2E45A

Solution structure of fe65 ww domain
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
50
structure length
50
Chain Sequence
DSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGRASPSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amyloid beta A4 precursor protein-binding family B member 1
publication title Solution structure of Fe65 WW domain
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 2
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2006-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2e45A01
1K9RA 2JMFA 3KCEA 4E5RA 2YSGA 2YSHA 2EZ5W 3KAIA 2ZQTA 3M7NA 3M85A 4REXA 3TCZA 1WMVA 4QIBA 3KABA 1K9QA 5CQ2A 2DMVA 1WR7A 2XP4A 2ZR4A 2DK7A 2YSFA 2ZR6A 2M8JA 2DJYA 1PINA 3ODKA 2YSIA 1YW5A 3LE4A 1NMVA 2KXQA 2XP3A 2ZR5A 2XP8A 2XP7A 2MDIA 2JV4A 1EG3A 1TK7A 3NTPA 1EG4A 2ZAJA 2ZQSA 3TC5A 3KAFA 2ZQUA 2DK1A 2XP6A 3OOBA 3KADA 1ZCNA 2F21A 4U84A 2BA1A 1I5HW 2XP5A 1F8AB 3CNGA 3WH0A 2JXWA 2M3OW 3KAGA 4U85A 3KAHA 2M8IA 2RE3A 2DWVA 5AHTA 2JX8A 2XPBA 4U86A 1JMQA 2L4JA 1O6WA 2XPAA 2ZQVA 3TDBA 2Q5AA 2LAJA 2YSBA 2ITKA 3L4HA 2E45A 2XP9A
chains in the Genus database with same CATH superfamily
1K9RA 2JMFA 3KCEA 3MQGA 4E5RA 2YSGA 2YSHA 2EZ5W 3KAIA 2ZQTA 3M7NA 3M85A 4REXA 3TCZA 1WMVA 4QIBA 5U47A 2WAEA 3KABA 3MCBA 1K9QA 5CQ2A 2OWOA 2DMVA 1WR7A 5E5WA 4A0TA 2XP4A 2ZR4A 1FLCA 1TR8A 2DK7A 2YSFA 3FSBA 2ZR6A 2M8JA 2DJYA 3PQHA 1PINA 5E62A 3ODKA 2YSIA 1YW5A 3LE4A 1NMVA 2KXQA 2XP3A 2ZR5A 3MCBB 2XP8A 3FS8A 2XP7A 2MDIA 2JV4A 2Y8NB 4A0UA 1EG3A 1TK7A 3NTPA 1EG4A 2ZAJA 2ZQSA 3TC5A 1RP5A 5E65A 3KAFA 2ZQUA 2DK1A 2XP6A 3OOBA 3KADA 4GLXA 1ZCNA 2F21A 4U84A 3FSCA 2BA1A 1I5HW 5E66A 3LKXA 5E64A 2XP5A 1F8AB 3CNGA 3WH0A 2JXWA 2M3OW 2WADA 3KAGA 4U85A 3KAHA 3MQHA 2M8IA 2RE3A 2DWVA 5AHTA 2JX8A 2XPBA 4U86A 1JMQA 2L4JA 1O6WA 2XPAA 2ZQVA 3TDBA 2Q5AA 3LKXB 2QRVA 2LAJA 2YSBA 2ITKA 3L4HA 2E45A 2XP9A 2YAJB
chains in the Genus database with same CATH topology
1K9RA 2JMFA 3KCEA 3MQGA 4E5RA 2YSGA 2YSHA 2EZ5W 3KAIA 2ZQTA 3M7NA 3M85A 4REXA 3TCZA 1WMVA 4QIBA 5U47A 2WAEA 3KABA 3MCBA 1K9QA 5CQ2A 2OWOA 2DMVA 1WR7A 5E5WA 4A0TA 2XP4A 2ZR4A 1FLCA 1TR8A 2DK7A 2YSFA 3FSBA 2ZR6A 2M8JA 2DJYA 3PQHA 1PINA 5E62A 3ODKA 2YSIA 1YW5A 3LE4A 1NMVA 2KXQA 2XP3A 2ZR5A 3MCBB 2XP8A 3FS8A 2XP7A 2MDIA 2JV4A 2Y8NB 4A0UA 1EG3A 1TK7A 3NTPA 1EG4A 2ZAJA 2ZQSA 3TC5A 1RP5A 5E65A 3KAFA 2ZQUA 2DK1A 2XP6A 3OOBA 3KADA 4GLXA 1ZCNA 2F21A 4U84A 3FSCA 2BA1A 1I5HW 5E66A 3LKXA 5E64A 2XP5A 1F8AB 3CNGA 3WH0A 2JXWA 2M3OW 2WADA 3KAGA 4U85A 3KAHA 3MQHA 2M8IA 2RE3A 2DWVA 5AHTA 2JX8A 2XPBA 4U86A 1JMQA 2L4JA 1O6WA 2XPAA 2ZQVA 3TDBA 2Q5AA 3LKXB 2QRVA 2LAJA 2YSBA 2ITKA 3L4HA 2E45A 2XP9A 2YAJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9R A;  2JMF A;  3KCE A;  4E5R A;  2YSG A;  2YSH A;  2EZ5 W;  3KAI A;  2ZQT A;  3M7N A;  3M85 A;  4REX A;  3TCZ A;  1WMV A;  4QIB A;  3KAB A;  1K9Q A;  5CQ2 A;  2DMV A;  1WR7 A;  2XP4 A;  2ZR4 A;  2DK7 A;  