2ID4A 1RVF2 3MICA 1XU5E 2EXJA 4PIXA 3ZYHA 1C28A 1ND2C 1LEMA 3NNFA 4S2GA 1WLWA 2A5ZA 2W68A 4M3CF 5DAPA 4DO0A 4FT8A 1TME1 2MHFA 4C0BA 3AZVA 5F3GA 4GMP1 2IZWA 4IESA 4GMP0 2ZGKA 1BBT2 3POSA 4BM8A 1QHDA 1JI6A 5DG2A 5A7QA 5I8TA 2E63A 3OGMB 1IS5A 5H9PA 4XQ4A 5BXXA 1YI9A 3VL9A 4C1WA 1Y43B 1DQ1A 1W3XA 1HDKA 3N7MA 2DVBA 4M42A 1XNKA 2RM21 3MHZA 4UOJA 3S6PA 2DFBA 2A6VA 2CSGA 3KT1A 1N1SA 3NCIA 2FDJA 4M01A 2UU8A 4DXSA 4ONUA 5A7PA 5JPNB 4LBNA 2HWF3 5JXGA 3FZ3A 1UX6A 4UYBA 1NXMA 1W6NA 4MHUA 5F2WA 3KWVA 1GOFA 1WW6A 2JD4A 2W1QA 1QXJA 4ASMB 1XYNA 4Q4Y3 5CZKA 3ZFGB 4BQXA 2NYYA 3S7IA 4L2NA 1D4M1 5KC6A 3DECA 4I0BA 1OA2A 4N53A 1QJY3 2QBXA 2CYFA 1QDCA 3MF9A 5BNNC 3VBSC 1CZSA 2WABA 4I30A 4AZZA 5L7OB 2B45X 2OUHA 5EJZB 4XJ8A 5H9RA 1UKGA 2RS12 3K4AA 2P5OA 3WF4A 1RUOA 4DXTA 2ZZQA 4J2DA 2AACA 3LB9A 2YMZA 4EROA 3GJAA 3FHQA 5A33A 2B9VA 1Q56A 3DYOA 4Q4V2 1S0IA 4OMCA 4YW4A 5ABJA 1XE8A 2EIGA 3ZXDA 1AR93 1ZBE1 3MFAA 2WT2A 1OF4A 3VDBA 4P9LA 1UXZA 1YFYA 5DDJ3 4KH9A 4K1ZA 2PAEA 4BQ4A 2I2SA 2WFF1 1GV9A 4XURA 1NCRA 4KGGA 2B8MA 2OW4A 4D7TA 4Y1YA 2Q1MA 5FYYA 5C3PA 4UXAA 1GMMA 1R081 2GAUA 3C3VA 1SLCA 2P34A 1HKDA 1XBFA 2C24A 3IN9A 4J1WA 4FJ9A 1AR81 4PDWA 1AF9A 3SITA 4YM0A 3E6BA 3I2KA 1CPNA 3LF7A 3ZSMA 3SNMA 3SEPA 4AAXA 4W4ZA 1PK6C 3WHTA 1OUSA 2BQPA 2DCKA 2WS92 4M0HA 2KD7A 4Q4W2 3NKTA 2VZRA 5FPLA 3X29B 3ZFEC 3R6SA 4MSVA 1S0FA 4E8CA 2XGXA 1NZIA 4RS5A 1U5YA 4M0NA 1VR3A 3M7AA 4BQ2A 5A3TA 4Q1RA 5GLTA 1E57A 1W6QA 3IPVB 1FMD2 2XL9A 2ZACA 4OI4A 5C9AC 3ES1A 4I02A 2MW2A 1JHJA 1PO23 1DGRA 3LOBA 2J1VA 4BWOA 1Y7BA 5CNAA 1XPWA 3I3DA 5GLUA 1HXS3 3ACIA 3GBWA 1SHWB 1XE0A 3AP4A 1G86A 1XVCE 4GA9A 1UOJA 3CHXA 1IOAA 3SH5A 4Q27A 4ZU5A 2R6QA 1ND3C 5FDBA 3BTAA 3APBA 5F37A 4X8PA 5FYUA 3HEIA 1REFA 5EFUA 1FXZA 1UF2C 4MG2A 2F17A 3UV9A 3DF0A 3AKRA 3SEEA 1T6BX 3RDIA 4RHV2 1NQJA 3B00A 1O3RA 3MDPA 3OUIA 1ZREA 1JUHA 1S0DA 2VMEA 4E8DA 1XC6A 2FBEA 2RE9A 1H6XA 1GICA 2ATFA 2IVIB 2YGLA 1RUNA 1SLTA 4CDUC 3D6EA 2ZTNA 3CEWA 1RUI1 2XJUA 1WD4A 5IK4A 4S2DA 1Z7S1 3AMMA 4M45A 3I59B 4LHNA 4DTOA 2ZOEB 4H7MA 5F6LB 4Z82A 3AC0A 3GCXA 3MLLA 2ZZJA 4QPYA 5K9YA 1OKQA 1ULEA 1OLRA 5IATA 4B08A 1Y4WA 2XWJB 1J59A 2LF3A 3SCXA 3KV5A 1STMA 4XUTA 5FZDA 3TN92 4FPLA 5AFBA 4AKHA 3K4DA 4OI0A 4OHWA 3OGSA 4DZGA 4GWJA 4J6GA 2GNTA 2DTYA 2AR6A 3MBWA 4GKYA 2Q8EA 1LOEA 1IKQA 3WW2A 1NUKA 2Y0IA 5FBZA 2ZGPA 1LGNA 2UYAA 4GJZA 2XOMA 4QKFA 2SLIA 1S55A 3C7EA 2GMMA 5FMBA 2A6WA 4QPGA 2JIGA 3W58A 3WG2A 3VB9A 5CFDB 1W8ZA 1A8MA 2BNMA 2RJKA 2XH6A 4OMDA 2PAMA 1YIFA 1H30A 1KD7A 3W9AA 5HI0A 3WCRA 5LBBA 2QJVA 2HH9A 3UKTA 1ASJ3 1V6KA 1XMFE 4O61A 1ZX5A 3LDRA 4OQ9A 4QQOA 1I5ZA 1V0AA 2VZ3A 4HOOA 2FCVA 1AYM1 3EQEA 1LHVA 2WQ4A 4GB31 3QNOA 1GLHA 3ZDSA 5GM0A 3THDA 4M4PA 4LORA 2WZPP 2WNUB 1OUXA 3O1TA 5F5IA 4A6SA 4ICGC 1DQ4A 3KGZA 2WZR1 2AEZA 2LALA 5BNOB 1CR7A 2QQLA 5CADA 4LK7A 1GZ9A 1XL3C 2Y38A 3A0KA 1OHFA 4M3UA 3O1OA 2P3YA 1PX3A 3CL1A 3UKVA 2IXJA 4CEYB 1ENXA 3OB8A 3RNSA 2X05A 3AFKA 2CGNA 4W50A 2OVPB 2JX9A 2WO7A 2WZEA 2XKOA 4Y24A 5FZ9A 5C4WC 5IT6A 1SCRA 4JCKA 2W46A 3NNLA 4DXZA 4KI4A 3CU7A 3FE5A 4E4DX 4RQPC 3P3PA 4NO4A 4QU2A 2UURA 3TAEA 4P9IA 3MLJA 5J98B 1RUD1 3OUHA 5APAA 4DB5A 5CFCB 3K4ZA 4JHZA 3M8LA 3SPYA 3LWCA 1VBD2 4QT6A 1UY2A 1VBE3 1WUVA 2HWC2 2GNBA 4QDRA 4F7ZA 5FWJA 4M3TA 3PU3A 3GZAA 4F83A 3A22A 1I3HA 4JV4A 5GZGA 1UY3A 3Q8FA 5FZ6A 5JUVA 5LK5A 1S2BA 1RUJ3 1AR72 2ZEYA 3OPTA 2DY4A 5DQ0A 1SPPB 5J1XA 4QHBA 3V7DB 1IS4A 4GKXA 3A7QA 2ZHNA 4CUBA 1BMV1 4IT5A 5JMOA 3KV6A 5CISA 1K3IA 4OLLA 4IE0A 5GKAC 2DU1A 3LEIA 3N7LA 4IW3A 3MEPA 3FHIB 3N1EA 2H6CA 4QPIC 3VBHB 3A0NA 5I91A 3OYWA 4FXGB 4XMIA 3KVAA 3TNPB 2J1EA 5KXBA 2PN5A 3WG4A 2Q8DA 1FYUA 3PTRB 3H3LA 4RR3B 3IAQA 2OKXA 4CDXA 2VCCA 3H3ZA 4XACA 4K8FA 3ALQA 3OBAA 4KQ7A 3K77A 4YFWA 5CYYA 2PHTA 3D3AA 2BVBA 1QH7A 1IHMA 1IPSA 4HPKA 5F8PA 1N1VA 3SQ2A 3LA3A 4LBOA 2PHUA 4Q0VA 5ERLA 2JDMA 2QNKA 4KWUA 4TWTA 3QETA 3QEPA 1OOPC 3ZFEB 4ES8A 1UU5A 1PGW2 2HKXA 2VNOA 3GCWA 4B3NA 2OVRB 4MOAA 4YPJA 3SUPA 3U4SA 2P5BA 1ND2A 2VCMA 2EALA 1DFQA 2MMBA 3HNYM 3KVBA 1R093 4Q4Y2 4UF0A 3JUUA 1A34A 2ERFA 2RDQA 5A7SA 4DEQA 1QJY2 3L2OB 4TLGA 2G9ZA 1OQ1A 4HK9A 5IVJA 4AVSA 2JE8A 1ZZ6A 4LKDA 2QXFA 2VM9A 3KS7A 3IDAA 4EN6B 3JXSA 4MUVA 1T2XA 4FPHA 4P00B 1K5MA 2YYOA 2XVKA 1ND3B 2A6ZA 1L7LA 2NZ9A 2OIIA 4LBKA 4NHMA 2A73B 1PM4A 2JB8A 1XOYA 4XF3A 3THCA 1XU1A 3OG2A 5FJKA 2AYHA 4YM1A 4Q8KA 3LDKA 4RNGA 1DQ0A 4M3RA 2R30A 4B7KA 1CJDA 1AR92 3ACFA 1JHNA 4XFIA 1WLTA 1QNYA 2VZQA 1V6JA 3MW3A 5DDJ2 4IV1C 3U11A 1TEIA 2CV6A 2DBIA 1UZVA 3AFGA 4FJXA 4I2OA 2MEV1 1JZ6A 3WW1A 5FZBA 4FFIA 1W6OA 2D98A 5FMDA 3PLQA 5A32B 2ES3A 2YU1A 3WY6A 5BNNA 4FFGA 1PVC1 3VBUB 2XJQA 2VNRA 3VBSA 4DY3A 1ULCA 3LSEA 5FXXA 1VB2A 5K8SA 1FOD2 1SLBA 1KS4A 2D6PA 1KFUL 3AL6A 4BIFA 1QOTA 3I3MA 1ALYA 2RR13 1H2KA 1JBCA 2W87A 4QPWA 2XQXA 4BQ3A 3U1XA 1YQ8A 4QD2A 4V2VA 1QXRA 5LCWL 4DTRA 2WIIB 1MS9A 2FCTA 4AEKA 1Y9QA 1FZ5E 1CIYA 4M3CB 4NRMA 3ZFFB 4UFIA 4DTUA 1O8PA 3WDTA 2O0OA 1L7QA 1LOFC 3FLPA 2WLQA 4WM7C 3VDAA 5BY5A 2EIEA 3U0ZA 2PA7A 2V73A 4XTMA 5GZDA 1EV12 2WRAA 3CJXA 1PO22 3KD1E 2VMHA 2ZKNA 3I8TA 5A1AA 3N9NA 1HXS2 4C8DA 4DU3A 1N3OA 3RMDA 4XUQA 4GXLA 5JZGC 3V56A 4XFAA 4MGSA 4AGRA 5HXVA 3P5BA 3HNBM 3NL1A 1DU3D 5LRSA 2UY9A 5FXVA 1QJEA 2QQKA 5FMOL 3VN4A 4BISA 5FZFA 2X5IA 3NHGA 1PK6A 2VNGA 1NLSA 1PZ8A 2OPWA 4LIUA 4XABA 3VBFB 1J3RA 4BA6A 1O3TA 4A3XA 4XF0A 1ULDA 2VUJA 5EXOA 3IDEA 4A7YA 1G9CA 3MIDA 3RRDA 4ARYA 5FAXA 3WEZA 4BU2A 4CCCA 1BLZA 3WT3A 1BK0A 1CAUB 3K75B 1W06A 1Z78A 4TTGA 1WLCA 3EHKA 3D5OA 4MO3M 3J8F3 4AFDA 5EJ3A 3MPBA 3HBZA 5C9AA 4QX0A 4GWIA 1NY71 2WFPA 5EWSA 4Y22A 1ZRIA 2BNOA 4ISRA 3IT8A 5JMCA 5AVPA 2AGSA 2BGCA 4XZUG 4YNIA 2GMPA 4N53C 1BXHA 1W9TA 2GDFA 2WZ8A 4RA0A 3M4FA 3CDZB 2G9FA 1KDMA 2J1AA 3AKTA 3MFCA 3RI9A 2XONA 1PO13 2A6YA 3MYXA 1UY0A 4QDQA 3LDBA 5KWRA 4IL7A 4LUKA 3BU0A 1Q8PA 1QJX3 4INDA 2ZAAA 5FBJA 3GZEA 1IZ3A 1W8HA 3O1MA 3KD5E 5CG9A 3PNAA 2P3JA 2VQ0A 4ZPIA 4MADA 2ZGNA 1VBC1 5F3IA 1FPN2 1KXGA 4FCAA 4K3UA 1YCIA 2R061 4CDUA 3S30A 2ATQA 4FJLA 2R073 3EB7A 1A6CA 1QQP3 3MV01 4LLOA 5C8WA 1RUH1 3ENRA 2WO1A 2HEVF 1ASJ2 5A3OA 5I0DA 1RMU1 1RHI2 3AYDA 3LIGA 2JE7A 4CDQC 4Q8LA 2D3SA 4QB1A 3INAA 4KI5M 4S2FA 1US3A 4NE9A 1OD5A 1KGYA 1UY1A 3H9AA 4WV8A 4XAEA 1HB4A 3URFA 2BRTA 1DZTA 4COVA 1YI7A 2BOJA 2XB6C 4QPIB 3BU7A 4IQPA 3N7JA 4KHUA 2BBAA 1C8NA 1PX4A 3GBFA 4HN1A 3LFIA 4PDWC 2RJLA 3WOGA 2W1SA 1ST8A 2VMFA 2WN2A 5KHJA 3ZN6B 1VRBA 2ZEZA 4XZPA 2JDZA 1X36A 2WO3A 1IG9A 1TMF1 1ONAA 1UWWA 3IDBB 3N35A 3PVOA 4MGTA 1YUDA 2JDAA 4HN0A 1HV0A 1W2NA 1CX4A 4YGCA 4BQ5A 4Q29A 1QXPA 1ACCA 1OKOA 2PLV3 4W6WA 2ZJCA 3S57A 2DTUA 4ZU4A 5FMOS 2OQ6A 3LPFA 4OFGA 3RJRA 4AFBA 4KGQA 4LMFA 4AI0A 3O1VA 3QH6A 3NV4A 4AKGA 2B5HA 5T55A 1H9WA 4NHXA 3WV6A 1C8M1 1NQDA 4XJWA 3P6BA 3WP5A 3J7LA 2P3KA 2IFRA 4M4RA 1VBE2 1GUIA 3ZYRA 4E27A 4FJKA 4CEWB 1S4CA 1WAJA 4WM8B 4W8JA 1FZ6E 2DCYA 2XLGA 3E6DA 1H4HA 4NIDA 5H9SA 5F1RA 2EF6A 1JOBA 2F4LA 4AR2A 4DFSA 5FXZA 1RUJ2 2JDPA 5C6CA 2ZEXA 3ZSJA 4HSLA 1TME3 1RGSA 2XLAA 1VBA1 3B01A 4GMP3 5C4WA 4AG4A 4R9DA 2YGMA 4G3YC 1WLDA 3BODA 3OTFA 2VD7A 4YVSB 4AI1A 3MIGA 3AJZA 4RQPA 1NCQB 3RZJA 2ZEWA 1DF0A 1DGRN 3O0VA 2VMDA 4B7EA 3USUB 2CY6A 2RM23 4DU1A 3AXDA 4UW6A 5FUPA 1W6MA 3L0MA 4DMIA 1HIXA 2AEYA 3S7EA 4LLFA 3H7YA 4LOSA 4LQRA 5FZCA 3VDDC 3GHMA 4JGZA 4D94A 1F8VA 3PIGA 4LIVA 3AVSA 4GH4B 1DG6A 1QJZA 3IB3A 4LO6B 4E2QA 3GM8A 1YWKA 3OF1A 1MS1A 3RQ0A 1IPJA 2Y6JA 1D4M3 4QXKA 3ZSKA 4CP0A 1O7FA 4V1PA 4BQ1A 2RMU3 1R092 2GC1A 3UGGA 4E9KA 2WO2A 3C7HA 3E97A 1C5HA 1NAEA 5T52A 3T1LA 1JODA 4QM8A 1S0CA 5C8CC 2DCTA 1W2AX 4N43A 3VL8A 1CZVA 1TG7A 1DBNA 3KT7A 4CCJA 1IG3A 5FP9A 3I7DA 4AI2A 1XXNA 4META 1APNA 4AFMA 1XVBE 1P8JA 5LBEA 1FYZE 3WX5A 1TNRA 5E88A 2DV9A 2HJIA 2GH8A 2OZ6A 4LA3A 2OA2A 2QQWA 2JDHA 2VBBA 3ZXJA 1ZBE3 3PVNA 5FKCA 4B1LA 2JG8C 4LHKA 4YGEA 5FYMA 3UJQA 4B8EA 1UYPA 2XMLA 1ZZ9A 3G7DA 1C57A 2E32A 1LHOA 4BQWA 4BZ4A 5GLVA 4LOTA 1OOPA 3ETQA 3L2HA 2JH9A 4CVUA 1NKGA 1WMXA 4KWLA 3C7OA 4CP1A 4FFFA 4WVVA 2A3YA 4MGIE 3N9OA 1PNFA 3UESA 5A6QA 4GULA 1W6NB 2E51A 1AR83 3MO4A 2ZGOA 2HWB1 1RB8G 4MX3A 1MHZG 2BFUL 4NPMA 4QGLA 3WQ7A 1DGWA 4WZFA 2VW0A 1OXCA 2RJ2A 2J1UA 1RC6A 1FZIE 4L97A 2B7YA 3UETA 4FO9A 4DOUA 1AX2A 5FYBA 2RR12 5K0UB 4ZU7A 2P1PB 1Q5OA 1BBT1 3NWKA 4FK0A 4NRQA 4Z2WA 5A80A 1REDA 4KBZA 2XLFA 5FK8A 3KCCA 2AREA 2WNOA 1WMFA 1LOCA 4B1MA 2DVAA 1CZTA 4RG8A 3NV3A 3R4UA 4PF5A 4JGYA 1UX7A 4FBFA 4DRVA 3WW3A 1CAWA 5A33B 5DAXA 2OZJA 2JIJA 4AI9A 4D3WA 4N9IA 4QB6A 1W2TA 2EAKA 2YC2A 4LHLA 5ABJB 1QF3A 2I74A 1ULPA 1RTVA 1ZM1A 4AL9A 5C3SA 2FDHA 3JBG3 3V65A 4Z92B 3UIQA 2GZWA 4YARA 3U75A 3ILRA 4PBOA 3KQRA 4XFGA 3CLPA 2RDNA 3HN1A 2XXZA 3KHCA 4Y4YA 3NAPC 1DQ6A 1NCRB 2Y34A 5CKQA 3ZYJB 4E4SA 3K51A 2XDVA 4N7IA 4XXPA 1NEXB 3ZR5A 4JDOA 4PI2A 2XVLA 3ZM8A 1GFF2 3ZVXA 4HG6B 5EPAA 5FPUA 2IUWA 1GP4A 5FO7B 1XSQA 1AR63 3SUOA 1CAVB 2HWE3 3VKNA 3IIAA 1QIQA 5A7WA 3T2OA 5BUVA 1JYVA 3J26N 4FJ8A 1CJPA 2VBPA 4CDXC 4KHQA 5H37A 3CJIB 2CWSA 4YSFA 2VQUA 2RS11 4FPKA 1O5LA 4AK3A 3U4XA 1W9FA 1Z7S3 5FUNA 3VKOA 1UZWA 1HB3A 5FO9B 5IHRA 3HP9A 1GYKA 3GJBA 4BJ0A 5HCAA 1LOFA 2K2SA 2WT0A 1POV0 1UQXA 4QKNA 4WM7A 1UIJA 2VULA 3SJJA 3J8F2 3B9IA 5DUXA 4RS5B 1GOHA 5GZCA 2BPA2 1F5JA 4RFT0 1BZWA 1W6QB 3Q8CA 5A3MA 5JR2A 2J1SA 4Y5Z0 4A6OA 4Y20A 1OLME 5JZGA 2VOTA 5IYYA 3TEXA 5JXHA 4PF1A 4XDPA 3QH7A 5IW0A 3SKJE 2K5SA 2HWD1 3A23A 1BVP1 3ABZA 3T3YA 1PO12 3V64A 4QNCA 4BK4A 1G6NA 5D8AA 3M70A 4RSUA 1QJX2 1RYYA 1K5MC 3RZKA 3IKWA 4I3PA 2WNVB 2XPJA 2BFUS 2E33A 1AJKA 1SMVA 1MS0A 4D0QA 1O8SA 4AQ2A 2R072 5LA0A 1QQP2 4LBLA 2WS91 1Q9YA 2JECA 2VCAA 4FAGA 4BMBA 1H2NA 3BI3A 4GB33 1F4HA 4LK6A 1UZYA 4FJJA 3H7JA 4QAWA 5EIYB 4OUEA 1UOGA 1YJKA 5FPZA 2R043 3ZSLA 3VV1A 1LU2A 3GGLA 5HCFA 1AL21 3CNAA 4EJRA 4Z2AA 3WUCA 4FOQA 1ZNPA 5F5QA 1J3QA 4UT5A 4OUMA 3WNMA 3CO2A 1TVGA 2XVGA 2GSYA 3I3QA 1O6UA 1HRV1 3POEA 2VQTA 2ADDA 1V6NA 4BCUA 4EN9B 3O1UA 1OQDA 1YQ2A 1RL3A 3NJVA 3HD8B 4P9GA 3NKGA 4UFKA 4NR1A 4DY5A 3KF3A 3MIEA 3BTYA 1E5RA 3DKQA 1Z0HA 4QWNA 4OHYA 5ANQA 2OYQA 4KMQA 1WCUA 5G04L 1FZ0E 4AI3A 5F3CA 3MIHA 4M3CE 1LECA 1EUTA 1VALA 1HN0A 3ILFA 2IXLA 4P9JA 4LO4B 5FY4A 2VGDA 1IKPA 1LTEA 2PLV2 1W99A 3H1YA 2LF6A 1GANA 4QX1A 1XNTA 4QPGB 1RUD3 3B93A 3PTYA 5FPVA 4A42A 3VHOA 3SUNA 4CDQA 1EY2A 2RS33 1X8MA 2D40A 1US2A 1DYOA 2MZWB 2PHXA 2UWAA 3AMNA 3POWA 4ATEA 1G9BA 4GD4A 5GLZA 3DXTA 4LR4A 3H0OA 2W39A 5FRAA 4NWWA 1IG0A 1LHNA 2WQ8A 3DXUA 1AXZA 3TBDA 4ARXA 3UL2A 2BBVA 3LEMA 1ENSA 1RUF3 3ZXFA 3TN91 1LOBA 1REEA 2X5IC 1A3KA 4JDNA 4FOYA 4BK5A 3C7FA 4XIKA 2VG9A 4W6XA 3ZN5A 4PLNA 3U10A 4JRPA 3WNOA 3ZO0B 3N4MA 1ZRCA 2ZMNA 2PHRA 1MVQA 3AP6A 4H55A 2GH2A 3VBOB 3OJBA 3Q8EA 2ZCWA 2R49A 1JYCA 3ZXAC 4DTNA 4FPCA 3ZKUA 3HIFA 2RM22 3GF6A 1VIWB 1JXNA 3B9CA 3Q8AA 5IVFA 3BIEA 1MTYG 2CL2A 2VZSA 1UMHA 1QKQA 3NVCA 1SLLA 5DUWA 4R9BA 