2E34A

L11 structure with rdc and rg refinement
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
147
structure length
147
Chain Sequence
MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of free L11 and functional dynamics of L11 in free, L11-rRNA(58 nt) binary and L11-rRNA(58 nt)-thiostrepton ternary complexes
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Rna binding protein
molecule keywords 50S ribosomal protein L11
total genus 19
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
A PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2e34A02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2e34A01
1YITI 1YIJI 3CJQB 1VQ5I 3EGVB 3CF5F 5GADJ 1YJWI 3CCSI 1VQ9I 3CCLI 4IO9F 1FOYA 5GAGJ 1YJNI 5JVGF 1VQLI 3CCEI 3J7YJ 2QA4I 1S72I 3CC2I 5DM6F 1VQ4I 3PIOF 1FOXA 3CCUI 1ACIA 3G6EI 2NXNB 3CCQI 5GAHJ 3PIPF 4IOCF 2H8WA 1VQMI 1VQ7I 2JQ7A 2OTLI 1WIBA 4IOAF 3CJSB 1VQKI 2QEXI 3CCJI 1QA6A 1VQ8I 1YI2I 3CD6I 3CJRB 3CCVI 3CJTB 2ZJPF 3CC7I 1YJ9I 3G4SI 2E35A 3CC4I 2E36A 1Y39A 1VQNI 1FOWA 4UY8I 2K3FA 2ZJRF 2OTJI 3CMEI 5GAEJ 3DLLF 1MMSA 2E34A 2FOWA 1VQ6I 3J7ZI 4V19K 1VQPI 3CMAI 1YHQI 3CCRI 1VQOI 3G71I 2ZJQF 3I56I 3CCMI 5DM7F 1HC8A 3I55I
chains in the Genus database with same CATH superfamily
4NHJA 5GPAA 4YEJA 5ICCA 1D8JA 4XN3A 2QYOA 1EF4A 2HDWA 3IV5A 2M0MA 3MQ0A 5LHGA 1T95A 2R92J 2L2OA 3RIRA 1VQ5I 2XAGA 3S14J 1K6YA 2KHMA 4OOIA 1R00A 5IOYA 2JPBA 1MMGA 1BR4A 2VE8A 3HRTA 3OIPA 1JHFA 3CMYA 5J1YA 1EV7A 2VB6A 3OYJA 2IS1A 2RQQA 4LB5A 3DPLC 3AFHA 2EA4A 3D0SA 3R61A 3ZN0A 1V54H 4P5OA 2LBFA 1MKMA 3DLAA 2H6CA 3JREA 2QA4I 2AXTC 4M3GA 4A3DJ 1XG1A 5DM6F 2DYSH 4RAZA 2XHKA 3WTUC 1JJ6C 1J5YA 2UV1A 1PDNC 4BU2A 2NNNA 1R5ID 3KEYA 2M2EA 1H0MA 3VB2A 5KAFC 5J6XA 3ECHA 2CW0F 1ZR2A 2YS9A 3X2QH 3BT9A 1PUFA 3J7AY 3F22A 1Q1VA 4CGZA 1KU9A 5H6RA 5HODA 5GAHJ 4P9FA 1JT0A 4ENKA 4MQ9F 1LDDA 1JUPA 2STTA 4PJLA 3GZ6A 3SEQA 3ABUA 5KCMA 3GTKJ 3PQKA 1DUXC 3F6VA 1T0FA 2DFHA 2DMUA 1UCRA 1A6IA 1J59A 4PCQA 1TWFJ 4A69C 4YG2F 2DFIA 4FE4A 1WH7A 3CJTB 3HGGA 3RZDJ 4A3JJ 2GA1A 4MNUA 3WTYC 1FC3A 3V7SA 2EV5A 2HZDA 3VEPA 2EPFA 4HYEA 4IHSA 1VQNI 2N8GA 4ZDLA 2JUGA 1F5TA 3ZP5A 4ZZLA 1GXQA 1KU2A 3HOVJ 2LSOA 1ULYA 3HL2A 3QU6A 5ILSA 4RM2A 4XL9A 4CZZA 2X6XA 1X1AA 2UUZA 4L9TA 3QRFF 2O6GE 4XRMA 2XRNA 5HNFA 3CDLA 1WI3A 1ZLKA 5TGTA 2ELKA 2DTZA 2HPIA 1H88C 3MZHA 3ZQLA 1Z05A 1ETXA 3BDDA 3ZQQA 1ENHA 1IN5A 1KQ0A 3V7CA 1BOAA 3SDBA 3ML6A 3A0BC 2R7ZJ 2ME6A 5L3DA 4RB1A 1T38A 1MZBA 2HU9A 1TTYA 4M6XA 1W36C 1WCMJ 5IYDJ 2TDXA 4G8XA 1SVLA 2ZO4A 2X1EA 1E0EA 4BE0A 5C4JJ 2EINH 4Y3OA 1T8IA 2L7MP 4XMYA 1OKRA 2PQ8A 3JSOA 2F48A 3JRBA 5BPDA 1YS6A 4KISA 3HKZA 2XV4S 3FISA 4KIGA 3ZQGA 2IS2A 1MMDA 4I99C 2BY0A 5LGNA 2VC0A 4G6TB 3TGNA 2R7TA 1FBUA 1P7IA 1S6LA 4A6EA 1O3TA 2V1XA 5DD8A 2LK2A 2YX4A 4HZFA 3UKGA 2Q2EB 1FY7A 1O57A 4G12A 1BIAA 4C2MJ 3VYSB 4FASD 1K83J 2YU3A 3JAMZ 5LEJA 1I1SA 3OS0A 3ROUA 2CMPA 2WAEA 1W0TA 2PG4A 3HSRA 4ETSA 1QHGA 1IGNA 1FOXA 4U0WA 3WU0A 3FHZA 1IN8A 2HQAA 3CCUI 3SJMA 1PUEE 2V79A 3R4KA 2P8TA 4BL0B 4B8XA 1XGSA 3T5XA 1TQMA 4W97A 1Q1HA 2H8WA 2FQ3A 4A3CJ 1TP4A 1D3YA 3LSHA 4EGYA 1QA6A 3JTGA 3LOCA 3BQZA 3LA7A 3PNVA 1P7JA 1BI1A 3NARA 4EJWA 1UG2A 2WBMA 3IH4A 2XAHA 2NOGA 2LH9A 3OYBA 2F4MB 2ZFUA 1RRJA 5KHDA 1O3SA 1OYYA 1K79A 3R60A 3K4MA 1MBJA 1VZ0A 3LSKA 4FHTA 2HDCA 1F4KA 2LF7A 3RJPA 2R7SA 3OMYA 5FJ8J 3DEUA 3IH3A 3KYLA 3PO2J 2ELJA 1IV6A 1A5JA 2DPUA 3BZ6A 1IC8A 3HM5A 1A36A 2A5YB 2E34A 4W1UA 4J01A 4II3A 2FNAA 3HZJA 2KDZA 4IRHA 4LK0F 4IHWA 4PGHA 5B1BH 2R7WA 3ZMTA 4XOTA 3V8JA 3HOTA 4BQAA 3RPQA 4CXFA 2QF7A 3F23A 1ZG1A 5E8GA 5F6FA 4AIKA 1XMKA 2R5ZB 1WJBA 3SXYA 4XLEA 1EH7A 1MBGA 2Y2ZA 3IKTA 3L2WA 2VT2A 3QODA 4EVIA 3MEXA 4YIFA 2KRHA 2JJ7A 5E1XA 2PX9A 3WE2A 2JRMA 1AKHA 2KFDA 5AONA 1T56A 5E3MA 3FXQA 4UB6C 4UNOA 2KIUA 3TEDA 1O3QA 3GXOA 5ERIA 1R49A 2FX0A 3VFZA 3E6MA 1YYVA 2L4AA 4DNCA 1FPQA 2MLKA 3GF2A 2Z9OA 4IO9F 2G7HA 1R4NB 4LG0B 1VF9A 1YJNI 3L2CA 2QKMB 2WV0A 2K40A 3JW4A 4XRSA 2M4GA 2HI3A 1ERDA 2CQXA 2IXSA 2NVYJ 2CO5A 2DJIA 2EFPA 2HOAA 4G7HF 3CP2A 4HV5A 1UHSA 2M9HA 2VI6A 1FIPA 3OR2C 2Y30A 5FD6A 4OINF 2E2JJ 2F4IA 2FD5A 2RAEA 4PJ0C 4DYCA 4EMSA 5H6QA 3CUQA 3GFLA 5H20A 3Q0VA 4WX9A 4E4HA 2VPLA 2CV1A 1D1AA 2XDVA 2ZNZA 2E1CA 4LIVA 3ZCOA 1Z7LA 5J3LA 4KJZA 5FFZA 5FKMA 4OIOF 4IOCF 2O8XA 4HA8A 2M1BA 1UELB 2LKXA 4D7NA 3I5UA 2OUMA 2A6TA 3O3KA 4M3EA 3ZN1A 3QQAA 4LLGF 2BVMA 3GZNB 2H8RA 1RI7A 5DCMB 3U1DA 1ZKGA 4JX4A 2WTEA 3S16J 2RN7A 4XM3A 3PQJA 1QO0D 5IP9J 1G8XA 2XB0X 2DA6A 5CVVA 1UJ8A 4DYRA 1QZEA 3BG9A 4S05A 1U2WA 3QPSA 4HPQA 2MD5A 3S3OA 3GTJJ 1W36D 3H36A 3SQNA 1Z6TA 1KONA 3K4JA 2DMNA 3E1SA 2LY1A 1OCOH 4FX4A 1QBJA 2WWYA 2NVUB 2CW8A 1SD7A 2FF4A 4JP0A 5DCMA 2ID3A 1WKMA 5J8CA 2DO7A 5E18F 1Y6IA 2DQLA 2VJJA 2QSGX 1OLTA 2NYXA 2A05A 2HKOA 2XPUA 2JA8J 2AQFA 4R1HA 4RS8A 2E7WA 2M5WA 3WG9A 1BA5A 2WAQN 2HQNA 3HHGA 2HGCA 2IBDA 3JR9A 2DJNA 3FMQA 3H5RA 4AYBN 5EGOA 3EUAA 3RPUD 4Q47A 1XGNA 3TDUC 3GTPJ 4BDZA 4NNJA 2EIJH 1DPUA 2QSHX 1I6HJ 2VKHA 3MKWB 4Y33A 3CUQC 2EFOA 1X3ZB 4PSWA 1QZZA 1O7LA 1HKQA 2DPDA 1HDPA 3HEFA 1Y1WJ 1TT5B 3D5LA 5EG0B 4CICA 2V7FA 4PDKA 5IT3A 4OIPF 2K4BA 2K86A 4PZJA 2CUEA 1VQ9I 2QENA 1R1UA 1B9NA 1YW9A 4HV6A 4YFNF 2LFBA 3F21A 2UWMA 1TZLA 2OZ6A 4KMFA 1IUYA 5JVGF 1VQLI 3TW6A 3AAFA 3C2BA 2A07F 2PBIA 5CYVA 2HQ5A 4CCOA 1J75A 4P1WA 2GBYA 3OYAA 4Y52J 1OMIA 3F8BA 3FM3A 4ZDOA 3AG1H 3KPHA 3OS1A 5D8KB 1YRNA 1XD7A 2FU4A 3ZMVA 2V6CA 4RMNA 4XNFA 4I98B 4E7ZA 3G6EI 3BY6A 4ASNA 2FA5A 5C4XJ 4HDUA 2BGCA 4PSXA 5IT9Z 4A3FJ 1QVUA 2IEKA 3ZQHA 5L3CA 4ESBA 2BOLA 3EETA 3F72A 4JYKA 2ETHA 4NQWB 2E2IJ 2EZKA 2M7BA 3TOBA 3OYFA 2FJ1A 4E70A 1QHHD 2IVMA 1IDYA 2GLOA 1YX3A 3CCVI 4ZZDA 1DP3A 3G1MA 2ZNYA 3I9V2 2EK5A 4YFKF 2K3PA 5LRRA 3F8FA 1RESA 5J1RA 1IV8A 2E35A 2NS8A 2HYGD 2E5ZA 4X1EA 2VLAA 2EIMH 1LUJB 1WSUA 4JOMA 4MO7A 3E7LA 2R7UA 4HF0A 4UY8I 4C3IJ 1V5FA 4BE1A 4ZYAA 3OIQA 3K4NA 1MMSA 3S2WA 3KZIC 3JSPA 2XAJA 2FOWA 1MNDA 3REOA 4RB3C 3ZPLA 2YPRA 3AG3H 3GLLA 2MYSA 1ZELA 4XKWA 4BQOA 3PL8A 1PVEA 2P6TA 1WGXA 2LKSA 4MTEA 5LHHA 2VXDA 2WB1A 1JTYA 3BR1A 3FZVA 1RNLA 3NAUA 3FXUA 3P7NA 2VE9A 3BCAA 3WGIA 1G3YA 1Z21A 2DDBA 3GFJA 2STWA 2JTVA 1SC7A 1U8RA 3S1RJ 4S04A 2D1VA 2OQRA 5M3MJ 3FKJA 2D45A 2A6HF 2JA5J 2NS0A 2ICWG 5ICFA 2L7ZA 5E20A 2FBKA 3DP7A 1X1CA 3AL0B 4I0BA 3CLQA 1TNTA 4C2UA 3MAJA 3FXKA 1G3WA 3BTJA 4XONA 5BMZA 3QYFA 2AHQA 4AUXA 2VXZA 1WWXA 2CUJA 1TW2A 1QNTA 4Q4ZF 1X1BA 2Q8KA 3M07A 3GEZA 4QPOA 2DA1A 2W48A 3C2GA 2HOSA 2CQKA 4M9SA 