2E46A

Crystal structure analysis of the clock protein ea4
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
157
structure length
157
Chain Sequence
MHHGFTTPSRAIAVLSTETIRGNITFTQVQDGKVHVQGGITGLPPGEYGFHVHEKGDLSGGCLSTGSHFNPEHKDHGHPNDVNRHVGDLGNVVFDENHYSRIDLVDDQISLSGPHGIIGRAVVLHEKADDYGKSDHPDSRKTGNAGGRVACGVIGIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title the clock protein EA4 ticks away with movement of a mobile copper ion
rcsb
source organism Bombyx mori
molecule tags Metal binding protein
molecule keywords Time interval measuring enzyme TIME
total genus 33
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2006-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2e46A00
1MFMA 1XTMA 2GBUA 3ECUA 1E9OB 1F1DA 2AQTA 1S4IA 1E9QA 5KBKA 2WZ6A 2APSA 4FF9A 1IBDA 2VR6A 2R27A 4A7GF 3KBEA 1SXBA 2WZ0A 2WWNA 1XTLA 3GQFA 3KM2A 4OH2A 3HFFA 2Z7UA 5KBLA 2V0AA 1TO5A 3CE1A 1FUNA 4MCMA 1DSWA 3PU7A 3KBFA 4A7QA 2WYTA 2WKOF 3K91A 3F7LA 2AQRA 4L05A 1Z9NA 3SODB 3RE0A 4A7UA 3L9YA 1E9QB 1COBA 2Z7WA 1HL4A 1KMGA 1CBJA 1UXMA 3KH4A 2ZKWA 1F1GA 3ECWA 4OJAA 2GBVA 1OALA 2ZKYA 1SXNA 1JK9A 2E46A 1SXAA 1F18A 1B4TA 3ECVA 3GTTA 1SDYA 1CB4A 1SXSA 2AQSA 1U3NA 3S0PA 1YAIA 2AQQA 1PU0A 1BZOA 1TO4A 4A7TA 1PZSA 1PTZA 2AEOA 2GBTA 1IBBA 4B3EA 2WZ5A 2K4WA 2AQNA 3CQQA 1UXLA 5KBMA 1EJ8A 1N18A 3H2PA 1IBFA 4A7GA 1QUPA 4A7SA 4MCNA 3MKGA 2ZKXA 1ESOA 4N3TA 2Q2LA 1E9PB 2ZOWA 2VR8A 1XSOA 1DO5A 1OAJA 1Q0EA 3MNDA 3HOGA 3QQDB 4BCZA 2WKOA 1F1AA 2WWOA 4BD4A 2JLPA 2SODB 1N19A 1AZVA 1IBHA 3GZQA 1JCVA 2Z7ZA 1OZUA 1YSOA 1HL5A 1IB5A 3GZOA 2C9VA 1SPDA 3HW7A 3T5WA 1Z9PA 2XJLA 2WYZA 3KH3A 4U4IA 4BCYA 1OZTG 3LTVA 1OEZW 1SXZA 3GTVA 4A7VA 2C9SA 1L3NA 2VR7A 3GZPA 2C9UA 1JK9B 1B4LA 1SOSA 1RK7A 1YAZA 3F7KA 1E9PA 1SXCA 2XJKA 2JCWA 3H2QA 3QQDA 1BA9A 2E47A 2NNXA 1SRDA 2AQPA 5CU9A 3CQPA 1P1VA 1E9OA 1SDAB 3KM1A 4N3UA 2Z7YA 3L9EA 1EQWA 2LU5A 2AF2A