2YSF A;  2ZR6 A;  2M8J A;  2DJY A;  1PIN A;  3ODK A;  2YSI A;  1YW5 A;  3LE4 A;  1NMV A;  2KXQ A;  2XP3 A;  2ZR5 A;  2XP8 A;  2XP7 A;  2MDI A;  2JV4 A;  1EG3 A;  1TK7 A;  3NTP A;  1EG4 A;  2ZAJ A;  2ZQS A;  3TC5 A;  3KAF A;  2ZQU A;  2DK1 A;  2XP6 A;  3OOB A;  3KAD A;  1ZCN A;  2F21 A;  4U84 A;  2BA1 A;  1I5H W;  2XP5 A;  1F8A B;  3CNG A;  3WH0 A;  2JXW A;  2M3O W;  3KAG A;  4U85 A;  3KAH A;  2M8I A;  2RE3 A;  2DWV A;  5AHT A;  2JX8 A;  2XPB A;  4U86 A;  1JMQ A;  2L4J A;  1O6W A;  2XPA A;  2ZQV A;  3TDB A;  2Q5A A;  2LAJ A;  2YSB A;  2ITK A;  3L4H A;  2E45 A;  2XP9 A; 
#chains in the Genus database with same CATH topology
 1K9R A;  2JMF A;  3KCE A;  3MQG A;  4E5R A;  2YSG A;  2YSH A;  2EZ5 W;  3KAI A;  2ZQT A;  3M7N A;  3M85 A;  4REX A;  3TCZ A;  1WMV A;  4QIB A;  5U47 A;  2WAE A;  3KAB A;  3MCB A;  1K9Q A;  5CQ2 A;  2OWO A;  2DMV A;  1WR7 A;  5E5W A;  4A0T A;  2XP4 A;  2ZR4 A;  1FLC A;  1TR8 A;  2DK7 A;  2YSF A;  3FSB A;  2ZR6 A;  2M8J A;  2DJY A;  3PQH A;  1PIN A;  5E62 A;  3ODK A;  2YSI A;  1YW5 A;  3LE4 A;  1NMV A;  2KXQ A;  2XP3 A;  2ZR5 A;  3MCB B;  2XP8 A;  3FS8 A;  2XP7 A;  2MDI A;  2JV4 A;  2Y8N B;  4A0U A;  1EG3 A;  1TK7 A;  3NTP A;  1EG4 A;  2ZAJ A;  2ZQS A;  3TC5 A;  1RP5 A;  5E65 A;  3KAF A;  2ZQU A;  2DK1 A;  2XP6 A;  3OOB A;  3KAD A;  4GLX A;  1ZCN A;  2F21 A;  4U84 A;  3FSC A;  2BA1 A;  1I5H W;  5E66 A;  3LKX A;  5E64 A;  2XP5 A;  1F8A B;  3CNG A;  3WH0 A;  2JXW A;  2M3O W;  2WAD A;  3KAG A;  4U85 A;  3KAH A;  3MQH A;  2M8I A;  2RE3 A;  2DWV A;  5AHT A;  2JX8 A;  2XPB A;  4U86 A;  1JMQ A;  2L4J A;  1O6W A;  2XPA A;  2ZQV A;  3TDB A;  2Q5A A;  3LKX B;  2QRV A;  2LAJ A;  2YSB A;  2ITK A;  3L4H A;  2E45 A;  2XP9 A;  2YAJ B; 
#chains in the Genus database with same CATH homology
 1K9R A;  2JMF A;  3KCE A;  3MQG A;  4E5R A;  2YSG A;  2YSH A;  2EZ5 W;  3KAI A;  2ZQT A;  3M7N A;  3M85 A;  4REX A;  3TCZ A;  1WMV A;  4QIB A;  5U47 A;  2WAE A;  3KAB A;  3MCB A;  1K9Q A;  5CQ2 A;  2OWO A;  2DMV A;  1WR7 A;  5E5W A;  4A0T A;  2XP4 A;  2ZR4 A;  1FLC A;  1TR8 A;  2DK7 A;  2YSF A;  3FSB A;  2ZR6 A;  2M8J A;  2DJY A;  3PQH A;  1PIN A;  5E62 A;  3ODK A;  2YSI A;  1YW5 A;  3LE4 A;  1NMV A;  2KXQ A;  2XP3 A;  2ZR5 A;  3MCB B;  2XP8 A;  3FS8 A;  2XP7 A;  2MDI A;  2JV4 A;  2Y8N B;  4A0U A;  1EG3 A;  1TK7 A;  3NTP A;  1EG4 A;  2ZAJ A;  2ZQS A;  3TC5 A;  1RP5 A;  5E65 A;  3KAF A;  2ZQU A;  2DK1 A;  2XP6 A;  3OOB A;  3KAD A;  4GLX A;  1ZCN A;  2F21 A;  4U84 A;  3FSC A;  2BA1 A;  1I5H W;  5E66 A;  3LKX A;  5E64 A;  2XP5 A;  1F8A B;  3CNG A;  3WH0 A;  2JXW A;  2M3O W;  2WAD A;  3KAG A;  4U85 A;  3KAH A;  3MQH A;  2M8I A;  2RE3 A;  2DWV A;  5AHT A;  2JX8 A;  2XPB A;  4U86 A;  1JMQ A;  2L4J A;  1O6W A;  2XPA A;  2ZQV A;  3TDB A;  2Q5A A;  3LKX B;  2QRV A;  2LAJ A;  2YSB A;  2ITK A;  3L4H A;  2E45 A;  2XP9 A;  2YAJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...