1FEXA 5FKLA 1P4AA 1XS9A 3B6AA 4A3EJ 2DMTA 2CW7A 2XGEA 2BY1A 3BZCA 1AKHB 2V9KA 3A03A 1DU0A 1BJAA 5JHFA 5FLMJ 5DCFA 2EZLA 1EH6A 1H9GA 3HSFA 4ZTJA 3HG9A 4JK1X 4BAYA 4RB2C 2CUZA 1OCRH 3KLOA 3LSGA 1FOKA 1YLFA 1WFXA 3RCOA 3D5SC 2PN6A 4RA2A 4B48A 1SFEA 1EH8A 2JA7J 4EEFG 4U87A 1MDMB 4X6AJ 2NS7A 3OYHA 3EPZA 2CQ7A 1Y0NA 1DGRM 3EQLF 4E7IA 1DPRA 4BACA 3WODF 2WC2A 2QM3A 2XSDC 2Z16A 5DDGA 2EB7A 1YJ9I 2EWNA 2K85A 2L9RA 2X6OA 2QBYB 3QYEA 2BXYA 3G4SI 5D5UB 4KT5C 3LA3A 3PSFA 3HIFA 3VYRB 3BR6A 3HRMA 4G7ZF 2MH9A 1K78B 3ISPA 2VJIA 2DK5A 3DBLB 4E7LA 3GTMJ 4AYBA 2LYCA 2ZJRF 2XIGA 2V1DA 3IAS2 2ISZA 4YRVA 4RGUA 1XN7A 5LGTA 2DFEA 4YIIA 1KYWA 1FT9A 1ON1A 1RUOA 1I50J 1LE8B 1STZA 1KU7A 1FTZA 3BJOA 1ZR4A 3FBIB 1POGA 3W2AA 3BR0A 2J5OA 1T0FC 1U5TA 3A1YA 4M6VA 1MNEA 1WVRA 2WADA 3FDYA 4KT6A 4HF1A 4DZPA 1ZLJA 2KLOA 3LSTA 1BIBA 4EM2A 2E71A 1YQAA 3J81Z 3E6BA 1YW7A 1FYMA 5J1UA 1R71A 2EIKH 3S2DJ 3HPHA 4AC0A 3I55I 2K5CA 2JWTA 4C3HJ 2VL8A 4GO1A 3FKIJ 1BC7C 3GTLJ 2AQEA 3ZXSA 2DW4A 1NG6A 4RLFA 3GTOJ 3H3ZA 1MJ9A 3T0YA 4GCVA 3BR2A 2XVCA 3BJ6A 4WF2A 2B9SA 2XAUA 2XF5A 2ZMEC 4LGWA 5K7HA 3HBLA 4XR6A 3HOSA 1W1WE 1IN6A 1IN7A 2A5WA 1WJAA 2FRHA 2R7OA 4U88A 2R7XA 4RAGA 3IUOA 4KA4A 2P81A 1IG7A 2F2EA 2CQNA 5D6EA 2IGMA 2JPCA 3OYEA 4KN7X 1ON2A 2GXAA 1K6OA 3S32A 2K02A 2ZC2A 2DODA 2ECCA 1R36A 1Y1VJ 5E17F 3H3VK 2NVTJ 1BOBA 2LREA 5CPRB 2MFZA 4JBAA 3M1EA 5L3FA 3CCQI 1HF0A 2ZMEB 4F7ZA 2OJED 2KP6A 2OTLI 5HLHA 2OQGA 3FHNA 3G1LA 3H9JA 3BG3A 1NTCA 3IL2A 4ESFA 1BL0A 5HS8A 1BN5A 2K9NA 4HX8A 1IF1A 3HSEA 4EATA 1LDKB 3TO7A 3JRIA 3B73A 3S93A 5DTDA 3HUGA 3WTXC 4BNCA 1M1EB 4BYYA 2GIZA 4BEHA 2GOMA 1TT0A 4C3JJ 2L4MA 3G1OA 5K7FA 1K4SA 3DBRB 5KAIC 5ILVA 4GXOA 2Y0MA 3BR5A 2Q0OA 3UR3C 1ITYA 5H2FC 4OMZA 4B4CA 4DBQA 2MW8A 1LFUP 2O8KA 4EQQA 3BPXA 1KU3A 1HDDC 2F5CA 1HBXG 1VQ6I 3GW2A 2W25A 4ENJA 5FD5A 4DYQA 4G9YA 1PP7U 2I8DA 3C3WA 1K7AA 3HXLA 4B44A 3G71I 3A02A 4UHTA 3E5QA 1D5YA 3J80K 2M8EA 3K7AJ 2MG4A 5KVRA 3WG7H 3CUOA 4HAMA 2LD5A 5LRSA 1TBXA 5E3NA 1XSDA 1R7JA 1EKEA 1QGPA 3BROA 1MW7A 2BW3A 3ZQCA 2OA4A 2IGNA 1DU6A 3K4BA 2VKEA 3KLNA 3DF8A 2V9VA 1YITI 4XQFA 1K4TA 1UG0A 2A68F 1BI3A 5IYCJ 3EGVB 1EA3A 2QQ9A 1KZHA 4AM3A 5GADJ 1L3LA 1O4XA 3FXMA 2EV0A 1H89C 3BG5A 1S7AA 4IVNA 3HRUA 2GZWA 2VOOA 4ZC3A 3TO6A 2KISA 4Q48A 2H09A 2X85A 2CYYA 2XPWA 5IOZA 3CC2I 1JGGA 2H94A 2V1NA 1I5ZA 2A3SA 2JZYA 3M8FA 4XK4A 2OAZA 1D8KA 3W3CA 3ZMSA 3ZMZA 4TV7A 5F27A 4BUPA 3W6VA 1LVKA 1U0JA 4P55A 4D7MA 5K7ZA 4I01A 2H1LA 4AU7A 2GAUA 3CO6C 2XROA 4LLLA 1NK3P 4XSXF 2E5NA 3PUBA 4XORA 4MHGA 3KEQA 3H5AA 1MBKA 2DT6A 3PSIA 1VQ7I 3E6DA 5DV5A 2MABA 3P9KA 4B47A 4XLHA 3KP4A 2QEXI 1CQTA 4PJJA 2JRTA 2L01A 4MGRA 2YX7A 4DQ2A 4U0VA 1J9IA 3KP6A 4A2UA 2R4GA 3Q5FA 2QZ8A 1KA8A 3GTQJ 3K70C 1V55H 2CQQA 1HKSA 1GVDA 3GFMA 1USTA 3DCFA 2GOXB 1LEBA 2ZSIB 1Y39A 4FCYA 2BW3B 2ZXHA 4ZYGA 2PJRB 1SFKA 4D1QA 5HLIA 2Y31A 1GV2A 2VQHA 2K3FA 1R22A 4EJOA 5BOXA 2O61A 3SZGA 3HJEA 3A2KA 1B72B 2BZTA 2KMUA 3EUHA 4NQWA 3KZYA 4F55A 4XKVA 2CRGA 2QUFA 3OYIA 4V19K 2XAFA 1BI2A 4UVBA 1IAWA 3OOPA 3R6SA 4DZJA 3BG6A 2KZVA 1DP7P 1F43A 2A69F 1RKWA 2C6YA 1IZ1A 3COAC 4CDGA 2E60A 2M34A 4AD9A 5FRMA 2V6EA 2KIFA 5F0FA 1NHAA 3V42A 2OD5A 1EJ9A 4FE7A 1WI9A 2M7AA 2X9DA 3IKVA 4O5VA 4WWCA 1OYWA 2XC7A 1TWHJ 4XLFA 3IWZA 2EZHA 4EJVA 3MKYB 3LSMA 1ZARA 3BTIA 2FXAA 3JAMK 1OQYA 3M7GA 2CS3A 3RKXA 4J19A 1BW5A 1XTAA 4BXXJ 3F0CA 3PUFA 2HTJA 4PJNA 4BH9A 4CA0A 2VKVA 2LF8A 1XGOA 2E1OA 5F04A 5GAGJ 4AIDA 3ZQIA 1AA7A 3FXRA 1FSEA 1IRFA 1FP2A 1RUNA 4E6KG 1IN4A 2LBFB 3ZR8X 1VI0A 2HVQA 2W57A 2W24A 3JRHA 2RC4A 4WXCA 4HDVA 3KP7A 1Z9CA 3NRVA 2E1NA 3VPRA 1A31A 3J80Z 5EEAA 1OYIA 5F1JA 4HNTA 3CLOA 4FT8A 4XBFA 2W4SA 3CTAA 3BR3A 4A3MJ 4D5FA 3KYDB 3V8LA 4RM3A 3CZ6A 2VONA 2PMHA 2VODA 3I71A 1IDZA 2X6YA 1H9TA 3PO3J 3ERED 1X2NA 1RR7A 1W7PD 4BJ6C 2NNYA 3OL4A 1HXDA 2M0CA 1X3UA 2LY9A 5LEKA 3DTEA 5KNLA 3DKYA 2Z99A 3WHCA 1R1VA 1S5LC 3OR1C 4IZZA 1VQ8I 3QPTA 3BLYA 3GX4X 1YI2I 5CKTA 2CU7A 3CJRB 2DA2A 3E3VA 1UFMA 2HWVA 4BE2A 3C7JA 3GYHX 2QLZA 1RETA 5BQTA 1XC5A 1G4DA 1T2KA 1DDNA 2FE3A 4BDYA 3PJRA 2FOKA 3VYTB 3CC4I 3IRQA 2YUSA 4G6DA 3HPGA 2JT1A 2A61A 2EV6A 4YFXF 3ASOH 3QAHA 1JXSA 4F92B 2DA7A 2DT5A 2NAZA 4MFEA 1SAUA 1I3QJ 4A3LJ 2DFFA 4HRIA 1W7PA 1IW7F 5E3OA 1ODDA 3ZGKA 1YHQI 4GDFA 5E1WA 3RKWA 4HNVA 2JVHA 3CO7C 2XKOA 2R5YA 5BS6A 1HLVA 3QP5A 2QCOA 4DIQA 4LLNA 3HC7A 2DK8A 3ASNH 2H27A 2Y0SA 4F91B 4XOPA 2M87A 5EGOB 1BW6A 4I0AA 1FWZA 4RLQA 1S29A 3OSGA 2RNJA 4IX7A 4UUVA 3SHFA 4M3FA 2BY3A 1R6RA 1W5TA 2MC4A 1SD6A 3VDXA 2HOEA 3AL0C 1YIJI 3CJQB 2KIMA 2GXGA 2CJJA 2XRLA 3K4LA 2W00A 1SAXA 1Z0XA 4BBSJ 3CCLI 2EQRA 3BWGA 4IQJA 3SZPA 4E7KA 2FMYA 1IXCA 5FFXA 3UNGC 4XRSG 3S8PA 4ABZA 1Z7UA 2W7NA 1RIOH 3VODA 5JI6A 1YG2A 2OPTA 2VC1A 3TW7A 1XB4A 2ME0A 3DXJF 4UUSA 1WJEA 2LRDA 5FKKA 4EJTA 1FMWA 3DU6A 3DEEA 4PJMA 3PIOF 1SFOJ 2AO9A 3GO5A 5J47A 3ECOA 2XASA 1OPCA 5HDGA 4LB6B 3CJNA 4ZYDA 1P92A 2IGKA 2LLKA 1BM9A 4MFDA 3ZMUA 5ICEA 3Q3SA 2GQQA 3E0JB 1CF7B 4D9JA 2HNHA 1QPIA 2JA2A 2ADUA 1LFBA 5D6FA 4CZCA 4DW6A 2WA0A 3GLXA 2VKDA 1N75A 3CJSB 5FGMA 1W7PB 1JT6A 4AVZA 1TWGJ 3T1BA 2ECBA 3FMSA 2GA2A 2Y75A 4LK1F 2Y0SN 4Y15A 4HOBA 2B63J 1X19A 3C1DA 4KICA 5JVTA 2W82A 1MSEC 3CCYA 1AU7A 1IXSB 2IPQX 2ZXJA 5DD4A 1FP1D 3PFIA 1QQIA 4QSHA 3HOUJ 3PNTA 4LJZF 1FOWA 3NQOA 3DEWA 1SFUA 1OR7A 1X58A 1MH4A 5TRDA 2OTJI 3ABTA 2FMLA 2VIXA 2XPVA 3I53A 5IY5H 1HW2A 2JN6A 3VOEA 2F5DA 3DPTA 3M1CA 3D1NI 2DA4A 4N4OB 5M5WJ 1Z6RA 5BPIA 1MH3A 1VQPI 1JKQC 3EDPA 4Y7NJ 5HDNA 3MN2A 1G6NA 1J09A 1MBHA 2DU9A 3BOQA 3E5UA 3PFYA 1BI0A 3S2HJ 2QGUA 5IP6A 1LJ9A 1HOMA 3LMMA 1SFXA 1V4RA 3DBHB 3TO9A 2ZJQF 1KYZA 2COMA 4UV8A 2L54A 2CV2A 3K70D 3F8CA 4OWRB 1GUUA 3CCMI 4XLCA 1U3EM 2PJRA 5TJJA 2OZUA 1QPMA 2B7EA 3MKZA 3JRCA 3FIWA 1PP8F 4WK8F 1TNSA 2IGOA 3HTUA 2E1MC 1HKTA 1MIJA 4BHPA 1A35A 5M5XJ 3L7WA 2OU2A 5CVIA 1D0ZA 1ZQ3P 3H35A 2IS6A 4XLNF 1J0RA 2HZTA 3AG4H 3V4GA 1GDTA 1R23A 2MA3A 4ZYEA 2PMUA 4BGDA 3E97A 1B8IA 3LFUA 2IT0A 1ZREA 3GWZA 5D4SA 2FQ4A 1T39A 3S1MJ 2LG4A 1T33A 5L3GA 3W2VA 3I58A 2VASA 4UXNA 4EJUA 3BZKA 3FK7A 3JCUC 4H0EA 3MCZA 5HS9A 4LOCA 4IL6C 1UZCA 3BTCA 1IRGA 1PUFB 4V2GA 3RQ4A 5FROA 2MC3A 3PIPF 1XCVA 2TRTA 2JUCA 2P6SA 3H92A 4G6QA 4B1RA 4JQFA 4F52A 4ZTFA 2XUBA 2CG4A 5KK1A 2IA1A 1MMNA 5ILUA 5HLGA 2QQ8A 5J4YA 2DMQA 3FK6A 5IPAA 1HCRA 4KIFA 3WU2C 1YO5C 1B4AA 2KKOA 3A0HC 1MDMA 2DI3A 3E5XA 3I4PA 2V1UA 1QRYA 2LKPA 4ENNA 1ORKA 2VBWA 3GUDA 3OYGA 3VWBA 5TISC 3OYMA 4D0PA 2EBIA 4BQNA 1GXPA 4IJAA 2LTPA 3Q0UA 