2E3UA

Crystal structure analysis of dim2p from pyrococcus horikoshii ot3
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
172
structure length
166
Chain Sequence
b'KQEEYVKIPKDRIAVLIGKKGQTKKEIEKRTKTKITIDSETGEVWITSTKETEDPLAVWKARDIVLAIGRGFSPERAFRLLNEGEYLEIINLTDIIALPRVRGRIIGRKGRTRQIIEEMSGASVSVYGKTVAIIGNPIQIEIAKTAIEKLARGSPHGSVYRYLERR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein PH1566
publication title Crystal structure of Dim2p: a preribosomal RNA processing factor, from Pyrococcus horikoshii OT3 at 2.30 A
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Rna binding protein
total genus 56
structure length 166
sequence length 172
ec nomenclature
pdb deposition date 2006-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2e3uA01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2e3uA02
1VIHA 1VIGA 2CTMA 4AIMA 2PY9A 4JVHA 3VKEA 2BL5A 4LIJA 1ZTGA 2AXYA 2CPQA 2JEAI 5C0XG 4OO1G 1K1GA 2HH2A 2OPUA 2JZXA 2E3UA 2HH3A 2OPVA 4JVYA 3AEVB 3V69A 4IFDG 2YQRA 1EC6A 1TUAA 2CTEA 5K36G 4AM3A 2JA9A 3U1KA 4NBQA 2CTLA 1DTJA 2CTKA 2JVZA 4B8TA 2ANRA 1WE8A 2DGRA 1KHMA 2JE6I 2PQUA 2QNDA 1X4MA 2Z0SA 1J5KA 4WALA 1J4WA 1ZZKA 3L7ZC 2MJHA 4BA2I 2JEBI 2BA0A 4WANA 5JEAG 1WVNA 4QMFB 2NN6G 2P2RA 2FMRA 1DT4A 2CTJA 1X4NA 4BA1I 1ZZJA 1ZZIA 2CTFA 2ANNA
chains in the Genus database with same CATH superfamily
4LF7H 1VIGA 2PY9A 3J81W 4DV0H 4DR5H 5IWAH 1ODHA 4YHHH 2UUBH 2FFMA 3GR5A 4B3SH 1MSZA 1F0XA 2UUCH 4DR2H 1XNRH 3T1YH 4X64H 4LF9H 4JVYA 2ZQEA 1EC6A 1S20A 1WTJA 2X06A 3KDGA 2CTLA 5LL6b 1HNXH 5IT9W 2ANRA 1WE8A 4DV5H 1KHMA 1IBKH 3OTOH 2JE6I 3OSSD 2M6QA 4LFCH 5LMUH 1I6UA 4BA2I 4AQYH 2VQFH 2BA0A 1N34H 4WANA 4QMFB 2NN6G 4LF5H 2HHHH 2M8WA 1DT4A 2O4CA 3NCVA 4NXMH 1N32H 2FPHX 2P2RA 4K0KH 4LF8H 2UXDH 4AIMA 4JI4H 4JVHA 5LMNH 2BL5A 1FJGH 1ZTGA 2AXYA 4JI3H 4DV7H 2JEAI 2LRRA 4LFAH 2JZXA 2CPMA 2E3UA 2HH3A 1NXUA 3AEVB 1N36H 2ZM6H 4E9JA 2LF0A 1Z2IA 3U1KA 1I94H 4B8TA 4DR6H 5DT9A 4JI2H 5BR8H 2PQUA 4GKJH 3UOEA 1X4MA 2Z0SA 1J5KA 4X65H 4OCHA 4DV6H 4DV2H 1HNZH 2MJHA 4LFBH 4PDBA 4X66H 4DR7H 1IBLH 3I0PA 2E5LH 4JI8H 4DUZH 2CWHA 1ZZJA 1XRHA 1ZZIA 4LF4H 1VIHA 2CTMA 4GKKH 3RF2A 3VKEA 4FJSA 4DV1H 4YY3H 4JI0H 2CPQA 5C0XG 4OO1G 1K1GA 2PT7G 2G8YA 4OX9H 2UUAH 4DR1H 2OPVA 3J7AK 4IFDG 2YQRA 1TUAA 2CTEA 2D9IA 4DV3H 5K36G 4B3TH 1XMQH 2VKCA 2JVZA 1DTJA 2CTKA 5FLXW 2LTLA 4H8AA 1HNWH 1V8CA 2A1SA 2UU9H 2QNDA 4WALA 1J4WA 1ZZKA 3QD7X 3JAMW 4JV5H 3GABA 