2E3UA

Crystal structure analysis of dim2p from pyrococcus horikoshii ot3
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
172
structure length
166
Chain Sequence
KQEEYVKIPKDRIAVLIGKKGQTKKEIEKRTKTKITIDSETGEVWITSTKETEDPLAVWKARDIVLAIGRGFSPERAFRLLNEGEYLEIINLTDIIALPRVRGRIIGRKGRTRQIIEEMSGASVSVYGKTVAIIGNPIQIEIAKTAIEKLARGSPHGSVYRYLERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Dim2p: a preribosomal RNA processing factor, from Pyrococcus horikoshii OT3 at 2.30 A
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Rna binding protein
molecule keywords Hypothetical protein PH1566
total genus 56
structure length 166
sequence length 172
ec nomenclature
pdb deposition date 2006-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2e3uA01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2e3uA02
2PY9A 1X4MA 4B8TA 1VIHA 1WVNA 2P2RA 5K36G 4AM3A 5C0XG 2CTMA 2CTLA 1ZZJA 1ZTGA 2HH2A 4WALA 1K1GA 2BA0A 4WANA 4JVHA 2CTEA 1J4WA 1X4NA 3AEVB 3V69A 2ANRA 2OPVA 5JEAG 2NN6G 2ANNA 2MJHA 1DT4A 4JVYA 2FMRA 2E3UA 2HH3A 2CTFA 2JEBI 4NBQA 1ZZKA 4AIMA 1ZZIA 2BL5A 1J5KA 4BA2I 3U1KA 1WE8A 2JA9A 2OPUA 4IFDG 3VKEA 1DTJA 1VIGA 2JVZA 2PQUA 2AXYA 4BA1I 2CPQA 4OO1G 2QNDA 2JZXA 3L7ZC 1TUAA 2Z0SA 4LIJA 2YQRA 2DGRA 1EC6A 2CTJA 2JE6I 1KHMA 4QMFB 2JEAI 2CTKA
chains in the Genus database with same CATH superfamily
2X06A 1VIHA 3J81W 1N33H 1I94H 3J7AK 5LMUH 4AM3A 4B3TH 4DV5H 2VKCA 1S20A 1ZZJA 3UOEA 4WANA 2BA0A 2ZQEA 1HNZH 3V69A 5BR8H 5JEAG 2ZM6H 1MSZA 4LF5H 4LFCH 2CWFA 2MJHA 4DUZH 1HNWH 4JI7H 1XNQH 2ANNA 1ZZIA 2HH3A 2HHHH 4NBQA 1S03G 4KHPH 2E5LH 2F4VH 4BA2I 4JI8H 2Y3MA 2OPUA 4DUYH 4LF8H 2A1SA 3RF2A 3VKEA 1DTJA 4EC5A 4IFDG 1XNRH 1XMQH 3T1YH 4X64H 4OO1G 4LF6H 3GABA 2DGRA 4X62H 2JE6I 2CWHA 4H8AA 3OTOH 3KDGA 2UXBH 5LMNH 2PY9A 1X4MA 1WHRA 4X66H 4DV7H 2P2RA 1NXUA 1HR0H 1N32H 2M6QA 4OX9H 2HH2A 1F0XA 3NCVA 4DR3H 3KDKA 1J4WA 2UUBH 4JI6H 1X4NA 4LF9H 5IWAH 1IBLH 1AN7A 1V9NA 2FMRA 2JEBI 4AIMA 1X9ZA 3U1KA 2JVZA 3GKUA 4BA1I 4OD6A 1IBKH 4LFBH 4LFAH 2LRRA 2LTMA 2UUCH 4DR7H 5DT9A 2Z0SA 4LIJA 2G8YA 1EC6A 1PQXA 1FJGH 2D9IA 4NZTM 1X0AA 4B8TA 4JI1H 1WVNA 5K36G 2O4CA 3J80W 2CTMA 4K0KH 4JI5H 4GKKH 2PT7G 3OSSD 4LF4H 1VBIA 1ZTGA 1UG8A 3I0PA 2UUAH 5IT9W 2LF0A 4GKJH 2UU9H 5LL6b 4B3RH 4LF7H 2ANRA 2OPVA 4JV5H 2NN6G 4DR1H 4YHHH 4JVYA 4PDBA 4FJUA 2E3UA 4JI2H 4DV4H 1K1GA 4DV2H 2BL5A 4FJSA 1XRHA 3JAMW 3T1HH 2PQUA 1N34H 1ODHA 4JI0H 5A2QW 3QD7X 2CPQA 