1ODMA 2LUWA 3SH3A 4IUGA 4ASKA 1R1A1 1C3HA 1LKNA 2ARXA 1YNAA 2PXJA 2VMCA 4BXSV 2AH2A 5T5JA 2JDKA 2YZ4A 3L9JT 2YBSA 2D5HA 1JU3A 3CQOA 4YGBA 4ZY9A 5B2GB 4QGNA 3ACHA 1MZ6A 3ZXKA 1CGPA 3PJQA 1F15A 4XUNA 4Q1PA 3IMNA 5CIRA 1VMFA 4HT1T 2CHHA 1D4M2 2JJ6A 4CDWC 4ZS3A 2XJRA 2W94A 1YQ6A 5IAVA 4TLFA 2RMU2 3M3QA 3KM5A 3VD9A 4KWKA 4E3SA 2RV9A 2VJ5A 1COV3 2GP3A 1DLLA 4D8MA 1QNWA 2HBUA 3J27A 2ZHLA 1H9PA 2GC3A 1NA1B 5A3LA 2LRPA 3F95A 3BKZA 1OFNA 2EVXA 2W08A 5CEHA 1NE4A 2Q1ZB 3DPRC 3LA7A 4C0HA 4K40A 1KITA 1UZZA 2VBDA 5J3UA 3IMMA 4MXWA 5J09A 3HAGA 3OYWB 2D3RA 3VDDA 1N3QA 1ZBE2 4M00A 2IXHA 3VHRA 2FMYA 1RUE3 1VBD1 4FVMA 1DGWX 1W2UA 2HWC1 2P17A 3MLKA 4FPJA 1H0BA 4HCBA 1SACA 2VO5A 4URAA 5IK7A 2O1QA 3D0JA 4XQDA 4QX3A 2BWAA 1JYIA 2Z2SB 4HPKB 1EAH1 4DTSA 2MEV3 4IE5A 4AEDB 5BV6A 4NRPA 2E26A 3WD5A 3TL8B 1GZTA 2E53A 4TYSA 1QY4A 2ZGLA 1AR71 1AR82 2VL4A 3I2IA 4Q0PA 3RWNA 2WLPA 3S9HA 5HV0A 1ND2B 2W1WA 4UF0B 4UFJA 4I0WB 3BN6A 4CUCA 4YZ4A 5FYVA 5C8CA 1ULGA 1CD3G 1R1ZA 3SCHA 3EJKA 1Q3EA 3KCXA 5SV8A 3MI8A 4FQ4A 1GU3A 3GYDA 2D6OX 5C3QA 4RGKA 1RUG1 1DGLA 4AGGA 4HVRA 4Y5SA 2JG8A 2Y33A 3GBGA 4ZS2A 4BYYA 1ULOA 4C90A 5AC93 5JWPA 1LR5A 3HT1A 3AYCA 1O3SA 3WQ0A 3WNXA 1AYN3 3O1RA 1VJ2A 2Q5TA 2XBO2 1TZOA 4OYUA 4CCMA 3QEWA 2BP6A 2X10A 3JBG2 3C94A 3PL0A 3QERA 1SFYA 2BZDA 2XJVA 1BKZA 1V9U3 3C2UA 1Y3TA 3TAGA 1JYNA 3TNQA 1N1YA 2QCSB 4Q4Y1 4QB2A 3M3EA 5L9BA 3ZKYA 1GP5A 3B5LB 3AP7A 3WR0A 1AX1A 4QKDA 4UFLA 1HQLA 1W6OB 4YVWC 3BVOA 1W8FA 2W2IA 4AQSA 2OZSA 5BNNB 1QJY1 3IM0A 3PURA 2QTWB 1GNZA 3J7HA 3LEGA 4HKOA 4NN0A 3VBSB 1XMGE 1AR62 3ZPOA 2HWE2 4HFSA 2W95A 5BNPC 1GZWA 1KS5A 3MW2A 2FD8A 1QEXA 2DVFA 4CCKA 3JD71 1ZBA1 2QDRA 2NLRA 3T08A 2ZX0A 4JGZC 4BDVB 4HVQA 5JOYA 1V6OA 1Z7S2 1VPHA 2IC1A 4GZ9A 4D69A 4K7JA 1MR5A 2ET1A 5BNQA 3B02A 3LDSA 1B35C 4ATFA 3BOWA 4LBQA 2VJXA 3ZYIB 2YY1A 2BERA 1ZRDA 1NX9A 2DVGA 1QH6A 4FPFA 5DDJ1 5FYHA 5FZ8A 3NAPA 3RZZA 1ZA4A 4FP2A 4B4RA 1J1TA 2WJSA 5FFOC 5GZEA 2DWRA 2Z79A 2UY8A 4IGOA 1ZZBA 1LOGA 2P3IA 3BOPA 5IREA 3FJSA 4N43C 3H1MA 5FYSA 5L7OA 1FNYA 4DS0A 3OOXA 1URXA 1AL0G 2VVFA 1VBC3 1FOD1 1W03A 3T0AA 2WT1A 1RUH3 1PK6B 4R9CA 4XJZA 3WHUA 1YYNA 2JG9C 5I0UA 5HCHA 4AKIA 1IS3A 2HWF2 5T50A 4FJMA 2YROA 4FQZA 4XJUA 5A6YA 5LATA 2ZBJA 5FYZA 5CKNA 1F2NA 4D7SA 3AKPA 3MZHA 3ROUA 2G9GA 3BYWA 1YQCA 4FP3A 4LTAA 5I8SA 5FZ0A 2R042 1N1TA 3K48A 1Q8QA 3VUOA 4LKSA 1GWMA 4AE2A 5C9AB 2C4XA 4AXOA 3LCPA 2CGPA 3AB0A 4Y22B 1MS3A 2EXHA 3J9SA 1EV11 4Y1XA 2Q8CA 1PO21 1OSGA 2AZ5A 1J3PA 5FZOA 5C70A 5CBLA 3DV8A 1FZ9E 3H8OA 2Y6FA 1GWKA 2FQPA 5FZAA 5DAQA 4Y1VA 2OUJA 2GC0A 2VW2A 3AX4A 1JZ8A 2GNDA 5CFDA 5JCTA 4JVAA 1H8TC 1YXWA 5LZ6A 2ZX4A 2JICA 3AZZA 3LGRA 4CCOA 2YBPA 5JI7A 4N8MA 2NQYA 3AMQA 4Y5TA 1PNGA 1SBEA 1KJRA 1YRZA 4JGYC 2WWJA 1XRUA 3WF2A 1WBLA 4LE3A 1M4WA 1RUD2 2NMOA 4P14A 4XYXA 2NP0A 4YW7A 2HEWF 3NRUA 4CDUB 5FJHA 3U14A 2RS32 1N47A 5HXMA 1E5SA 4EWDA 4NIGA 3OGLB 1V70A 3S5QA 2XJPA 2P6CA 1UIKA 3AZWA 1VRH1 5IFPA 2PMWB 4BPZA 2YBKA 1D4VB 3N9LA 1EYBA 3ZYFA 2QQPA 4FJGA 5FO8B 1RUF2 1UMZA 1VBB1 3AJYA 1MEC1 4FTSA 2Z5WA 2RDRA 5FYCA 1XE7A 4QQ2A 4WZCA 5I8YA 1U5IA 4EZHA 1T6GC 5FCCA 5DXDA 1SFPA 3WG1A 4ORFA 3MIBA 2C0ZA 1OQEA 4HKWA 5FLHA 4G4FA 4V2WA 5JOXA 1A8DA 2QUOA 2D93A 2R1DA 3T0BA 1FPN1 1W9WA 3M2MA 4EV0A 4GALA 4XPVA 3ZXGA 2VU9A 3AMPA 1H4GA 3O0XA 4Q0UA 5KHGA 4EPHA 4XC9A 2OVQB 5C5UA 1ASJ1 3BCWA 3RYPA 1RHI1 1TE1B 3PU8A 3OY8B 1NXD1 3SUQA 1WCSA 4IERA 3R4SA 4L99A 4CCLA 3SKVA 5ACA3 2JPNA 5C7GA 3DYPA 3QCWA 4NPRA 3SH4A 4JS5A 3TJYA 1YFWA 5LW9A 1JZ5A 4JQRA 5D8AC 1O91A 2VXJA 2Y8KA 4N7UA 4OZOA 4Q5OA 5I0SA 4GAMC 5HPOA 2E7AA 3DKWA 3OGKB 5CAZA 1KRIA 2DURA 3C7GA 3LD8A 5DG1A 2YB7A 1WCKA 3VD7A 4H3WA 4OULA 4CU8A 1COV2 2EICA 4BB3A 3WP4A 4PHZA 1S0BA 3KMHA 2CAVA 4UI9L 1OFSA 1UNBA 2DCJA 3PVEA 1XNDA 4WVWA 5C4WB 3OGRA 3CMGA 3VKLA 4M3YA 1U5XA 2BOIA 3PVBB 2JENA 3HR9A 1A78A 1UL9A 2QDNA 4K1YA 4RQPB 5AVAA 2K9ZA 4XILA 1YHFA 2TNFA 1DHKB 3KSCA 2JHCA 4RL5A 1QMJA 4RR3A 5J7MA 2PFVA 4JTOA 2Y60A 2W1UA 1MQTA 1NE6A 1W8TA 2H0VA 3MKSB 2ARBA 4KHYA 4F3JA 3KHBA 1W6MB 3RZGA 1R64A 4XOGA 1S2EA 4FJ7A 3A4UA 2FDKA 1WAFA 2DCZA 2WAAA 5DZEA 1RUE2 2OXBA 4JZRA 1EPZA 1VBE1 4E2GA 3I49A 1W8WA 4BLJA 1X8EA 1HV1A 1RUC1 5FPAA 1L3JA 2JD9A 1L7RA 1HRI1 3KCYA 4HMZA 4A44A 4CDWA 2MEV2 2RS51 1D7PM 4HSJA 4RD7A 1CAXA 4A7ZA 2W91A 2HWB3 3IBMA 1W9YA 3NJXA 3I2DA 4IV3C 1PZ7A 3C6PB 3WDXA 1LGBA 1RUJ1 1GOGA 2J1RA 4FPYA 5LA2A 4BQYA 3J2PA 3HNMA 1WW5A 1OLMA 1JUIA 2NPIA 3OGJA 4AQ6A 1YQ5A 4FJHA 1E5HA 4PLOA 3DPRA 3VGIA 3WF1A 3BPZA 4X6RB 5FP8A 2FDGA 5A7OA 3T4VA 5FPXA 1FT9A 2VAUA 2LS6A 1W0OA 3M3CA 4N43B 2PELA 5IVVA 2EXKA 3B94A 5FLIA 1MS4A 3AK0A 3BTXA 4EE2A 2QKDA 3H3UA 2F4PA 4NIHA 5AC92 3RS6A 1QJU1 2VUDA 4LO7A 2L9LA 5FP4A 2V72A 1GR3A 2A7AA 4P08A 1ZZ8A 4NAMA 1AYN2 2DVDA 4XF1A 4R4XA 1J84A 5F6KA 5KXCA 1QU0A 3R4DB 1OD3A 3POFA 4B4QA 3OSDA 1OOPB 3WDYA 1JZ4A 2YC4A 1V9U2 3HOBA 1ODNA 1BEV1 4Q4X3 3H8RA 4YG0A 3NE6A 1Q43A 4KG8A 4ASLA 2JEMA 1V6LA 4QX2A 1JYXA 5J96B 4Q2FA 3O12A 2Y64A 1G8WA 5TSWA 3K2OA 3V0BA 1IGOA 4XBNA 4MGQA 1FZ8E 4QNDA 3B69A 3TB0A 2UYBA 4L9BA 3ZFFA 4YW2A 2VZPA 3C95A 1RXFA 4PQQA 4QX5A 3WF0A 2VTXA 2EAAA 3OBTA 2WINB 4XMAA 1BK1A 1MZEA 4PI0A 1PIV3 2YV8A 5LK7B 3VBRC 4FJ5A 1NY72 5FWEA 4HZFA 4JDMA 4CYDA 5L19A 1CQ9A 3TOJA 2VH9A 3ST7A 5IZ7A 2PTMA 1NLRA 2ZHKA 3MUZ1 1N3PA 4CCDA 2VNVA 5FV3A 1W90A 3PUHA 4HL0A 3U07A 4E2SA 4IV1B 1UMIA 4LHSA 4YM3A 2VOVA 5FZKA 1RXGA 3WVJA 2HWD3 3BVCA 1WCQA 5JDBA 4H7LA 2DU0A 3FFQA 2JKXA 2Y6GA 1H2LA 3KGLA 1XVEE 1D2QA 4LO8A 5F32A 4JRQA 4YVWA 3WP3A 2VVDA 4XBQA 2VUAA 1UYYA 1CONA 1XYOA 4EP9A 3VZMA 4BOWA 4K8RB 3TRSB 5BNPA 5A6ZA 2DEBA 3ZOIA 4P5HA 3UYJA 2C26A 2YC0A 1KEXA 4A2UA 3VHPA 1AXKA 4FOWA 2DF7A 1RUH2 2WS93 1LAJA 1MACA 4XAAA 4IEQA 1XQNA 2V09A 4JTNA 4DPNA 2B9UA 2ZGTA 2ZGSA 4YW6A 2YU2A 2NM1A 3P3NA 4TXWA 4RN5A 1B35A 4I9LA 1AL23 4E4HA 3SISA 4WM7B 3SMHA 4AVBA 4JAAA 4IDZA 4JHTA 3CBNA 2GALA 4KI6A 1HRV3 2GU9A 5C33A 5DPNA 5LEKA 2AUYA 1HX6A 2F6BA 4AW7A 5L7OC 2N7GA 4A45A 4CTEA 4QQHA 4KG0A 1SLAA 3HT2A 3KB5A 3OEBA 3LOIA 4J25A 4ZONA 5JZGB 4Y20B 2QE3A 2ZGUA 2P4EA 5IK5A 5CU1A 1K45A 4Q0SA 4P02B 5KHHA 2OVUA 5EJ1B 4R4ZA 4HONA 3BTZA 5D8AB 1PVXA 1JYWA 3V0AA 5JVVA 1UKRA 2JG9A 2VIXA 1Y9GA 3POGA 4PIZA 4AYUA 3QNNA 4GQ7A 2JB4A 3BIWE 3E5UA 1JOPA 1I9RA 4FPGA 3OPWA 3G6JB 4H14A 2WFF3 3KD4A 1SBFA 3M3OA 4P9WA 4NMIA 2VMGA 4G9SB 5A70A 1FZ2E 1OVSA 3AP9A 4DINB 1R083 3NGIA 1W2OA 2P1BA 2KA3A 3MF6A 2G4IA 4DNYA 3I2HA 1N1CA 3H1WA 1CN1A 4MYEA 2Q0AA 2A1XA 1FZ3E 4XFCA 1RVF1 5LRRA 3QESA 4FTBA 2LM3A 1XB9A 3E5XA 4HVOA 3ZIWA 2X29A 2BGOA 4N53B 3KZ4C 2JH8A 2UWBA 5KR7A 5B4XA 2ZX3A 1AVBA 2YXSA 5GJ6A 1H8TA 2UWCA 4PLMA 2ZPXA 2R32A 1PO11 4R52A 1FZ7E 1LOAA 4JC1A 3RVHA 4AHWA 1QJX1 1UOBA 4W6YA 2JWPA 4AOCA 2BVVA 1Q8OA 2D7FA 2X53S 5IBKB 4I0AA 1XU2A 1JH5A 1VE0A 1OH3A 4X5NA 1F31A 3PUSA 4XUPA 1JOJA 4IE4A 4LEJA 2OYZA 1OVPA 1PGSA 2JXAA 1QQP1 3S0MA 1CX1A 1R1A3 2ZMLA 4CDQB 3QOPA 4AHYA 3THTA 5FOJB 4L0PA 3FMGA 4XJ9A 2WA4A 2XUEA 3FBYA 3NMBA 5FYIA 2BEOA 4YG6A 5FR3A 5JI9A 1SDDB 5ACA2 4KHSA 4WVMA 1BVVA 1WZXA 3GZUC 3QEVA 4O9EA 4TZDA 1OMIA 3PMEA 5LB6A 5D21A 2W5FA 3OGGA 4MXVA 4PDWB 1X9TA 4Q26A 5FXWA 3E1F1 3N36A 4COZA 3QLQA 1CESA 1SDWA 3MUY1 2EIBA 4IGQA 1GZCA 2GC2A 3H8UA 1DYPA 1YLLA 4QHOA 1W6PA 5CVRA 1RUI3 3ZSEA 2WDBA 2XJTA 5T5PA 1ENRA 4ITCA 2LROA 4AWDA 3ZLIA 4XFHA 4NAOA 1O4YA 1POV1 5DZFA 1AJOA 1VAVA 3LA2A 4FJIA 5LA1A 2B1EA 3VZJA 1ZA7A 5FY0A 4EQVA 3PUAA 1DCSA 1X7NA 3LE0A 4Q4V1 1W8UA 2J42A 4XHXA 4IGPA 3LIHA 4NIAA 4LBQD 5I0RA 4PT6A 5IVBA 5LWBA 3I3EA 2P1MB 4ADOA 2CDPA 1DLCA 3I2FA 2BYVE 3EO6A 4AI6A 3N3HA 4JKLA 5JSOA 4QM9A 5JXJA 1BCXA 1WW4A 3WNKA 3RWKX 2IXCA 3I3BA 1EAH3 5CKMA 3W59A 4ISQA 3WDVA 3VD3A 5FREA 2J22A 4CP9A 4YZ2A 5CFDC 5JLVA 1AR73 4X8NA 2RCUA 1OBNA 4GWNA 5FY7A 3VZLA 2HWB2 3SQ0A 3O14A 5A3UA 1B09A 1VAKA 3CFRA 3KLSA 4UFHA 2YFUA 4DTMA 3ACLA 4URTA 3L8BA 1VMHA 5FQ0A 1LESA 2WQZC 1G9AA 3AVRA 2GN3A 1MMOG 5FZGA 2D3PA 2Y6LA 4FK4A 4Q4W1 2DDUA 1AYM3 3WUDA 3D0SA 2FDFA 5K7PA 1W8NA 4KL1A 4IEUA 3NJYA 3MIFA 1S2KA 2ILMA 3DYMA 4IEVA 4YRDA 5JXIA 2VPVA 4QXHA 1RUG3 3N9QA 1X33A 1MS8A 2P37A 2WNUC 2WZR3 4LPLA 1XVDE 4A41A 5KBFA 4NHKA 2XL7A 1UU6A 3AKQA 1FMD1 3FBMA 3JB4C 4EZ4A 4ZHNA 5BNOC 2VTFA 2VOKA 1OPOA 3OD4A 2P1OB 3DL3A 2Q4SA 2LW8A 1WD3A 4MXWB 3TEYA 4ZXKA 3VDDB 1YFXA 4CEYC 1OH4A 2YPDA 3HMYA 3N9PA 5IUQA 2KM2A 2D44A 5GALA 3RMYA 4M41A 1PMIA 2XWBB 3ILNA 4MVTA 2JKBA 3LFMA 4YWAA 4FPOB 3UGFA 1PHMA 2IXIA 4IEZA 4IV3A 2J7MA 1IS6A 3ITQA 4RHV1 1LHWA 4Q4X2 5A1FA 3FHAA 2HBTA 4JKMA 1FZ4E 1WA6X 4QX8A 2JHAA 2RMU1 5E1RA 3L1NA 2W3JA 5K0UA 3JZVA 4KWJA 3O1SA 1HB1A 1VAMA 5CFCC 3I2GA 4FJNA 3ES4A 3RSJA 4S2HA 3DCQA 1J83A 3JD73 1ZBA3 1ZYBA 4NUBA 5CB7A 4Z1VA 5C8CB 5L9RA 5J37A 4LJHA 3SLIA 5E6HA 2K0GA 4Y1ZA 4OI1A 3FLRA 2VZ1A 3NSTA 4RGGA 3ZMNA 3T0DA 2Z42A 3DUIA 3RMBA 4P9XA 4D6RA 1H2MA 3L2YA 4PIYA 2DBNA 4DTXA 1HN1A 1PIV2 2WSUA 3ETPA 3TYJA 3N9MA 5G05L 1GQPA 1WWYA 5F5AA 2JG8B 3JCIA 3VDCA 2HEYF 3FL7A 5H9QA 3SHRA 1TME2 3CZUA 1J1LA 4FSJA 2A71A 2YPJA 4AVAA 4EYWA 1W05A 1ZVFA 2DTWA 2WR9A 3DGTA 3OBRA 4K20A 1H8VA 3W21A 2GMEA 4KNCA 2HWD2 4XUOA 4A3ZA 2VTXJ 4FVVA 1FZ1E 2R0FA 3VBHC 4QHZA 3HPNA 5A7NA 5JAXA 3O5SA 3IDCB 3O7OA 1YEWA 1CAVA 1FOD3 1GKBA 5C71A 3WW4A 1NLQA 3RZHA 4RR3C 1JZ3A 3CJIA 4R8HA 4EWEA 1WW7A 5F39A 2R1BA 3OPZA 1FPOA 4YG3A 1MQTC 4CCNA 2PFTA 4MZUA 5J36A 2BJSA 2XG3A 4CP2A 4HBNA 1GZWB 4JQTA 1W0PA 2FZ1A 3BGAA 5FTTC 5FZ7A 1EPWA 3ECQA 3VBRA 2HLEA 5FIXA 4UBHA 4DEVA 2Y6HA 1GWLA 3WQ1A 2PQQA 3RJ2X 3VZKA 4U2AA 1FI2A 2E7QA 4LBJA 5JR7B 4D7YA 1WCDJ 2V5YA 1XU3E 1AL22 3CFOA 3ACGA 3LKJA 1SBDA 4IEPA 2TEPA 3WDWA 3ZR6A 5CG8A 1XYPA 4CPBD 1F4AA 1SEFA 1O4TA 4EWAA 1LU1A 2ARCA 1EV13 3VD5A 2W0XA 2QQMA 1HRV2 3J7NA 1CVNA 4LA2A 4LBQB 5FMCA 2XBO1 4M3XA 2VZUA 3N1BA 3JBG1 2XHNA 3EBRA 4H2AA 3VLBB 3NAPB 3TWIA 2DUOA 3RYRA 3UKNA 1CWPA 1D0GA 1FNZA 3E5QA 2WL1A 2WNVA 2E31A 3GZTB 3MGUA 1RJ8A 4XXAA 3SQOA 5KHKA 5LY1A 4QDSA 3NW4A 5JOWA 2SBAA 3T4HB 2XQRA 3U78A 1UXXX 2WC2A 1LENA 2HYKA 1AR61 3LQCA 4L8QA 2HWE1 4CDXB 4DIQA 3IIIA 5KXDA 2H4TA 3TAFA 1FV3A 2ZXQA 3HBKA 3NNGA 4QQPA 5F3EA 5IVCA 4IE6A 2OQ7A 2WFF2 1GSLA 3POYA 1W04A 3ZFGA 1OLQA 4NJ4A 2AENA 4M3ZA 5IVYA 1S0GA 1VRH3 2GP5A 2PHWA 1R082 2V4VA 3UT0A 2VY0A 4TSVA 1PVC3 3SCGA 2PAKA 2WN3A 3GHNA 1W8OA 3VBUC 4TN7A 1POQA 1XNCA 3ATGA 3HJRA 4QQLA 4UW3A 5JSPA 2D6MA 4OQ8A 1VBB3 1MEC3 3S5AA 4RL7A 4Y3OA 3HGKE 2ZGQA 1P22A 2P1NB 1H1AA 4WBBA 3MW4A 3D82A 5JSRA 3NAEA 4OHZA 3ZXEA 1XMHE 4J2EA 5D1IA 4LE4A 3LSDA 1GP6A 3OCPA 5FZOB 1FV2A 2EA7A 3VZOA 4NPLA 1MZFA 4CZSA 3ZFFC 1MVEA 4BE3A 5ISLA 3VZNA 1K5MB 3QD6A 2CDOA 2WYSA 4NIIA 2IWGB 2R16A 3W20A 1LRHA 1FPN3 1UZ0A 3ME2A 2BTVC 2VOXA 3HQUA 2CTVA 2BNNA 3FFZA 1ZZCA 3N7KA 3NO8A 4I01A 4RGAA 5DN2A 3B3QE 3ON7A 1O4ZA 2HWF1 1SFNA 5HV4A 1MZ5A 1RHI3 3O0WA 3OEAA 3H50A 3POJA 5EYYA 1R1A2 3RWUA 3RMAA 1FAYA 4N9HA 4CXWA 5EQUA 1DZQA 3FLTA 