2KJBA 1JTXA 3S3MA 3OYLA 5HNHA 2XF7A 1MSFC 4EGZA 4S0HB 2LY2A 1GV5A 3JRFA 4NDLA 1WPKA 1OCCH 4XLAA 2Y9YA 2O5RA 5CQGA 2WY8Q 5ED4A 1OCPA 4II2A 3LL7A 2L5QA 4YELA 4F93B 3BJAA 2W84A 4M9XA 3MKLA 4QLCU 2IRFG 4M3DA 1OCZH 4R79A 4NUBA 3P5JA 2NVQJ 2BBYA 1U9OA 1C0WA 1J7KA 3KP2A 3I4MJ 2XKPA 2L9NA 1LVAA 4PFPA 4DJAA 5DM7F 3RI4A 4H4KC 3FM5A 1TQIA 1JKOC 1X4PA 4KNYA 3I4NJ 2VN2A 4PK4A 4Y13A 3QYBA 5JR3A 3K4KA 2HYFA 3TP0A 1ZN2A 2EA2A 1ETVA 2P5LC 4OIQF 2RVCA 3AG2H 2WB1N 5F64A 4OMYA 2QBYA 4BHCA 1XPXA 1LB2A 4I76A 4M72A 3SYTA 1A6QA 3G73A 1W5SA 5HS7A 2R5YB 3CCEI 1D0XA 4RB0A 3CMMA 1HSJA 3DTIA 2CWEA 2IJLA 1G3SA 1Y0UA 1UAAA 4E7JA 2HYJA 3H0GJ 2L3DA 4IXAA 3KETA 2TCTA 4U0YA 3I64A 2Z5UA 1I39A 1YS7A 4A5NA 3OY9A 2HVSA 4BS9A 1OR7C 4PFOA 2F5VA 1O3RA 3ULQB 3RKQA 4EM0B 1FBQA 5FKNA 5JLXA 2FUG2 1E3OC 3L9FA 2F4OB 2JA6J 2JVGA 3OOUA 3O2PE 1XSVA 2VBXA 4LMYA 4V2FA 3K69A 4BXFA 1SD5A 3DPUA 2CGPA 2DOAA 3ABKH 4N4NB 5EJCA 5D8LB 2MGQA 1AWCA 2JQ7A 4IOAF 4QWQA 2YSRA 2EJRA 2NVXJ 5LHIA 4LG3A 1G59A 1F9NA 2FNPA 2FBHA 1DQUA 3OWTA 1FMVA 4A3BJ 3KP3A 1JHHA 3C2HA 2LDUA 2R3SA 1RC9A 5EG0A 2JMWA 6PAXA 4ZJZA 5EZHA 1NG7A 3IAM2 5F0HA 1N78A 3F6OA 3N4MA 4BEHB 4PGGA 3TKYA 2Z2SB 3ZQ7A 3TOAA 3OS2A 1JI8A 1SANA 4IPAA 1R5HA 3MZYA 1SMTA 3KCCA 4UUTA 1D1CA 1JE8A 1FLIA 5CVJA 3IRRA 2Z1DA 3ELKA 5E1ZB 3WGGA 4E7SA 3R0AA 4WXDA 3P9IA 1GLNA 4L9NA 1JGSA 2HXIA 3U21A 4P9UA 3OYKA 1IJWC 4G94A 2M3AA 2MH2A 3RSNA 1FX7A 2WV1A 2KQRA 3ABLH 3NWSA 4RGXA 1VNDA 3B6CA 2P4WA 3WTSC 3V8KA 3H5NA 2ZMEA 3FXJA 4ZH4F 1IRZA 3K2ZA 2CUFA 3MFKA 2KRFA 1GT0C 1ZHFA 1P2FA 2CH0A 2DBBA 2QSFX 2OCCH 4M74A 1S7OA 2MSYA 1ZH5A 3S15J 1Z3XA 3K1PA 5J4VA 3FXOA 3VSLA 5L3EA 4CH7A 5JHUA 5J8FA 3GFIA 4BBRJ 4UVAA 2RNGA 3JRDA 4G7OF 2X51A 5HOOA 2ZSHB 3IH2A 2H1KA 5K1YA 3ABMH 3JTHA 4FETA 1UHWA 4C9YA 1IXRC 4X0GA 2BY2A 4LD5A 4O3MA 3W6JB 1TW3A 4IRIA 4HSTA 3HGYA 4F3QA 4RBOA 1BR2A 2DLLA 2K4JA 3DWLE 1Z3YA 1W4MA 2X1DA 2R7FA 2FSWA 3LFKA 4HBLA 4A0ZA 3H0DA 2IA0A 4M6YA 1ZRDA 4GYGA 1LEAA 4HLXA 5CVRA 2L9VA 5EF6A 2G9WA 4HQMA 3RDIA 2ACJA 2HQRA 4U7BA 4UV9A 3W6KB 1S3JA 5EZGA 5B3SH 4RDUA 2KT0A 1IRXA 3JRAA 4HQEA 2B0LA 2O3FA 3LAJA 2P0WA 2EFNA 3BPVA 3H9QA 1D1BA 2KJCA 1W0UA 1KQ8A 1MGTA 2KRCA 4E7HA 2HTSA 4DBRA 1NK2P 3HOXJ 2R5ZA 2ZXWH 4PUSA 3H1CA 1RPWA 3CCJI 4B09A 1B6AA 4IHYA 2Y69H 1W5CC 3K4CA 2PFBA 4FQGA 4XRFA 5K5RA 4FX0A 2Z33A 3D5RC 1P6RA 4LG0A 2UXNA 3K1NA 2DQRA 5C3EJ 3L2VA 2DCEA 2DOEA 3U9GA 4L5EA 3FX3A 5F0CA 2ESNA 2DN0A 2MBFA 5D5WB 1XSXA 2X4HA 1USSA 1APLC 3QOEA 2V4JC 2VQCA 3BQYA 1QU3A 1Y8QB 3RYPA 4FTHA 3U1KA 1ZYRF 2ZB9A 3L09A 4ANJA 4HNUA 2OF7A 3H9GA 5AIPA 4ENMA 1ZRCA 2AS5F 2K9SA 1R58A 2DYRH 2W1OA 4U7DA 1Y56A 2EFQA 2O0YA 1F36A 2VPRA 1F1ZA 1UHMA 1XDUA 3RYRA 3TDZC 3OYDA 2KIQA 4RGRA 2GIVA 4N9HA 1SD4A 4MEXF 1ZRFA 1BBYA 2PJPA 2OCEA 1IUFA 3F8MA 1I1GA 4D5CA 5FLXZ 1HA8A 3I54A 1G3TA 4ZDPA 3GZ5A 3AKZA 1ETOA 5JLWA 1OISA 3WU1B 3ZRGA 1XMXA 1LPQA 1JUSA 1RZ4A 1FYKA 3VYUB 3K10A 3KZZA 4XN0A 2DAOA 4C2TA 4MLOA 4BQQA 5E79C 1P4XA 3K2AA 2XB5A 2IW5A 1JUMA 3MVPA 2L7FP 2PEXA 1I3AA 1QZYA 4KIBA 2VJ4A 1IO2A 5FO5A 1B1BA 4CSWA 5B1AH 1MJBA 3WTTC 4A3IJ 3OYNA 2R0QC 5DUIA 3KEOA 3DKXA 3V7RA 4KDPA 3WE3A 1YRNB 4MEYF 2K9LA 3WTWC 2D1HA 3Q9SA 4CCJA 1I27A 1T6SA 4GRIA 4IF4A 1FIAA 2FBIA 4Z2YA 4B43A 4IHVA 3HOWJ 2MLGA 1VQMI 2EILH 2Q2EA 1SVMA 2IP2A 4EM1A 5HVQC 3L2RA 3R0JA 2AXLA 2R7DA 3RTRA 4CCNA 5M3FJ 4QTRA 2CV0A 4L5JA 4HX4A 2KZGA 2GXBA 3I59A 3ERMA 3HUGB 3PM1A 5DYMA 2HEOA 3HTSB 2ZBKA 1P4WA 3NWTA 3ZQFA 3HHHA 1YX5A 2EZIA 3CESA 3K9TA 3CQZJ 3MMYB 2LC2A 2BHYA 5FB2A 2X0LA 5GTIC 2PLYA 1XDSA 2JK3A 1K78A 1U5TC 4MQVA 4KN4X 5FRNA 2DXIA 4L0YB 2VQLA 1Z67A 4HG2A 2R7QA 2X1CA 5GAEJ 2HPMA 3PNYA 4P96A 4AIHA 1DGWY 1SMYF 1E2XA 1RR8C 3I59B 1ZGJA 2E19A 3CMAI 1LFPA 4K2EA 4HF2A 5CVUA 1ZAOA 2L0KA 3T8RA 1LE8A 3LWFA 3L1PA 4N9IA 4KMUX 4Y4RA 3KE2A 4A93J 3JRGA 3A01B 1OFCX 2W85A 3HB9A 3TBIA 4ITVA 1K61A 2RDPA 1XMAA 3TQNA 4IHXA 1WJ5A 2LR8A 1MNMC 3I56I 1PJRA 1R1TA 1HQCA 2L7KA 5LD2C 1TC3C 2HVRA 5D4RA 2EFWA 1HC8A 4Z6YA 4UUSB 1KQ9A 1YFHA 4GYIA 1SEUA 3S1QJ 2A6EF 1TWAJ 1WHUA 5LBQA 4HEA2 9ANTA 1LKXA 4NC8A 2G0EA 1YJWI 1U78A 1PYVA 2V9PA 1WQ2A 1FOYA 2RQPA 3HYIA 4AWXB 4OU0A 2F5FA 3SDGA 5IT9K 2BXZA 1J2XA 3LA2A 1D5VA 3ONQA 3DTKA 2M45A 3QPHA 2R93J 3KIOA 2QQBA 1S72I 2QQAA 2OV7A 4N0BA 3QPLA 5AIQA 3ZOBA 1FYLA 1Y8RB 3GMEA 3L2QA 5CJ9A 3RQIA 4IEJA 3QOPA 3DU5A 2MD0A 3GTGJ 1U6GA 4A6DA 3T8TA 3EYIA 4XKCA 1G2HA 3WGHA 2E7XA 1V5GA 1OCTC 2WAFA 5IYBJ 2VBYA 1T98A 1GVJA 3QU3A 3CDHA 2QKLB 1L0OC 2ZFWA 2CFOA 1XGMA 1D0YA 1WJFA 4RGSA 4A12A 4ESJA 1LQ1A 1X1PA 2NRAC 1HSTA 1ETWA 1P9QC 2BEOA 4R8HA 4A3GJ 5C44J 2UZKA 2I10A 2K9QA 3Q0WA 1ZK8A 3FXLA 4AIJA 1AOYA 2KL4A 3IC7A 1CGPA 4XKBA 2LP0A 3TMOA 3O8GA 4GGGA 2ESHA 1FNNA 3IWFA 3C18A 3M8EA 1TWCJ 2P7CB 1WJCA 1S8NA 2Y48A 4A3KJ 1E3PA 2M30A 2ID6A 2ZJPF 3LSIA 3F8NA 3Q9VA 3BC8A 5D5XB 2X48A 1YIOA 2DT7B 2HR3A 2NOJB 2RREA 2LVSA 5E8IA 5CQEA 1XX5A 4M73A 2E36A 3S1NJ 2E1MB 2LNBA 1YW8A 2CSOA 3CP8A 4RAFA 1BJZA 2HDDA 1Z77A 2KDOA 4NC7A 3LQRA 4XLPF 4ZYHA 2D5VA 3DLLF 3S17J 2Y9ZA 2VJ5A 4O6JA 2O7OA 5B5EC 5HLTA 2YU9J 4JX5A 5K5QA 2QVOA 2IS4A 2XGDA 1R9TJ 3LSPA 4OAZA 2BYVE 4EV0A 2DTRA 1FJLA 4BY7J 1JJ8C 3J7AO 5DS9A 2BE5F 3I3LA 1U5TB 4CCLA 4IKFA 1A04A 4BXUA 3LSRA 1ETYA 4FISA 2ZXIA 1XCBA 3DKWA 2RGVA 2LOOA 2PMZA 3F9KA 4NBQA 1KGSA 5F1RA 1X1DA 3KX2A 1TLHB 2F6CA 3IP4B 1Z1DA 3F3XA 1BC8C 3A4CA 4IHTA 2XAQA 3KYCB 2K27A 2LMDA 3K0LA 3CF5F 3W2WA 5EEGA 3CCSI 1FTTA 4UB8C 4AVPA 3B02A 4WXHA 1N25A 2XGXA 3WHBA 1ZG5A 1AHDP 2D2WA 3BG7A 2L9SA 4LFUA 3IHUA 4M3BA 3CDIA 3FBNB 3OL3A 1B8IB 2IA2A 4BHBA 4GFBA 4UVCA 3NEUA 3BCBA 3OV8A 3HOZJ 1VQ4I 3M9AA 1MBFA 3N05A 2OBPA 2R7RA 2O9LA 4HSRA 4L9JA 2HS5A 3SZTA 5A2QZ 5FKOA 3U2RA 3J81K 4Q5SF 1S7EA 1ACIA 2GWRA 3TP3A 2NXNB 4DOZA 1WRJA 2J5PA 2PI0A 5J40A 1WH5A 2BHZA 4CYCA 1YTYA 1V5EA 1WIBA 3FMRA 4CYDA 1E17A 1VQKI 5LFAA 2COBA 2WAQA 5A2QK 3L2UA 5GPCA 3ZMDA 2JSCA 2XF6A 2VBZA 2O03A 2VUMJ 2I5UA 2IAIA 1S9HA 3EUHC 4NB5A 1E3HA 2P5VA 3CC7I 4CUGA 3O6BB 1FSHA 3K1MA 5FLVA 4ON0A 3I0TA 1YOVB 2DMPA 4MIMA 1JKRC 2UXXA 2Z3YA 1BR1A 2BVLA 1ZG3A 1LDJA 4L18B 2ZCWA 5BNGA 4L9VA 1GHCA 1ETQA 2M4KA 3DQVC 4JX6A 4Y17A 1LNWA 1MBEA 2M8GX 4BJ5C 4M71A 1WZ2A 3CCRI 4I7HA 4B3XA 4A0YA 1VQOI 5D5VB 1T08B 2CFXA 4HLYA 3P9CA 1RKTA 1HW5A 3MWMA 3SFIA 2XSJC 4OAYA 3QP6A 3ESWB 2XGCA 3HOYJ 3LQQA 5HDKA 2RKHA 1ZTRA 1R5GA 4B3AA 4XIDA 3GVAA 4I09A 5GP9A 4DGWB 5B66C 3OYCA 4CCMA 1REPC 1VTNC 1N77A 4C30A 3CUQB 5GTHC 2R7VA 2RV8A 3A01A 3BTLA 3N97A 2HOTA 1H8AC 2DOFA 3K6GA 4I2OA 3LAPA 2GM4A 3G3ZA 