4JI3H 2LTLA 1WTJA 2QNDA 4DR5H 3L7ZC 1XMOH 1TUAA 1SEIA 4JI4H 4NXMH 3SB1A 1KHMA 2UXCH 2CTKA 1Z2IA 5FLXW 2K1HA 4DR2H 2VQFH 2M8WA 5C0XG 2CTLA 1N36H 1J5EH 4OCHA 4DR4H 4JYAH 2FFMA 4X65H 2FPHX 4WALA 4JVHA 2CTEA 3EZJA 4DV6H 1IBMH 3AEVB 4NXNH 2CPMA 4B3MH 1DT4A 1HNXH 2CTFA 2UXDH 1ZZKA 2VQEH 1V8CA 1J5KA 4DR6H 1WE8A 2JA9A 4DV0H 1VIGA 4B3SH 2AXYA 3GR5A 3FAUA 3OETA 4G08A 4NZRM 4B8CD 4YY3H 4AQYH 1FKAH 2JZXA 4DV1H 1I6UA 2YQRA 2CTJA 4DV3H 4QMFB 2JEAI 4E9JA
chains in the Genus database with same CATH topology
2PY9A 1X4MA 4B8TA 1VIHA 1WVNA 2P2RA 5K36G 4AM3A 5C0XG 2CTMA 2CTLA 1ZZJA 1ZTGA 2HH2A 4WALA 1K1GA 2BA0A 4WANA 4JVHA 2CTEA 1J4WA 1X4NA 3AEVB 3V69A 2ANRA 2OPVA 5JEAG 2NN6G 2ANNA 2MJHA 1DT4A 4JVYA 2FMRA 2E3UA 2HH3A 2CTFA 2JEBI 4NBQA 1ZZKA 4AIMA 1ZZIA 2BL5A 1J5KA 4BA2I 3U1KA 1WE8A 2JA9A 2OPUA 4IFDG 3VKEA 1DTJA 1VIGA 2JVZA 2PQUA 2AXYA 4BA1I 2CPQA 4OO1G 2QNDA 2JZXA 3L7ZC 1TUAA 2Z0SA 4LIJA 2YQRA 2DGRA 1EC6A 2CTJA 2JE6I 1KHMA 4QMFB 2JEAI 2CTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PY9 A;  1X4M A;  4B8T A;  1VIH A;  1WVN A;  2P2R A;  5K36 G;  4AM3 A;  5C0X G;  2CTM A;  2CTL A;  1ZZJ A;  1ZTG A;  2HH2 A;  4WAL A;  1K1G A;  2BA0 A;  4WAN A;  4JVH A;  2CTE A;  1J4W A;  1X4N A;  3AEV B;  3V69 A;  2ANR A;  2OPV A;  5JEA G;  2NN6 G;  2ANN A;  2MJH A;  1DT4 A;  4JVY A;  2FMR A;  2E3U A;  2HH3 A;  2CTF A;  2JEB I;  4NBQ A;  1ZZK A;  4AIM A;  1ZZI A;  2BL5 A;  1J5K A;  4BA2 I;  3U1K A;  1WE8 A;  2JA9 A;  2OPU A;  4IFD G;  3VKE A;  1DTJ A;  1VIG A;  2JVZ A;  2PQU A;  2AXY A;  4BA1 I;  2CPQ A;  4OO1 G;  2QND A;  2JZX A;  3L7Z C;  1TUA A;  2Z0S A;  4LIJ A;  2YQR A;  2DGR A;  1EC6 A;  2CTJ A;  2JE6 I;  1KHM A;  4QMF B;  2JEA I;  2CTK A; 
#chains in the Genus database with same CATH topology
 2X06 A;  1VIH A;  3J81 W;  1N33 H;  1I94 H;  3J7A K;  5LMU H;  4AM3 A;  4B3T H;  4DV5 H;  2VKC A;  1S20 A;  1ZZJ A;  3UOE A;  4WAN A;  2BA0 A;  2ZQE A;  1HNZ H;  3V69 A;  5BR8 H;  5JEA G;  2ZM6 H;  1MSZ A;  4LF5 H;  4LFC H;  2CWF A;  2MJH A;  4DUZ H;  1HNW H;  4JI7 H;  1XNQ H;  2ANN A;  1ZZI A;  2HH3 A;  2HHH H;  4NBQ A;  1S03 G;  4KHP H;  2E5L H;  2F4V H;  4BA2 I;  4JI8 H;  2Y3M A;  2OPU A;  4DUY H;  4LF8 H;  2A1S A;  3RF2 A;  3VKE A;  1DTJ A;  4EC5 A;  4IFD G;  1XNR H;  1XMQ H;  3T1Y H;  4X64 H;  4OO1 G;  4LF6 H;  3GAB A;  2DGR A;  4X62 H;  2JE6 I;  2CWH A;  4H8A A;  3OTO H;  3KDG A;  2UXB H;  5LMN H;  2PY9 A;  1X4M A;  