2E3UA

Crystal structure analysis of dim2p from pyrococcus horikoshii ot3
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
172
structure length
166
Chain Sequence
b'KQEEYVKIPKDRIAVLIGKKGQTKKEIEKRTKTKITIDSETGEVWITSTKETEDPLAVWKARDIVLAIGRGFSPERAFRLLNEGEYLEIINLTDIIALPRVRGRIIGRKGRTRQIIEEMSGASVSVYGKTVAIIGNPIQIEIAKTAIEKLARGSPHGSVYRYLERR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein PH1566
molecule tags Rna binding protein
source organism Pyrococcus horikoshii
publication title Crystal structure of Dim2p: a preribosomal RNA processing factor, from Pyrococcus horikoshii OT3 at 2.30 A
pubmed doi rcsb
total genus 56
structure length 166
sequence length 172
ec nomenclature
pdb deposition date 2006-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2e3uA01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2e3uA02
2CTLA 4JVHA 3L7ZC 4WALA 1DT4A 1DTJA 2OPUA 4B8TA 2JEAI 4JVYA 2FMRA 4LIJA 1WVNA 2DGRA 5K36G 4BA2I 2CTEA 2HH2A 2ANRA 2PY9A 2BL5A 1X4NA 2CTMA 2CTJA 2YQRA 1J4WA 1VIGA 1ZTGA 4IFDG 2JVZA 2JE6I 2OPVA 2AXYA 2P2RA 2CTFA 2E3UA 2NN6G 2BA0A 1EC6A 2JA9A 2ANNA 5C0XG 1X4MA 2CTKA 1WE8A 1ZZIA 4AM3A 5JEAG 4QMFB 2Z0SA 3V69A 4AIMA 2MJHA 1TUAA 4OO1G 4BA1I 3VKEA 1ZZJA 2JZXA 3U1KA 2PQUA 2CPQA 2HH3A 1VIHA 1K1GA 1J5KA 1KHMA 2JEBI 4NBQA 4WANA 2QNDA 1ZZKA 3AEVB
chains in the Genus database with same CATH superfamily
1IBLH 4JVHA 1NXUA 1N33H 3L7ZC 1SEIA 3SB1A 2UUBH 4FJUA 1WVNA 4DR4H 2DGRA 1MSZA 2CPMA 3J80W 2CWHA 3OSSD 5LMNH 2CWFA 2CTEA 4JI6H 2HH2A 4NZTM 1HNXH 1J4WA 1X4NA 4LFCH 2YQRA 1VIGA 2G8YA 2JE6I 4LF8H 2P2RA 4X64H 3NCVA 2E3UA 4JI2H 4AQYH 4JI8H 1EC6A 3FAUA 2ZM6H 1WTJA 4G08A 2CTKA 5C0XG 3OTOH 4DV5H 1WE8A 4LFAH 1J5EH 1PQXA 4X66H 1S20A 3EZJA 3V69A 2VQFH 1TUAA 3J81W 4NXMH 4LF9H 4BA1I 1ZZJA 2A1SA 1ODHA 4OCHA 2CPQA 2HH3A 4DV7H 4PDBA 1J5KA 2LTLA 4DV1H 1KHMA 1XRHA 4JI3H 4WANA 5IT9W 1IBKH 1XNQH 2UXCH 1F0XA 1DTJA 2OPUA 4B8TA 3T1YH 4GKKH 5LMUH 4DR5H 2E5LH 2UXDH 3I0PA 4DUYH 2HHHH 2FPHX 3GKUA 4DR7H 1HR0H 2BL5A 1ZTGA 2PT7G 1XNRH 4OD6A 4LF7H 2JVZA 1AN7A 4H8AA 4GKJH 2AXYA 4LFBH 1WHRA 2NN6G 4JI5H 4JI1H 2ANNA 5A2QW 3KDGA 4LF6H 4DR1H 3KDKA 4QMFB 3GABA 4AIMA 1N36H 1V9NA 2JZXA 1HNWH 5DT9A 2PQUA 2LTMA 4E9JA 5FLXW 1VIHA 2VQEH 1X9ZA 1XMQH 4NBQA 4OX9H 2K1HA 4DV0H 1N34H 4LF4H 1DT4A 2JEAI 5IWAH 4JYAH 2Y3MA 1X0AA 4NZRM 3JAMW 2D9IA 4B8CD 4YY3H 1VBIA 2ANRA 4B3SH 4JI7H 5K36G 1Z2IA 2CTMA 1IBMH 4IFDG 2CTFA 4NXNH 4B3RH 2BA0A 2JA9A 1X4MA 