2JSPA 4BY1J 4KFCA 2BV6A 1JKPC 1X4OA 2DA3A 3QWLA 1VFCA 3J7YJ 4YIRX 1TQPA 3CF2A 4A0XA 4LITA 3EUKL 4QPQA 5EYRA 2ISYA 4CYCB 2K9MA 2L02A 3SFZA 5F08A 1V3FA 3DV8A 1X3WB 2ZJ2A 3HKZN 1HW1A 4HX7A 4L0ZB 2DDAA 2E2HJ 4M9ZA 5FLXK 4IQ4A 4NC6A 3LSJA 1NH3A 3H3UA 4A5MA 1TL8A 3WTZA 1FZPB 3HDDA 1Z91A 3OSFA 1MMAA 1FBSA 4LIUA 4HW0A 1SVOA 3M3YJ 3E6CC 3FF5A 4I02A 3DFGA 3O8HA 2X6WA 3G2BA 3GCMA 4BKXA 5DEQA 2FEZA 4XICA 3WTVC 4BJTA 3CD6I 3KP5A 1X2MA 1ONVA 3SEZA 1OJLA 5L3BA 2HKXA 5EEHA 3RPUA 4KITB 1QVTA 2HXOA 2KPMA 3FWEA 5JFRA 1B59A 2ZKZA 4IRGA 1U8BA 3TL4X 2QWWA 2H6BA 4L5IA 2WY7Q 4KUMA 3RKYA 1ZGWA 1WJDA 1R4MB 2P7VB 5M5YJ 1YE9A 3OIOA 5DUKA 2EH3A 3HRSA 3LNQA 3MZ8A 5LLQA 4OIRF 3RZOJ 1MD0A 3CMEI 1ZGAA 4I6ZA 2K7LA 2ELHA 1B9MA 4CO8A 1B72A 2Q1ZB 4CHUA 3M4OJ 5EDNA 1ETKA 2DA5A 2G7UA 5LGUA 1U9NA 2PMZN 3J7ZI 5CLSA 1UB9A 5IP7J 4J00A 5E3LA 2P5KA 1O7FA 3KFWX 4MTDA 4XSZF 1MJAA 2VT3A 3S3NA 3EYYA 4QIWN 5ICGA 2OC6A 1CF7A 2VOPA 3L00A 2VQGA 2YR2A 4WCGA 2HFHA 2V26A 3M8JA 1I6XA 3MD2A 3BP8A 3VSKA 4CCKA 5K5OA 4KYWA 2F5EA 1UMQA 3GBGA 4RAYA
chains in the Genus database with same CATH topology
1YITI 1YIJI 3CJQB 1VQ5I 3EGVB 3CF5F 5GADJ 1YJWI 3CCSI 1VQ9I 3CCLI 4IO9F 1FOYA 5GAGJ 1YJNI 5JVGF 1VQLI 3CCEI 3J7YJ 2QA4I 1S72I 3CC2I 5DM6F 1VQ4I 3PIOF 1FOXA 3CCUI 1ACIA 3G6EI 2NXNB 3CCQI 5GAHJ 3PIPF 4IOCF 2H8WA 1VQMI 1VQ7I 2JQ7A 2OTLI 1WIBA 4IOAF 3CJSB 1VQKI 2QEXI 3CCJI 1QA6A 1VQ8I 1YI2I 3CD6I 3CJRB 3CCVI 3CJTB 2ZJPF 3CC7I 1YJ9I 3G4SI 2E35A 3CC4I 2E36A 1Y39A 1VQNI 1FOWA 4UY8I 2K3FA 2ZJRF 2OTJI 3CMEI 5GAEJ 3DLLF 1MMSA 2E34A 2FOWA 1VQ6I 3J7ZI 4V19K 1VQPI 3CMAI 1YHQI 3CCRI 1VQOI 3G71I 2ZJQF 3I56I 3CCMI 5DM7F 1HC8A 3I55I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT I;  1YIJ I;  3CJQ B;  1VQ5 I;  3EGV B;  3CF5 F;  5GAD J;  1YJW I;  3CCS I;  1VQ9 I;  3CCL I;  4IO9 F;  1FOY A;  5GAG J;  1YJN I;  5JVG F;  1VQL I;  3CCE I;  3J7Y J;  2QA4 I;  1S72 I;  3CC2 I;  5DM6 F;  1VQ4 I;  3PIO F;  1FOX A;  3CCU I;  1ACI A;  3G6E I;  2NXN B;  3CCQ I;  5GAH J;  3PIP F;  4IOC F;  2H8W A;  1VQM I;  1VQ7 I;  2JQ7 A;  2OTL I;  1WIB A;  4IOA F;  3CJS B;  1VQK I;  2QEX I;  3CCJ I;  1QA6 A;  1VQ8 I;  1YI2 I;  3CD6 I;  3CJR B;  3CCV I;  3CJT B;  2ZJP F;  3CC7 I;  1YJ9 I;  3G4S I;  2E35 A;  3CC4 I;  2E36 A;  1Y39 A;  1VQN I;  1FOW A;  4UY8 I;  2K3F A;  2ZJR F;  2OTJ I;  3CME I;  5GAE J;  3DLL F;  1MMS A;  2E34 A;  2FOW A;  1VQ6 I;  3J7Z I;  4V19 K;  1VQP I;  3CMA I;  1YHQ I;  3CCR I;  1VQO I;  3G71 I;  2ZJQ F;  3I56 I;  3CCM I;  5DM7 F;  1HC8 A;  3I55 I; 
#chains in the Genus database with same CATH topology
 4NHJ A;  5GPA A;  4YEJ A;  5ICC A;  1D8J A;  4XN3 A;  2QYO A;  1EF4 A;  2HDW A;  3IV5 A;  2M0M A;  3MQ0 A;  5LHG A;  1T95 A;  2R92 J;  2L2O A;  3RIR A;  1VQ5 I;  2XAG A;  3S14 J;  1K6Y A;  2KHM A;  4OOI A;  1R00 A;  5IOY A;  2JPB A;  1MMG A;  1BR4 A;  2VE8 A;  3HRT A;  3OIP A;  1JHF A;  3CMY A;  5J1Y A;  1EV7 A;  2VB6 A;  3OYJ A;  2IS1 A;  2RQQ A;  4LB5 A;  3DPL C;  3AFH A;  2EA4 A;  3D0S A;  3R61 A;  3ZN0 A;  1V54 H;  4P5O A;  2LBF A;  1MKM A;  3DLA A;  2H6C A;  3JRE A;  2QA4 I;  2AXT C;  4M3G A;  4A3D J;  1XG1 A;  5DM6 F;  2DYS H;  4RAZ A;  2XHK A;  3WTU C;  1JJ6 C;  1J5Y A;  2UV1 A;  1PDN C;  4BU2 A;  2NNN A;  1R5I D;  3KEY A;  2M2E A;  1H0M A;  3VB2 A;  5KAF C;  5J6X A;  3ECH A;  2CW0 F;  1ZR2 A;  2YS9 A;  3X2Q H;  3BT9 A;  1PUF A;  3J7A Y;  3F22 A;  1Q1V A;  4CGZ A;  1KU9 A;  5H6R A;  5HOD A;  5GAH J;  4P9F A;  1JT0 A;  4ENK A;  4MQ9 F;  1LDD A;  1JUP A;  2STT A;  4PJL A;  3GZ6 A;  3SEQ A;  3ABU A;  5KCM A;  3GTK J;  3PQK A;  1DUX C;  3F6V A;  1T0F A;  2DFH A;  2DMU A;  1UCR A;  1A6I A;  1J59 A;  4PCQ A;  1TWF J;  4A69 C;  4YG2 F;  2DFI A;  4FE4 A;  1WH7 A;  3CJT B;  3HGG A;  3RZD J;  4A3J J;  2GA1 A;  4MNU A;  3WTY C;  1FC3 A;  3V7S A;  2EV5 A;  2HZD A;  3VEP A;  2EPF A;  4HYE A;  4IHS A;  1VQN I;  2N8G A;  4ZDL A;  2JUG A;  1F5T A;  3ZP5 A;  4ZZL A;  1GXQ A;  1KU2 A;  3HOV J;  2LSO A;  1ULY A;  3HL2 A;  3QU6 A;  5ILS A;  4RM2 A;  4XL9 A;  4CZZ A;  2X6X A;  1X1A A;  2UUZ A;  4L9T A;  3QRF F;  2O6G E;  4XRM A;  2XRN A;  5HNF A;  3CDL A;  1WI3 A;  1ZLK A;  5TGT A;  2ELK A;  2DTZ A;  2HPI A;  1H88 C;  3MZH A;  3ZQL A;  1Z05 A;  1ETX A;  3BDD A;  3ZQQ A;  1ENH A;  1IN5 A;  1KQ0 A;  3V7C A;  1BOA A;  3SDB A;  3ML6 A;  3A0B C;  2R7Z J;  2ME6 A;  5L3D A;  4RB1 A;  1T38 A;  1MZB A;  2HU9 A;  1TTY A;  4M6X A;  1W36 C;  1WCM J;  5IYD J;  2TDX A;  4G8X A;  1SVL A;  2ZO4 A;  2X1E A;  1E0E A;  4BE0 A;  5C4J J;  2EIN H;  4Y3O A;  1T8I A;  2L7M P;  4XMY A;  1OKR A;  2PQ8 A;  3JSO A;  2F48 A;  3JRB A;  5BPD A;  1YS6 A;  4KIS A;  3HKZ A;  2XV4 S;  3FIS A;  4KIG A;  3ZQG A;  2IS2 A;  1MMD A;  4I99 C;  2BY0 A;  5LGN A;  2VC0 A;  4G6T B;  3TGN A;  2R7T A;  1FBU A;  1P7I A;  1S6L A;  4A6E A;  1O3T A;  2V1X A;  5DD8 A;  2LK2 A;  2YX4 A;  4HZF A;  3UKG A;  2Q2E B;  1FY7 A;  1O57 A;  4G12 A;  1BIA A;  4C2M J;  3VYS B;  4FAS D;  1K83 J;  2YU3 A;  3JAM Z;  5LEJ A;  1I1S A;  3OS0 A;  3ROU A;  2CMP A;  2WAE A;  1W0T A;  2PG4 A;  3HSR A;  4ETS A;  1QHG A;  1IGN A;  1FOX A;  4U0W A;  3WU0 A;  3FHZ A;  1IN8 A;  2HQA A;  3CCU I;  3SJM A;  1PUE E;  2V79 A;  3R4K A;  2P8T A;  4BL0 B;  4B8X A;  1XGS A;  3T5X A;  1TQM A;  4W97 A;  1Q1H A;  2H8W A;  2FQ3 A;  4A3C J;  1TP4 A;  1D3Y A;  3LSH A;  4EGY A;  1QA6 A;  3JTG A;  3LOC A;  3BQZ A;  3LA7 A;  3PNV A;  1P7J A;  1BI1 A;  3NAR A;  4EJW A;  1UG2 A;  2WBM A;  3IH4 A;  2XAH A;  2NOG A;  2LH9 A;  3OYB A;  2F4M B;  2ZFU A;  1RRJ A;  5KHD A;  1O3S A;  1OYY A;  1K79 A;  3R60 A;  3K4M A;  1MBJ A;  1VZ0 A;  3LSK A;  4FHT A;  2HDC A;  1F4K A;  2LF7 A;  3RJP A;  2R7S A;  3OMY A;  5FJ8 J;  3DEU A;  3IH3 A;  3KYL A;  3PO2 J;  2ELJ A;  1IV6 A;  1A5J A;  2DPU A;  3BZ6 A;  1IC8 A;  3HM5 A;  1A36 A;  2A5Y B;  2E34 A;  4W1U A;  4J01 A;  4II3 A;  2FNA A;  3HZJ A;  2KDZ A;  4IRH A;  4LK0 F;  4IHW A;  4PGH A;  5B1B H;  2R7W A;  3ZMT A;  4XOT A;  3V8J A;  3HOT A;  4BQA A;  3RPQ A;  4CXF A;  2QF7 A;  3F23 A;  1ZG1 A;  5E8G A;  5F6F A;  4AIK A;  1XMK A;  2R5Z B;  1WJB A;  3SXY A;  4XLE A;  1EH7 A;  1MBG A;  2Y2Z A;  3IKT A;  3L2W A;  2VT2 A;  3QOD A;  4EVI A;  3MEX A;  4YIF A;  2KRH A;  2JJ7 A;  5E1X A;  2PX9 A;  3WE2 A;  2JRM A;  1AKH A;  2KFD A;  5AON A;  1T56 A;  5E3M A;  3FXQ A;  4UB6 C;  4UNO A;  2KIU A;  3TED A;  1O3Q A;  3GXO A;  5ERI A;  1R49 A;  2FX0 A;  