3WDUA 1PGW1 1UPSA 4AHXA 5FZ1A 2IXKA 1PGL2 2WYFA 4J1XA 1UY4A 2R041 3AM2A 4KU7A 4NVPA 1IQDC 1UW8A 4YW3A 2V5DA 2OS2A 2VR4A 3KV9A 4NOTA 1DP0A 2XHKA 2LTNA 4XHBA 5FY5A 3PHMA 2VUCA 3VBFC 4COUA 5IAXA 1YC61 1YJLA 3RZLA 1IQAA 2XR4A 3WXPA 5I93A 3ZX7A 4CU9A 2E6VA 3I97A 3P1IA 3PMSA 1RUI2 2YB5A 3VBOA 5FZ4A 5A6XA 1NT0A 3I2JA 4A4AA 1MPXA 3H8XA 2X8KA 3IPVA 2ZGMA 4XCAA 3WQBA 4PBPA 3MPPG 4W65A 1S1AA 3FC0A 4D6SA 2BGPA 4ADNA 4FTEA 3WINE 1SCSA 2ZHMA 1NG0A 1AR91 4XEZA 2KXLA 1QGLA 3WNNA 4XDQA 4CU7A 2C9AA 2RDSA 4AF9A 3JB8A 2A70A 2Q30A 1RINA 1V6IA 2QZ2A 1PM7A 2ZX1A 1PZ9A 2RS31 3CZJA 4GWMA 4XCBA 3RMCA 3SCFA 3QACA 4BXFA 4J2BA 1VLNA 5F2SA 1RUC3 4COYA 2MPFA 1HRI3 3AYAA 1EAH2 3J4UH 2RS53 4Z07A 4FOVA 4DXRA 1UCXA 4LITA 4OHXA 4K21A 1YIPA 3AKSA 2ZKLA 3ELNA 1KFXL 1RUF1 2R063 5IJRA 5F9TA 3RZMA 3RPQA 1ZRRA 4IEXA 3RGBA 2X5IB 4BHPA 2YDEA 1K42A 5IWFA 1JZ7A 1AZDA 3SNNA 1JTZX 1NA1A 1RMU3 1UO9A 2FMDA 1LODA 2OZMA 3E4YA 2ZABA 4NROA 3I59A 2YHJA 1AYM2 3SPZA 3RFRA 4GB32 4P5YA 3CF6E 4Q0QA 5LASA 4CUAA 5FP3A 2QQUA 4B4PA 1UN1A 3Q8BA 4I9QA 5T5LA 4E4ZA 1ZRFA 1RUG2 3T2QA 4CXYA 3HN3A 1ZZ7A 2WZR2 3KV4A 4IEWA 2BW8A 5AFEA 4DUXA 1O3QA 4I09A 2QZ3A 1V6MA 4FXKB 4HKLA 1QJU3 4SLIA 1RJ7A 3HWJA 2G1MA 4AFAA 3EMRA 2VMIA 2TUNA 1TMF3 4HANA 1HXS1 3WSOA 1MQTB 5FZMA 4AEDA 2WNEA 3FUQA 2Q8OA 3QBQA 5J48A 4FK2A 3NNMA 1X9PA 4LKFA 1BEV3 5FLJA 3WCSA 5FY8A 3I2OA 2ENRA 1SZBA 4MH0E 4CDWB 3HVDA 1CAXB 4QX7A 3ZYGA 5LEJA 5FP7A 1XVFE 1FX5A 3GDBA 1F35A 1UD1A 4GIQA 1C8M3 3FWEA 1COV1 3CIHA 5E16A 2EIDA 2HD0A 3D8CA 3A21A 2NMNA 2WNUA 2Z4FA 5FZ3A 4AHZA 3JD72 1ZBA2 4DU4A 2YUEA 5DUVA 2WKKA 4CEWC 1W0NA 3DPRB 4WM8C 5A3WA 5FKBA 5BNOA 1JU4A 3C6OB 2R0HA 4DTPA 2VC9A 1C1FA 2VOWA 3JQWA 2O14A 4HLTA 1ULFA 4JRAA 4LULA 2A75A 4MLOA 3ZMOA 2O8QA 4CEYA 3WLUA 4CE8A 1VBA3 2WBKA 3THPA 5DABA 3VD4A 5EV7A 1JW2A 1RUE1 1S0JA 4QU1A 1HQNA 3BALA 4RYDA 2OT7A 4YVSC 3AMHA 3Q9OA 1NCQC 3PIJA 3HQXA 1AX0A 4I3GA 5FK7A 4DRRA 1M06G 1WKYA 3FX3A 5CFCA 2D6NA 2IVJA 5F5CA 2ZGRA 2DUQA 3EYPA 4ET7A 3UO2A 2IFWA 4HK8A 4CU6A 5L36A 1C4RA 2ZAHA 3V0BB 2C5DA 3LAGA 4IEYA 4GH4C 1O5UA 1X50A 1E5IA 3H42B 1S0EA 3FUOA 3ZN4A 4A7KA 2CGOA 2G19A 3J7MA 5IFTA 4KBBA 3D4KA 1SPPA 5LBCA 4AI8A 4DTJA 4XF4A 2VJ4A 1CIWA 1HB2A 2A6XA 3PUIA 3OGVA 4LO5B 5AC91 4CPBA 2PYTA 3BB6A 1PGL1 3WF3A 2JDUA 1AYN1 2P2KA 3UGHA 4FI9A 1EP0A 2VW1A 5KXEA 1O59A 3AZYA 3VBHA 3W5NA 1DZRA 1V9U1 2R7EB 4U36A 4NHLA 3E4WA 3KT4A 4QXBA 3TABA 1QDOA 3I54A 3VHNA 1DYKA 2C6SA 4YVWB 5KHIA 3POBA 2NN8A 3T2TA 2ORZA 4ZZ8A 3BUCA 1F5FA 1UYXA 1RIRA 4BH9A 5BNPB 2QVSB 4MHRA 5E89A 2FW3A 4N90A 1WMDA 1KQRA 3ZFEA 2WWSA 4RFRB 1GQGA 5EYXA 4AVCA 3PDQA 3W5MA 1OURA 1OT5A 1W39A 2DFCA 4JGZB 5GLWA 1W28A 5IK8A 5EHDA 2B46X 2RVAA 5LY2A 4FAHA 2CAUA 2X09A 2H0BA 3UJOA 4GAZA 1VRH2 3OUJA 4QGMA 1UYZA 3AL5A 2D5FA 1PVC2 1RVF3 5JPMB 1B35B 3RI8A 1I1EA 3ZPYA 2ET7A 5T3NA 1LEDA 5T5OA 1JMUB 4WVZA 1VBB2 4AAPA 1MEC2 1HLCA 5FYTA 5DZGA 4J2AA 1BBT3 1Y9MA 2JE9A 4K9SA 4XBLA 5K0UC 3MV11 3CQ8A 1ND3A 1RITA 3I4IA 4LNVA 2ARAA 5K4LA 2D43A 1AHSA 2RG4A 3DN7A 4X6QB 5GZFA 3T30A 4P9YA 2ETEA 4OUSA 2Y0OA 1GNYA 1SLIA 4XETA 4XJAA 2QQNA 2YFZA 4BMEA 4QXCA 3C6NB 1KJLA 2VCBA 2XJSA 5DAVA 1UAIA 1AUYA 4XF9A 4XVHA 5FZIA 1DQ2A 3SQ4A 2OPKA 2QQVA 1D0HA 2FYOA 2FHRA 2JG9B 3T1MA 2P5GA 5ABJC 1EUUA 4KHNA 3RYKA 1PMJX 1I6XA 4JRLA 3K46A 1VP6A 5A32A 2VVEA 4OZXA 5BYNA 3VBUA 2WUHA 4LBMA 5F7UA 1NCRC 1U12A 3NV1A 5JIAA 2JDYA 4XFBA 1YFUA 4XQWA 1OA3A 1R091 2GNMA 4AVVA 2PHDA 2VECA 1MHYG 1CPMA 1LB2A 1LDKE 1LHUA 4AVTA 1U0AA 1WMEA 3POIA 1H1IA 5EP9A 2BU9A 2DUPA 2RS13 2B42B 2KR2A 3GALA 5ANNA 3CJIC 2VZVA 3PJYA 2A3XA 2I07B 4M3CA 5KC5A 3E6CC 4X5MA 4NWVA 2CWMA 4E4BA 4Y33A 2FZ2A 5A1LA 4OI2A 1POV3 1H8TB 2C1FA 1K5JA 2TBVA 3ZIXA 3ZYBA 3WG3A 5A3NA 3C8XA 4AQTA 1WGPA 1CLQA 4Q4V3 2B39A 3RMXA 4IE7A 4ZXEA 2E7TA 4RS5C 4HETA 2QQIA 2P1QB 4JGYB 1UPIA 4O9GA 1FS1A 1CAWB 2Z69A 1DIWA 3AP5A 4JS4A 2I45A 4LXLA 1U5ZA 3OY8A 1UU4A 3NDKA 5FY9A 5HCBA 1FATA 3K3OA 4QKBA 1DDLA 4Z8BA 2WAOA 1RUC2 4IETA 4AEMA 3RG0A 4EN8B 1HRI2 3QEXA 1LCLA 3AYEA 5HBAA 3WZ1A 2YG0A 4BLIA 1G7YA 2RS52 3IAPA 2VQAA 4YM2A 3T09A 4AFCA 5B4NA 1TNFA 5CA6A 1FXXA 3VBFA 1DQ5A 1XNBA 2QFEA 4WVMB 1VBC2 2BV4A 2WNVC 2PHFA 1WBFA
chains in the Genus database with same CATH topology
2B8IA 4DTMA 2HYXA 2YFUA 3BN6A 3L8BA 3HGLA 2W87A 1MMOG 4I6JB 4QPWA 2XQXA 4FK4A 2Y6LA 2DDUA 2ORXA 2VZOA 3CKHA 3LEKA 1W8NA 5LCWL 4DTRA 1GU3A 5JXIA 3DYMA 1FZ5E 1CIYA 1PMHX 4LPLA 4DTUA 1XVDE 1O8PA 1W9SA 4A41A 1L7QA 4KHWA 1ULOA 2VTFA 3VDAA 2P1OB 2EIEA 2LW8A 2VZTA 3KD1E 5A1AA 4OYUA 3QEWA 1OH4A 2X10A 3F2ZA 3HL8A 4DU3A 3C94A 3RMDA 3QERA 2BZDA 1XNAA 4XUQA 4ZZ5A 2B7MA 4M41A 4MGSA 3TAGA 1JYNA 4JX0A 2J7MA 3HNBM 1K12A 4QB2A 2QQKA 2QQJA 3FHAA 4JKMA 3NHGA 1FZ4E 4JKKA 2JHAA 2OZSA 3J7HA 3L1NA 2W3JA 3LEGA 1XMGE 1Q9XA 2W95A 3I2GA 4FJNA 3LPGA 4ARYA 3WEZA 1J83A 1XVGE 3K75B 3T08A 4BDVB 4TTGA 3SVIA 3WNPA 2VZ1A 3SQ1A 1H6YA 4GZ9A 3SI6A 4MO3M 3T0DA 3RMBA 4UAPA 4QX0A 4GWIA 4DTXA 1HN1A 3ETPA 5G05L 3LDSA 1GQPA 2VJXA 4XZUG 3VDCA 3FL7A 2BERA 1NX9A 1W9TA 2WZ8A 3CZUA 1I5PA 3CDZB 2J1AA 4EYWA 5DMYA 2XONA 4QDQA 1UY0A 3LDBA 3QEIA 3T2PA 4XUOA 4A3ZA 1JZ2A 5IREA 4DUVA 3KD5E 1FZ1E 3HPNA 1OF3A 4MADA 5C71A 3T0AA 3U37A 1BHGA 1JZ3A 2ATQA 4FJLA 3EB7A 3MV01 4AKIA 2WO1A 4DUWA 2PFTA 4FJMA 5I0DA 4QB1A 4KI5M 1US3A 3BGAA 1KGYA 1UY1A 3ECQA 4DEVA 2HLEA 2PQSA 2Y6HA 1IH7A 4KHUA 1XU3E 2JHPA 3CFOA 2BBAA 3ACGA 4LKSA 1PX4A 3LZIA 2C4XA 1F4AA 2J1TA 2Y6KA 2W1SA 3VD5A 2VMFA 2QQMA 2WN2A 1SG3A 2ZEZA 5C70A 4M3XA 1FZ9E 2VZUA 3N1BA 1IG9A 2WO3A 3NQHA 2XHNA 1UWWA 2JDAA 1JZ8A 1FZHE 2E31A 3CFPA 2DTUA 4QDSA 3LPFA 1UXXX 4M3WA 3WF2A 5FUIA 3LQCA 2QQOA 3IIIA 4AKGA 2H4TA 3TAFA 1LNSA 2ZXQA 3NRUA 3WNLA 3NNGA 2W47A 3P6BA 3FN9A 4M4RA 2C9KA 5HXMA 1GUIA 3OGLB 4HCCA 2B4KA 4FJKA 1WAJA 4M3ZA 4W8JA 1FZ6E 3LZJA 2V4VA 5IFPA 2WN3A 3GXUA 2W9XA 1W8OA 2W92A 2ID4A 3HJRA 4FJGA 1XU5E 3HGKE 2ZEXA 1P22A 2P1NB 3NAEA 4AG4A 1XMHE 4J2EA 1JI6A 3OGMB 2ZEWA 2VMDA 2CDOA 2WYSA 4DU1A 4M42A 4UOJA 3T0BA 1W9WA 1UZ0A 3L0MA 3NCIA 5DN2A 4DXSA 4EPHA 4LQRA 2OVQB 5JXGA 3OEAA 3RWUA 3RMAA 3SUQA 3IB3A 3SKVA 2JPNA 1GOFA 3GM8A 5C7GA 2W1QA 3DYPA 1UY4A 5CZKA 4JS5A 2Y6JA 3TJYA 1JZ5A 3DECA 2Y8KA 4OZOA 1IQDC 5HPOA 4GAMC 2QBXA 2V5DA 2VR4A 3OGKB 1DP0A 3C7GA 3LD8A 1CZSA 2YB7A 2WABA 2WO2A 3C7HA 3VD7A 5EJZB 1NAEA 4CU8A 2EICA 4CU9A 3K4AA 3I97A 3P1IA 2P5OA 4UI9L 2YB5A 2DCJA 3WF4A 1CZVA 1TG7A 4DXTA 3OGRA 3I2JA 3CMGA 4A4AA 1MPXA 4J2DA 4M3YA 3FHQA 3WQBA 1XVBE 1P8JA 2B9VA 1FYZE 2JHCA 4RL5A 3DYOA 4OMCA 2PFVA 2BGPA 4ADNA 2W1UA 1OF4A 3MKSB 3WNNA 4KHYA 4CU7A 1UXZA 1R64A 2E32A 4FJ7A 1WAFA 2JH9A 2WAAA 1NKGA 3CZJA 3RMCA 4CVUA 4XURA 3C7OA 4J2BA 2JD9A 1L7RA 3UESA 1GMMA 4A44A 4DXRA 1D7PM 4FJ9A 2W91A 3MO4A 1MHZG 3NJXA 3C6PB 5IJRA 1GOGA 2J1RA 5LA2A 3I2KA 2RJ2A 2J1UA 3J2PA 1FZIE 3HNMA 3UETA 3SEPA 4AAXA 4W4ZA 1K42A 1JZ7A 3SNNA 2P1PB 3E4YA 2OZMA 4FJHA 2DCKA 4FK0A 2KD7A 3WF1A 2VZRA 3SPZA 4P5YA 4CUAA 4E8CA 2LS6A 4I9QA 1CZTA 4RG8A 3T2QA 3HN3A 1UX7A 4DUXA 1JHJA 4QB6A 2YC2A 2L9LA 2V72A 2J1VA 4P08A 1ULPA 1XPWA 3I3DA 3ACIA 1J84A 3WSOA 1SHWB 3UIQA 1OD3A 1XVCE 4FK2A 1JZ4A 2YC4A 3HEIA 3HOBA 1NEXB 3NE6A 3SEEA 3ZM8A 4HG6B 4QX2A 1JYXA 2VMEA 3SUOA 1XVFE 4E8DA 1JYVA 3GDBA 1XC6A 2Y64A 3T2OA 1H6XA 3K2OA 4FJ8A 4KHQA 5H37A 4MGQA 2VQUA 3CIHA 1FZ8E 2HD0A 2EIDA 4QNDA 2Z4FA 3A21A 2VZPA 4DU4A 3C95A 5IHRA 4M45A 4PQQA 3WF0A 3HP9A 1W0NA 4BJ0A 4DTOA 1JU4A 3AC0A 3C6OB 3SJJA 4FJ5A 4B08A 1GOHA 4DTPA 2LF3A 2VC9A 3SCXA 4XUTA 5IZ7A 4AKHA 3K4DA 3MUZ1 3OGSA 5JR2A 2J1SA 2WBKA 3PUHA 4A6OA 4GWJA 2VOTA 3VD4A 3MBWA 5IYYA 1UMIA 5JXHA 4LHSA 4PF1A 4RYDA 1NUKA 1WCQA 3A23A 3SKJE 3ABZA 4QNCA 2JKXA 2Y6GA 4BK4A 1XVEE 2XOMA 4JRQA 1RYYA 3C7EA 1UYYA 4EP9A 4OMDA 1WKYA 2DEBA 2E33A 3EYPA 2C26A 1KEXA 4D0QA 1O8SA 4ET7A 5LA0A 1XMFE 4CU6A 1Q9YA 2VZ3A 2VCAA 1F4HA 3QNOA 4FJJA 4QAWA 5EIYB 4OUEA 3THDA 4M4PA 5IFTA 4TXWA 4RN5A 4I9LA 3GGLA 4Z2AA 4DTJA 2VJ4A 3PUIA 3WNMA 2QQLA 3OGVA 1TVGA 4KI6A 3WF3A 1XL3C 2VQTA 5DPNA 1YQ2A 3NJVA 4M3UA 4A45A 4FI9A 1PX3A 3OEBA 3OB8A 2X05A 1O59A 4W50A 2OVPB 2OYQA 2WZEA 4KMQA 5G04L 1FZ0E 3W5NA 2W46A 1EUTA 1K45A 2R7EB 4KI4A 4P02B 3E4WA 5EJ1B 3TABA 1JYWA 3TAEA 4QX1A 1W99A 2LF6A 4ZZ8A 2VIXA 1XNTA 2ORZA 3QNNA 4A42A 3SUNA 1UYXA 3K4ZA 4JHZA 3SPYA 2FW3A 1UY2A 1US2A 4QDRA 3W5MA 1DYOA 2MZWB 4M3TA 1OT5A 1FZ2E 3A22A 2RVAA 3NGIA 2X09A 1UY3A 2WQ8A 3I2HA 4ARXA 5JUVA 1UYZA 1FZ3E 2ZEYA 3QESA 2DY4A 5DQ0A 5J1XA 3V7DB 2BGOA 2JH8A 3A7QA 4CUBA 5JMOA 4BK5A 4J2AA 3C7FA 5B4XA 1K3IA 3MV11 3WNOA 3CQ8A 4JRPA 3LEIA 1FZ7E 3N1EA 1GNYA 2QQNA 2YFZA 2J1EA 3VDBA 4DTNA 3C6NB 5IBKB 2VCBA 3IAQA 1MTYG 2OKXA 2VCCA 2VZSA 4X5NA 4XVHA 4XUPA 1UMHA 3OBAA 1CX1A 3SQ4A 3K77A 5CYYA 2FYOA 3D3AA 2P5GA 1EUUA 4IUGA 4KHNA 1PMJX 3SQ2A 2VMCA 4BXSV 4L0PA 3K46A 4KWUA 4ZY9A 3CQOA 3QETA 3QEPA 1JU3A 3ACHA 2WUHA 5F7UA 2OVRB 1SDDB 4MOAA 4XUNA 4YPJA 4KHSA 3SUPA 3HNYM 2MMBA 3QEVA 2W5FA 2W94A 3E1F1 1MHYG 3L2OB 4DEQA 3VD9A 1LDKE 4E3SA 2EIBA 2RV9A 3MUY1 2VJ5A 2JE8A 4D8MA 2QXFA 3J27A 2VM9A 2WDBA 2VZVA 3IDAA 4X5MA 3JXSA 4E4BA 1T2XA 4P00B 4FJIA 5LA1A 2B1EA 3C8XA 3THCA 1CLQA 3LE0A 3OG2A 4ZXEA 4PT6A 2QQIA 2P1QB 4RNGA 3I3EA 2P1MB 4ADOA 1FS1A 4M3RA 3ACFA 2CDPA 4JS4A 1DLCA 3I2FA 4FVMA 2VZQA 3NDKA 4AI6A 4JKLA 5JXJA 4HCBA 2VO5A 3WNKA 4QX3A 3I3BA 2WAOA 4DTSA 4FJXA 1JZ6A 2E26A 3QEXA 3VD3A 3TL8B 2YG0A 5B4NA 2J22A 3IAPA 3T09A 3UNPA 2RCUA 1FXXA 2VL4A 3SQ0A 3I2IA 3S9HA 3CFRA 2W1WA 4CUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YFU A;  3BN6 A;  2HYX A;  2W87 A;  4I6J B;  4QPW A;  2XQX A;  2Y6L A;  2DDU A;  2ORX A;  2VZO A;  3CKH A;  3LEK A;  1W8N A;  5LCW L;  1GU3 A;  5JXI A;  3DYM A;  1CIY A;  1PMH X;  4LPL A;  1O8P A;  1W9S A;  4A41 A;  1L7Q A;  1ULO A;  2VTF A;  3VDA A;  2P1O B;  2EIE A;  2LW8 A;  2VZT A;  5A1A A;  4OYU A;  1OH4 A;  2X10 A;  3F2Z A;  2BZD A;  4XUQ A;  1XNA A;  4ZZ5 A;  4MGS A;  1JYN A;  4JX0 A;  2J7M A;  3HNB M;  1K12 A;  4QB2 A;  2QQK A;  2QQJ A;  3FHA A;  4JKM A;  4JKK A;  3J7H A;  2W3J A;  3LEG A;  2W95 A;  3I2G A;  3LPG A;  4ARY A;  3WEZ A;  1J83 A;  3K75 B;  3T08 A;  4BDV B;  4TTG A;  3WNP A;  2VZ1 A;  1H6Y A;  4GZ9 A;  3T0D A;  4MO3 M;  4UAP A;  4QX0 A;  4GWI A;  1HN1 A;  3ETP A;  5G05 L;  1GQP A;  2VJX A;  4XZU G;  3VDC A;  3FL7 A;  2BER A;  1NX9 A;  1W9T A;  2WZ8 A;  3CZU A;  1I5P A;  3CDZ B;  2J1A A;  5DMY A;  2XON A;  4QDQ A;  1UY0 A;  3T2P A;  4XUO A;  4A3Z A;  1JZ2 A;  4DUV A;  3HPN A;  1OF3 A;  4MAD A;  5C71 A;  3T0A A;  3U37 A;  1BHG A;  1JZ3 A;  3EB7 A;  3MV0 1;  2WO1 A;  4DUW A;  5I0D A;  4QB1 A;  4KI5 M;  1US3 A;  3BGA A;  1KGY A;  1UY1 A;  3ECQ A;  4DEV A;  2HLE A;  2PQS A;  2Y6H A;  2BBA A;  3ACG A;  4LKS A;  1PX4 A;  2C4X A;  1F4A A;  2J1T A;  2Y6K A;  2W1S A;  3VD5 A;  2VMF A;  2QQM A;  2WN2 A;  1SG3 A;  2ZEZ A;  5C70 A;  2VZU A;  2WO3 A;  3NQH A;  2XHN A;  1UWW A;  2JDA A;  