2X06A 4JI0H 1I6UA 4AM3A 1FKAH 3T1HH 4X62H 4JI4H 4BA2I 4EC5A 2UUCH 3U1KA 5BR8H 4LF5H 4B3TH 3GR5A 1FJGH 1K1GA 1I94H 4K0KH 2LF0A 2VKCA 1ZZKA 3AEVB 2CTLA 3QD7X 1N32H 4DV3H 2M6QA 4WALA 4JV5H 4JVYA 2FMRA 1V8CA 4LIJA 5LL6b 2ZQEA 3RF2A 4YHHH 4FJSA 4OO1G 4DR2H 2PY9A 2UXBH 2CTJA 4DR3H 2OPVA 1UG8A 4DV6H 2UUAH 1HNZH 2O4CA 2FFMA 1S03G 4KHPH 1ZZIA 5JEAG 2Z0SA 4DV2H 2MJHA 1XMOH 3J7AK 3OETA 3VKEA 4DR6H 4DUZH 3UOEA 4X65H 4DV4H 2M8WA 4B3MH 2JEBI 2LRRA 2F4VH 2QNDA 2UU9H
chains in the Genus database with same CATH topology
2CTLA 4JVHA 3L7ZC 4WALA 1DT4A 1DTJA 2OPUA 4B8TA 2JEAI 4JVYA 2FMRA 4LIJA 1WVNA 2DGRA 5K36G 4BA2I 2CTEA 2HH2A 2ANRA 2PY9A 2BL5A 1X4NA 2CTMA 2CTJA 2YQRA 1J4WA 1VIGA 1ZTGA 4IFDG 2JVZA 2JE6I 2OPVA 2AXYA 2P2RA 2CTFA 2E3UA 2NN6G 2BA0A 1EC6A 2JA9A 2ANNA 5C0XG 1X4MA 2CTKA 1WE8A 1ZZIA 4AM3A 5JEAG 4QMFB 2Z0SA 3V69A 4AIMA 2MJHA 1TUAA 4OO1G 4BA1I 3VKEA 1ZZJA 2JZXA 3U1KA 2PQUA 2CPQA 2HH3A 1VIHA 1K1GA 1J5KA 1KHMA 2JEBI 4NBQA 4WANA 2QNDA 1ZZKA 3AEVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTL A;  4JVH A;  3L7Z C;  4WAL A;  1DT4 A;  1DTJ A;  2OPU A;  4B8T A;  2JEA I;  4JVY A;  2FMR A;  4LIJ A;  1WVN A;  2DGR A;  5K36 G;  4BA2 I;  2CTE A;  2HH2 A;  2ANR A;  2PY9 A;  2BL5 A;  1X4N A;  2CTM A;  2CTJ A;  2YQR A;  1J4W A;  1VIG A;  1ZTG A;  4IFD G;  2JVZ A;  2JE6 I;  2OPV A;  2AXY A;  2P2R A;  2CTF A;  2E3U A;  2NN6 G;  2BA0 A;  1EC6 A;  2JA9 A;  2ANN A;  5C0X G;  1X4M A;  2CTK A;  1WE8 A;  1ZZI A;  4AM3 A;  5JEA G;  4QMF B;  2Z0S A;  3V69 A;  4AIM A;  2MJH A;  1TUA A;  4OO1 G;  4BA1 I;  3VKE A;  1ZZJ A;  2JZX A;  3U1K A;  2PQU A;  2CPQ A;  2HH3 A;  1VIH A;  1K1G A;  1J5K A;  1KHM A;  2JEB I;  4NBQ A;  4WAN A;  2QND A;  1ZZK A;  3AEV B; 
#chains in the Genus database with same CATH topology
 1IBL H;  4JVH A;  1NXU A;  1N33 H;  3L7Z C;  1SEI A;  3SB1 A;  2UUB H;  4FJU A;  1WVN A;  4DR4 H;  2DGR A;  1MSZ A;  2CPM A;  3J80 W;  2CWH A;  3OSS D;  5LMN H;  2CWF A;  2CTE A;  4JI6 H;  2HH2 A;  4NZT M;  1HNX H;  1J4W A;  1X4N A;  4LFC H;  2YQR A;  1VIG A;  2G8Y A;  2JE6 I;  4LF8 H;  2P2R A;  4X64 H;  3NCV A;  2E3U A;  4JI2 H;  4AQY H;  4JI8 H;  1EC6 A;  3FAU A;  2ZM6 H;  1WTJ A;  4G08 A;  2CTK A;  5C0X G;  3OTO H;  4DV5 H;  1WE8 A;  4LFA H;  1J5E H;  1PQX A;  4X66 H;  1S20 A;  3EZJ A;  3V69 A;  2VQF H;  1TUA A;  3J81 W;  4NXM H;  4LF9 H;  4BA1 I;  1ZZJ A;  2A1S A;  1ODH A;  4OCH A;  2CPQ A;  2HH3 A;  4DV7 H;  4PDB