3VFZ A;  3E6M A;  1YYV A;  2L4A A;  4DNC A;  1FPQ A;  2MLK A;  3GF2 A;  2Z9O A;  4IO9 F;  2G7H A;  1R4N B;  4LG0 B;  1VF9 A;  1YJN I;  3L2C A;  2QKM B;  2WV0 A;  2K40 A;  3JW4 A;  4XRS A;  2M4G A;  2HI3 A;  1ERD A;  2CQX A;  2IXS A;  2NVY J;  2CO5 A;  2DJI A;  2EFP A;  2HOA A;  4G7H F;  3CP2 A;  4HV5 A;  1UHS A;  2M9H A;  2VI6 A;  1FIP A;  3OR2 C;  2Y30 A;  5FD6 A;  4OIN F;  2E2J J;  2F4I A;  2FD5 A;  2RAE A;  4PJ0 C;  4DYC A;  4EMS A;  5H6Q A;  3CUQ A;  3GFL A;  5H20 A;  3Q0V A;  4WX9 A;  4E4H A;  2VPL A;  2CV1 A;  1D1A A;  2XDV A;  2ZNZ A;  2E1C A;  4LIV A;  3ZCO A;  1Z7L A;  5J3L A;  4KJZ A;  5FFZ A;  5FKM A;  4OIO F;  4IOC F;  2O8X A;  4HA8 A;  2M1B A;  1UEL B;  2LKX A;  4D7N A;  3I5U A;  2OUM A;  2A6T A;  3O3K A;  4M3E A;  3ZN1 A;  3QQA A;  4LLG F;  2BVM A;  3GZN B;  2H8R A;  1RI7 A;  5DCM B;  3U1D A;  1ZKG A;  4JX4 A;  2WTE A;  3S16 J;  2RN7 A;  4XM3 A;  3PQJ A;  1QO0 D;  5IP9 J;  1G8X A;  2XB0 X;  2DA6 A;  5CVV A;  1UJ8 A;  4DYR A;  1QZE A;  3BG9 A;  4S05 A;  1U2W A;  3QPS A;  4HPQ A;  2MD5 A;  3S3O A;  3GTJ J;  1W36 D;  3H36 A;  3SQN A;  1Z6T A;  1KON A;  3K4J A;  2DMN A;  3E1S A;  2LY1 A;  1OCO H;  4FX4 A;  1QBJ A;  2WWY A;  2NVU B;  2CW8 A;  1SD7 A;  2FF4 A;  4JP0 A;  5DCM A;  2ID3 A;  1WKM A;  5J8C A;  2DO7 A;  5E18 F;  1Y6I A;  2DQL A;  2VJJ A;  2QSG X;  1OLT A;  2NYX A;  2A05 A;  2HKO A;  2XPU A;  2JA8 J;  2AQF A;  4R1H A;  4RS8 A;  2E7W A;  2M5W A;  3WG9 A;  1BA5 A;  2WAQ N;  2HQN A;  3HHG A;  2HGC A;  2IBD A;  3JR9 A;  2DJN A;  3FMQ A;  3H5R A;  4AYB N;  5EGO A;  3EUA A;  3RPU D;  4Q47 A;  1XGN A;  3TDU C;  3GTP J;  4BDZ A;  4NNJ A;  2EIJ H;  1DPU A;  2QSH X;  1I6H J;  2VKH A;  3MKW B;  4Y33 A;  3CUQ C;  2EFO A;  1X3Z B;  4PSW A;  1QZZ A;  1O7L A;  1HKQ A;  2DPD A;  1HDP A;  3HEF A;  1Y1W J;  1TT5 B;  3D5L A;  5EG0 B;  4CIC A;  2V7F A;  4PDK A;  5IT3 A;  4OIP F;  2K4B A;  2K86 A;  4PZJ A;  2CUE A;  1VQ9 I;  2QEN A;  1R1U A;  1B9N A;  1YW9 A;  4HV6 A;  4YFN F;  2LFB A;  3F21 A;  2UWM A;  1TZL A;  2OZ6 A;  4KMF A;  1IUY A;  5JVG F;  1VQL I;  3TW6 A;  3AAF A;  3C2B A;  2A07 F;  2PBI A;  5CYV A;  2HQ5 A;  4CCO A;  1J75 A;  4P1W A;  2GBY A;  3OYA A;  4Y52 J;  1OMI A;  3F8B A;  3FM3 A;  4ZDO A;  3AG1 H;  3KPH A;  3OS1 A;  5D8K B;  1YRN A;  1XD7 A;  2FU4 A;  3ZMV A;  2V6C A;  4RMN A;  4XNF A;  4I98 B;  4E7Z A;  3G6E I;  3BY6 A;  4ASN A;  2FA5 A;  5C4X J;  4HDU A;  2BGC A;  4PSX A;  5IT9 Z;  4A3F J;  1QVU A;  2IEK A;  3ZQH A;  5L3C A;  4ESB A;  2BOL A;  3EET A;  3F72 A;  4JYK A;  2ETH A;  4NQW B;  2E2I J;  2EZK A;  2M7B A;  3TOB A;  3OYF A;  2FJ1 A;  4E70 A;  1QHH D;  2IVM A;  1IDY A;  2GLO A;  1YX3 A;  3CCV I;  4ZZD A;  1DP3 A;  3G1M A;  2ZNY A;  3I9V 2;  2EK5 A;  4YFK F;  2K3P A;  5LRR A;  3F8F A;  1RES A;  5J1R A;  1IV8 A;  2E35 A;  2NS8 A;  2HYG D;  2E5Z A;  4X1E A;  2VLA A;  2EIM H;  1LUJ B;  1WSU A;  4JOM A;  4MO7 A;  3E7L A;  2R7U A;  4HF0 A;  4UY8 I;  4C3I J;  1V5F A;  4BE1 A;  4ZYA A;  3OIQ A;  3K4N A;  1MMS A;  3S2W A;  3KZI C;  3JSP A;  2XAJ A;  2FOW A;  1MND A;  3REO A;  4RB3 C;  3ZPL A;  2YPR A;  3AG3 H;  3GLL A;  2MYS A;  1ZEL A;  4XKW A;  4BQO A;  3PL8 A;  1PVE A;  2P6T A;  1WGX A;  2LKS A;  4MTE A;  5LHH A;  2VXD A;  2WB1 A;  1JTY A;  3BR1 A;  3FZV A;  1RNL A;  3NAU A;  3FXU A;  3P7N A;  2VE9 A;  3BCA A;  3WGI A;  1G3Y A;  1Z21 A;  2DDB A;  3GFJ A;  2STW A;  2JTV A;  1SC7 A;  1U8R A;  3S1R J;  4S04 A;  2D1V A;  2OQR A;  5M3M J;  3FKJ A;  2D45 A;  2A6H F;  2JA5 J;  2NS0 A;  2ICW G;  5ICF A;  2L7Z A;  5E20 A;  2FBK A;  3DP7 A;  1X1C A;  3AL0 B;  4I0B A;  3CLQ A;  1TNT A;  4C2U A;  3MAJ A;  3FXK A;  1G3W A;  3BTJ A;  4XON A;  5BMZ A;  3QYF A;  2AHQ A;  4AUX A;  2VXZ A;  1WWX A;  2CUJ A;  1TW2 A;  1QNT A;  4Q4Z F;  1X1B A;  2Q8K A;  3M07 A;  3GEZ A;  4QPO A;  2DA1 A;  2W48 A;  3C2G A;  2HOS A;  2CQK A;  4M9S A;  1FEX A;  5FKL A;  1P4A A;  1XS9 A;  3B6A A;  4A3E J;  2DMT A;  2CW7 A;  2XGE A;  2BY1 A;  3BZC A;  1AKH B;  2V9K A;  3A03 A;  1DU0 A;  1BJA A;  5JHF A;  5FLM J;  5DCF A;  2EZL A;  1EH6 A;  1H9G A;  3HSF A;  4ZTJ A;  3HG9 A;  4JK1 X;  4BAY A;  4RB2 C;  2CUZ A;  1OCR H;  3KLO A;  3LSG A;  1FOK A;  1YLF A;  1WFX A;  3RCO A;  3D5S C;  2PN6 A;  4RA2 A;  4B48 A;  1SFE A;  1EH8 A;  2JA7 J;  4EEF G;  4U87 A;  1MDM B;  4X6A J;  2NS7 A;  3OYH A;  3EPZ A;  2CQ7 A;  1Y0N A;  1DGR M;  3EQL F;  4E7I A;  1DPR A;  4BAC A;  3WOD F;  2WC2 A;  2QM3 A;  2XSD C;  2Z16 A;  5DDG A;  2EB7 A;  1YJ9 I;  2EWN A;  2K85 A;  2L9R A;  2X6O A;  2QBY B;  3QYE A;  2BXY A;  3G4S I;  5D5U B;  4KT5 C;  3LA3 A;  3PSF A;  3HIF A;  3VYR B;  3BR6 A;  3HRM A;  4G7Z F;  2MH9 A;  1K78 B;  3ISP A;  2VJI A;  2DK5 A;  3DBL B;  4E7L A;  3GTM J;  4AYB A;  2LYC A;  2ZJR F;  2XIG A;  2V1D A;  3IAS 2;  2ISZ A;  4YRV A;  4RGU A;  1XN7 A;  5LGT A;  2DFE A;  4YII A;  1KYW A;  1FT9 A;  1ON1 A;  1RUO A;  1I50 J;  1LE8 B;  1STZ A;  1KU7 A;  1FTZ A;  3BJO A;  1ZR4 A;  3FBI B;  1POG A;  3W2A A;  3BR0 A;  2J5O A;  1T0F C;  1U5T A;  3A1Y A;  4M6V A;  1MNE A;  1WVR A;  2WAD A;  3FDY A;  4KT6 A;  4HF1 A;  4DZP A;  1ZLJ A;  2KLO A;  3LST A;  1BIB A;  4EM2 A;  2E71 A;  1YQA A;  3J81 Z;  3E6B A;  1YW7 A;  1FYM A;  5J1U A;  1R71 A;  2EIK H;  3S2D J;  3HPH A;  4AC0 A;  3I55 I;  2K5C A;  2JWT A;  4C3H J;  2VL8 A;  4GO1 A;  3FKI J;  1BC7 C;  3GTL J;  2AQE A;  3ZXS A;  2DW4 A;  1NG6 A;  4RLF A;  3GTO J;  3H3Z A;  1MJ9 A;  3T0Y A;  4GCV A;  3BR2 A;  2XVC A;  3BJ6 A;  4WF2 A;  2B9S A;  2XAU A;  2XF5 A;  2ZME C;  4LGW A;  5K7H A;  3HBL A;  4XR6 A;  3HOS A;  1W1W E;  1IN6 A;  1IN7 A;  2A5W A;  1WJA A;  2FRH A;  2R7O A;  4U88 A;  2R7X A;  4RAG A;  3IUO A;  4KA4 A;  2P81 A;  1IG7 A;  2F2E A;  2CQN A;  5D6E A;  2IGM A;  2JPC A;  3OYE A;  4KN7 X;  1ON2 A;  2GXA A;  1K6O A;  3S32 A;  2K02 A;  2ZC2 A;  2DOD A;  2ECC A;  1R36 A;  1Y1V J;  5E17 F;  3H3V K;  2NVT J;  1BOB A;  2LRE A;  5CPR B;  2MFZ A;  4JBA A;  3M1E A;  5L3F A;  3CCQ I;  1HF0 A;  2ZME B;  4F7Z A;  2OJE D;  2KP6 A;  2OTL I;  5HLH A;  2OQG A;  3FHN A;  3G1L A;  3H9J A;  3BG3 A;  1NTC A;  3IL2 A;  4ESF A;  1BL0 A;  5HS8 A;  1BN5 A;  2K9N A;  4HX8 A;  1IF1 A;  3HSE A;  4EAT A;  1LDK B;  3TO7 A;  3JRI A;  3B73 A;  3S93 A;  5DTD A;  3HUG A;  3WTX C;  4BNC A;  1M1E B;  4BYY A;  2GIZ A;  4BEH A;  2GOM A;  1TT0 A;  4C3J J;  2L4M A;  3G1O A;  5K7F A;  1K4S A;  3DBR B;  5KAI C;  