1JZ8 A;  2E31 A;  4QDS A;  3LPF A;  1UXX X;  3WF2 A;  5FUI A;  3LQC A;  2QQO A;  3III A;  1LNS A;  3NRU A;  2ZXQ A;  3WNL A;  3NNG A;  2W47 A;  3P6B A;  3FN9 A;  4M4R A;  2C9K A;  5HXM A;  1GUI A;  3OGL B;  2B4K A;  4W8J A;  2V4V A;  5IFP A;  2WN3 A;  3GXU A;  2W9X A;  1W8O A;  2W92 A;  2ID4 A;  3HJR A;  2ZEX A;  1P22 A;  2P1N B;  4AG4 A;  1JI6 A;  3OGM B;  2ZEW A;  2VMD A;  2CDO A;  2WYS A;  4UOJ A;  3T0B A;  1W9W A;  1UZ0 A;  5DN2 A;  4DXS A;  4LQR A;  2OVQ B;  5JXG A;  3OEA A;  3IB3 A;  3SKV A;  1GOF A;  3GM8 A;  5C7G A;  2W1Q A;  3DYP A;  1UY4 A;  5CZK A;  2Y6J A;  1JZ5 A;  3DEC A;  2Y8K A;  4OZO A;  1IQD C;  5HPO A;  2QBX A;  2V5D A;  2VR4 A;  3OGK B;  1DP0 A;  3C7G A;  1CZS A;  2YB7 A;  2WAB A;  2WO2 A;  3C7H A;  3VD7 A;  5EJZ B;  1NAE A;  4CU8 A;  2EIC A;  4CU9 A;  3K4A A;  3I97 A;  3P1I A;  4UI9 L;  3WF4 A;  2DCJ A;  1CZV A;  1TG7 A;  4DXT A;  3OGR A;  3I2J A;  3CMG A;  4A4A A;  1MPX A;  3FHQ A;  3WQB A;  1P8J A;  2B9V A;  3DYO A;  4OMC A;  2BGP A;  2W1U A;  1OF4 A;  3MKS B;  3WNN A;  4CU7 A;  1UXZ A;  1R64 A;  2E32 A;  2WAA A;  3CZJ A;  1NKG A;  4CVU A;  4XUR A;  3C7O A;  2JD9 A;  1L7R A;  3UES A;  1GMM A;  4A44 A;  4DXR A;  1D7P M;  2W91 A;  3MO4 A;  3NJX A;  3C6P B;  5IJR A;  2J1R A;  1GOG A;  5LA2 A;  3I2K A;  2RJ2 A;  2J1U A;  3HNM A;  3UET A;  3SEP A;  4AAX A;  4W4Z A;  1K42 A;  1JZ7 A;  2P1P B;  2DCK A;  2KD7 A;  3WF1 A;  2VZR A;  4P5Y A;  4CUA A;  4E8C A;  2LS6 A;  1CZT A;  3T2Q A;  3HN3 A;  1UX7 A;  4DUX A;  1JHJ A;  4QB6 A;  2YC2 A;  2L9L A;  2V72 A;  2J1V A;  4P08 A;  1ULP A;  1XPW A;  3I3D A;  3ACI A;  1J84 A;  3WSO A;  1SHW B;  1OD3 A;  1JZ4 A;  2YC4 A;  3HEI A;  3HOB A;  1NEX B;  3SEE A;  3ZM8 A;  4HG6 B;  4QX2 A;  1JYX A;  2VME A;  4E8D A;  1JYV A;  3GDB A;  1XC6 A;  2Y64 A;  3T2O A;  1H6X A;  4MGQ A;  2VQU A;  3CIH A;  2EID A;  3A21 A;  2Z4F A;  2VZP A;  5IHR A;  4PQQ A;  3WF0 A;  1W0N A;  4BJ0 A;  1JU4 A;  3AC0 A;  3C6O B;  1GOH A;  2VC9 A;  4XUT A;  3K4D A;  3MUZ 1;  3OGS A;  5JR2 A;  2J1S A;  2WBK A;  3PUH A;  4A6O A;  4GWJ A;  2VOT A;  3VD4 A;  3MBW A;  5IYY A;  1UMI A;  5JXH A;  4LHS A;  4PF1 A;  4RYD A;  1NUK A;  1WCQ A;  3A23 A;  3SKJ E;  3ABZ A;  2JKX A;  2Y6G A;  4BK4 A;  2XOM A;  1RYY A;  3C7E A;  1UYY A;  4OMD A;  1WKY A;  2E33 A;  3EYP A;  2C26 A;  1KEX A;  4D0Q A;  1O8S A;  4ET7 A;  5LA0 A;  4CU6 A;  2VZ3 A;  2VCA A;  1F4H A;  5EIY B;  4QAW A;  4OUE A;  3THD A;  4M4P A;  5IFT A;  4TXW A;  4RN5 A;  3GGL A;  4Z2A A;  3PUI A;  3WNM A;  2QQL A;  3OGV A;  1TVG A;  3WF3 A;  2VQT A;  5DPN A;  1YQ2 A;  3NJV A;  4A45 A;  4FI9 A;  1PX3 A;  3OEB A;  3OB8 A;  2X05 A;  1O59 A;  4W50 A;  2OVP B;  2WZE A;  4KMQ A;  5G04 L;  3W5N A;  2W46 A;  1EUT A;  1K45 A;  2R7E B;  4P02 B;  5EJ1 B;  1JYW A;  4QX1 A;  1W99 A;  4ZZ8 A;  2ORZ A;  1XNT A;  4A42 A;  1UYX A;  3K4Z A;  4JHZ A;  1UY2 A;  1US2 A;  4QDR A;  3W5M A;  1DYO A;  1OT5 A;  3A22 A;  2RVA A;  2X09 A;  1UY3 A;  2WQ8 A;  3I2H A;  4ARX A;  5JUV A;  1UYZ A;  2ZEY A;  5DQ0 A;  5J1X A;  3V7D B;  2BGO A;  3A7Q A;  4CUB A;  5JMO A;  4BK5 A;  3C7F A;  5B4X A;  1K3I A;  3MV1 1;  3WNO A;  3LEI A;  1GNY A;  2QQN A;  2YFZ A;  2J1E A;  3VDB A;  3C6N B;  5IBK B;  2VCB A;  3IAQ A;  2OKX A;  2VCC A;  2VZS A;  4XVH A;  4XUP A;  1UMH A;  3OBA A;  1CX1 A;  3K77 A;  5CYY A;  3D3A A;  1EUU A;  4IUG A;  1PMJ X;  2VMC A;  4BXS V;  4L0P A;  3K46 A;  4KWU A;  4ZY9 A;  3CQO A;  1JU3 A;  3ACH A;  2WUH A;  5F7U A;  2OVR B;  1SDD B;  4MOA A;  4XUN A;  4YPJ A;  3HNY M;  2W5F A;  2W94 A;  3E1F 1;  4DEQ A;  3L2O B;  3VD9 A;  1LDK E;  2RV9 A;  2EIB A;  3MUY 1;  2JE8 A;  4D8M A;  2VM9 A;  2WDB A;  2VZV A;  3IDA A;  3JXS A;  1T2X A;  4P00 B;  5LA1 A;  3C8X A;  3THC A;  3LE0 A;  3OG2 A;  4ZXE A;  4PT6 A;  2QQI A;  2P1Q B;  3I3E A;  2P1M B;  1FS1 A;  3ACF A;  2CDP A;  1DLC A;  3I2F A;  2VZQ A;  4JKL A;  5JXJ A;  2VO5 A;  3WNK A;  4QX3 A;  3I3B A;  2WAO A;  1JZ6 A;  2E26 A;  3VD3 A;  2YG0 A;  5B4N A;  2J22 A;  3IAP A;  3T09 A;  3UNP A;  2VL4 A;  3I2I A;  2W1W A;  4CUC A; 
#chains in the Genus database with same CATH topology
 2B8I A;  2R06 2;  2HYX A;  4IXL A;  4L92 A;  1HJG A;  4XFF A;  3HGL A;  2RR1 1;  3ZDV A;  1CAU A;  4BIO A;  4Q4W 3;  2FCU A;  4I6J B;  1LJ7 A;  3AXE A;  3PUQ A;  5A7W B;  2ORX A;  2VZO A;  3CKH A;  1RMU 2;  3LEK A;  2ZX2 A;  3BPS A;  3ORJ A;  4C91 A;  3B7M A;  1W6P B;  2D6L X;  4MV2 A;  4Y26 A;  2WWU A;  3IWZ A;  1PMH X;  4LKE A;  4PJY A;  4CXX A;  3TEW A;  3ZFG C;  2O8O A;  3DEM A;  3SXW A;  1W9S A;  5C3O A;  1FMD 3;  2XKP A;  4IEO A;  1F9K A;  4OCT A;  4YLZ A;  4KHW A;  4EYU A;  4OHV A;  3JU9 A;  4O7X A;  3KF5 A;  4Y1U A;  3NV2 A;  3NJZ A;  3JQX A;  1QJU 2;  1JW6 A;  2VZT A;  3M3I A;  4FPE A;  2E9Q A;  4AEJ A;  3ZYP A;  1VMJ A;  4YZ5 A;  2BUK A;  3F2Z A;  4QMA A;  1TMF 2;  3HL8 A;  4ES9 A;  5FY1 A;  4ZZ5 A;  1XNA A;  3USS A;  2B7M A;  3R0R A;  4GJY A;  4CRQ A;  1BYH A;  4XW3 A;  4F8A A;  3V0A B;  1TQ5 A;  5ACA 1;  4JX0 A;  4RHV 3;  1K12 A;  1BEV 2;  3TAY A;  3TEZ A;  1QJF A;  2QQJ A;  3O1P A;  4JKK A;  4CP9 B;  1KDK A;  1HW5 A;  1D2S A;  4QPG C;  1Q9X A;  5SV5 A;  1V00 A;  1G9D A;  3M1H A;  1X82 A;  4K6B A;  3LPG A;  5EZW A;  4PQ9 A;  1C8M 2;  5FZH A;  2BWC A;  5FQ0 B;  1LGC A;  1XVG E;  3K3N A;  4C1X A;  4QPI A;  3VKM A;  1ENQ A;  4YGD A;  3SVI A;  4MGY E;  3WNP A;  3SQ1 A;  1H6Y A;  3R05 A;  2W52 A;  3SI6 A;  3NNJ A;  1QWR A;  4UAP A;  3J8F 1;  4L11 A;  4UBG A;  4KU8 A;  5DUU A;  1G9F A;  5I0T A;  2H6B A;  3TN9 3;  2D97 A;  3ZN6 A;  3WP6 A;  5M0T A;  1GQH A;  4O65 A;  4LT5 A;  2JDN A;  3OBZ A;  2AC1 A;  4HXC A;  4D6Q A;  1I5P A;  1VBA 2;  1Q8V A;  1NOV A;  2WSV A;  5DMY A;  4CCE A;  1JYT A;  1QOS A;  3QEI A;  2PFW A;  4XIO A;  3T2P A;  3ZXL A;  5D2A A;  1JZ2 A;  2GN7 A;  1OA4 A;  4EN7 B;  5LBF A;  4MGZ E;  4XTP A;  4DUV A;  1Q8S A;  3VBO C;  3UO3 A;  1XJA A;  5JIU A;  4B29 A;  2Q1F A;  1OF3 A;  4IV3 B;  1W3V A;  4ZKT B;  5LA9 A;  4UWD A;  4YZ1 A;  4LUM A;  4EN0 A;  3U37 A;  1AXY A;  1BHG A;  1J58 A;  3UNP A;  4YW5 A;  2R07 1;  4COW A;  4MGK E;  4YW1 A;  4OVE A;  4DUW A;  1UOF A;  2OX0 A;  5C5T A;  4CEW A;  1JS9 A;  4UW5 A;  4WM8 A;  5FZE A;  4UW4 A;  4PCR A;  1IPK A;  1NYW A;  2RKH A;  3AZX A;  4NHY A;  2K46 A;  2PQS A;  4CSW A;  1MS5 A;  1IH7 A;  2DYC A;  3ASI A;  4YYO A;  5L9V A;  2JHP A;  2D6K A;  4SBV A;  5BPX A;  2P6H A;  4Y4R A;  3IZO A;  3LZI A;  4YFZ A;  2J1T A;  2Y6K A;  5JOZ A;  1NZC A;  5C3R A;  2V4A A;  2CU5 A;  1BMV 2;  1SQ4 A;  4UFM A;  4IV1 A;  2VXR A;  1C1L A;  1SG3 A;  3KQ4 B;  2EXI A;  2XBO 3;  4YVS A;  5E8A A;  5L73 A;  3OD0 A;  1NCQ A;  1GNH A;  5FPB A;  2ZA9 A;  3NQH A;  2PHL A;  2MNG A;  5A3P A;  1NA1 C;  1LUL A;  2FDI A;  4R9A A;  3LZZ A;  3USU A;  1XSR A;  1WA4 A;  4XE9 A;  4YZ3 A;  1JN2 P;  1C5I A;  1OPM A;  1FZH E;  1OI6 A;  2BDR A;  2Y26 A;  2ZMK A;  3EXU A;  4CUG A;  2PLV 1;  1BQP A;  4Q4X 1;  3GNE A;  2VE1 A;  3CFP A;  4FFH A;  3SC7 X;  2CNA A;  5IVE A;  5T54 A;  5FZL A;  1BJQ A;  4M3W A;  3HQR A;  5FUI A;  2QQO A;  2RHP A;  1VBD 3;  4AGV A;  1VB4 A;  1LNS A;  2HWC 3;  4GH4 A;  2A3W A;  2JQT A;  1GBG A;  3WNL A;  2W47 A;  3UK9 A;  5FOB B;  3FN9 A;  2XUM A;  1HJF A;  2C9K A;  2WA3 A;  4HCC A;  2B4K A;  4DQA A;  4AED C;  4XDO A;  4CA9 A;  1QOO A;  3LZJ A;  2ADE A;  2ZS6 B;  1HQW A;  3GXU A;  2W9X A;  3VBR B;  1H1M A;  1PIV 1;  3VKF C;  2W92 A;  1OC1 A;  1YO8 A;  5DAW A;  2ID4 A;  1RVF 2;  3MIC A;  1XU5 E;  2EXJ A;  4PIX A;  3ZYH A;  1C28 A;  1ND2 C;  1LEM A;  3NNF A;  4S2G A;  1WLW A;  2A5Z A;  2W68 A;  4M3C F;  5DAP A;  4DO0 A;  4FT8 A;  1TME 1;  2MHF A;  4C0B A;  3AZV A;  5F3G A;  4GMP 1;  2IZW A;  4IES A;  4GMP 0;  2ZGK A;  1BBT 2;  3POS A;  4BM8 A;  1QHD A;  1JI6 A;  5DG2 A;  5A7Q A;  5I8T A;  2E63 A;  3OGM B;  1IS5 A;  5H9P A;  4XQ4 A;  5BXX A;  1YI9 A;  3VL9 A;  4C1W A;  1Y43 B;  1DQ1 A;  1W3X A;  1HDK A;  3N7M A;  2DVB A;  4M42 A;  1XNK A;  2RM2 1;  3MHZ A;  4UOJ A;  3S6P A;  2DFB A;  2A6V A;  2CSG A;  3KT1 A;  1N1S A;  3NCI A;  2FDJ A;  4M01 A;  2UU8 A;  4DXS A;  4ONU A;  5A7P A;  5JPN B;  4LBN A;  2HWF 3;  5JXG A;  3FZ3 A;  1UX6 A;  4UYB A;  1NXM A;  1W6N A;  4MHU A;  5F2W A;  3KWV A;  1GOF A;  1WW6 A;  2JD4 A;  2W1Q A;  1QXJ A;  4ASM B;  1XYN A;  4Q4Y 3;  5CZK A;  3ZFG B;  4BQX A;  2NYY A;  3S7I A;  4L2N A;  1D4M 1;  5KC6 A;  3DEC A;  4I0B A;  1OA2 A;  4N53 A;  1QJY 3;  2QBX A;  2CYF A;  1QDC A;  3MF9 A;  5BNN C;  3VBS C;  1CZS A;  2WAB A;  4I30 A;  4AZZ A;  5L7O B;  2B45 X;  2OUH A;  5EJZ B;  4XJ8 A;  5H9R A;  1UKG A;  2RS1 2;  3K4A A;  2P5O A;  3WF4 A;  1RUO A;  4DXT A;  2ZZQ A;  4J2D A;  2AAC A;  3LB9 A;  2YMZ A;  4ERO A;  3GJA A;  3FHQ A;  5A33 A;  2B9V A;  1Q56 A;  3DYO A;  4Q4V 2;  1S0I A;  4OMC A;  4YW4 A;  5ABJ A;  1XE8 A;  2EIG A;  3ZXD A;  1AR9 3;  1ZBE 1;  3MFA A;  2WT2 A;  1OF4 A;  3VDB A;  4P9L A;  1UXZ A;  1YFY A;  5DDJ 3;  4KH9 A;  4K1Z A;  2PAE A;  4BQ4 A;  2I2S A;  2WFF 1;  1GV9 A;  4XUR A;  1NCR A;  4KGG A;  2B8M A;  2OW4 A;  4D7T A;  4Y1Y A;  2Q1M A;  5FYY A;  5C3P A;  4UXA A;  1GMM A;  1R08 1;  2GAU A;  3C3V A;  1SLC A;  2P34 A;  1HKD A;  1XBF A;  2C24 A;  3IN9 A;  4J1W A;  4FJ9 A;  1AR8 1;  4PDW A;  1AF9 A;  3SIT A;  4YM0 A;  3E6B A;  3I2K A;  1CPN A;  3LF7 A;  3ZSM A;  3SNM A;  3SEP A;  4AAX A;  4W4Z A;  1PK6 C;  3WHT A;  1OUS A;  2BQP A;  2DCK A;  2WS9 2;  4M0H A;  2KD7 A;  4Q4W 2;  3NKT A;  2VZR A;  5FPL A;  3X29 B;  3ZFE C;  3R6S A;  4MSV A;  1S0F A;  4E8C A;  2XGX A;  1NZI A;  4RS5 A;  1U5Y A;  4M0N A;  1VR3 A;  3M7A A;  4BQ2 A;  5A3T A;  4Q1R A;  5GLT A;  1E57 A;  1W6Q A;  3IPV B;  1FMD 2;  2XL9 A;  2ZAC A;  4OI4 A;  5C9A C;  3ES1 A;  4I02 A;  2MW2 A;  1JHJ A;  1PO2 3;  1DGR A;  3LOB A;  2J1V A;  4BWO A;  1Y7B A;  5CNA A;  1XPW A;  3I3D A;  5GLU A;  1HXS 3;  3ACI A;  3GBW A;  1SHW B;  1XE0 A;  3AP4 A;  1G86 A;  1XVC E;  4GA9 A;  1UOJ A;  3CHX A;  1IOA A;  3SH5 A;  4Q27 A;  4ZU5 A;  2R6Q A;  1ND3 C;  5FDB A;  3BTA A;  3APB A;  5F37 A;  4X8P A;  5FYU A;  3HEI A;  1REF A;  5EFU A;  1FXZ A;  1UF2 C;  4MG2 A;  2F17 A;  3UV9 A;  3DF0 A;  3AKR A;  3SEE A;  1T6B X;  3RDI A;  4RHV 2;  1NQJ A;  3B00 A;  1O3R A;  3MDP A;  3OUI A;  1ZRE A;  1JUH A;  1S0D A;  2VME A;  4E8D A;  1XC6 A;  2FBE A;  2RE9 A;  1H6X A;  1GIC A;  2ATF A;  2IVI B;  2YGL A;  1RUN A;  1SLT A;  4CDU C;  3D6E A;  2ZTN A;  3CEW A;  1RUI 1;  2XJU A;  1WD4 A;  5IK4 A;  4S2D A;  1Z7S 1;  3AMM A;  4M45 A;  3I59 B;  4LHN A;  4DTO A;  2ZOE B;  4H7M A;  5F6L B;  4Z82 A;  3AC0 A;  3GCX A;  3MLL A;  2ZZJ A;  4QPY A;  5K9Y A;  1OKQ A;  1ULE A;  1OLR A;  5IAT A;  4B08 A;  1Y4W A;  2XWJ B;  