A;  1J5K A;  2LTL A;  4DV1 H;  1KHM A;  1XRH A;  4JI3 H;  4WAN A;  5IT9 W;  1IBK H;  1XNQ H;  2UXC H;  1F0X A;  1DTJ A;  2OPU A;  4B8T A;  3T1Y H;  4GKK H;  5LMU H;  4DR5 H;  2E5L H;  2UXD H;  3I0P A;  4DUY H;  2HHH H;  2FPH X;  3GKU A;  4DR7 H;  1HR0 H;  2BL5 A;  1ZTG A;  2PT7 G;  1XNR H;  4OD6 A;  4LF7 H;  2JVZ A;  1AN7 A;  4H8A A;  4GKJ H;  2AXY A;  4LFB H;  1WHR A;  2NN6 G;  4JI5 H;  4JI1 H;  2ANN A;  5A2Q W;  3KDG A;  4LF6 H;  4DR1 H;  3KDK A;  4QMF B;  3GAB A;  4AIM A;  1N36 H;  1V9N A;  2JZX A;  1HNW H;  5DT9 A;  2PQU A;  2LTM A;  4E9J A;  5FLX W;  1VIH A;  2VQE H;  1X9Z A;  1XMQ H;  4NBQ A;  4OX9 H;  2K1H A;  4DV0 H;  1N34 H;  4LF4 H;  1DT4 A;  2JEA I;  5IWA H;  4JYA H;  2Y3M A;  1X0A A;  4NZR M;  3JAM W;  2D9I A;  4B8C D;  4YY3 H;  1VBI A;  2ANR A;  4B3S H;  4JI7 H;  5K36 G;  1Z2I A;  2CTM A;  1IBM H;  4IFD G;  2CTF A;  4NXN H;  4B3R H;  2BA0 A;  2JA9 A;  1X4M A;  2X06 A;  4JI0 H;  1I6U A;  4AM3 A;  1FKA H;  3T1H H;  4X62 H;  4JI4 H;  4BA2 I;  4EC5 A;  2UUC H;  3U1K A;  5BR8 H;  4LF5 H;  4B3T H;  3GR5 A;  1FJG H;  1K1G A;  1I94 H;  4K0K H;  2LF0 A;  2VKC A;  1ZZK A;  3AEV B;  2CTL A;  3QD7 X;  1N32 H;  4DV3 H;  2M6Q A;  4WAL A;  4JV5 H;  4JVY A;  2FMR A;  1V8C A;  4LIJ A;  5LL6 b;  2ZQE A;  3RF2 A;  4YHH H;  4FJS A;  4OO1 G;  4DR2 H;  2PY9 A;  2UXB H;  2CTJ A;  4DR3 H;  2OPV A;  1UG8 A;  4DV6 H;  2UUA H;  1HNZ H;  2O4C A;  2FFM A;  1S03 G;  4KHP H;  1ZZI A;  5JEA G;  2Z0S A;  4DV2 H;  2MJH A;  1XMO H;  3J7A K;  3OET A;  3VKE A;  4DR6 H;  4DUZ H;  3UOE A;  4X65 H;  4DV4 H;  2M8W A;  4B3M H;  2JEB I;  2LRR A;  2F4V H;  2QND A;  2UU9 H; 
#chains in the Genus database with same CATH homology
 2CTL A;  4JVH A;  3L7Z C;  4WAL A;  1DT4 A;  1DTJ A;  2OPU A;  4B8T A;  2JEA I;  4JVY A;  2FMR A;  4LIJ A;  1WVN A;  2DGR A;  5K36 G;  4BA2 I;  2CTE A;  2HH2 A;  2ANR A;  2PY9 A;  2BL5 A;  1X4N A;  2CTM A;  2CTJ A;  2YQR A;  1J4W A;  1VIG A;  1ZTG A;  4IFD G;  2JVZ A;  2JE6 I;  2OPV A;  2AXY A;  2P2R A;  2CTF A;  2E3U A;  2NN6 G;  2BA0 A;  1EC6 A;  2JA9 A;  2ANN A;  5C0X G;  1X4M A;  2CTK A;  1WE8 A;  1ZZI A;  4AM3 A;  5JEA G;  4QMF B;  2Z0S A;  3V69 A;  4AIM A;  2MJH A;  1TUA A;  4OO1 G;  4BA1 I;  3VKE A;  1ZZJ A;  2JZX A;  3U1K A;  2PQU A;  2CPQ A;  2HH3 A;  1VIH A;  1K1G A;  1J5K A;  1KHM A;  2JEB I;  4NBQ A;  4WAN A;  2QND A;  1ZZK A;  3AEV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...