5ILV A;  4GXO A;  2Y0M A;  3BR5 A;  2Q0O A;  3UR3 C;  1ITY A;  5H2F C;  4OMZ A;  4B4C A;  4DBQ A;  2MW8 A;  1LFU P;  2O8K A;  4EQQ A;  3BPX A;  1KU3 A;  1HDD C;  2F5C A;  1HBX G;  1VQ6 I;  3GW2 A;  2W25 A;  4ENJ A;  5FD5 A;  4DYQ A;  4G9Y A;  1PP7 U;  2I8D A;  3C3W A;  1K7A A;  3HXL A;  4B44 A;  3G71 I;  3A02 A;  4UHT A;  3E5Q A;  1D5Y A;  3J80 K;  2M8E A;  3K7A J;  2MG4 A;  5KVR A;  3WG7 H;  3CUO A;  4HAM A;  2LD5 A;  5LRS A;  1TBX A;  5E3N A;  1XSD A;  1R7J A;  1EKE A;  1QGP A;  3BRO A;  1MW7 A;  2BW3 A;  3ZQC A;  2OA4 A;  2IGN A;  1DU6 A;  3K4B A;  2VKE A;  3KLN A;  3DF8 A;  2V9V A;  1YIT I;  4XQF A;  1K4T A;  1UG0 A;  2A68 F;  1BI3 A;  5IYC J;  3EGV B;  1EA3 A;  2QQ9 A;  1KZH A;  4AM3 A;  5GAD J;  1L3L A;  1O4X A;  3FXM A;  2EV0 A;  1H89 C;  3BG5 A;  1S7A A;  4IVN A;  3HRU A;  2GZW A;  2VOO A;  4ZC3 A;  3TO6 A;  2KIS A;  4Q48 A;  2H09 A;  2X85 A;  2CYY A;  2XPW A;  5IOZ A;  3CC2 I;  1JGG A;  2H94 A;  2V1N A;  1I5Z A;  2A3S A;  2JZY A;  3M8F A;  4XK4 A;  2OAZ A;  1D8K A;  3W3C A;  3ZMS A;  3ZMZ A;  4TV7 A;  5F27 A;  4BUP A;  3W6V A;  1LVK A;  1U0J A;  4P55 A;  4D7M A;  5K7Z A;  4I01 A;  2H1L A;  4AU7 A;  2GAU A;  3CO6 C;  2XRO A;  4LLL A;  1NK3 P;  4XSX F;  2E5N A;  3PUB A;  4XOR A;  4MHG A;  3KEQ A;  3H5A A;  1MBK A;  2DT6 A;  3PSI A;  1VQ7 I;  3E6D A;  5DV5 A;  2MAB A;  3P9K A;  4B47 A;  4XLH A;  3KP4 A;  2QEX I;  1CQT A;  4PJJ A;  2JRT A;  2L01 A;  4MGR A;  2YX7 A;  4DQ2 A;  4U0V A;  1J9I A;  3KP6 A;  4A2U A;  2R4G A;  3Q5F A;  2QZ8 A;  1KA8 A;  3GTQ J;  3K70 C;  1V55 H;  2CQQ A;  1HKS A;  1GVD A;  3GFM A;  1UST A;  3DCF A;  2GOX B;  1LEB A;  2ZSI B;  1Y39 A;  4FCY A;  2BW3 B;  2ZXH A;  4ZYG A;  2PJR B;  1SFK A;  4D1Q A;  5HLI A;  2Y31 A;  1GV2 A;  2VQH A;  2K3F A;  1R22 A;  4EJO A;  5BOX A;  2O61 A;  3SZG A;  3HJE A;  3A2K A;  1B72 B;  2BZT A;  2KMU A;  3EUH A;  4NQW A;  3KZY A;  4F55 A;  4XKV A;  2CRG A;  2QUF A;  3OYI A;  4V19 K;  2XAF A;  1BI2 A;  4UVB A;  1IAW A;  3OOP A;  3R6S A;  4DZJ A;  3BG6 A;  2KZV A;  1DP7 P;  1F43 A;  2A69 F;  1RKW A;  2C6Y A;  1IZ1 A;  3COA C;  4CDG A;  2E60 A;  2M34 A;  4AD9 A;  5FRM A;  2V6E A;  2KIF A;  5F0F A;  1NHA A;  3V42 A;  2OD5 A;  1EJ9 A;  4FE7 A;  1WI9 A;  2M7A A;  2X9D A;  3IKV A;  4O5V A;  4WWC A;  1OYW A;  2XC7 A;  1TWH J;  4XLF A;  3IWZ A;  2EZH A;  4EJV A;  3MKY B;  3LSM A;  1ZAR A;  3BTI A;  2FXA A;  3JAM K;  1OQY A;  3M7G A;  2CS3 A;  3RKX A;  4J19 A;  1BW5 A;  1XTA A;  4BXX J;  3F0C A;  3PUF A;  2HTJ A;  4PJN A;  4BH9 A;  4CA0 A;  2VKV A;  2LF8 A;  1XGO A;  2E1O A;  5F04 A;  5GAG J;  4AID A;  3ZQI A;  1AA7 A;  3FXR A;  1FSE A;  1IRF A;  1FP2 A;  1RUN A;  4E6K G;  1IN4 A;  2LBF B;  3ZR8 X;  1VI0 A;  2HVQ A;  2W57 A;  2W24 A;  3JRH A;  2RC4 A;  4WXC A;  4HDV A;  3KP7 A;  1Z9C A;  3NRV A;  2E1N A;  3VPR A;  1A31 A;  3J80 Z;  5EEA A;  1OYI A;  5F1J A;  4HNT A;  3CLO A;  4FT8 A;  4XBF A;  2W4S A;  3CTA A;  3BR3 A;  4A3M J;  4D5F A;  3KYD B;  3V8L A;  4RM3 A;  3CZ6 A;  2VON A;  2PMH A;  2VOD A;  3I71 A;  1IDZ A;  2X6Y A;  1H9T A;  3PO3 J;  3ERE D;  1X2N A;  1RR7 A;  1W7P D;  4BJ6 C;  2NNY A;  3OL4 A;  1HXD A;  2M0C A;  1X3U A;  2LY9 A;  5LEK A;  3DTE A;  5KNL A;  3DKY A;  2Z99 A;  3WHC A;  1R1V A;  1S5L C;  3OR1 C;  4IZZ A;  1VQ8 I;  3QPT A;  3BLY A;  3GX4 X;  1YI2 I;  5CKT A;  2CU7 A;  3CJR B;  2DA2 A;  3E3V A;  1UFM A;  2HWV A;  4BE2 A;  3C7J A;  3GYH X;  2QLZ A;  1RET A;  5BQT A;  1XC5 A;  1G4D A;  1T2K A;  1DDN A;  2FE3 A;  4BDY A;  3PJR A;  2FOK A;  3VYT B;  3CC4 I;  3IRQ A;  2YUS A;  4G6D A;  3HPG A;  2JT1 A;  2A61 A;  2EV6 A;  4YFX F;  3ASO H;  3QAH A;  1JXS A;  4F92 B;  2DA7 A;  2DT5 A;  2NAZ A;  4MFE A;  1SAU A;  1I3Q J;  4A3L J;  2DFF A;  4HRI A;  1W7P A;  1IW7 F;  5E3O A;  1ODD A;  3ZGK A;  1YHQ I;  4GDF A;  5E1W A;  3RKW A;  4HNV A;  2JVH A;  3CO7 C;  2XKO A;  2R5Y A;  5BS6 A;  1HLV A;  3QP5 A;  2QCO A;  4DIQ A;  4LLN A;  3HC7 A;  2DK8 A;  3ASN H;  2H27 A;  2Y0S A;  4F91 B;  4XOP A;  2M87 A;  5EGO B;  1BW6 A;  4I0A A;  1FWZ A;  4RLQ A;  1S29 A;  3OSG A;  2RNJ A;  4IX7 A;  4UUV A;  3SHF A;  4M3F A;  2BY3 A;  1R6R A;  1W5T A;  2MC4 A;  1SD6 A;  3VDX A;  2HOE A;  3AL0 C;  1YIJ I;  3CJQ B;  2KIM A;  2GXG A;  2CJJ A;  2XRL A;  3K4L A;  2W00 A;  1SAX A;  1Z0X A;  4BBS J;  3CCL I;  2EQR A;  3BWG A;  4IQJ A;  3SZP A;  4E7K A;  2FMY A;  1IXC A;  5FFX A;  3UNG C;  4XRS G;  3S8P A;  4ABZ A;  1Z7U A;  2W7N A;  1RIO H;  3VOD A;  5JI6 A;  1YG2 A;  2OPT A;  2VC1 A;  3TW7 A;  1XB4 A;  2ME0 A;  3DXJ F;  4UUS A;  1WJE A;  2LRD A;  5FKK A;  4EJT A;  1FMW A;  3DU6 A;  3DEE A;  4PJM A;  3PIO F;  1SFO J;  2AO9 A;  3GO5 A;  5J47 A;  3ECO A;  2XAS A;  1OPC A;  5HDG A;  4LB6 B;  3CJN A;  4ZYD A;  1P92 A;  2IGK A;  2LLK A;  1BM9 A;  4MFD A;  3ZMU A;  5ICE A;  3Q3S A;  2GQQ A;  3E0J B;  1CF7 B;  4D9J A;  2HNH A;  1QPI A;  2JA2 A;  2ADU A;  1LFB A;  5D6F A;  4CZC A;  4DW6 A;  2WA0 A;  3GLX A;  2VKD A;  1N75 A;  3CJS B;  5FGM A;  1W7P B;  1JT6 A;  4AVZ A;  1TWG J;  3T1B A;  2ECB A;  3FMS A;  2GA2 A;  2Y75 A;  4LK1 F;  2Y0S N;  4Y15 A;  4HOB A;  2B63 J;  1X19 A;  3C1D A;  4KIC A;  5JVT A;  2W82 A;  1MSE C;  3CCY A;  1AU7 A;  1IXS B;  2IPQ X;  2ZXJ A;  5DD4 A;  1FP1 D;  3PFI A;  1QQI A;  4QSH A;  3HOU J;  3PNT A;  4LJZ F;  1FOW A;  3NQO A;  3DEW A;  1SFU A;  1OR7 A;  1X58 A;  1MH4 A;  5TRD A;  2OTJ I;  3ABT A;  2FML A;  2VIX A;  2XPV A;  3I53 A;  5IY5 H;  1HW2 A;  2JN6 A;  3VOE A;  2F5D A;  3DPT A;  3M1C A;  3D1N I;  2DA4 A;  4N4O B;  5M5W J;  1Z6R A;  5BPI A;  1MH3 A;  1VQP I;  1JKQ C;  3EDP A;  4Y7N J;  5HDN A;  3MN2 A;  1G6N A;  1J09 A;  1MBH A;  2DU9 A;  3BOQ A;  3E5U A;  3PFY A;  1BI0 A;  3S2H J;  2QGU A;  5IP6 A;  1LJ9 A;  1HOM A;  3LMM A;  1SFX A;  1V4R A;  3DBH B;  3TO9 A;  2ZJQ F;  1KYZ A;  2COM A;  4UV8 A;  2L54 A;  2CV2 A;  3K70 D;  3F8C A;  4OWR B;  1GUU A;  3CCM I;  4XLC A;  1U3E M;  2PJR A;  5TJJ A;  2OZU A;  1QPM A;  2B7E A;  3MKZ A;  3JRC A;  3FIW A;  1PP8 F;  4WK8 F;  1TNS A;  2IGO A;  3HTU A;  2E1M C;  1HKT A;  1MIJ A;  4BHP A;  1A35 A;  5M5X J;  3L7W A;  2OU2 A;  5CVI A;  1D0Z A;  1ZQ3 P;  3H35 A;  2IS6 A;  4XLN F;  1J0R A;  2HZT A;  3AG4 H;  3V4G A;  1GDT A;  1R23 A;  2MA3 A;  4ZYE A;  2PMU A;  4BGD A;  3E97 A;  1B8I A;  3LFU A;  2IT0 A;  1ZRE A;  3GWZ A;  5D4S A;  2FQ4 A;  1T39 A;  3S1M J;  2LG4 A;  1T33 A;  5L3G A;  3W2V A;  