1J59 A;  2LF3 A;  3SCX A;  3KV5 A;  1STM A;  4XUT A;  5FZD A;  3TN9 2;  4FPL A;  5AFB A;  4AKH A;  3K4D A;  4OI0 A;  4OHW A;  3OGS A;  4DZG A;  4GWJ A;  4J6G A;  2GNT A;  2DTY A;  2AR6 A;  3MBW A;  4GKY A;  2Q8E A;  1LOE A;  1IKQ A;  3WW2 A;  1NUK A;  2Y0I A;  5FBZ A;  2ZGP A;  1LGN A;  2UYA A;  4GJZ A;  2XOM A;  4QKF A;  2SLI A;  1S55 A;  3C7E A;  2GMM A;  5FMB A;  2A6W A;  4QPG A;  2JIG A;  3W58 A;  3WG2 A;  3VB9 A;  5CFD B;  1W8Z A;  1A8M A;  2BNM A;  2RJK A;  2XH6 A;  4OMD A;  2PAM A;  1YIF A;  1H30 A;  1KD7 A;  3W9A A;  5HI0 A;  3WCR A;  5LBB A;  2QJV A;  2HH9 A;  3UKT A;  1ASJ 3;  1V6K A;  1XMF E;  4O61 A;  1ZX5 A;  3LDR A;  4OQ9 A;  4QQO A;  1I5Z A;  1V0A A;  2VZ3 A;  4HOO A;  2FCV A;  1AYM 1;  3EQE A;  1LHV A;  2WQ4 A;  4GB3 1;  3QNO A;  1GLH A;  3ZDS A;  5GM0 A;  3THD A;  4M4P A;  4LOR A;  2WZP P;  2WNU B;  1OUX A;  3O1T A;  5F5I A;  4A6S A;  4ICG C;  1DQ4 A;  3KGZ A;  2WZR 1;  2AEZ A;  2LAL A;  5BNO B;  1CR7 A;  2QQL A;  5CAD A;  4LK7 A;  1GZ9 A;  1XL3 C;  2Y38 A;  3A0K A;  1OHF A;  4M3U A;  3O1O A;  2P3Y A;  1PX3 A;  3CL1 A;  3UKV A;  2IXJ A;  4CEY B;  1ENX A;  3OB8 A;  3RNS A;  2X05 A;  3AFK A;  2CGN A;  4W50 A;  2OVP B;  2JX9 A;  2WO7 A;  2WZE A;  2XKO A;  4Y24 A;  5FZ9 A;  5C4W C;  5IT6 A;  1SCR A;  4JCK A;  2W46 A;  3NNL A;  4DXZ A;  4KI4 A;  3CU7 A;  3FE5 A;  4E4D X;  4RQP C;  3P3P A;  4NO4 A;  4QU2 A;  2UUR A;  3TAE A;  4P9I A;  3MLJ A;  5J98 B;  1RUD 1;  3OUH A;  5APA A;  4DB5 A;  5CFC B;  3K4Z A;  4JHZ A;  3M8L A;  3SPY A;  3LWC A;  1VBD 2;  4QT6 A;  1UY2 A;  1VBE 3;  1WUV A;  2HWC 2;  2GNB A;  4QDR A;  4F7Z A;  5FWJ A;  4M3T A;  3PU3 A;  3GZA A;  4F83 A;  3A22 A;  1I3H A;  4JV4 A;  5GZG A;  1UY3 A;  3Q8F A;  5FZ6 A;  5JUV A;  5LK5 A;  1S2B A;  1RUJ 3;  1AR7 2;  2ZEY A;  3OPT A;  2DY4 A;  5DQ0 A;  1SPP B;  5J1X A;  4QHB A;  3V7D B;  1IS4 A;  4GKX A;  3A7Q A;  2ZHN A;  4CUB A;  1BMV 1;  4IT5 A;  5JMO A;  3KV6 A;  5CIS A;  1K3I A;  4OLL A;  4IE0 A;  5GKA C;  2DU1 A;  3LEI A;  3N7L A;  4IW3 A;  3MEP A;  3FHI B;  3N1E A;  2H6C A;  4QPI C;  3VBH B;  3A0N A;  5I91 A;  3OYW A;  4FXG B;  4XMI A;  3KVA A;  3TNP B;  2J1E A;  5KXB A;  2PN5 A;  3WG4 A;  2Q8D A;  1FYU A;  3PTR B;  3H3L A;  4RR3 B;  3IAQ A;  2OKX A;  4CDX A;  2VCC A;  3H3Z A;  4XAC A;  4K8F A;  3ALQ A;  3OBA A;  4KQ7 A;  3K77 A;  4YFW A;  5CYY A;  2PHT A;  3D3A A;  2BVB A;  1QH7 A;  1IHM A;  1IPS A;  4HPK A;  5F8P A;  1N1V A;  3SQ2 A;  3LA3 A;  4LBO A;  2PHU A;  4Q0V A;  5ERL A;  2JDM A;  2QNK A;  4KWU A;  4TWT A;  3QET A;  3QEP A;  1OOP C;  3ZFE B;  4ES8 A;  1UU5 A;  1PGW 2;  2HKX A;  2VNO A;  3GCW A;  4B3N A;  2OVR B;  4MOA A;  4YPJ A;  3SUP A;  3U4S A;  2P5B A;  1ND2 A;  2VCM A;  2EAL A;  1DFQ A;  2MMB A;  3HNY M;  3KVB A;  1R09 3;  4Q4Y 2;  4UF0 A;  3JUU A;  1A34 A;  2ERF A;  2RDQ A;  5A7S A;  4DEQ A;  1QJY 2;  3L2O B;  4TLG A;  2G9Z A;  1OQ1 A;  4HK9 A;  5IVJ A;  4AVS A;  2JE8 A;  1ZZ6 A;  4LKD A;  2QXF A;  2VM9 A;  3KS7 A;  3IDA A;  4EN6 B;  3JXS A;  4MUV A;  1T2X A;  4FPH A;  4P00 B;  1K5M A;  2YYO A;  2XVK A;  1ND3 B;  2A6Z A;  1L7L A;  2NZ9 A;  2OII A;  4LBK A;  4NHM A;  2A73 B;  1PM4 A;  2JB8 A;  1XOY A;  4XF3 A;  3THC A;  1XU1 A;  3OG2 A;  5FJK A;  2AYH A;  4YM1 A;  4Q8K A;  3LDK A;  4RNG A;  1DQ0 A;  4M3R A;  2R30 A;  4B7K A;  1CJD A;  1AR9 2;  3ACF A;  1JHN A;  4XFI A;  1WLT A;  1QNY A;  2VZQ A;  1V6J A;  3MW3 A;  5DDJ 2;  4IV1 C;  3U11 A;  1TEI A;  2CV6 A;  2DBI A;  1UZV A;  3AFG A;  4FJX A;  4I2O A;  2MEV 1;  1JZ6 A;  3WW1 A;  5FZB A;  4FFI A;  1W6O A;  2D98 A;  5FMD A;  3PLQ A;  5A32 B;  2ES3 A;  2YU1 A;  3WY6 A;  5BNN A;  4FFG A;  1PVC 1;  3VBU B;  2XJQ A;  2VNR A;  3VBS A;  4DY3 A;  1ULC A;  3LSE A;  5FXX A;  1VB2 A;  5K8S A;  1FOD 2;  1SLB A;  1KS4 A;  2D6P A;  1KFU L;  3AL6 A;  4BIF A;  1QOT A;  3I3M A;  1ALY A;  2RR1 3;  1H2K A;  1JBC A;  2W87 A;  4QPW A;  2XQX A;  4BQ3 A;  3U1X A;  1YQ8 A;  4QD2 A;  4V2V A;  1QXR A;  5LCW L;  4DTR A;  2WII B;  1MS9 A;  2FCT A;  4AEK A;  1Y9Q A;  1FZ5 E;  1CIY A;  4M3C B;  4NRM A;  3ZFF B;  4UFI A;  4DTU A;  1O8P A;  3WDT A;  2O0O A;  1L7Q A;  1LOF C;  3FLP A;  2WLQ A;  4WM7 C;  3VDA A;  5BY5 A;  2EIE A;  3U0Z A;  2PA7 A;  2V73 A;  4XTM A;  5GZD A;  1EV1 2;  2WRA A;  3CJX A;  1PO2 2;  3KD1 E;  2VMH A;  2ZKN A;  3I8T A;  5A1A A;  3N9N A;  1HXS 2;  4C8D A;  4DU3 A;  1N3O A;  3RMD A;  4XUQ A;  4GXL A;  5JZG C;  3V56 A;  4XFA A;  4MGS A;  4AGR A;  5HXV A;  3P5B A;  3HNB M;  3NL1 A;  1DU3 D;  5LRS A;  2UY9 A;  5FXV A;  1QJE A;  2QQK A;  5FMO L;  3VN4 A;  4BIS A;  5FZF A;  2X5I A;  3NHG A;  1PK6 A;  2VNG A;  1NLS A;  1PZ8 A;  2OPW A;  4LIU A;  4XAB A;  3VBF B;  1J3R A;  4BA6 A;  1O3T A;  4A3X A;  4XF0 A;  1ULD A;  2VUJ A;  5EXO A;  3IDE A;  4A7Y A;  1G9C A;  3MID A;  3RRD A;  4ARY A;  5FAX A;  3WEZ A;  4BU2 A;  4CCC A;  1BLZ A;  3WT3 A;  1BK0 A;  1CAU B;  3K75 B;  1W06 A;  1Z78 A;  4TTG A;  1WLC A;  3EHK A;  3D5O A;  4MO3 M;  3J8F 3;  4AFD A;  5EJ3 A;  3MPB A;  3HBZ A;  5C9A A;  4QX0 A;  4GWI A;  1NY7 1;  2WFP A;  5EWS A;  4Y22 A;  1ZRI A;  2BNO A;  4ISR A;  3IT8 A;  5JMC A;  5AVP A;  2AGS A;  2BGC A;  4XZU G;  4YNI A;  2GMP A;  4N53 C;  1BXH A;  1W9T A;  2GDF A;  2WZ8 A;  4RA0 A;  3M4F A;  3CDZ B;  2G9F A;  1KDM A;  2J1A A;  3AKT A;  3MFC A;  3RI9 A;  2XON A;  1PO1 3;  2A6Y A;  3MYX A;  1UY0 A;  4QDQ A;  3LDB A;  5KWR A;  4IL7 A;  4LUK A;  3BU0 A;  1Q8P A;  1QJX 3;  4IND A;  2ZAA A;  5FBJ A;  3GZE A;  1IZ3 A;  1W8H A;  3O1M A;  3KD5 E;  5CG9 A;  3PNA A;  2P3J A;  2VQ0 A;  4ZPI A;  4MAD A;  2ZGN A;  1VBC 1;  5F3I A;  1FPN 2;  1KXG A;  4FCA A;  4K3U A;  1YCI A;  2R06 1;  4CDU A;  3S30 A;  2ATQ A;  4FJL A;  2R07 3;  3EB7 A;  1A6C A;  1QQP 3;  3MV0 1;  4LLO A;  5C8W A;  1RUH 1;  3ENR A;  2WO1 A;  2HEV F;  1ASJ 2;  5A3O A;  5I0D A;  1RMU 1;  1RHI 2;  3AYD A;  3LIG A;  2JE7 A;  4CDQ C;  4Q8L A;  2D3S A;  4QB1 A;  3INA A;  4KI5 M;  4S2F A;  1US3 A;  4NE9 A;  1OD5 A;  1KGY A;  1UY1 A;  3H9A A;  4WV8 A;  4XAE A;  1HB4 A;  3URF A;  2BRT A;  1DZT A;  4COV A;  1YI7 A;  2BOJ A;  2XB6 C;  4QPI B;  3BU7 A;  4IQP A;  3N7J A;  4KHU A;  2BBA A;  1C8N A;  1PX4 A;  3GBF A;  4HN1 A;  3LFI A;  4PDW C;  2RJL A;  3WOG A;  2W1S A;  1ST8 A;  2VMF A;  2WN2 A;  5KHJ A;  3ZN6 B;  1VRB A;  2ZEZ A;  4XZP A;  2JDZ A;  1X36 A;  2WO3 A;  1IG9 A;  1TMF 1;  1ONA A;  1UWW A;  3IDB B;  3N35 A;  3PVO A;  4MGT A;  1YUD A;  2JDA A;  4HN0 A;  1HV0 A;  1W2N A;  1CX4 A;  4YGC A;  4BQ5 A;  4Q29 A;  1QXP A;  1ACC A;  1OKO A;  2PLV 3;  4W6W A;  2ZJC A;  3S57 A;  2DTU A;  4ZU4 A;  5FMO S;  2OQ6 A;  3LPF A;  4OFG A;  3RJR A;  4AFB A;  4KGQ A;  4LMF A;  4AI0 A;  3O1V A;  3QH6 A;  3NV4 A;  4AKG A;  2B5H A;  5T55 A;  1H9W A;  4NHX A;  3WV6 A;  1C8M 1;  1NQD A;  4XJW A;  3P6B A;  3WP5 A;  3J7L A;  2P3K A;  2IFR A;  4M4R A;  1VBE 2;  1GUI A;  3ZYR A;  4E27 A;  4FJK A;  4CEW B;  1S4C A;  1WAJ A;  4WM8 B;  4W8J A;  1FZ6 E;  2DCY A;  2XLG A;  3E6D A;  1H4H A;  4NID A;  5H9S A;  5F1R A;  2EF6 A;  1JOB A;  2F4L A;  4AR2 A;  4DFS A;  5FXZ A;  1RUJ 2;  2JDP A;  5C6C A;  2ZEX A;  3ZSJ A;  4HSL A;  1TME 3;  1RGS A;  2XLA A;  1VBA 1;  3B01 A;  4GMP 3;  5C4W A;  4AG4 A;  4R9D A;  2YGM A;  4G3Y C;  1WLD A;  3BOD A;  3OTF A;  2VD7 A;  4YVS B;  4AI1 A;  3MIG A;  3AJZ A;  4RQP A;  1NCQ B;  3RZJ A;  2ZEW A;  1DF0 A;  1DGR N;  3O0V A;  2VMD A;  4B7E A;  3USU B;  2CY6 A;  2RM2 3;  4DU1 A;  3AXD A;  4UW6 A;  5FUP A;  1W6M A;  3L0M A;  4DMI A;  1HIX A;  2AEY A;  3S7E A;  4LLF A;  3H7Y A;  4LOS A;  4LQR A;  5FZC A;  3VDD C;  3GHM A;  4JGZ A;  4D94 A;  1F8V A;  3PIG A;  4LIV A;  3AVS A;  4GH4 B;  1DG6 A;  1QJZ A;  3IB3 A;  4LO6 B;  4E2Q A;  3GM8 A;  1YWK A;  3OF1 A;  1MS1 A;  3RQ0 A;  1IPJ A;  2Y6J A;  1D4M 3;  4QXK A;  3ZSK A;  4CP0 A;  1O7F A;  4V1P A;  4BQ1 A;  2RMU 3;  1R09 2;  2GC1 A;  3UGG A;  4E9K A;  2WO2 A;  3C7H A;  3E97 A;  1C5H A;  1NAE A;  5T52 A;  3T1L A;  1JOD A;  4QM8 A;  1S0C A;  5C8C C;  2DCT A;  1W2A X;  4N43 A;  3VL8 A;  1CZV A;  1TG7 A;  1DBN A;  3KT7 A;  4CCJ A;  1IG3 A;  5FP9 A;  3I7D A;  4AI2 A;  1XXN A;  4MET A;  1APN A;  4AFM A;  1XVB E;  1P8J A;  5LBE A;  1FYZ E;  3WX5 A;  1TNR A;  5E88 A;  2DV9 A;  2HJI A;  2GH8 A;  2OZ6 A;  4LA3 A;  2OA2 A;  2QQW A;  2JDH A;  2VBB A;  3ZXJ A;  1ZBE 3;  3PVN A;  5FKC A;  4B1L A;  2JG8 C;  4LHK A;  4YGE A;  5FYM A;  3UJQ A;  4B8E A;  1UYP A;  2XML A;  1ZZ9 A;  3G7D A;  1C57 A;  2E32 A;  1LHO A;  4BQW A;  4BZ4 A;  5GLV A;  4LOT A;  1OOP A;  3ETQ A;  3L2H A;  2JH9 A;  4CVU A;  1NKG A;  1WMX A;  4KWL A;  3C7O A;  4CP1 A;  4FFF A;  4WVV A;  2A3Y A;  4MGI E;  3N9O A;  1PNF A;  3UES A;  5A6Q A;  4GUL A;  1W6N B;  2E51 A;  1AR8 3;  3MO4 A;  2ZGO A;  2HWB 1;  1RB8 G;  4MX3 A;  1MHZ G;  2BFU L;  4NPM A;  4QGL A;  3WQ7 A;  1DGW A;  4WZF A;  2VW0 A;  1OXC A;  2RJ2 A;  2J1U A;  1RC6 A;  1FZI E;  4L97 A;  2B7Y A;  3UET A;  4FO9 A;  4DOU A;  1AX2 A;  5FYB A;  2RR1 2;  5K0U B;  4ZU7 A;  2P1P B;  1Q5O A;  1BBT 1;  3NWK A;  4FK0 A;  4NRQ A;  4Z2W A;  5A80 A;  1RED A;  4KBZ A;  2XLF A;  5FK8 A;  3KCC A;  2ARE A;  2WNO A;  1WMF A;  1LOC A;  4B1M A;  2DVA A;  1CZT A;  4RG8 A;  3NV3 A;  3R4U A;  4PF5 A;  4JGY A;  1UX7 A;  4FBF A;  4DRV A;  3WW3 A;  1CAW A;  5A33 B;  5DAX A;  2OZJ A;  2JIJ A;  4AI9 A;  4D3W A;  4N9I A;  4QB6 A;  1W2T A;  2EAK A;  2YC2 A;  4LHL A;  5ABJ B;  1QF3 A;  2I74 A;  1ULP A;  1RTV A;  1ZM1 A;  4AL9 A;  5C3S A;  2FDH A;  3JBG 3;  3V65 A;  4Z92 B;  3UIQ A;  2GZW A;  4YAR A;  3U75 A;  3ILR A;  4PBO A;  3KQR A;  4XFG A;  3CLP A;  2RDN A;  3HN1 A;  2XXZ A;  3KHC A;  4Y4Y A;  3NAP C;  1DQ6 A;  1NCR B;  2Y34 A;  5CKQ A;  3ZYJ B;  4E4S A;  3K51 A;  2XDV A;  4N7I A;  4XXP A;  1NEX B;  3ZR5 A;  4JDO A;  4PI2 A;  2XVL A;  3ZM8 A;  1GFF 2;  3ZVX A;  4HG6 B;  5EPA A;  5FPU A;  2IUW A;  1GP4 A;  5FO7 B;  1XSQ A;  1AR6 3;  3SUO A;  1CAV B;  2HWE 3;  3VKN A;  3IIA A;  1QIQ A;  5A7W A;  3T2O A;  5BUV A;  1JYV A;  3J26 N;  4FJ8 A;  1CJP A;  2VBP A;  4CDX C;  4KHQ A;  5H37 A;  3CJI B;  2CWS A;  4YSF A;  2VQU A;  2RS1 1;  4FPK A;  1O5L A;  4AK3 A;  3U4X A;  1W9F A;  1Z7S 3;  5FUN A;  3VKO A;  1UZW A;  1HB3 A;  5FO9 B;  5IHR A;  3HP9 A;  1GYK A;  3GJB A;  4BJ0 A;  5HCA A;  1LOF A;  2K2S A;  2WT0 A;  1POV 0;  1UQX A;  4QKN A;  4WM7 A;  1UIJ A;  2VUL A;  3SJJ A;  3J8F 2;  3B9I A;  5DUX A;  4RS5 B;  1GOH A;  5GZC A;  2BPA 2;  1F5J A;  4RFT 0;  1BZW A;  1W6Q B;  3Q8C A;  5A3M A;  5JR2 A;  2J1S A;  4Y5Z 0;  4A6O A;  4Y20 A;  1OLM E;  5JZG A;  2VOT A;  5IYY A;  3TEX A;  5JXH A;  4PF1 A;  4XDP A;  3QH7 A;  5IW0 A;  3SKJ E;  2K5S A;  2HWD 1;  3A23 A;  1BVP 1;  3ABZ A;  3T3Y A;  