2E3UA

Crystal structure analysis of dim2p from pyrococcus horikoshii ot3
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
172
structure length
166
Chain Sequence
KQEEYVKIPKDRIAVLIGKKGQTKKEIEKRTKTKITIDSETGEVWITSTKETEDPLAVWKARDIVLAIGRGFSPERAFRLLNEGEYLEIINLTDIIALPRVRGRIIGRKGRTRQIIEEMSGASVSVYGKTVAIIGNPIQIEIAKTAIEKLARGSPHGSVYRYLERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein PH1566
publication title Crystal structure of Dim2p: a preribosomal RNA processing factor, from Pyrococcus horikoshii OT3 at 2.30 A
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Rna binding protein
total genus 56
structure length 166
sequence length 172
ec nomenclature
pdb deposition date 2006-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2e3uA01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2e3uA02
2CTFA 1VIHA 1KHMA 1WE8A 4BA2I 1ZTGA 4QMFB 2JVZA 2CTJA 2JE6I 1K1GA 4B8TA 4LIJA 2OPUA 1EC6A 2JZXA 3AEVB 2JEBI 1J4WA 2CTKA 2BL5A 4NBQA 1ZZJA 2ANRA 1DTJA 3U1KA 1TUAA 2YQRA 1ZZKA 1VIGA 2CPQA 5JEAG 5C0XG 2AXYA 2NN6G 2FMRA 1J5KA 2PY9A 1X4MA 4OO1G 3V69A 2ANNA 2DGRA 2HH3A 4JVHA 1X4NA 2BA0A 2JA9A 2QNDA 2P2RA 2CTLA 2CTMA 2MJHA 3VKEA 4AM3A 2CTEA 2OPVA 3L7ZC 2PQUA 2JEAI 4IFDG 4JVYA 4WANA 4BA1I 5K36G 2Z0SA 1DT4A 1ZZIA 2HH2A 4WALA 4AIMA 2E3UA 1WVNA
chains in the Genus database with same CATH superfamily
1HNWH 4X64H 2UXBH 1KHMA 5LL6b 3T1YH 1ZTGA 1XMQH 3OSSD 2CTJA 2JE6I 2LRRA 4JI4H 4LFCH 4LIJA 1X0AA 2JZXA 5LMNH 1J4WA 2CTKA 1N32H 2UUAH 2BL5A 4X65H 3KDGA 4JI3H 2VQFH 5DT9A 3RF2A 2LF0A 1ZZKA 3U1KA 4B8CD 5JEAG 3JAMW 3J80W 2AXYA 5IT9W 1IBKH 3J81W 2K1HA 3OETA 3I0PA 4JVHA 1X4NA 2QNDA 2JA9A 4DV4H 1XRHA 4EC5A 1J5EH 4OX9H 3L7ZC 2PQUA 4IFDG 3GR5A 4JVYA 2D9IA 4B3RH 4JI2H 4YHHH 4DV2H 1ZZIA 1SEIA 4LFAH 4NXNH 1S20A 1X9ZA 1N34H 2UUCH 3KDKA 3UOEA 2M6QA 4DV0H 4NZRM 4B8TA 1Z2IA 2OPUA 2X06A 2CWFA 2Y3MA 1VBIA 1EC6A 4DR6H 4PDBA 2O4CA 4JI8H 2JEBI 4DR2H 4LFBH 4K0KH 1HR0H 1V8CA 4LF5H 1V9NA 4DR1H 1ZZJA 4B3TH 1TUAA 2ZQEA 2CPQA 3GABA 4NXMH 4OO1G 3GKUA 1X4MA 5FLXW 3V69A 1HNZH 1IBMH 2DGRA 4AQYH 1FKAH 4JI5H 4DV3H 4DV7H 3OTOH 4DR3H 2E5LH 2P2RA 4JI6H 3VKEA 4LF9H 2JEAI 1N33H 4BA1I 5A2QW 4LF8H 5K36G 2HH2A 3J7AK 2PT7G 2CTFA 1VIHA 2HHHH 4BA2I 1HNXH 4QMFB 2M8WA 2JVZA 4DV5H 4NZTM 2UXDH 1S03G 3AEVB 4B3SH 5LMUH 2UU9H 4JI7H 4OCHA 4NBQA 4DUYH 1DTJA 2CPMA 2YQRA 1J5KA 1VIGA 2CWHA 2LTMA 2NN6G 2FMRA 1I94H 4JV5H 4JYAH 4DR4H 2BA0A 4JI0H 4AM3A 2CTLA 2CTMA 