3I58 A;  2VAS A;  4UXN A;  4EJU A;  3BZK A;  3FK7 A;  3JCU C;  4H0E A;  3MCZ A;  5HS9 A;  4LOC A;  4IL6 C;  1UZC A;  3BTC A;  1IRG A;  1PUF B;  4V2G A;  3RQ4 A;  5FRO A;  2MC3 A;  3PIP F;  1XCV A;  2TRT A;  2JUC A;  2P6S A;  3H92 A;  4G6Q A;  4B1R A;  4JQF A;  4F52 A;  4ZTF A;  2XUB A;  2CG4 A;  5KK1 A;  2IA1 A;  1MMN A;  5ILU A;  5HLG A;  2QQ8 A;  5J4Y A;  2DMQ A;  3FK6 A;  5IPA A;  1HCR A;  4KIF A;  3WU2 C;  1YO5 C;  1B4A A;  2KKO A;  3A0H C;  1MDM A;  2DI3 A;  3E5X A;  3I4P A;  2V1U A;  1QRY A;  2LKP A;  4ENN A;  1ORK A;  2VBW A;  3GUD A;  3OYG A;  3VWB A;  5TIS C;  3OYM A;  4D0P A;  2EBI A;  4BQN A;  1GXP A;  4IJA A;  2LTP A;  3Q0U A;  2KJB A;  1JTX A;  3S3M A;  3OYL A;  5HNH A;  2XF7 A;  1MSF C;  4EGZ A;  4S0H B;  2LY2 A;  1GV5 A;  3JRF A;  4NDL A;  1WPK A;  1OCC H;  4XLA A;  2Y9Y A;  2O5R A;  5CQG A;  2WY8 Q;  5ED4 A;  1OCP A;  4II2 A;  3LL7 A;  2L5Q A;  4YEL A;  4F93 B;  3BJA A;  2W84 A;  4M9X A;  3MKL A;  4QLC U;  2IRF G;  4M3D A;  1OCZ H;  4R79 A;  4NUB A;  3P5J A;  2NVQ J;  2BBY A;  1U9O A;  1C0W A;  1J7K A;  3KP2 A;  3I4M J;  2XKP A;  2L9N A;  1LVA A;  4PFP A;  4DJA A;  5DM7 F;  3RI4 A;  4H4K C;  3FM5 A;  1TQI A;  1JKO C;  1X4P A;  4KNY A;  3I4N J;  2VN2 A;  4PK4 A;  4Y13 A;  3QYB A;  5JR3 A;  3K4K A;  2HYF A;  3TP0 A;  1ZN2 A;  2EA2 A;  1ETV A;  2P5L C;  4OIQ F;  2RVC A;  3AG2 H;  2WB1 N;  5F64 A;  4OMY A;  2QBY A;  4BHC A;  1XPX A;  1LB2 A;  4I76 A;  4M72 A;  3SYT A;  1A6Q A;  3G73 A;  1W5S A;  5HS7 A;  2R5Y B;  3CCE I;  1D0X A;  4RB0 A;  3CMM A;  1HSJ A;  3DTI A;  2CWE A;  2IJL A;  1G3S A;  1Y0U A;  1UAA A;  4E7J A;  2HYJ A;  3H0G J;  2L3D A;  4IXA A;  3KET A;  2TCT A;  4U0Y A;  3I64 A;  2Z5U A;  1I39 A;  1YS7 A;  4A5N A;  3OY9 A;  2HVS A;  4BS9 A;  1OR7 C;  4PFO A;  2F5V A;  1O3R A;  3ULQ B;  3RKQ A;  4EM0 B;  1FBQ A;  5FKN A;  5JLX A;  2FUG 2;  1E3O C;  3L9F A;  2F4O B;  2JA6 J;  2JVG A;  3OOU A;  3O2P E;  1XSV A;  2VBX A;  4LMY A;  4V2F A;  3K69 A;  4BXF A;  1SD5 A;  3DPU A;  2CGP A;  2DOA A;  3ABK H;  4N4N B;  5EJC A;  5D8L B;  2MGQ A;  1AWC A;  2JQ7 A;  4IOA F;  4QWQ A;  2YSR A;  2EJR A;  2NVX J;  5LHI A;  4LG3 A;  1G59 A;  1F9N A;  2FNP A;  2FBH A;  1DQU A;  3OWT A;  1FMV A;  4A3B J;  3KP3 A;  1JHH A;  3C2H A;  2LDU A;  2R3S A;  1RC9 A;  5EG0 A;  2JMW A;  6PAX A;  4ZJZ A;  5EZH A;  1NG7 A;  3IAM 2;  5F0H A;  1N78 A;  3F6O A;  3N4M A;  4BEH B;  4PGG A;  3TKY A;  2Z2S B;  3ZQ7 A;  3TOA A;  3OS2 A;  1JI8 A;  1SAN A;  4IPA A;  1R5H A;  3MZY A;  1SMT A;  3KCC A;  4UUT A;  1D1C A;  1JE8 A;  1FLI A;  5CVJ A;  3IRR A;  2Z1D A;  3ELK A;  5E1Z B;  3WGG A;  4E7S A;  3R0A A;  4WXD A;  3P9I A;  1GLN A;  4L9N A;  1JGS A;  2HXI A;  3U21 A;  4P9U A;  3OYK A;  1IJW C;  4G94 A;  2M3A A;  2MH2 A;  3RSN A;  1FX7 A;  2WV1 A;  2KQR A;  3ABL H;  3NWS A;  4RGX A;  1VND A;  3B6C A;  2P4W A;  3WTS C;  3V8K A;  3H5N A;  2ZME A;  3FXJ A;  4ZH4 F;  1IRZ A;  3K2Z A;  2CUF A;  3MFK A;  2KRF A;  1GT0 C;  1ZHF A;  1P2F A;  2CH0 A;  2DBB A;  2QSF X;  2OCC H;  4M74 A;  1S7O A;  2MSY A;  1ZH5 A;  3S15 J;  1Z3X A;  3K1P A;  5J4V A;  3FXO A;  3VSL A;  5L3E A;  4CH7 A;  5JHU A;  5J8F A;  3GFI A;  4BBR J;  4UVA A;  2RNG A;  3JRD A;  4G7O F;  2X51 A;  5HOO A;  2ZSH B;  3IH2 A;  2H1K A;  5K1Y A;  3ABM H;  3JTH A;  4FET A;  1UHW A;  4C9Y A;  1IXR C;  4X0G A;  2BY2 A;  4LD5 A;  4O3M A;  3W6J B;  1TW3 A;  4IRI A;  4HST A;  3HGY A;  4F3Q A;  4RBO A;  1BR2 A;  2DLL A;  2K4J A;  3DWL E;  1Z3Y A;  1W4M A;  2X1D A;  2R7F A;  2FSW A;  3LFK A;  4HBL A;  4A0Z A;  3H0D A;  2IA0 A;  4M6Y A;  1ZRD A;  4GYG A;  1LEA A;  4HLX A;  5CVR A;  2L9V A;  5EF6 A;  2G9W A;  4HQM A;  3RDI A;  2ACJ A;  2HQR A;  4U7B A;  4UV9 A;  3W6K B;  1S3J A;  5EZG A;  5B3S H;  4RDU A;  2KT0 A;  1IRX A;  3JRA A;  4HQE A;  2B0L A;  2O3F A;  3LAJ A;  2P0W A;  2EFN A;  3BPV A;  3H9Q A;  1D1B A;  2KJC A;  1W0U A;  1KQ8 A;  1MGT A;  2KRC A;  4E7H A;  2HTS A;  4DBR A;  1NK2 P;  3HOX J;  2R5Z A;  2ZXW H;  4PUS A;  3H1C A;  1RPW A;  3CCJ I;  4B09 A;  1B6A A;  4IHY A;  2Y69 H;  1W5C C;  3K4C A;  2PFB A;  4FQG A;  4XRF A;  5K5R A;  4FX0 A;  2Z33 A;  3D5R C;  1P6R A;  4LG0 A;  2UXN A;  3K1N A;  2DQR A;  5C3E J;  3L2V A;  2DCE A;  2DOE A;  3U9G A;  4L5E A;  3FX3 A;  5F0C A;  2ESN A;  2DN0 A;  2MBF A;  5D5W B;  1XSX A;  2X4H A;  1USS A;  1APL C;  3QOE A;  2V4J C;  2VQC A;  3BQY A;  1QU3 A;  1Y8Q B;  3RYP A;  4FTH A;  3U1K A;  1ZYR F;  2ZB9 A;  3L09 A;  4ANJ A;  4HNU A;  2OF7 A;  3H9G A;  5AIP A;  4ENM A;  1ZRC A;  2AS5 F;  2K9S A;  1R58 A;  2DYR H;  2W1O A;  4U7D A;  1Y56 A;  2EFQ A;  2O0Y A;  1F36 A;  2VPR A;  1F1Z A;  1UHM A;  1XDU A;  3RYR A;  3TDZ C;  3OYD A;  2KIQ A;  4RGR A;  2GIV A;  4N9H A;  1SD4 A;  4MEX F;  1ZRF A;  1BBY A;  2PJP A;  2OCE A;  1IUF A;  3F8M A;  1I1G A;  4D5C A;  5FLX Z;  1HA8 A;  3I54 A;  1G3T A;  4ZDP A;  3GZ5 A;  3AKZ A;  1ETO A;  5JLW A;  1OIS A;  3WU1 B;  3ZRG A;  1XMX A;  1LPQ A;  1JUS A;  1RZ4 A;  1FYK A;  3VYU B;  3K10 A;  3KZZ A;  4XN0 A;  2DAO A;  4C2T A;  4MLO A;  4BQQ A;  5E79 C;  1P4X A;  3K2A A;  2XB5 A;  2IW5 A;  1JUM A;  3MVP A;  2L7F P;  2PEX A;  1I3A A;  1QZY A;  4KIB A;  2VJ4 A;  1IO2 A;  5FO5 A;  1B1B A;  4CSW A;  5B1A H;  1MJB A;  3WTT C;  4A3I J;  3OYN A;  2R0Q C;  5DUI A;  3KEO A;  3DKX A;  3V7R A;  4KDP A;  3WE3 A;  1YRN B;  4MEY F;  2K9L A;  3WTW C;  2D1H A;  3Q9S A;  4CCJ A;  1I27 A;  1T6S A;  4GRI A;  4IF4 A;  1FIA A;  2FBI A;  4Z2Y A;  4B43 A;  4IHV A;  3HOW J;  2MLG A;  1VQM I;  2EIL H;  2Q2E A;  1SVM A;  2IP2 A;  4EM1 A;  5HVQ C;  3L2R A;  3R0J A;  2AXL A;  2R7D A;  3RTR A;  4CCN A;  5M3F J;  4QTR A;  2CV0 A;  4L5J A;  4HX4 A;  2KZG A;  2GXB A;  3I59 A;  3ERM A;  3HUG B;  3PM1 A;  5DYM A;  2HEO A;  3HTS B;  2ZBK A;  1P4W A;  3NWT A;  3ZQF A;  3HHH A;  1YX5 A;  2EZI A;  3CES A;  3K9T A;  3CQZ J;  3MMY B;  2LC2 A;  2BHY A;  5FB2 A;  2X0L A;  5GTI C;  2PLY A;  1XDS A;  2JK3 A;  1K78 A;  1U5T C;  4MQV A;  4KN4 X;  5FRN A;  2DXI A;  4L0Y B;  2VQL A;  1Z67 A;  4HG2 A;  2R7Q A;  2X1C A;  5GAE J;  2HPM A;  3PNY A;  4P96 A;  4AIH A;  1DGW Y;  1SMY F;  1E2X A;  1RR8 C;  3I59 B;  1ZGJ A;  2E19 A;  3CMA I;  1LFP A;  4K2E A;  4HF2 A;  5CVU A;  1ZAO A;  2L0K A;  3T8R A;  1LE8 A;  3LWF A;  3L1P A;  4N9I A;  4KMU X;  4Y4R A;  3KE2 A;  4A93 J;  3JRG A;  3A01 B;  1OFC X;  2W85 A;  3HB9 A;  3TBI A;  4ITV A;  1K61 A;  