1WHR A;  4X66 H;  4DV7 H;  2P2R A;  1NXU A;  1HR0 H;  1N32 H;  2M6Q A;  4OX9 H;  2HH2 A;  1F0X A;  3NCV A;  4DR3 H;  3KDK A;  1J4W A;  2UUB H;  4JI6 H;  1X4N A;  4LF9 H;  5IWA H;  1IBL H;  1AN7 A;  1V9N A;  2FMR A;  2JEB I;  4AIM A;  1X9Z A;  3U1K A;  2JVZ A;  3GKU A;  4BA1 I;  4OD6 A;  1IBK H;  4LFB H;  4LFA H;  2LRR A;  2LTM A;  2UUC H;  4DR7 H;  5DT9 A;  2Z0S A;  4LIJ A;  2G8Y A;  1EC6 A;  1PQX A;  1FJG H;  2D9I A;  4NZT M;  1X0A A;  4B8T A;  4JI1 H;  1WVN A;  5K36 G;  2O4C A;  3J80 W;  2CTM A;  4K0K H;  4JI5 H;  4GKK H;  2PT7 G;  3OSS D;  4LF4 H;  1VBI A;  1ZTG A;  1UG8 A;  3I0P A;  2UUA H;  5IT9 W;  2LF0 A;  4GKJ H;  2UU9 H;  5LL6 b;  4B3R H;  4LF7 H;  2ANR A;  2OPV A;  4JV5 H;  2NN6 G;  4DR1 H;  4YHH H;  4JVY A;  4PDB A;  4FJU A;  2E3U A;  4JI2 H;  4DV4 H;  1K1G A;  4DV2 H;  2BL5 A;  4FJS A;  1XRH A;  3JAM W;  3T1H H;  2PQU A;  1N34 H;  1ODH A;  4JI0 H;  5A2Q W;  3QD7 X;  2CPQ A;  4JI3 H;  2LTL A;  1WTJ A;  2QND A;  4DR5 H;  3L7Z C;  1XMO H;  1TUA A;  1SEI A;  4JI4 H;  4NXM H;  3SB1 A;  1KHM A;  2UXC H;  2CTK A;  1Z2I A;  5FLX W;  2K1H A;  4DR2 H;  2VQF H;  2M8W A;  5C0X G;  2CTL A;  1N36 H;  1J5E H;  4OCH A;  4DR4 H;  4JYA H;  2FFM A;  4X65 H;  2FPH X;  4WAL A;  4JVH A;  2CTE A;  3EZJ A;  4DV6 H;  1IBM H;  3AEV B;  4NXN H;  2CPM A;  4B3M H;  1DT4 A;  1HNX H;  2CTF A;  2UXD H;  1ZZK A;  2VQE H;  1V8C A;  1J5K A;  4DR6 H;  1WE8 A;  2JA9 A;  4DV0 H;  1VIG A;  4B3S H;  2AXY A;  3GR5 A;  3FAU A;  3OET A;  4G08 A;  4NZR M;  4B8C D;  4YY3 H;  4AQY H;  1FKA H;  2JZX A;  4DV1 H;  1I6U A;  2YQR A;  2CTJ A;  4DV3 H;  4QMF B;  2JEA I;  4E9J A; 
#chains in the Genus database with same CATH homology
 2PY9 A;  1X4M A;  4B8T A;  1VIH A;  1WVN A;  2P2R A;  5K36 G;  4AM3 A;  5C0X G;  2CTM A;  2CTL A;  1ZZJ A;  1ZTG A;  2HH2 A;  4WAL A;  1K1G A;  2BA0 A;  4WAN A;  4JVH A;  2CTE A;  1J4W A;  1X4N A;  3AEV B;  3V69 A;  2ANR A;  2OPV A;  5JEA G;  2NN6 G;  2ANN A;  2MJH A;  1DT4 A;  4JVY A;  2FMR A;  2E3U A;  2HH3 A;  2CTF A;  2JEB I;  4NBQ A;  1ZZK A;  4AIM A;  1ZZI A;  2BL5 A;  1J5K A;  4BA2 I;  3U1K A;  1WE8 A;  2JA9 A;  2OPU A;  4IFD G;  3VKE A;  1DTJ A;  1VIG A;  2JVZ A;  2PQU A;  2AXY A;  4BA1 I;  2CPQ A;  4OO1 G;  2QND A;  2JZX A;  3L7Z C;  1TUA A;  2Z0S A;  4LIJ A;  2YQR A;  2DGR A;  1EC6 A;  2CTJ A;  2JE6 I;  1KHM A;  4QMF B;  2JEA I;  2CTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...