1UG8A 4E9JA 2MJHA 2CTEA 4WANA 4FJSA 1WHRA 4DV1H 4JI1H 4B3MH 4X62H 3NCVA 2F4VH 2Z0SA 1DT4A 4AIMA 4LF7H 2VKCA 3QD7X 4G08A 4DR5H 3SB1A 1WE8A 1MSZA 3T1HH 1ODHA 4GKJH 1I6UA 1NXUA 4KHPH 4DUZH 2UUBH 1XMOH 1N36H 1F0XA 2FPHX 4FJUA 4OD6A 1WTJA 1XNQH 2ANRA 1AN7A 5C0XG 1FJGH 2PY9A 4DR7H 4LF6H 4YY3H 2A1SA 4H8AA 1PQXA 2ANNA 2HH3A 4X66H 2UXCH 2G8YA 5IWAH 3FAUA 2OPVA 2FFMA 2VQEH 3EZJA 4DV6H 1XNRH 4LF4H 2LTLA 5BR8H 4GKKH 1K1GA 4WALA 2ZM6H 1IBLH 2E3UA 1WVNA
chains in the Genus database with same CATH topology
2CTFA 1VIHA 1KHMA 1WE8A 4BA2I 1ZTGA 4QMFB 2JVZA 2CTJA 2JE6I 1K1GA 4B8TA 4LIJA 2OPUA 1EC6A 2JZXA 3AEVB 2JEBI 1J4WA 2CTKA 2BL5A 4NBQA 1ZZJA 2ANRA 1DTJA 3U1KA 1TUAA 2YQRA 1ZZKA 1VIGA 2CPQA 5JEAG 5C0XG 2AXYA 2NN6G 2FMRA 1J5KA 2PY9A 1X4MA 4OO1G 3V69A 2ANNA 2DGRA 2HH3A 4JVHA 1X4NA 2BA0A 2JA9A 2QNDA 2P2RA 2CTLA 2CTMA 2MJHA 3VKEA 4AM3A 2CTEA 2OPVA 3L7ZC 2PQUA 2JEAI 4IFDG 4JVYA 4WANA 4BA1I 5K36G 2Z0SA 1DT4A 1ZZIA 2HH2A 4WALA 4AIMA 2E3UA 1WVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTF A;  1VIH A;  1KHM A;  1WE8 A;  4BA2 I;  1ZTG A;  4QMF B;  2JVZ A;  2CTJ A;  2JE6 I;  1K1G A;  4B8T A;  4LIJ A;  2OPU A;  1EC6 A;  2JZX A;  3AEV B;  2JEB I;  1J4W A;  2CTK A;  2BL5 A;  4NBQ A;  1ZZJ A;  2ANR A;  1DTJ A;  3U1K A;  1TUA A;  2YQR A;  1ZZK A;  1VIG A;  2CPQ A;  5JEA G;  5C0X G;  2AXY A;  2NN6 G;  2FMR A;  1J5K A;  2PY9 A;  1X4M A;  4OO1 G;  3V69 A;  2ANN A;  2DGR A;  2HH3 A;  4JVH A;  1X4N A;  2BA0 A;  2JA9 A;  2QND A;  2P2R A;  2CTL A;  2CTM A;  2MJH A;  3VKE A;  4AM3 A;  2CTE A;  2OPV A;  3L7Z C;  2PQU A;  2JEA I;  4IFD G;  4JVY A;  4WAN A;  4BA1 I;  5K36 G;  2Z0S A;  1DT4 A;  1ZZI A;  2HH2 A;  4WAL A;  4AIM A;  2E3U A;  1WVN A; 
#chains in the Genus database with same CATH topology
 1HNW H;  4X64 H;  2UXB H;  1KHM A;  5LL6 b;  3T1Y H;  1ZTG A;  1XMQ H;  3OSS D;  2CTJ A;  2JE6 I;  2LRR A;  4JI4 H;  4LFC H;  4LIJ A;  1X0A A;  2JZX A;  5LMN H;  1J4W A;  2CTK A;  1N32 H;  2UUA H;  2BL5 A;  4X65 H;  3KDG A;  4JI3 H;  2VQF H;  5DT9 A;  3RF2 A;  2LF0 A;  1ZZK A;  3U1K A;  4B8C D;  5JEA G;  3JAM W;  3J80 W;  2AXY A;  5IT9 W;  1IBK H;  3J81 W;  2K1H A;  3OET A;  3I0P A;  4JVH A;  1X4N A;  2QND A;  2JA9 A;  4DV4 H;  1XRH A;  4EC5 A;  1J5E H;  4OX9 H;  3L7Z C;  2PQU A;  4IFD G;  3GR5 A;  4JVY A;  2D9I A;  4B3R H;  4JI2 H;  4YHH H;  4DV2 H;  1ZZI A;  1SEI A;  4LFA H;  4NXN H;  1S20 A;  1X9Z A;  1N34 H;  2UUC H;  