4OD6A 2VQEH 4LF6H 2ANNA 1X0AA 4G08A 1S03G 1AN7A 4EC5A 4DR4H 3T1HH 1X4NA 1J5EH 2LTMA 2Y3MA 2FMRA 2CTFA 4JI6H 4NXNH 3KDKA 4NZRM 2F4VH 4JYAH 1PQXA 4LIJA 1HR0H 1XMOH 4FJUA 2HH2A 2OPUA 3SB1A 4DUYH 4JI1H 4DR3H 3V69A 3FAUA 4X62H 2CWFA 4JI7H 4DV4H 1V9NA 4AM3A 1FKAH 2K1HA 3J80W 2JA9A 5A2QW 4NBQA 4JI5H 4B3RH 1UG8A 1X9ZA 2DGRA 3EZJA 3GKUA 3OETA 1SEIA 1IBMH 1VBIA 3L7ZC 2JEBI 5JEAG 1WVNA 4NZTM 4B8CD 1N33H 2UXBH 2CTJA 2UXCH 4B3MH 4BA1I 1WHRA 4KHPH 1XNQH
chains in the Genus database with same CATH topology
1VIHA 1VIGA 2CTMA 4AIMA 2PY9A 4JVHA 3VKEA 2BL5A 4LIJA 1ZTGA 2AXYA 2CPQA 2JEAI 5C0XG 4OO1G 1K1GA 2HH2A 2OPUA 2JZXA 2E3UA 2HH3A 2OPVA 4JVYA 3AEVB 3V69A 4IFDG 2YQRA 1EC6A 1TUAA 2CTEA 5K36G 4AM3A 2JA9A 3U1KA 4NBQA 2CTLA 1DTJA 2CTKA 2JVZA 4B8TA 2ANRA 1WE8A 2DGRA 1KHMA 2JE6I 2PQUA 2QNDA 1X4MA 2Z0SA 1J5KA 4WALA 1J4WA 1ZZKA 3L7ZC 2MJHA 4BA2I 2JEBI 2BA0A 4WANA 5JEAG 1WVNA 4QMFB 2NN6G 2P2RA 2FMRA 1DT4A 2CTJA 1X4NA 4BA1I 1ZZJA 1ZZIA 2CTFA 2ANNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VIH A;  1VIG A;  2CTM A;  4AIM A;  2PY9 A;  4JVH A;  3VKE A;  2BL5 A;  4LIJ A;  1ZTG A;  2AXY A;  2CPQ A;  2JEA I;  5C0X G;  4OO1 G;  1K1G A;  2HH2 A;  2OPU A;  2JZX A;  2E3U A;  2HH3 A;  2OPV A;  4JVY A;  3AEV B;  3V69 A;  4IFD G;  2YQR A;  1EC6 A;  1TUA A;  2CTE A;  5K36 G;  4AM3 A;  2JA9 A;  3U1K A;  4NBQ A;  2CTL A;  1DTJ A;  2CTK A;  2JVZ A;  4B8T A;  2ANR A;  1WE8 A;  2DGR A;  1KHM A;  2JE6 I;  2PQU A;  2QND A;  1X4M A;  2Z0S A;  1J5K A;  4WAL A;  1J4W A;  1ZZK A;  3L7Z C;  2MJH A;  4BA2 I;  2JEB I;  2BA0 A;  4WAN A;  5JEA G;  1WVN A;  4QMF B;  2NN6 G;  2P2R A;  2FMR A;  1DT4 A;  2CTJ A;  1X4N A;  4BA1 I;  1ZZJ A;  1ZZI A;  2CTF A;  2ANN A; 
#chains in the Genus database with same CATH topology
 4LF7 H;  1VIG A;  2PY9 A;  3J81 W;  4DV0 H;  4DR5 H;  5IWA H;  1ODH A;  4YHH H;  2UUB H;  2FFM A;  3GR5 A;  4B3S H;  1MSZ A;  1F0X A;  2UUC H;  4DR2 H;  1XNR H;  3T1Y H;  4X64 H;  4LF9 H;  4JVY A;  2ZQE A;  1EC6 A;  1S20 A;  1WTJ A;  2X06 A;  3KDG A;  2CTL A;  5LL6 b;  1HNX H;  5IT9 W;  2ANR A;  1WE8 A;  4DV5 H;  1KHM A;  1IBK H;  3OTO H;  2JE6 I;  3OSS D;  2M6Q A;  4LFC H;  5LMU H;  1I6U A;  4BA2 I;  4AQY H;  2VQF H;  2BA0 A;  1N34 H;  4WAN A;  4QMF B;  2NN6 G;  4LF5 H;  2HHH H;  2M8W A;  1DT4 A;  2O4C A;  3NCV A;  4NXM H;  1N32 H;  2FPH X;  2P2R A;  4K0K H;  4LF8 H;  2UXD H;  4AIM A;  4JI4 H;  4JVH A;  5LMN H;  2BL5 A;  