1PO1 2;  3V64 A;  4QNC A;  4BK4 A;  1G6N A;  5D8A A;  3M70 A;  4RSU A;  1QJX 2;  1RYY A;  1K5M C;  3RZK A;  3IKW A;  4I3P A;  2WNV B;  2XPJ A;  2BFU S;  2E33 A;  1AJK A;  1SMV A;  1MS0 A;  4D0Q A;  1O8S A;  4AQ2 A;  2R07 2;  5LA0 A;  1QQP 2;  4LBL A;  2WS9 1;  1Q9Y A;  2JEC A;  2VCA A;  4FAG A;  4BMB A;  1H2N A;  3BI3 A;  4GB3 3;  1F4H A;  4LK6 A;  1UZY A;  4FJJ A;  3H7J A;  4QAW A;  5EIY B;  4OUE A;  1UOG A;  1YJK A;  5FPZ A;  2R04 3;  3ZSL A;  3VV1 A;  1LU2 A;  3GGL A;  5HCF A;  1AL2 1;  3CNA A;  4EJR A;  4Z2A A;  3WUC A;  4FOQ A;  1ZNP A;  5F5Q A;  1J3Q A;  4UT5 A;  4OUM A;  3WNM A;  3CO2 A;  1TVG A;  2XVG A;  2GSY A;  3I3Q A;  1O6U A;  1HRV 1;  3POE A;  2VQT A;  2ADD A;  1V6N A;  4BCU A;  4EN9 B;  3O1U A;  1OQD A;  1YQ2 A;  1RL3 A;  3NJV A;  3HD8 B;  4P9G A;  3NKG A;  4UFK A;  4NR1 A;  4DY5 A;  3KF3 A;  3MIE A;  3BTY A;  1E5R A;  3DKQ A;  1Z0H A;  4QWN A;  4OHY A;  5ANQ A;  2OYQ A;  4KMQ A;  1WCU A;  5G04 L;  1FZ0 E;  4AI3 A;  5F3C A;  3MIH A;  4M3C E;  1LEC A;  1EUT A;  1VAL A;  1HN0 A;  3ILF A;  2IXL A;  4P9J A;  4LO4 B;  5FY4 A;  2VGD A;  1IKP A;  1LTE A;  2PLV 2;  1W99 A;  3H1Y A;  2LF6 A;  1GAN A;  4QX1 A;  1XNT A;  4QPG B;  1RUD 3;  3B93 A;  3PTY A;  5FPV A;  4A42 A;  3VHO A;  3SUN A;  4CDQ A;  1EY2 A;  2RS3 3;  1X8M A;  2D40 A;  1US2 A;  1DYO A;  2MZW B;  2PHX A;  2UWA A;  3AMN A;  3POW A;  4ATE A;  1G9B A;  4GD4 A;  5GLZ A;  3DXT A;  4LR4 A;  3H0O A;  2W39 A;  5FRA A;  4NWW A;  1IG0 A;  1LHN A;  2WQ8 A;  3DXU A;  1AXZ A;  3TBD A;  4ARX A;  3UL2 A;  2BBV A;  3LEM A;  1ENS A;  1RUF 3;  3ZXF A;  3TN9 1;  1LOB A;  1REE A;  2X5I C;  1A3K A;  4JDN A;  4FOY A;  4BK5 A;  3C7F A;  4XIK A;  2VG9 A;  4W6X A;  3ZN5 A;  4PLN A;  3U10 A;  4JRP A;  3WNO A;  3ZO0 B;  3N4M A;  1ZRC A;  2ZMN A;  2PHR A;  1MVQ A;  3AP6 A;  4H55 A;  2GH2 A;  3VBO B;  3OJB A;  3Q8E A;  2ZCW A;  2R49 A;  1JYC A;  3ZXA C;  4DTN A;  4FPC A;  3ZKU A;  3HIF A;  2RM2 2;  3GF6 A;  1VIW B;  1JXN A;  3B9C A;  3Q8A A;  5IVF A;  3BIE A;  1MTY G;  2CL2 A;  2VZS A;  1UMH A;  1QKQ A;  3NVC A;  1SLL A;  5DUW A;  4R9B A;  1ODM A;  2LUW A;  3SH3 A;  4IUG A;  4ASK A;  1R1A 1;  1C3H A;  1LKN A;  2ARX A;  1YNA A;  2PXJ A;  2VMC A;  4BXS V;  2AH2 A;  5T5J A;  2JDK A;  2YZ4 A;  3L9J T;  2YBS A;  2D5H A;  1JU3 A;  3CQO A;  4YGB A;  4ZY9 A;  5B2G B;  4QGN A;  3ACH A;  1MZ6 A;  3ZXK A;  1CGP A;  3PJQ A;  1F15 A;  4XUN A;  4Q1P A;  3IMN A;  5CIR A;  1VMF A;  4HT1 T;  2CHH A;  1D4M 2;  2JJ6 A;  4CDW C;  4ZS3 A;  2XJR A;  2W94 A;  1YQ6 A;  5IAV A;  4TLF A;  2RMU 2;  3M3Q A;  3KM5 A;  3VD9 A;  4KWK A;  4E3S A;  2RV9 A;  2VJ5 A;  1COV 3;  2GP3 A;  1DLL A;  4D8M A;  1QNW A;  2HBU A;  3J27 A;  2ZHL A;  1H9P A;  2GC3 A;  1NA1 B;  5A3L A;  2LRP A;  3F95 A;  3BKZ A;  1OFN A;  2EVX A;  2W08 A;  5CEH A;  1NE4 A;  2Q1Z B;  3DPR C;  3LA7 A;  4C0H A;  4K40 A;  1KIT A;  1UZZ A;  2VBD A;  5J3U A;  3IMM A;  4MXW A;  5J09 A;  3HAG A;  3OYW B;  2D3R A;  3VDD A;  1N3Q A;  1ZBE 2;  4M00 A;  2IXH A;  3VHR A;  2FMY A;  1RUE 3;  1VBD 1;  4FVM A;  1DGW X;  1W2U A;  2HWC 1;  2P17 A;  3MLK A;  4FPJ A;  1H0B A;  4HCB A;  1SAC A;  2VO5 A;  4URA A;  5IK7 A;  2O1Q A;  3D0J A;  4XQD A;  4QX3 A;  2BWA A;  1JYI A;  2Z2S B;  4HPK B;  1EAH 1;  4DTS A;  2MEV 3;  4IE5 A;  4AED B;  5BV6 A;  4NRP A;  2E26 A;  3WD5 A;  3TL8 B;  1GZT A;  2E53 A;  4TYS A;  1QY4 A;  2ZGL A;  1AR7 1;  1AR8 2;  2VL4 A;  3I2I A;  4Q0P A;  3RWN A;  2WLP A;  3S9H A;  5HV0 A;  1ND2 B;  2W1W A;  4UF0 B;  4UFJ A;  4I0W B;  3BN6 A;  4CUC A;  4YZ4 A;  5FYV A;  5C8C A;  1ULG A;  1CD3 G;  1R1Z A;  3SCH A;  3EJK A;  1Q3E A;  3KCX A;  5SV8 A;  3MI8 A;  4FQ4 A;  1GU3 A;  3GYD A;  2D6O X;  5C3Q A;  4RGK A;  1RUG 1;  1DGL A;  4AGG A;  4HVR A;  4Y5S A;  2JG8 A;  2Y33 A;  3GBG A;  4ZS2 A;  4BYY A;  1ULO A;  4C90 A;  5AC9 3;  5JWP A;  1LR5 A;  3HT1 A;  3AYC A;  1O3S A;  3WQ0 A;  3WNX A;  1AYN 3;  3O1R A;  1VJ2 A;  2Q5T A;  2XBO 2;  1TZO A;  4OYU A;  4CCM A;  3QEW A;  2BP6 A;  2X10 A;  3JBG 2;  3C94 A;  3PL0 A;  3QER A;  1SFY A;  2BZD A;  2XJV A;  1BKZ A;  1V9U 3;  3C2U A;  1Y3T A;  3TAG A;  1JYN A;  3TNQ A;  1N1Y A;  2QCS B;  4Q4Y 1;  4QB2 A;  3M3E A;  5L9B A;  3ZKY A;  1GP5 A;  3B5L B;  3AP7 A;  3WR0 A;  1AX1 A;  4QKD A;  4UFL A;  1HQL A;  1W6O B;  4YVW C;  3BVO A;  1W8F A;  2W2I A;  4AQS A;  2OZS A;  5BNN B;  1QJY 1;  3IM0 A;  3PUR A;  2QTW B;  1GNZ A;  3J7H A;  3LEG A;  4HKO A;  4NN0 A;  3VBS B;  1XMG E;  1AR6 2;  3ZPO A;  2HWE 2;  4HFS A;  2W95 A;  5BNP C;  1GZW A;  1KS5 A;  3MW2 A;  2FD8 A;  1QEX A;  2DVF A;  4CCK A;  3JD7 1;  1ZBA 1;  2QDR A;  2NLR A;  3T08 A;  2ZX0 A;  4JGZ C;  4BDV B;  4HVQ A;  5JOY A;  1V6O A;  1Z7S 2;  1VPH A;  2IC1 A;  4GZ9 A;  4D69 A;  4K7J A;  1MR5 A;  2ET1 A;  5BNQ A;  3B02 A;  3LDS A;  1B35 C;  4ATF A;  3BOW A;  4LBQ A;  2VJX A;  3ZYI B;  2YY1 A;  2BER A;  1ZRD A;  1NX9 A;  2DVG A;  1QH6 A;  4FPF A;  5DDJ 1;  5FYH A;  5FZ8 A;  3NAP A;  3RZZ A;  1ZA4 A;  4FP2 A;  4B4R A;  1J1T A;  2WJS A;  5FFO C;  5GZE A;  2DWR A;  2Z79 A;  2UY8 A;  4IGO A;  1ZZB A;  1LOG A;  2P3I A;  3BOP A;  5IRE A;  3FJS A;  4N43 C;  3H1M A;  5FYS A;  5L7O A;  1FNY A;  4DS0 A;  3OOX A;  1URX A;  1AL0 G;  2VVF A;  1VBC 3;  1FOD 1;  1W03 A;  3T0A A;  2WT1 A;  1RUH 3;  1PK6 B;  4R9C A;  4XJZ A;  3WHU A;  1YYN A;  2JG9 C;  5I0U A;  5HCH A;  4AKI A;  1IS3 A;  2HWF 2;  5T50 A;  4FJM A;  2YRO A;  4FQZ A;  4XJU A;  5A6Y A;  5LAT A;  2ZBJ A;  5FYZ A;  5CKN A;  1F2N A;  4D7S A;  3AKP A;  3MZH A;  3ROU A;  2G9G A;  3BYW A;  1YQC A;  4FP3 A;  4LTA A;  5I8S A;  5FZ0 A;  2R04 2;  1N1T A;  3K48 A;  1Q8Q A;  3VUO A;  4LKS A;  1GWM A;  4AE2 A;  5C9A B;  2C4X A;  4AXO A;  3LCP A;  2CGP A;  3AB0 A;  4Y22 B;  1MS3 A;  2EXH A;  3J9S A;  1EV1 1;  4Y1X A;  2Q8C A;  1PO2 1;  1OSG A;  2AZ5 A;  1J3P A;  5FZO A;  5C70 A;  5CBL A;  3DV8 A;  1FZ9 E;  3H8O A;  2Y6F A;  1GWK A;  2FQP A;  5FZA A;  5DAQ A;  4Y1V A;  2OUJ A;  2GC0 A;  2VW2 A;  3AX4 A;  1JZ8 A;  2GND A;  5CFD A;  5JCT A;  4JVA A;  1H8T C;  1YXW A;  5LZ6 A;  2ZX4 A;  2JIC A;  3AZZ A;  3LGR A;  4CCO A;  2YBP A;  5JI7 A;  4N8M A;  2NQY A;  3AMQ A;  4Y5T A;  1PNG A;  1SBE A;  1KJR A;  1YRZ A;  4JGY C;  2WWJ A;  1XRU A;  3WF2 A;  1WBL A;  4LE3 A;  1M4W A;  1RUD 2;  2NMO A;  4P14 A;  4XYX A;  2NP0 A;  4YW7 A;  2HEW F;  3NRU A;  4CDU B;  5FJH A;  3U14 A;  2RS3 2;  1N47 A;  5HXM A;  1E5S A;  4EWD A;  4NIG A;  3OGL B;  1V70 A;  3S5Q A;  2XJP A;  2P6C A;  1UIK A;  3AZW A;  1VRH 1;  5IFP A;  2PMW B;  4BPZ A;  2YBK A;  1D4V B;  3N9L A;  1EYB A;  3ZYF A;  2QQP A;  4FJG A;  5FO8 B;  1RUF 2;  1UMZ A;  1VBB 1;  3AJY A;  1MEC 1;  4FTS A;  2Z5W A;  2RDR A;  5FYC A;  1XE7 A;  4QQ2 A;  4WZC A;  5I8Y A;  1U5I A;  4EZH A;  1T6G C;  5FCC A;  5DXD A;  1SFP A;  3WG1 A;  4ORF A;  3MIB A;  2C0Z A;  1OQE A;  4HKW A;  5FLH A;  4G4F A;  4V2W A;  5JOX A;  1A8D A;  2QUO A;  2D93 A;  2R1D A;  3T0B A;  1FPN 1;  1W9W A;  3M2M A;  4EV0 A;  4GAL A;  4XPV A;  3ZXG A;  2VU9 A;  3AMP A;  1H4G A;  3O0X A;  4Q0U A;  5KHG A;  4EPH A;  4XC9 A;  2OVQ B;  5C5U A;  1ASJ 1;  3BCW A;  3RYP A;  1RHI 1;  1TE1 B;  3PU8 A;  3OY8 B;  1NXD 1;  3SUQ A;  1WCS A;  4IER A;  3R4S A;  4L99 A;  4CCL A;  3SKV A;  5ACA 3;  2JPN A;  5C7G A;  3DYP A;  3QCW A;  4NPR A;  3SH4 A;  4JS5 A;  3TJY A;  1YFW A;  5LW9 A;  1JZ5 A;  4JQR A;  5D8A C;  1O91 A;  2VXJ A;  2Y8K A;  4N7U A;  4OZO A;  4Q5O A;  5I0S A;  4GAM C;  5HPO A;  2E7A A;  3DKW A;  3OGK B;  5CAZ A;  1KRI A;  2DUR A;  3C7G A;  3LD8 A;  5DG1 A;  2YB7 A;  1WCK A;  3VD7 A;  4H3W A;  4OUL A;  4CU8 A;  1COV 2;  2EIC A;  4BB3 A;  3WP4 A;  4PHZ A;  1S0B A;  3KMH A;  2CAV A;  4UI9 L;  1OFS A;  1UNB A;  2DCJ A;  3PVE A;  1XND A;  4WVW A;  5C4W B;  3OGR A;  3CMG A;  3VKL A;  4M3Y A;  1U5X A;  2BOI A;  3PVB B;  2JEN A;  3HR9 A;  1A78 A;  1UL9 A;  2QDN A;  4K1Y A;  4RQP B;  5AVA A;  2K9Z A;  4XIL A;  1YHF A;  2TNF A;  1DHK B;  3KSC A;  2JHC A;  4RL5 A;  1QMJ A;  4RR3 A;  5J7M A;  2PFV A;  4JTO A;  2Y60 A;  2W1U A;  1MQT A;  1NE6 A;  1W8T A;  2H0V A;  3MKS B;  2ARB A;  4KHY A;  4F3J A;  3KHB A;  1W6M B;  3RZG A;  1R64 A;  4XOG A;  1S2E A;  4FJ7 A;  3A4U A;  2FDK A;  1WAF A;  2DCZ A;  2WAA A;  5DZE A;  1RUE 2;  2OXB A;  4JZR A;  1EPZ A;  1VBE 1;  4E2G A;  3I49 A;  1W8W A;  4BLJ A;  1X8E A;  1HV1 A;  1RUC 1;  5FPA A;  1L3J A;  2JD9 A;  1L7R A;  1HRI 1;  3KCY A;  4HMZ A;  4A44 A;  4CDW A;  2MEV 2;  2RS5 1;  1D7P M;  4HSJ A;  4RD7 A;  1CAX A;  4A7Z A;  2W91 A;  2HWB 3;  3IBM A;  1W9Y A;  3NJX A;  3I2D A;  4IV3 C;  1PZ7 A;  3C6P B;  3WDX A;  1LGB A;  1RUJ 1;  1GOG A;  2J1R A;  4FPY A;  5LA2 A;  4BQY A;  3J2P A;  3HNM A;  1WW5 A;  1OLM A;  1JUI A;  2NPI A;  3OGJ A;  4AQ6 A;  1YQ5 A;  4FJH A;  1E5H A;  4PLO A;  3DPR A;  3VGI A;  3WF1 A;  3BPZ A;  4X6R B;  5FP8 A;  2FDG A;  5A7O A;  3T4V A;  5FPX A;  1FT9 A;  2VAU A;  2LS6 A;  1W0O A;  3M3C A;  4N43 B;  2PEL A;  5IVV A;  2EXK A;  3B94 A;  5FLI A;  1MS4 A;  3AK0 A;  3BTX A;  4EE2 A;  2QKD A;  3H3U A;  2F4P A;  4NIH A;  5AC9 2;  3RS6 A;  1QJU 1;  2VUD A;  4LO7 A;  2L9L A;  5FP4 A;  2V72 A;  1GR3 A;  2A7A A;  4P08 A;  1ZZ8 A;  4NAM A;  1AYN 2;  2DVD A;  4XF1 A;  4R4X A;  1J84 A;  5F6K A;  5KXC A;  1QU0 A;  3R4D B;  1OD3 A;  3POF A;  4B4Q A;  3OSD A;  1OOP B;  3WDY A;  1JZ4 A;  2YC4 A;  1V9U 2;  3HOB A;  1ODN A;  1BEV 1;  4Q4X 3;  3H8R A;  4YG0 A;  3NE6 A;  1Q43 A;  4KG8 A;  4ASL A;  2JEM A;  1V6L A;  4QX2 A;  1JYX A;  5J96 B;  4Q2F A;  3O12 A;  2Y64 A;  1G8W A;  5TSW A;  3K2O A;  3V0B A;  1IGO A;  4XBN A;  4MGQ A;  1FZ8 E;  4QND A;  3B69 A;  3TB0 A;  2UYB A;  4L9B A;  3ZFF A;  4YW2 A;  2VZP A;  3C95 A;  1RXF A;  4PQQ A;  4QX5 A;  3WF0 A;  2VTX A;  2EAA A;  3OBT A;  2WIN B;  4XMA A;  1BK1 A;  1MZE A;  4PI0 A;  1PIV 3;  2YV8 A;  5LK7 B;  3VBR C;  4FJ5 A;  1NY7 2;  5FWE A;  4HZF A;  4JDM A;  4CYD A;  5L19 A;  1CQ9 A;  3TOJ A;  2VH9 A;  3ST7 A;  5IZ7 A;  2PTM A;  1NLR A;  2ZHK A;  3MUZ 1;  1N3P A;  4CCD A;  2VNV A;  5FV3 A;  1W90 A;  3PUH A;  4HL0 A;  3U07 A;  4E2S A;  4IV1 B;  1UMI A;  4LHS A;  4YM3 A;  2VOV A;  5FZK A;  1RXG A;  3WVJ A;  2HWD 3;  3BVC A;  1WCQ A;  5JDB A;  4H7L A;  2DU0 A;  3FFQ A;  2JKX A;  2Y6G A;  1H2L A;  3KGL A;  1XVE E;  1D2Q A;  4LO8 A;  5F32 A;  4JRQ A;  4YVW A;  3WP3 A;  2VVD A;  4XBQ A;  2VUA A;  1UYY A;  1CON A;  1XYO A;  4EP9 A;  3VZM A;  4BOW A;  4K8R B;  3TRS B;  5BNP A;  5A6Z A;  2DEB A;  3ZOI A;  4P5H A;  3UYJ A;  2C26 A;  2YC0 A;  1KEX A;  4A2U A;  3VHP A;  1AXK A;  4FOW A;  2DF7 A;  1RUH 2;  2WS9 3;  1LAJ A;  1MAC A;  4XAA A;  4IEQ A;  1XQN A;  2V09 A;  4JTN A;  4DPN A;  2B9U A;  2ZGT A;  2ZGS A;  4YW6 A;  2YU2 