chains in the Genus database with same CATH superfamily
3NSDA 5DHVH 3SBPA 4WK0B 3CH8A 4K2UH 3ULUE 4GBXB 1FNFA 4XP4L 1CXEA 1T3FB 1PAZA 3GJEA 1W80A 5T3ZH 4PGJA 5B38G 2CALA 3V0WL 2CDFB 4J4PA 2Y25A 1U3HC 4PWKA 4JFFE 4RFEA 3BSGA 3GRGA 3ILPB 3PHOA 3N5AA 1HNFA 4H8QA 2A74A 1REIA 2P3YA 4DVRH 3OZKA 1WT5A 2HLFC 1QFUL 1S7VB 3CVIL 2QQKL 3RWHA 4QO1A 2HWZH 1U8MB 2IV9A 1N70A 4PJEE 5G5DA 4R0LC 3KPNA 5CP7B 3P02A 2FIKB 4OGAC 4YR6B 3VJ6B 3BZEB 4P3WA 1S7TA 4OLEA 1NPNA 5E4AA 1T83C 3GSUB 3KYKH 3MRMB 3ASWA 3OQRA 2L0DA 3RTQD 4O2CB 3O3BA 4UI2A 1BBJB 5IBTL 3ISYA 2GBAA 3LH2H 4JANA 3VYPA 4B5ZA 2KQNA 1SLUA 1URIA 2PWDA 5B39G 2FJHA 4IMKA 3SYAA 5IJKC 1HK6A 1RZ8A 5KVFL 1G9EA 3OAUL 2EE9A 3QWOA 4NQEE 2NOYA 3SY0A 4HH9A 4LLQB 4RRPG 2A6DA 4CRPA 3ZQWA 4AYID 1CBVL 4JO1L 1Q94B 4PRDB 4BZ2A 3Q48A 5E1AA 5SX5K 1GOFA 5JHLA 4NZJA 3OMNB 3SPGA 3F12B 1GGBL 4I3GA 1EEZB 2DYSB 4HWZB 2WQUA 2ERJC 5JOFB 1IE4A 4XC3H 5D7JC 1RUML 4DZ8A 4GT0A 1EBPA 3DX8B 4TL4A 5AZEL 3V95A 1BD2D 3BVVA 2W9EL 4L9DA 3JXAA 4XOEA 4U3CA 1IAIH 4AZ8B 2CKBH 4BWTA 4RVBA 3QIUC 2VDQB 1OE1A 3QBTB 5AG8A 2MCAA 3HI5H 4ZSOB 2G2RA 5L4MA 5K9JH 2WUBL 1JS4A 3C87A 1CGTA 4FG2A 4GG6B 3CLEH 4QLWA 2OP4L 3VH8A 4JE4B 5ESQA 3BDYL 3ELAT 3QORC 1KLFB 4GLRI 4MD5B 4XNZC 3QR0A 1BFVH 3NCJH 1UT9A 2F54B 1UACH 2ESVA 2NUTA 3WJJC 2CUHA 3KPSB 4JFTA 5A2BA 5IQ7L 1IC4L 4HJJH 1U8MA 3IDXL 1CDUA 3FHAA 4U1SA 1PZ2A 1A7QH 1XSIA 4PJGA 4PLOB 1A6PA 2CO6B 1DANU 1WIUA 4KKNA 3W0WE 1A65A 4KUZL 5FCUH 3V0VB 1WEJH 3M07A 1ZA3B 4QHMA 1IM3D 1ZS2A 4QUOA 1HH9A 2XYBA 1T1ZA 4YXKL 3HHRB 3K8LA 5I1KL 4DKFL 2VQTA 3GMOA 1DLFH 3QCVH 1CC3A 4X8JA 1Y6MR 4ICXA 5TF1H 4ZNCD 1O6TA 3I84A 1AI1H 2IG2H 5HDRA 4L0ZA 3PWVA 3RIAF 4ZYKB 4CU7A 2CR0A 4L5FH 2QQNL 4GI8A 4PWIA 1QO3A 1XIWD 2N56A 3AREB 1QR1B 4IJ3B 3DSNB 5E9AA 2GT9B 2R29H 3QA3A 3S34L 3GBNH 4MA7H 4BE6A 1LYQA 2QQLL 3Q8BA 