3KDK A;  3UOE A;  2M6Q A;  4DV0 H;  4NZR M;  4B8T A;  1Z2I A;  2OPU A;  2X06 A;  2CWF A;  2Y3M A;  1VBI A;  1EC6 A;  4DR6 H;  4PDB A;  2O4C A;  4JI8 H;  2JEB I;  4DR2 H;  4LFB H;  4K0K H;  1HR0 H;  1V8C A;  4LF5 H;  1V9N A;  4DR1 H;  1ZZJ A;  4B3T H;  1TUA A;  2ZQE A;  2CPQ A;  3GAB A;  4NXM H;  4OO1 G;  3GKU A;  1X4M A;  5FLX W;  3V69 A;  1HNZ H;  1IBM H;  2DGR A;  4AQY H;  1FKA H;  4JI5 H;  4DV3 H;  4DV7 H;  3OTO H;  4DR3 H;  2E5L H;  2P2R A;  4JI6 H;  3VKE A;  4LF9 H;  2JEA I;  1N33 H;  4BA1 I;  5A2Q W;  4LF8 H;  5K36 G;  2HH2 A;  3J7A K;  2PT7 G;  2CTF A;  1VIH A;  2HHH H;  4BA2 I;  1HNX H;  4QMF B;  2M8W A;  2JVZ A;  4DV5 H;  4NZT M;  2UXD H;  1S03 G;  3AEV B;  4B3S H;  5LMU H;  2UU9 H;  4JI7 H;  4OCH A;  4NBQ A;  4DUY H;  1DTJ A;  2CPM A;  2YQR A;  1J5K A;  1VIG A;  2CWH A;  2LTM A;  2NN6 G;  2FMR A;  1I94 H;  4JV5 H;  4JYA H;  4DR4 H;  2BA0 A;  4JI0 H;  4AM3 A;  2CTL A;  2CTM A;  1UG8 A;  4E9J A;  2MJH A;  2CTE A;  4WAN A;  4FJS A;  1WHR A;  4DV1 H;  4JI1 H;  4B3M H;  4X62 H;  3NCV A;  2F4V H;  2Z0S A;  1DT4 A;  4AIM A;  4LF7 H;  2VKC A;  3QD7 X;  4G08 A;  4DR5 H;  3SB1 A;  1WE8 A;  1MSZ A;  3T1H H;  1ODH A;  4GKJ H;  1I6U A;  1NXU A;  4KHP H;  4DUZ H;  2UUB H;  1XMO H;  1N36 H;  1F0X A;  2FPH X;  4FJU A;  4OD6 A;  1WTJ A;  1XNQ H;  2ANR A;  1AN7 A;  5C0X G;  1FJG H;  2PY9 A;  4DR7 H;  4LF6 H;  4YY3 H;  2A1S A;  4H8A A;  1PQX A;  2ANN A;  2HH3 A;  4X66 H;  2UXC H;  2G8Y A;  5IWA H;  3FAU A;  2OPV A;  2FFM A;  2VQE H;  3EZJ A;  4DV6 H;  1XNR H;  4LF4 H;  2LTL A;  5BR8 H;  4GKK H;  1K1G A;  4WAL A;  2ZM6 H;  1IBL H;  2E3U A;  1WVN A; 
#chains in the Genus database with same CATH homology
 2CTF A;  1VIH A;  1KHM A;  1WE8 A;  4BA2 I;  1ZTG A;  4QMF B;  2JVZ A;  2CTJ A;  2JE6 I;  1K1G A;  4B8T A;  4LIJ A;  2OPU A;  1EC6 A;  2JZX A;  3AEV B;  2JEB I;  1J4W A;  2CTK A;  2BL5 A;  4NBQ A;  1ZZJ A;  2ANR A;  1DTJ A;  3U1K A;  1TUA A;  2YQR A;  1ZZK A;  1VIG A;  2CPQ A;  5JEA G;  5C0X G;  2AXY A;  2NN6 G;  2FMR A;  1J5K A;  2PY9 A;  1X4M A;  4OO1 G;  3V69 A;  2ANN A;  2DGR A;  2HH3 A;  4JVH A;  1X4N A;  2BA0 A;  2JA9 A;  2QND A;  2P2R A;  2CTL A;  2CTM A;  2MJH A;  3VKE A;  4AM3 A;  2CTE A;  2OPV A;  3L7Z C;  2PQU A;  2JEA I;  4IFD G;  4JVY A;  4WAN A;  4BA1 I;  5K36 G;  2Z0S A;  1DT4 A;  1ZZI A;  2HH2 A;  4WAL A;  4AIM A;  2E3U A;  1WVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...