A;  2NM1 A;  3P3N A;  4TXW A;  4RN5 A;  1B35 A;  4I9L A;  1AL2 3;  4E4H A;  3SIS A;  4WM7 B;  3SMH A;  4AVB A;  4JAA A;  4IDZ A;  4JHT A;  3CBN A;  2GAL A;  4KI6 A;  1HRV 3;  2GU9 A;  5C33 A;  5DPN A;  5LEK A;  2AUY A;  1HX6 A;  2F6B A;  4AW7 A;  5L7O C;  2N7G A;  4A45 A;  4CTE A;  4QQH A;  4KG0 A;  1SLA A;  3HT2 A;  3KB5 A;  3OEB A;  3LOI A;  4J25 A;  4ZON A;  5JZG B;  4Y20 B;  2QE3 A;  2ZGU A;  2P4E A;  5IK5 A;  5CU1 A;  1K45 A;  4Q0S A;  4P02 B;  5KHH A;  2OVU A;  5EJ1 B;  4R4Z A;  4HON A;  3BTZ A;  5D8A B;  1PVX A;  1JYW A;  3V0A A;  5JVV A;  1UKR A;  2JG9 A;  2VIX A;  1Y9G A;  3POG A;  4PIZ A;  4AYU A;  3QNN A;  4GQ7 A;  2JB4 A;  3BIW E;  3E5U A;  1JOP A;  1I9R A;  4FPG A;  3OPW A;  3G6J B;  4H14 A;  2WFF 3;  3KD4 A;  1SBF A;  3M3O A;  4P9W A;  4NMI A;  2VMG A;  4G9S B;  5A70 A;  1FZ2 E;  1OVS A;  3AP9 A;  4DIN B;  1R08 3;  3NGI A;  1W2O A;  2P1B A;  2KA3 A;  3MF6 A;  2G4I A;  4DNY A;  3I2H A;  1N1C A;  3H1W A;  1CN1 A;  4MYE A;  2Q0A A;  2A1X A;  1FZ3 E;  4XFC A;  1RVF 1;  5LRR A;  3QES A;  4FTB A;  2LM3 A;  1XB9 A;  3E5X A;  4HVO A;  3ZIW A;  2X29 A;  2BGO A;  4N53 B;  3KZ4 C;  2JH8 A;  2UWB A;  5KR7 A;  5B4X A;  2ZX3 A;  1AVB A;  2YXS A;  5GJ6 A;  1H8T A;  2UWC A;  4PLM A;  2ZPX A;  2R32 A;  1PO1 1;  4R52 A;  1FZ7 E;  1LOA A;  4JC1 A;  3RVH A;  4AHW A;  1QJX 1;  1UOB A;  4W6Y A;  2JWP A;  4AOC A;  2BVV A;  1Q8O A;  2D7F A;  2X53 S;  5IBK B;  4I0A A;  1XU2 A;  1JH5 A;  1VE0 A;  1OH3 A;  4X5N A;  1F31 A;  3PUS A;  4XUP A;  1JOJ A;  4IE4 A;  4LEJ A;  2OYZ A;  1OVP A;  1PGS A;  2JXA A;  1QQP 1;  3S0M A;  1CX1 A;  1R1A 3;  2ZML A;  4CDQ B;  3QOP A;  4AHY A;  3THT A;  5FOJ B;  4L0P A;  3FMG A;  4XJ9 A;  2WA4 A;  2XUE A;  3FBY A;  3NMB A;  5FYI A;  2BEO A;  4YG6 A;  5FR3 A;  5JI9 A;  1SDD B;  5ACA 2;  4KHS A;  4WVM A;  1BVV A;  1WZX A;  3GZU C;  3QEV A;  4O9E A;  4TZD A;  1OMI A;  3PME A;  5LB6 A;  5D21 A;  2W5F A;  3OGG A;  4MXV A;  4PDW B;  1X9T A;  4Q26 A;  5FXW A;  3E1F 1;  3N36 A;  4COZ A;  3QLQ A;  1CES A;  1SDW A;  3MUY 1;  2EIB A;  4IGQ A;  1GZC A;  2GC2 A;  3H8U A;  1DYP A;  1YLL A;  4QHO A;  1W6P A;  5CVR A;  1RUI 3;  3ZSE A;  2WDB A;  2XJT A;  5T5P A;  1ENR A;  4ITC A;  2LRO A;  4AWD A;  3ZLI A;  4XFH A;  4NAO A;  1O4Y A;  1POV 1;  5DZF A;  1AJO A;  1VAV A;  3LA2 A;  4FJI A;  5LA1 A;  2B1E A;  3VZJ A;  1ZA7 A;  5FY0 A;  4EQV A;  3PUA A;  1DCS A;  1X7N A;  3LE0 A;  4Q4V 1;  1W8U A;  2J42 A;  4XHX A;  4IGP A;  3LIH A;  4NIA A;  4LBQ D;  5I0R A;  4PT6 A;  5IVB A;  5LWB A;  3I3E A;  2P1M B;  4ADO A;  2CDP A;  1DLC A;  3I2F A;  2BYV E;  3EO6 A;  4AI6 A;  3N3H A;  4JKL A;  5JSO A;  4QM9 A;  5JXJ A;  1BCX A;  1WW4 A;  3WNK A;  3RWK X;  2IXC A;  3I3B A;  1EAH 3;  5CKM A;  3W59 A;  4ISQ A;  3WDV A;  3VD3 A;  5FRE A;  2J22 A;  4CP9 A;  4YZ2 A;  5CFD C;  5JLV A;  1AR7 3;  4X8N A;  2RCU A;  1OBN A;  4GWN A;  5FY7 A;  3VZL A;  2HWB 2;  3SQ0 A;  3O14 A;  5A3U A;  1B09 A;  1VAK A;  3CFR A;  3KLS A;  4UFH A;  2YFU A;  4DTM A;  3ACL A;  4URT A;  3L8B A;  1VMH A;  5FQ0 A;  1LES A;  2WQZ C;  1G9A A;  3AVR A;  2GN3 A;  1MMO G;  5FZG A;  2D3P A;  2Y6L A;  4FK4 A;  4Q4W 1;  2DDU A;  1AYM 3;  3WUD A;  3D0S A;  2FDF A;  5K7P A;  1W8N A;  4KL1 A;  4IEU A;  3NJY A;  3MIF A;  1S2K A;  2ILM A;  3DYM A;  4IEV A;  4YRD A;  5JXI A;  2VPV A;  4QXH A;  1RUG 3;  3N9Q A;  1X33 A;  1MS8 A;  2P37 A;  2WNU C;  2WZR 3;  4LPL A;  1XVD E;  4A41 A;  5KBF A;  4NHK A;  2XL7 A;  1UU6 A;  3AKQ A;  1FMD 1;  3FBM A;  3JB4 C;  4EZ4 A;  4ZHN A;  5BNO C;  2VTF A;  2VOK A;  1OPO A;  3OD4 A;  2P1O B;  3DL3 A;  2Q4S A;  2LW8 A;  1WD3 A;  4MXW B;  3TEY A;  4ZXK A;  3VDD B;  1YFX A;  4CEY C;  1OH4 A;  2YPD A;  3HMY A;  3N9P A;  5IUQ A;  2KM2 A;  2D44 A;  5GAL A;  3RMY A;  4M41 A;  1PMI A;  2XWB B;  3ILN A;  4MVT A;  2JKB A;  3LFM A;  4YWA A;  4FPO B;  3UGF A;  1PHM A;  2IXI A;  4IEZ A;  4IV3 A;  2J7M A;  1IS6 A;  3ITQ A;  4RHV 1;  1LHW A;  4Q4X 2;  5A1F A;  3FHA A;  2HBT A;  4JKM A;  1FZ4 E;  1WA6 X;  4QX8 A;  2JHA A;  2RMU 1;  5E1R A;  3L1N A;  2W3J A;  5K0U A;  3JZV A;  4KWJ A;  3O1S A;  1HB1 A;  1VAM A;  5CFC C;  3I2G A;  4FJN A;  3ES4 A;  3RSJ A;  4S2H A;  3DCQ A;  1J83 A;  3JD7 3;  1ZBA 3;  1ZYB A;  4NUB A;  5CB7 A;  4Z1V A;  5C8C B;  5L9R A;  5J37 A;  4LJH A;  3SLI A;  5E6H A;  2K0G A;  4Y1Z A;  4OI1 A;  3FLR A;  2VZ1 A;  3NST A;  4RGG A;  3ZMN A;  3T0D A;  2Z42 A;  3DUI A;  3RMB A;  4P9X A;  4D6R A;  1H2M A;  3L2Y A;  4PIY A;  2DBN A;  4DTX A;  1HN1 A;  1PIV 2;  2WSU A;  3ETP A;  3TYJ A;  3N9M A;  5G05 L;  1GQP A;  1WWY A;  5F5A A;  2JG8 B;  3JCI A;  3VDC A;  2HEY F;  3FL7 A;  5H9Q A;  3SHR A;  1TME 2;  3CZU A;  1J1L A;  4FSJ A;  2A71 A;  2YPJ A;  4AVA A;  4EYW A;  1W05 A;  1ZVF A;  2DTW A;  2WR9 A;  3DGT A;  3OBR A;  4K20 A;  1H8V A;  3W21 A;  2GME A;  4KNC A;  2HWD 2;  4XUO A;  4A3Z A;  2VTX J;  4FVV A;  1FZ1 E;  2R0F A;  3VBH C;  4QHZ A;  3HPN A;  5A7N A;  5JAX A;  3O5S A;  3IDC B;  3O7O A;  1YEW A;  1CAV A;  1FOD 3;  1GKB A;  5C71 A;  3WW4 A;  1NLQ A;  3RZH A;  4RR3 C;  1JZ3 A;  3CJI A;  4R8H A;  4EWE A;  1WW7 A;  5F39 A;  2R1B A;  3OPZ A;  1FPO A;  4YG3 A;  1MQT C;  4CCN A;  2PFT A;  4MZU A;  5J36 A;  2BJS A;  2XG3 A;  4CP2 A;  4HBN A;  1GZW B;  4JQT A;  1W0P A;  2FZ1 A;  3BGA A;  5FTT C;  5FZ7 A;  1EPW A;  3ECQ A;  3VBR A;  2HLE A;  5FIX A;  4UBH A;  4DEV A;  2Y6H A;  1GWL A;  3WQ1 A;  2PQQ A;  3RJ2 X;  3VZK A;  4U2A A;  1FI2 A;  2E7Q A;  4LBJ A;  5JR7 B;  4D7Y A;  1WCD J;  2V5Y A;  1XU3 E;  1AL2 2;  3CFO A;  3ACG A;  3LKJ A;  1SBD A;  4IEP A;  2TEP A;  3WDW A;  3ZR6 A;  5CG8 A;  1XYP A;  4CPB D;  1F4A A;  1SEF A;  1O4T A;  4EWA A;  1LU1 A;  2ARC A;  1EV1 3;  3VD5 A;  2W0X A;  2QQM A;  1HRV 2;  3J7N A;  1CVN A;  4LA2 A;  4LBQ B;  5FMC A;  2XBO 1;  4M3X A;  2VZU A;  3N1B A;  3JBG 1;  2XHN A;  3EBR A;  4H2A A;  3VLB B;  3NAP B;  3TWI A;  2DUO A;  3RYR A;  3UKN A;  1CWP A;  1D0G A;  1FNZ A;  3E5Q A;  2WL1 A;  2WNV A;  2E31 A;  3GZT B;  3MGU A;  1RJ8 A;  4XXA A;  3SQO A;  5KHK A;  5LY1 A;  4QDS A;  3NW4 A;  5JOW A;  2SBA A;  3T4H B;  2XQR A;  3U78 A;  1UXX X;  2WC2 A;  1LEN A;  2HYK A;  1AR6 1;  3LQC A;  4L8Q A;  2HWE 1;  4CDX B;  4DIQ A;  3III A;  5KXD A;  2H4T A;  3TAF A;  1FV3 A;  2ZXQ A;  3HBK A;  3NNG A;  4QQP A;  5F3E A;  5IVC A;  4IE6 A;  2OQ7 A;  2WFF 2;  1GSL A;  3POY A;  1W04 A;  3ZFG A;  1OLQ A;  4NJ4 A;  2AEN A;  4M3Z A;  5IVY A;  1S0G A;  1VRH 3;  2GP5 A;  2PHW A;  1R08 2;  2V4V A;  3UT0 A;  2VY0 A;  4TSV A;  1PVC 3;  3SCG A;  2PAK A;  2WN3 A;  3GHN A;  1W8O A;  3VBU C;  4TN7 A;  1POQ A;  1XNC A;  3ATG A;  3HJR A;  4QQL A;  4UW3 A;  5JSP A;  2D6M A;  4OQ8 A;  1VBB 3;  1MEC 3;  3S5A A;  4RL7 A;  4Y3O A;  3HGK E;  2ZGQ A;  1P22 A;  2P1N B;  1H1A A;  4WBB A;  3MW4 A;  3D82 A;  5JSR A;  3NAE A;  4OHZ A;  3ZXE A;  1XMH E;  4J2E A;  5D1I A;  4LE4 A;  3LSD A;  1GP6 A;  3OCP A;  5FZO B;  1FV2 A;  2EA7 A;  3VZO A;  4NPL A;  1MZF A;  4CZS A;  3ZFF C;  1MVE A;  4BE3 A;  5ISL A;  3VZN A;  1K5M B;  3QD6 A;  2CDO A;  2WYS A;  4NII A;  2IWG B;  2R16 A;  3W20 A;  1LRH A;  1FPN 3;  1UZ0 A;  3ME2 A;  2BTV C;  2VOX A;  3HQU A;  2CTV A;  2BNN A;  3FFZ A;  1ZZC A;  3N7K A;  3NO8 A;  4I01 A;  4RGA A;  5DN2 A;  3B3Q E;  3ON7 A;  1O4Z A;  2HWF 1;  1SFN A;  5HV4 A;  1MZ5 A;  1RHI 3;  3O0W A;  3OEA A;  3H50 A;  3POJ A;  5EYY A;  1R1A 2;  3RWU A;  3RMA A;  1FAY A;  4N9H A;  4CXW A;  5EQU A;  1DZQ A;  3FLT A;  3WDU A;  1PGW 1;  1UPS A;  4AHX A;  5FZ1 A;  2IXK A;  1PGL 2;  2WYF A;  4J1X A;  1UY4 A;  2R04 1;  3AM2 A;  4KU7 A;  4NVP A;  1IQD C;  1UW8 A;  4YW3 A;  2V5D A;  2OS2 A;  2VR4 A;  3KV9 A;  4NOT A;  1DP0 A;  2XHK A;  2LTN A;  4XHB A;  5FY5 A;  3PHM A;  2VUC A;  3VBF C;  4COU A;  5IAX A;  1YC6 1;  1YJL A;  3RZL A;  1IQA A;  2XR4 A;  3WXP A;  5I93 A;  3ZX7 A;  4CU9 A;  2E6V A;  3I97 A;  3P1I A;  3PMS A;  1RUI 2;  2YB5 A;  3VBO A;  5FZ4 A;  5A6X A;  1NT0 A;  3I2J A;  4A4A A;  1MPX A;  3H8X A;  2X8K A;  3IPV A;  2ZGM A;  4XCA A;  3WQB A;  4PBP A;  3MPP G;  4W65 A;  1S1A A;  3FC0 A;  4D6S A;  2BGP A;  4ADN A;  4FTE A;  3WIN E;  1SCS A;  2ZHM A;  1NG0 A;  1AR9 1;  4XEZ A;  2KXL A;  1QGL A;  3WNN A;  4XDQ A;  4CU7 A;  2C9A A;  2RDS A;  4AF9 A;  3JB8 A;  2A70 A;  2Q30 A;  1RIN A;  1V6I A;  2QZ2 A;  1PM7 A;  2ZX1 A;  1PZ9 A;  2RS3 1;  3CZJ A;  4GWM A;  4XCB A;  3RMC A;  3SCF A;  3QAC A;  4BXF A;  4J2B A;  1VLN A;  5F2S A;  1RUC 3;  4COY A;  2MPF A;  1HRI 3;  3AYA A;  1EAH 2;  3J4U H;  2RS5 3;  4Z07 A;  4FOV A;  4DXR A;  1UCX A;  4LIT A;  4OHX A;  4K21 A;  1YIP A;  3AKS A;  2ZKL A;  3ELN A;  1KFX L;  1RUF 1;  2R06 3;  5IJR A;  5F9T A;  3RZM A;  3RPQ A;  1ZRR A;  4IEX A;  3RGB A;  2X5I B;  4BHP A;  2YDE A;  1K42 A;  5IWF A;  1JZ7 A;  1AZD A;  3SNN A;  1JTZ X;  1NA1 A;  1RMU 3;  1UO9 A;  2FMD A;  1LOD A;  2OZM A;  3E4Y A;  2ZAB A;  4NRO A;  3I59 A;  2YHJ A;  1AYM 2;  3SPZ A;  3RFR A;  4GB3 2;  4P5Y A;  3CF6 E;  4Q0Q A;  5LAS A;  4CUA A;  5FP3 A;  2QQU A;  4B4P A;  1UN1 A;  3Q8B A;  4I9Q A;  5T5L A;  4E4Z A;  1ZRF A;  1RUG 2;  3T2Q A;  4CXY A;  3HN3 A;  1ZZ7 A;  2WZR 2;  3KV4 A;  4IEW A;  2BW8 A;  5AFE A;  4DUX A;  1O3Q A;  4I09 A;  2QZ3 A;  1V6M A;  4FXK B;  4HKL A;  1QJU 3;  4SLI A;  1RJ7 A;  3HWJ A;  2G1M A;  4AFA A;  3EMR A;  2VMI A;  2TUN A;  1TMF 3;  4HAN A;  1HXS 1;  3WSO A;  1MQT B;  5FZM A;  4AED A;  2WNE A;  3FUQ A;  2Q8O A;  3QBQ A;  5J48 A;  4FK2 A;  3NNM A;  1X9P A;  4LKF A;  1BEV 3;  5FLJ A;  3WCS A;  5FY8 A;  3I2O A;  2ENR A;  1SZB A;  4MH0 E;  4CDW B;  3HVD A;  1CAX B;  4QX7 A;  3ZYG A;  5LEJ A;  5FP7 A;  1XVF E;  1FX5 A;  3GDB A;  1F35 A;  1UD1 A;  4GIQ A;  1C8M 3;  3FWE A;  1COV 1;  3CIH A;  5E16 A;  2EID A;  2HD0 A;  3D8C A;  3A21 A;  2NMN A;  2WNU A;  2Z4F A;  5FZ3 A;  4AHZ A;  3JD7 2;  1ZBA 2;  4DU4 A;  2YUE A;  5DUV A;  2WKK A;  4CEW C;  1W0N A;  3DPR B;  4WM8 C;  5A3W A;  5FKB A;  5BNO A;  1JU4 A;  3C6O B;  2R0H A;  4DTP A;  2VC9 A;  1C1F A;  2VOW A;  3JQW A;  2O14 A;  4HLT A;  1ULF A;  4JRA A;  4LUL A;  2A75 A;  4MLO A;  3ZMO A;  2O8Q A;  4CEY A;  3WLU A;  4CE8 A;  1VBA 3;  2WBK A;  3THP A;  5DAB A;  3VD4 A;  5EV7 A;  1JW2 A;  1RUE 1;  1S0J A;  4QU1 A;  1HQN A;  3BAL A;  4RYD A;  2OT7 A;  4YVS C;  3AMH A;  3Q9O A;  1NCQ C;  3PIJ A;  3HQX A;  1AX0 A;  4I3G A;  5FK7 A;  4DRR A;  1M06 G;  1WKY A;  3FX3 A;  5CFC A;  2D6N A;  2IVJ A;  5F5C A;  2ZGR A;  2DUQ A;  3EYP A;  4ET7 A;  3UO2 A;  2IFW A;  4HK8 A;  4CU6 A;  5L36 A;  1C4R A;  2ZAH A;  3V0B B;  2C5D A;  3LAG A;  4IEY A;  4GH4 C;  1O5U A;  1X50 A;  1E5I A;  3H42 B;  1S0E A;  3FUO A;  3ZN4 A;  4A7K A;  2CGO A;  2G19 A;  3J7M A;  5IFT A;  4KBB