5CNHA 5CEYB 3ZT6A 4P4KA 4KUCF 1SEBA 1UA6H 3HLKA 4CW1A 2RFXA 1EWHA 2GSGA 2X4SA 4GSDH 4LEBA 3UTZB 2DWYA 3OL2A 2VZ3A 4YIQB 3HC3L 2CHNA 4L8CB 4N68A 3BVDB 3INOA 3JTTB 2XRAL 2J6EH 3B2XA 4I77H 4IOSD 4K2UL 4PJEA 5EZIH 3K6DA 2EO1A 5LXGL 2P42B 2DLHA 1Q9LA 3V5HA 1FSKB 4JDZB 1ZHKB 2Q76B 2AEPL 3QIUD 3MRKA 4CC1A 4L0PB 2C3VA 1F3RB 1PZSA 3MNZB 2RGSA 1HNGA 3DDGA 1R1CA 4XB7A 3RY6C 1B0GA 1XCTA 3DXAD 4UT7H 1URLA 1U41A 1UXWA 3S7GA 2ZT9C 4WU7A 1PD6A 4YXHH 3ARED 5ENWA 4JGJA 4YLQT 4AT6A 3ETSA 5C0GA 2F15A 3EHBC 1DQDH 1QUPA 2BZCA 2WQSA 3ABLB 3QXAA 3TZVC 4WTWA 5IIEA 2ADFH 2CBPA 5AL8A 1RVFH 2OPCA 3EXJA 2JV6A 1AZCA 2MCPH 3NEXA 2NX5B 1IAII 2WB7A 3DETC 3HOGA 5F7EH 2CRIA 1VA9A 3KS0J 3UBXA 2ZWLT 3WKPA 3ILQC 4JFPA 1W0WB 5LUMA 1CL7I 2NQDA 1WISA 4J3WA 4ADGA 3BDYH 3CSYB 3CXFA 3ZE1B 5K1NA 2X28A 4I5BA 4WDIB 4L8BA 4N2MA 3PDOB 3PQYB 5K93A 3RNQA 5AENA 4RFNC 3WNIA 3T3MF 3B8YA 3RVWD 4N2EA 4BFJA 2GG1A 3DTXB 1ECYA 1RY7B 2RTTA 3IXTB 4IIZA 4LVEA 5ALCL 2JB6B 4OQTL 2VW7A 4QHUB 3OVUB 4P2OD 1ZDQA 3SCMA 3ULSA 4JFXA 2APBA 4JFYA 1MCLA 3OR7A 2VH5H 3ESMA 4Q52A 3SKNA 1XCQA 1I3GH 1VGKA 1YEHL 2J88L 1PJ9A 5DMGD 3G5YB 4NKMB 2Q7YA 1S9YA 2J2ZA 3W2DL 5AAMA 1U4EA 3VFPB 4YXKH 2C9QA 3ZHFA 1LDSA 1IGCH 1EA9C 2BLFA 5HYFA 1X6LA 4K5PA 4FCAA 3ZL4H 4K7PH 4WHTA 5HJ3B 1E3XA 3DI3B 1EH9A 1J1PL 3ETBF 3L3HB 1XGRA 3G6JE 3IU3B 1GRWA 2WW8A 4S1RL 2K0RA 3DARA 3QJTB 1B6DA 2A3TA 5SWSA 1OAKH 2IPKB 3LIZL 3O6ML 4A6YL 5LWYL 3MCG1 3H42H 5TE4L 4LSRH 5E6RB 1QAWA 1UA6L 1NPUA 5HDWA 4PPTA 4QXTA 1IZJA 4APQB 3HUJF 3MV7A 5TE7L 1VCAA 1LK2B 3BD3A 1CXFA 4FJZA 4WJG3 1E3ZA 4JKKA 4LO9A 2IC2A 2J6EL 4I77L 3NIFE 4UOQA 3N44B 3UZQB 2E4FA 3WIFB 3ZY7A 1IAOB 2WIMA 2TAAA 4GAAA 4JFHE 4PG2A 2VLJA 3ESOA 1CXLA 1X9QA 4GSRA 1B2WL 2WWMD 1WD9A 4JDVA 1G6RB 1KMGA 4XP1H 1GJIA 3HBGA 4ANUA 1N3NA 4RGNB 3OAZK 4Y16B 3ZJAA 5MI0C 3CVHL 5KVDH 3QO0B 3BVTA 4Q74A 1I8KB 2V37A 3S0PA 