2RDP A;  1XMA A;  3TQN A;  4IHX A;  1WJ5 A;  2LR8 A;  1MNM C;  3I56 I;  1PJR A;  1R1T A;  1HQC A;  2L7K A;  5LD2 C;  1TC3 C;  2HVR A;  5D4R A;  2EFW A;  1HC8 A;  4Z6Y A;  4UUS B;  1KQ9 A;  1YFH A;  4GYI A;  1SEU A;  3S1Q J;  2A6E F;  1TWA J;  1WHU A;  5LBQ A;  4HEA 2;  9ANT A;  1LKX A;  4NC8 A;  2G0E A;  1YJW I;  1U78 A;  1PYV A;  2V9P A;  1WQ2 A;  1FOY A;  2RQP A;  3HYI A;  4AWX B;  4OU0 A;  2F5F A;  3SDG A;  5IT9 K;  2BXZ A;  1J2X A;  3LA2 A;  1D5V A;  3ONQ A;  3DTK A;  2M45 A;  3QPH A;  2R93 J;  3KIO A;  2QQB A;  1S72 I;  2QQA A;  2OV7 A;  4N0B A;  3QPL A;  5AIQ A;  3ZOB A;  1FYL A;  1Y8R B;  3GME A;  3L2Q A;  5CJ9 A;  3RQI A;  4IEJ A;  3QOP A;  3DU5 A;  2MD0 A;  3GTG J;  1U6G A;  4A6D A;  3T8T A;  3EYI A;  4XKC A;  1G2H A;  3WGH A;  2E7X A;  1V5G A;  1OCT C;  2WAF A;  5IYB J;  2VBY A;  1T98 A;  1GVJ A;  3QU3 A;  3CDH A;  2QKL B;  1L0O C;  2ZFW A;  2CFO A;  1XGM A;  1D0Y A;  1WJF A;  4RGS A;  4A12 A;  4ESJ A;  1LQ1 A;  1X1P A;  2NRA C;  1HST A;  1ETW A;  1P9Q C;  2BEO A;  4R8H A;  4A3G J;  5C44 J;  2UZK A;  2I10 A;  2K9Q A;  3Q0W A;  1ZK8 A;  3FXL A;  4AIJ A;  1AOY A;  2KL4 A;  3IC7 A;  1CGP A;  4XKB A;  2LP0 A;  3TMO A;  3O8G A;  4GGG A;  2ESH A;  1FNN A;  3IWF A;  3C18 A;  3M8E A;  1TWC J;  2P7C B;  1WJC A;  1S8N A;  2Y48 A;  4A3K J;  1E3P A;  2M30 A;  2ID6 A;  2ZJP F;  3LSI A;  3F8N A;  3Q9V A;  3BC8 A;  5D5X B;  2X48 A;  1YIO A;  2DT7 B;  2HR3 A;  2NOJ B;  2RRE A;  2LVS A;  5E8I A;  5CQE A;  1XX5 A;  4M73 A;  2E36 A;  3S1N J;  2E1M B;  2LNB A;  1YW8 A;  2CSO A;  3CP8 A;  4RAF A;  1BJZ A;  2HDD A;  1Z77 A;  2KDO A;  4NC7 A;  3LQR A;  4XLP F;  4ZYH A;  2D5V A;  3DLL F;  3S17 J;  2Y9Z A;  2VJ5 A;  4O6J A;  2O7O A;  5B5E C;  5HLT A;  2YU9 J;  4JX5 A;  5K5Q A;  2QVO A;  2IS4 A;  2XGD A;  1R9T J;  3LSP A;  4OAZ A;  2BYV E;  4EV0 A;  2DTR A;  1FJL A;  4BY7 J;  1JJ8 C;  3J7A O;  5DS9 A;  2BE5 F;  3I3L A;  1U5T B;  4CCL A;  4IKF A;  1A04 A;  4BXU A;  3LSR A;  1ETY A;  4FIS A;  2ZXI A;  1XCB A;  3DKW A;  2RGV A;  2LOO A;  2PMZ A;  3F9K A;  4NBQ A;  1KGS A;  5F1R A;  1X1D A;  3KX2 A;  1TLH B;  2F6C A;  3IP4 B;  1Z1D A;  3F3X A;  1BC8 C;  3A4C A;  4IHT A;  2XAQ A;  3KYC B;  2K27 A;  2LMD A;  3K0L A;  3CF5 F;  3W2W A;  5EEG A;  3CCS I;  1FTT A;  4UB8 C;  4AVP A;  3B02 A;  4WXH A;  1N25 A;  2XGX A;  3WHB A;  1ZG5 A;  1AHD P;  2D2W A;  3BG7 A;  2L9S A;  4LFU A;  3IHU A;  4M3B A;  3CDI A;  3FBN B;  3OL3 A;  1B8I B;  2IA2 A;  4BHB A;  4GFB A;  4UVC A;  3NEU A;  3BCB A;  3OV8 A;  3HOZ J;  1VQ4 I;  3M9A A;  1MBF A;  3N05 A;  2OBP A;  2R7R A;  2O9L A;  4HSR A;  4L9J A;  2HS5 A;  3SZT A;  5A2Q Z;  5FKO A;  3U2R A;  3J81 K;  4Q5S F;  1S7E A;  1ACI A;  2GWR A;  3TP3 A;  2NXN B;  4DOZ A;  1WRJ A;  2J5P A;  2PI0 A;  5J40 A;  1WH5 A;  2BHZ A;  4CYC A;  1YTY A;  1V5E A;  1WIB A;  3FMR A;  4CYD A;  1E17 A;  1VQK I;  5LFA A;  2COB A;  2WAQ A;  5A2Q K;  3L2U A;  5GPC A;  3ZMD A;  2JSC A;  2XF6 A;  2VBZ A;  2O03 A;  2VUM J;  2I5U A;  2IAI A;  1S9H A;  3EUH C;  4NB5 A;  1E3H A;  2P5V A;  3CC7 I;  4CUG A;  3O6B B;  1FSH A;  3K1M A;  5FLV A;  4ON0 A;  3I0T A;  1YOV B;  2DMP A;  4MIM A;  1JKR C;  2UXX A;  2Z3Y A;  1BR1 A;  2BVL A;  1ZG3 A;  1LDJ A;  4L18 B;  2ZCW A;  5BNG A;  4L9V A;  1GHC A;  1ETQ A;  2M4K A;  3DQV C;  4JX6 A;  4Y17 A;  1LNW A;  1MBE A;  2M8G X;  4BJ5 C;  4M71 A;  1WZ2 A;  3CCR I;  4I7H A;  4B3X A;  4A0Y A;  1VQO I;  5D5V B;  1T08 B;  2CFX A;  4HLY A;  3P9C A;  1RKT A;  1HW5 A;  3MWM A;  3SFI A;  2XSJ C;  4OAY A;  3QP6 A;  3ESW B;  2XGC A;  3HOY J;  3LQQ A;  5HDK A;  2RKH A;  1ZTR A;  1R5G A;  4B3A A;  4XID A;  3GVA A;  4I09 A;  5GP9 A;  4DGW B;  5B66 C;  3OYC A;  4CCM A;  1REP C;  1VTN C;  1N77 A;  4C30 A;  3CUQ B;  5GTH C;  2R7V A;  2RV8 A;  3A01 A;  3BTL A;  3N97 A;  2HOT A;  1H8A C;  2DOF A;  3K6G A;  4I2O A;  3LAP A;  2GM4 A;  3G3Z A;  2JSP A;  4BY1 J;  4KFC A;  2BV6 A;  1JKP C;  1X4O A;  2DA3 A;  3QWL A;  1VFC A;  3J7Y J;  4YIR X;  1TQP A;  3CF2 A;  4A0X A;  4LIT A;  3EUK L;  4QPQ A;  5EYR A;  2ISY A;  4CYC B;  2K9M A;  2L02 A;  3SFZ A;  5F08 A;  1V3F A;  3DV8 A;  1X3W B;  2ZJ2 A;  3HKZ N;  1HW1 A;  4HX7 A;  4L0Z B;  2DDA A;  2E2H J;  4M9Z A;  5FLX K;  4IQ4 A;  4NC6 A;  3LSJ A;  1NH3 A;  3H3U A;  4A5M A;  1TL8 A;  3WTZ A;  1FZP B;  3HDD A;  1Z91 A;  3OSF A;  1MMA A;  1FBS A;  4LIU A;  4HW0 A;  1SVO A;  3M3Y J;  3E6C C;  3FF5 A;  4I02 A;  3DFG A;  3O8H A;  2X6W A;  3G2B A;  3GCM A;  4BKX A;  5DEQ A;  2FEZ A;  4XIC A;  3WTV C;  4BJT A;  3CD6 I;  3KP5 A;  1X2M A;  1ONV A;  3SEZ A;  1OJL A;  5L3B A;  2HKX A;  5EEH A;  3RPU A;  4KIT B;  1QVT A;  2HXO A;  2KPM A;  3FWE A;  5JFR A;  1B59 A;  2ZKZ A;  4IRG A;  1U8B A;  3TL4 X;  2QWW A;  2H6B A;  4L5I A;  2WY7 Q;  4KUM A;  3RKY A;  1ZGW A;  1WJD A;  1R4M B;  2P7V B;  5M5Y J;  1YE9 A;  3OIO A;  5DUK A;  2EH3 A;  3HRS A;  3LNQ A;  3MZ8 A;  5LLQ A;  4OIR F;  3RZO J;  1MD0 A;  3CME I;  1ZGA A;  4I6Z A;  2K7L A;  2ELH A;  1B9M A;  4CO8 A;  1B72 A;  2Q1Z B;  4CHU A;  3M4O J;  5EDN A;  1ETK A;  2DA5 A;  2G7U A;  5LGU A;  1U9N A;  2PMZ N;  3J7Z I;  5CLS A;  1UB9 A;  5IP7 J;  4J00 A;  5E3L A;  2P5K A;  1O7F A;  3KFW X;  4MTD A;  4XSZ F;  1MJA A;  2VT3 A;  3S3N A;  3EYY A;  4QIW N;  5ICG A;  2OC6 A;  1CF7 A;  2VOP A;  3L00 A;  2VQG A;  2YR2 A;  4WCG A;  2HFH A;  2V26 A;  3M8J A;  1I6X A;  3MD2 A;  3BP8 A;  3VSK A;  4CCK A;  5K5O A;  4KYW A;  2F5E A;  1UMQ A;  3GBG A;  4RAY A; 
#chains in the Genus database with same CATH homology
 1YIT I;  1YIJ I;  3CJQ B;  1VQ5 I;  3EGV B;  3CF5 F;  5GAD J;  1YJW I;  3CCS I;  1VQ9 I;  3CCL I;  4IO9 F;  1FOY A;  5GAG J;  1YJN I;  5JVG F;  1VQL I;  3CCE I;  3J7Y J;  2QA4 I;  1S72 I;  3CC2 I;  5DM6 F;  1VQ4 I;  3PIO F;  1FOX A;  3CCU I;  1ACI A;  3G6E I;  2NXN B;  3CCQ I;  5GAH J;  3PIP F;  4IOC F;  2H8W A;  1VQM I;  1VQ7 I;  2JQ7 A;  2OTL I;  1WIB A;  4IOA F;  3CJS B;  1VQK I;  2QEX I;  3CCJ I;  1QA6 A;  1VQ8 I;  1YI2 I;  3CD6 I;  3CJR B;  3CCV I;  3CJT B;  2ZJP F;  3CC7 I;  1YJ9 I;  3G4S I;  2E35 A;  3CC4 I;  2E36 A;  1Y39 A;  1VQN I;  1FOW A;  4UY8 I;  2K3F A;  2ZJR F;  2OTJ I;  3CME I;  5GAE J;  3DLL F;  1MMS A;  2E34 A;  2FOW A;  1VQ6 I;  3J7Z I;  4V19 K;  1VQP I;  3CMA I;  1YHQ I;  3CCR I;  1VQO I;  3G71 I;  2ZJQ F;  3I56 I;  3CCM I;  5DM7 F;  1HC8 A;  3I55 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...