A;  3D4K A;  1SPP A;  5LBC A;  4AI8 A;  4DTJ A;  4XF4 A;  2VJ4 A;  1CIW A;  1HB2 A;  2A6X A;  3PUI A;  3OGV A;  4LO5 B;  5AC9 1;  4CPB A;  2PYT A;  3BB6 A;  1PGL 1;  3WF3 A;  2JDU A;  1AYN 1;  2P2K A;  3UGH A;  4FI9 A;  1EP0 A;  2VW1 A;  5KXE A;  1O59 A;  3AZY A;  3VBH A;  3W5N A;  1DZR A;  1V9U 1;  2R7E B;  4U36 A;  4NHL A;  3E4W A;  3KT4 A;  4QXB A;  3TAB A;  1QDO A;  3I54 A;  3VHN A;  1DYK A;  2C6S A;  4YVW B;  5KHI A;  3POB A;  2NN8 A;  3T2T A;  2ORZ A;  4ZZ8 A;  3BUC A;  1F5F A;  1UYX A;  1RIR A;  4BH9 A;  5BNP B;  2QVS B;  4MHR A;  5E89 A;  2FW3 A;  4N90 A;  1WMD A;  1KQR A;  3ZFE A;  2WWS A;  4RFR B;  1GQG A;  5EYX A;  4AVC A;  3PDQ A;  3W5M A;  1OUR A;  1OT5 A;  1W39 A;  2DFC A;  4JGZ B;  5GLW A;  1W28 A;  5IK8 A;  5EHD A;  2B46 X;  2RVA A;  5LY2 A;  4FAH A;  2CAU A;  2X09 A;  2H0B A;  3UJO A;  4GAZ A;  1VRH 2;  3OUJ A;  4QGM A;  1UYZ A;  3AL5 A;  2D5F A;  1PVC 2;  1RVF 3;  5JPM B;  1B35 B;  3RI8 A;  1I1E A;  3ZPY A;  2ET7 A;  5T3N A;  1LED A;  5T5O A;  1JMU B;  4WVZ A;  1VBB 2;  4AAP A;  1MEC 2;  1HLC A;  5FYT A;  5DZG A;  4J2A A;  1BBT 3;  1Y9M A;  2JE9 A;  4K9S A;  4XBL A;  5K0U C;  3MV1 1;  3CQ8 A;  1ND3 A;  1RIT A;  3I4I A;  4LNV A;  2ARA A;  5K4L A;  2D43 A;  1AHS A;  2RG4 A;  3DN7 A;  4X6Q B;  5GZF A;  3T30 A;  4P9Y A;  2ETE A;  4OUS A;  2Y0O A;  1GNY A;  1SLI A;  4XET A;  4XJA A;  2QQN A;  2YFZ A;  4BME A;  4QXC A;  3C6N B;  1KJL A;  2VCB A;  2XJS A;  5DAV A;  1UAI A;  1AUY A;  4XF9 A;  4XVH A;  5FZI A;  1DQ2 A;  3SQ4 A;  2OPK A;  2QQV A;  1D0H A;  2FYO A;  2FHR A;  2JG9 B;  3T1M A;  2P5G A;  5ABJ C;  1EUU A;  4KHN A;  3RYK A;  1PMJ X;  1I6X A;  4JRL A;  3K46 A;  1VP6 A;  5A32 A;  2VVE A;  4OZX A;  5BYN A;  3VBU A;  2WUH A;  4LBM A;  5F7U A;  1NCR C;  1U12 A;  3NV1 A;  5JIA A;  2JDY A;  4XFB A;  1YFU A;  4XQW A;  1OA3 A;  1R09 1;  2GNM A;  4AVV A;  2PHD A;  2VEC A;  1MHY G;  1CPM A;  1LB2 A;  1LDK E;  1LHU A;  4AVT A;  1U0A A;  1WME A;  3POI A;  1H1I A;  5EP9 A;  2BU9 A;  2DUP A;  2RS1 3;  2B42 B;  2KR2 A;  3GAL A;  5ANN A;  3CJI C;  2VZV A;  3PJY A;  2A3X A;  2I07 B;  4M3C A;  5KC5 A;  3E6C C;  4X5M A;  4NWV A;  2CWM A;  4E4B A;  4Y33 A;  2FZ2 A;  5A1L A;  4OI2 A;  1POV 3;  1H8T B;  2C1F A;  1K5J A;  2TBV A;  3ZIX A;  3ZYB A;  3WG3 A;  5A3N A;  3C8X A;  4AQT A;  1WGP A;  1CLQ A;  4Q4V 3;  2B39 A;  3RMX A;  4IE7 A;  4ZXE A;  2E7T A;  4RS5 C;  4HET A;  2QQI A;  2P1Q B;  4JGY B;  1UPI A;  4O9G A;  1FS1 A;  1CAW B;  2Z69 A;  1DIW A;  3AP5 A;  4JS4 A;  2I45 A;  4LXL A;  1U5Z A;  3OY8 A;  1UU4 A;  3NDK A;  5FY9 A;  5HCB A;  1FAT A;  3K3O A;  4QKB A;  1DDL A;  4Z8B A;  2WAO A;  1RUC 2;  4IET A;  4AEM A;  3RG0 A;  4EN8 B;  1HRI 2;  3QEX A;  1LCL A;  3AYE A;  5HBA A;  3WZ1 A;  2YG0 A;  4BLI A;  1G7Y A;  2RS5 2;  3IAP A;  2VQA A;  4YM2 A;  3T09 A;  4AFC A;  5B4N A;  1TNF A;  5CA6 A;  1FXX A;  3VBF A;  1DQ5 A;  1XNB A;  2QFE A;  4WVM B;  1VBC 2;  2BV4 A;  2WNV C;  2PHF A;  1WBF A; 
#chains in the Genus database with same CATH homology
 2B8I A;  4DTM A;  2HYX A;  2YFU A;  3BN6 A;  3L8B A;  3HGL A;  2W87 A;  1MMO G;  4I6J B;  4QPW A;  2XQX A;  4FK4 A;  2Y6L A;  2DDU A;  2ORX A;  2VZO A;  3CKH A;  3LEK A;  1W8N A;  5LCW L;  4DTR A;  1GU3 A;  5JXI A;  3DYM A;  1FZ5 E;  1CIY A;  1PMH X;  4LPL A;  4DTU A;  1XVD E;  1O8P A;  1W9S A;  4A41 A;  1L7Q A;  4KHW A;  1ULO A;  2VTF A;  3VDA A;  2P1O B;  2EIE A;  2LW8 A;  2VZT A;  3KD1 E;  5A1A A;  4OYU A;  3QEW A;  1OH4 A;  2X10 A;  3F2Z A;  3HL8 A;  4DU3 A;  3C94 A;  3RMD A;  3QER A;  2BZD A;  1XNA A;  4XUQ A;  4ZZ5 A;  2B7M A;  4M41 A;  4MGS A;  3TAG A;  1JYN A;  4JX0 A;  2J7M A;  3HNB M;  1K12 A;  4QB2 A;  2QQK A;  2QQJ A;  3FHA A;  4JKM A;  3NHG A;  1FZ4 E;  4JKK A;  2JHA A;  2OZS A;  3J7H A;  3L1N A;  2W3J A;  3LEG A;  1XMG E;  1Q9X A;  2W95 A;  3I2G A;  4FJN A;  3LPG A;  4ARY A;  3WEZ A;  1J83 A;  1XVG E;  3K75 B;  3T08 A;  4BDV B;  4TTG A;  3SVI A;  3WNP A;  2VZ1 A;  3SQ1 A;  1H6Y A;  4GZ9 A;  3SI6 A;  4MO3 M;  3T0D A;  3RMB A;  4UAP A;  4QX0 A;  4GWI A;  4DTX A;  1HN1 A;  3ETP A;  5G05 L;  3LDS A;  1GQP A;  2VJX A;  4XZU G;  3VDC A;  3FL7 A;  2BER A;  1NX9 A;  1W9T A;  2WZ8 A;  3CZU A;  1I5P A;  3CDZ B;  2J1A A;  4EYW A;  5DMY A;  2XON A;  4QDQ A;  1UY0 A;  3LDB A;  3QEI A;  3T2P A;  4XUO A;  4A3Z A;  1JZ2 A;  5IRE A;  4DUV A;  3KD5 E;  1FZ1 E;  3HPN A;  1OF3 A;  4MAD A;  5C71 A;  3T0A A;  3U37 A;  1BHG A;  1JZ3 A;  2ATQ A;  4FJL A;  3EB7 A;  3MV0 1;  4AKI A;  2WO1 A;  4DUW A;  2PFT A;  4FJM A;  5I0D A;  4QB1 A;  4KI5 M;  1US3 A;  3BGA A;  1KGY A;  1UY1 A;  3ECQ A;  4DEV A;  2HLE A;  2PQS A;  2Y6H A;  1IH7 A;  4KHU A;  1XU3 E;  2JHP A;  3CFO A;  2BBA A;  3ACG A;  4LKS A;  1PX4 A;  3LZI A;  2C4X A;  1F4A A;  2J1T A;  2Y6K A;  2W1S A;  3VD5 A;  2VMF A;  2QQM A;  2WN2 A;  1SG3 A;  2ZEZ A;  5C70 A;  4M3X A;  1FZ9 E;  2VZU A;  3N1B A;  1IG9 A;  2WO3 A;  3NQH A;  2XHN A;  1UWW A;  2JDA A;  1JZ8 A;  1FZH E;  2E31 A;  3CFP A;  2DTU A;  4QDS A;  3LPF A;  1UXX X;  4M3W A;  3WF2 A;  5FUI A;  3LQC A;  2QQO A;  3III A;  4AKG A;  2H4T A;  3TAF A;  1LNS A;  2ZXQ A;  3NRU A;  3WNL A;  3NNG A;  2W47 A;  3P6B A;  3FN9 A;  4M4R A;  2C9K A;  5HXM A;  1GUI A;  3OGL B;  4HCC A;  2B4K A;  4FJK A;  1WAJ A;  4M3Z A;  4W8J A;  1FZ6 E;  3LZJ A;  2V4V A;  5IFP A;  2WN3 A;  3GXU A;  2W9X A;  1W8O A;  2W92 A;  2ID4 A;  3HJR A;  4FJG A;  1XU5 E;  3HGK E;  2ZEX A;  1P22 A;  2P1N B;  3NAE A;  4AG4 A;  1XMH E;  4J2E A;  1JI6 A;  3OGM B;  2ZEW A;  2VMD A;  2CDO A;  2WYS A;  4DU1 A;  4M42 A;  4UOJ A;  3T0B A;  1W9W A;  1UZ0 A;  3L0M A;  3NCI A;  5DN2 A;  4DXS A;  4EPH A;  4LQR A;  2OVQ B;  5JXG A;  3OEA A;  3RWU A;  3RMA A;  3SUQ A;  3IB3 A;  3SKV A;  2JPN A;  1GOF A;  3GM8 A;  5C7G A;  2W1Q A;  3DYP A;  1UY4 A;  5CZK A;  4JS5 A;  2Y6J A;  3TJY A;  1JZ5 A;  3DEC A;  2Y8K A;  4OZO A;  1IQD C;  5HPO A;  4GAM C;  2QBX A;  2V5D A;  2VR4 A;  3OGK B;  1DP0 A;  3C7G A;  3LD8 A;  1CZS A;  2YB7 A;  2WAB A;  2WO2 A;  3C7H A;  3VD7 A;  5EJZ B;  1NAE A;  4CU8 A;  2EIC A;  4CU9 A;  3K4A A;  3I97 A;  3P1I A;  2P5O A;  4UI9 L;  2YB5 A;  2DCJ A;  3WF4 A;  1CZV A;  1TG7 A;  4DXT A;  3OGR A;  3I2J A;  3CMG A;  4A4A A;  1MPX A;  4J2D A;  4M3Y A;  3FHQ A;  3WQB A;  1XVB E;  1P8J A;  2B9V A;  1FYZ E;  2JHC A;  4RL5 A;  3DYO A;  4OMC A;  2PFV A;  2BGP A;  4ADN A;  2W1U A;  1OF4 A;  3MKS B;  3WNN A;  4KHY A;  4CU7 A;  1UXZ A;  1R64 A;  2E32 A;  4FJ7 A;  1WAF A;  2JH9 A;  2WAA A;  1NKG A;  3CZJ A;  3RMC A;  4CVU A;  4XUR A;  3C7O A;  4J2B A;  2JD9 A;  1L7R A;  3UES A;  1GMM A;  4A44 A;  4DXR A;  1D7P M;  4FJ9 A;  2W91 A;  3MO4 A;  1MHZ G;  3NJX A;  3C6P B;  5IJR A;  1GOG A;  2J1R A;  5LA2 A;  3I2K A;  2RJ2 A;  2J1U A;  3J2P A;  1FZI E;  3HNM A;  3UET A;  3SEP A;  4AAX A;  4W4Z A;  1K42 A;  1JZ7 A;  3SNN A;  2P1P B;  3E4Y A;  2OZM A;  4FJH A;  2DCK A;  4FK0 A;  2KD7 A;  3WF1 A;  2VZR A;  3SPZ A;  4P5Y A;  4CUA A;  4E8C A;  2LS6 A;  4I9Q A;  1CZT A;  4RG8 A;  3T2Q A;  3HN3 A;  1UX7 A;  4DUX A;  1JHJ A;  4QB6 A;  2YC2 A;  2L9L A;  2V72 A;  2J1V A;  4P08 A;  1ULP A;  1XPW A;  3I3D A;  3ACI A;  1J84 A;  3WSO A;  1SHW B;  3UIQ A;  1OD3 A;  1XVC E;  4FK2 A;  1JZ4 A;  2YC4 A;  3HEI A;  3HOB A;  1NEX B;  3NE6 A;  3SEE A;  3ZM8 A;  4HG6 B;  4QX2 A;  1JYX A;  2VME A;  3SUO A;  1XVF E;  4E8D A;  1JYV A;  3GDB A;  1XC6 A;  2Y64 A;  3T2O A;  1H6X A;  3K2O A;  4FJ8 A;  4KHQ A;  5H37 A;  4MGQ A;  2VQU A;  3CIH A;  1FZ8 E;  2HD0 A;  2EID A;  4QND A;  2Z4F A;  3A21 A;  2VZP A;  4DU4 A;  3C95 A;  5IHR A;  4M45 A;  4PQQ A;  3WF0 A;  3HP9 A;  1W0N A;  4BJ0 A;  4DTO A;  1JU4 A;  3AC0 A;  3C6O B;  3SJJ A;  4FJ5 A;  4B08 A;  1GOH A;  4DTP A;  2LF3 A;  2VC9 A;  3SCX A;  4XUT A;  5IZ7 A;  4AKH A;  3K4D A;  3MUZ 1;  3OGS A;  5JR2 A;  2J1S A;  2WBK A;  3PUH A;  4A6O A;  4GWJ A;  2VOT A;  3VD4 A;  3MBW A;  5IYY A;  1UMI A;  5JXH A;  4LHS A;  4PF1 A;  4RYD A;  1NUK A;  1WCQ A;  3A23 A;  3SKJ E;  3ABZ A;  4QNC A;  2JKX A;  2Y6G A;  4BK4 A;  1XVE E;  2XOM A;  4JRQ A;  1RYY A;  3C7E A;  1UYY A;  4EP9 A;  4OMD A;  1WKY A;  2DEB A;  2E33 A;  3EYP A;  2C26 A;  1KEX A;  4D0Q A;  1O8S A;  4ET7 A;  5LA0 A;  1XMF E;  4CU6 A;  1Q9Y A;  2VZ3 A;  2VCA A;  1F4H A;  3QNO A;  4FJJ A;  4QAW A;  5EIY B;  4OUE A;  3THD A;  4M4P A;  5IFT A;  4TXW A;  4RN5 A;  4I9L A;  3GGL A;  4Z2A A;  4DTJ A;  2VJ4 A;  3PUI A;  3WNM A;  2QQL A;  3OGV A;  1TVG A;  4KI6 A;  3WF3 A;  1XL3 C;  2VQT A;  5DPN A;  1YQ2 A;  3NJV A;  4M3U A;  4A45 A;  4FI9 A;  1PX3 A;  3OEB A;  3OB8 A;  2X05 A;  1O59 A;  4W50 A;  2OVP B;  2OYQ A;  2WZE A;  4KMQ A;  5G04 L;  1FZ0 E;  3W5N A;  2W46 A;  1EUT A;  1K45 A;  2R7E B;  4KI4 A;  4P02 B;  3E4W A;  5EJ1 B;  3TAB A;  1JYW A;  3TAE A;  4QX1 A;  1W99 A;  2LF6 A;  4ZZ8 A;  2VIX A;  1XNT A;  2ORZ A;  3QNN A;  4A42 A;  3SUN A;  1UYX A;  3K4Z A;  4JHZ A;  3SPY A;  2FW3 A;  1UY2 A;  1US2 A;  4QDR A;  3W5M A;  1DYO A;  2MZW B;  4M3T A;  1OT5 A;  1FZ2 E;  3A22 A;  2RVA A;  3NGI A;  2X09 A;  1UY3 A;  2WQ8 A;  3I2H A;  4ARX A;  5JUV A;  1UYZ A;  1FZ3 E;  2ZEY A;  3QES A;  2DY4 A;  5DQ0 A;  5J1X A;  3V7D B;  2BGO A;  2JH8 A;  3A7Q A;  4CUB A;  5JMO A;  4BK5 A;  4J2A A;  3C7F A;  5B4X A;  1K3I A;  3MV1 1;  3WNO A;  3CQ8 A;  4JRP A;  3LEI A;  1FZ7 E;  3N1E A;  1GNY A;  2QQN A;  2YFZ A;  2J1E A;  3VDB A;  4DTN A;  3C6N B;  5IBK B;  2VCB A;  3IAQ A;  1MTY G;  2OKX A;  2VCC A;  2VZS A;  4X5N A;  4XVH A;  4XUP A;  1UMH A;  3OBA A;  1CX1 A;  3SQ4 A;  3K77 A;  5CYY A;  2FYO A;  3D3A A;  2P5G A;  1EUU A;  4IUG A;  4KHN A;  1PMJ X;  3SQ2 A;  2VMC A;  4BXS V;  4L0P A;  3K46 A;  4KWU A;  4ZY9 A;  3CQO A;  3QET A;  3QEP A;  1JU3 A;  3ACH A;  2WUH A;  5F7U A;  2OVR B;  1SDD B;  4MOA A;  4XUN A;  4YPJ A;  4KHS A;  3SUP A;  3HNY M;  2MMB A;  3QEV A;  2W5F A;  2W94 A;  3E1F 1;  1MHY G;  3L2O B;  4DEQ A;  3VD9 A;  1LDK E;  4E3S A;  2EIB A;  2RV9 A;  3MUY 1;  2VJ5 A;  2JE8 A;  4D8M A;  2QXF A;  3J27 A;  2VM9 A;  2WDB A;  2VZV A;  3IDA A;  4X5M A;  3JXS A;  4E4B A;  1T2X A;  4P00 B;  4FJI A;  5LA1 A;  2B1E A;  3C8X A;  3THC A;  1CLQ A;  3LE0 A;  3OG2 A;  4ZXE A;  4PT6 A;  2QQI A;  2P1Q B;  4RNG A;  3I3E A;  2P1M B;  4ADO A;  1FS1 A;  4M3R A;  3ACF A;  2CDP A;  4JS4 A;  1DLC A;  3I2F A;  4FVM A;  2VZQ A;  3NDK A;  4AI6 A;  4JKL A;  5JXJ A;  4HCB A;  2VO5 A;  3WNK A;  4QX3 A;  3I3B A;  2WAO A;  4DTS A;  4FJX A;  1JZ6 A;  2E26 A;  3QEX A;  3VD3 A;  3TL8 B;  2YG0 A;  5B4N A;  2J22 A;  3IAP A;  3T09 A;  3UNP A;  2RCU A;  1FXX A;  2VL4 A;  3SQ0 A;  3I2I A;  3S9H A;  3CFR A;  2W1W A;  4CUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...