1FJG H;  1ZTG A;  2AXY A;  4JI3 H;  4DV7 H;  2JEA I;  2LRR A;  4LFA H;  2JZX A;  2CPM A;  2E3U A;  2HH3 A;  1NXU A;  3AEV B;  1N36 H;  2ZM6 H;  4E9J A;  2LF0 A;  1Z2I A;  3U1K A;  1I94 H;  4B8T A;  4DR6 H;  5DT9 A;  4JI2 H;  5BR8 H;  2PQU A;  4GKJ H;  3UOE A;  1X4M A;  2Z0S A;  1J5K A;  4X65 H;  4OCH A;  4DV6 H;  4DV2 H;  1HNZ H;  2MJH A;  4LFB H;  4PDB A;  4X66 H;  4DR7 H;  1IBL H;  3I0P A;  2E5L H;  4JI8 H;  4DUZ H;  2CWH A;  1ZZJ A;  1XRH A;  1ZZI A;  4LF4 H;  1VIH A;  2CTM A;  4GKK H;  3RF2 A;  3VKE A;  4FJS A;  4DV1 H;  4YY3 H;  4JI0 H;  2CPQ A;  5C0X G;  4OO1 G;  1K1G A;  2PT7 G;  2G8Y A;  4OX9 H;  2UUA H;  4DR1 H;  2OPV A;  3J7A K;  4IFD G;  2YQR A;  1TUA A;  2CTE A;  2D9I A;  4DV3 H;  5K36 G;  4B3T H;  1XMQ H;  2VKC A;  2JVZ A;  1DTJ A;  2CTK A;  5FLX W;  2LTL A;  4H8A A;  1HNW H;  1V8C A;  2A1S A;  2UU9 H;  2QND A;  4WAL A;  1J4W A;  1ZZK A;  3QD7 X;  3JAM W;  4JV5 H;  3GAB A;  4OD6 A;  2VQE H;  4LF6 H;  2ANN A;  1X0A A;  4G08 A;  1S03 G;  1AN7 A;  4EC5 A;  4DR4 H;  3T1H H;  1X4N A;  1J5E H;  2LTM A;  2Y3M A;  2FMR A;  2CTF A;  4JI6 H;  4NXN H;  3KDK A;  4NZR M;  2F4V H;  4JYA H;  1PQX A;  4LIJ A;  1HR0 H;  1XMO H;  4FJU A;  2HH2 A;  2OPU A;  3SB1 A;  4DUY H;  4JI1 H;  4DR3 H;  3V69 A;  3FAU A;  4X62 H;  2CWF A;  4JI7 H;  4DV4 H;  1V9N A;  4AM3 A;  1FKA H;  2K1H A;  3J80 W;  2JA9 A;  5A2Q W;  4NBQ A;  4JI5 H;  4B3R H;  1UG8 A;  1X9Z A;  2DGR A;  3EZJ A;  3GKU A;  3OET A;  1SEI A;  1IBM H;  1VBI A;  3L7Z C;  2JEB I;  5JEA G;  1WVN A;  4NZT M;  4B8C D;  1N33 H;  2UXB H;  2CTJ A;  2UXC H;  4B3M H;  4BA1 I;  1WHR A;  4KHP H;  1XNQ H; 
#chains in the Genus database with same CATH homology
 1VIH A;  1VIG A;  2CTM A;  4AIM A;  2PY9 A;  4JVH A;  3VKE A;  2BL5 A;  4LIJ A;  1ZTG A;  2AXY A;  2CPQ A;  2JEA I;  5C0X G;  4OO1 G;  1K1G A;  2HH2 A;  2OPU A;  2JZX A;  2E3U A;  2HH3 A;  2OPV A;  4JVY A;  3AEV B;  3V69 A;  4IFD G;  2YQR A;  1EC6 A;  1TUA A;  2CTE A;  5K36 G;  4AM3 A;  2JA9 A;  3U1K A;  4NBQ A;  2CTL A;  1DTJ A;  2CTK A;  2JVZ A;  4B8T A;  2ANR A;  1WE8 A;  2DGR A;  1KHM A;  2JE6 I;  2PQU A;  2QND A;  1X4M A;  2Z0S A;  1J5K A;  4WAL A;  1J4W A;  1ZZK A;  3L7Z C;  2MJH A;  4BA2 I;  2JEB I;  2BA0 A;  4WAN A;  5JEA G;  1WVN A;  4QMF B;  2NN6 G;  2P2R A;  2FMR A;  1DT4 A;  2CTJ A;  1X4N A;  4BA1 I;  1ZZJ A;  1ZZI A;  2CTF A;  2ANN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...