4U1LB 2KMWA 1B3JA 1NCWH 1BCIA 2F7RA 4GEIA 5TF1L 1FL5B 2C3XA 2RR3A 3N43F 3QQ4B 3ZYJA 5ERWA 4AH2A 3AXLB 4FTDA 3MUZ1 5IB3A 5DD6A 3QJHA 1B88A 4K3GA 1IFRA 3HNSL 3IXTA 4X8CA 3QHTC 2PR9A 3X2QB 3TT1H 5KJRH 4X6EA 4TULL 4YFDB 1WF5A 3U7AA 1IFHH 1Y0LB 3K4ZA 4FXKA 2AV1A 3OXSA 3A47A 1VDGA 3VWKA 1ADQL 2W92A 3MLZH 5AOKA 5E9DD 5I0XA 1IGFL 4XCFH 4HAGA 1E43A 3TBCA 4EE2A 2CIIB 5IW1A 3B6SA 1IBHA 1MHCB 4OZHF 1JI1A 2F08A 3CCHA 4PIRF 3P3TA 2DQCL 3CZSA 4NIYE 3W2DH 4OFYD 2A1WL 3L1GA 3RBSA 3UDWA 1N10A 2BFVL 2LR4A 1NZRA 3S8FB 1MCHA 5I0YA 2XPYA 3ASNB 5DQDL 2DPKA 3MNWA 1KLGB 2E8YA 3QRLA 3CVIH 3FB6A 3FN3A 4JO8A 3BP6B 4TXVB 3ES6A 3HPJB 3VFWB 1QVOB 2O26U 1FFPA 4PJ9D 4MHHI 4OKDA 1E8ZA 3OZ9L 3VXRA 2YQBA 3TFKD 3T65B 2A83A 1W9XA 1ZT1B 2OR8A 2P28B 3E6FA 5AALA 3W9DB 4GRMB 4QHLB 5HXMA 2E9WA 1XH3A 4ZAKB 1KXQE 2BSRB 3HEIB 3EOYG 4AIZB 2XVBA 3MV01 5D6DA 2BS9A 5KVGH 3VD1A 1RUPH 3RTLA 5T1LA 4B7LA 1IO4C 2D2OA 4ATTA 1CVSC 3BZ5A 5IBTH 4ZX5A 3LKPB 3X1FA 3GIZL 4Z3FA 5F21B 4AQ1C 3VXUD 5IW6A 3JWNH 4QHPA 5FYKE 2NYYD 4IK6A 4O2FB 2P52A 5E7BA 1N3NB 4B27A 2YAQA 5IG7B 1IBGH 4FS0A 4RDQG 1NBYA 3CLFL 3W57A 3W11C 1NDMA 4X7EC 4Z3IA 1J0IA 3EYSL 1G9NL 5LQBH 3HC4L 1A9EA 1U2YA 4K3JH 4DW2H 4DKAA 3T2OA 4NFDA 4FQ1H 4H13C 1UFUA 4N9GB 1QEXA 1JZHA 4JRYD 1MPAL 2ADJB 3BP4A 2BSTB 3MRFA 1E5UI 5FHBH 1OW0A 1P5VA 1XCXA 4P5TB 2VLMD 2A9DA 3UBFA 3UGXA 5GZOA 1EEYB 4K23L 1CBJA 1RQ5A 1VZIA 2JCCE 3L7EA 1W2KT 1NIDA 3UG5A 1D5BA 4P2OC 3BYTA 1YPZB 2CBMA 1IAIL 5F1IA 2CBQA 1UB5A 3Q8AA 1ZLUH 2Y1ZA 4AK1A 2IANB 3NA9H 4KOCA 4B9JA 1Z3RA 5EG6C 1MHCA 3L4VA 1TVDA 4LSTL 4P9HC 1C5BH 1MEXH 3C5XA 2GI0A 3AAZB 3FOLB 3ZZSA 3MA7B 3B2UD 1UM4H 1A1OB 2UWEA 3O3AA 5F7DB 2DWDB 4ES9A 4G8EA 2ZUQC 5C08B 3RVUD 3QZOA 2IWFA 4WI0A 3PUUA 1S7XA 4M8QB 2NY3B 1H0DA 4IU2B 3VXRD 3BGMB 1X5FA 2CRMA 4QT5B 1QZNA 5T33H 4DOHB 1T4WA 5F3FA 3OBAA 4ODTL 5DQDH 5CGMA 2GTWB 5EEYA 4ODSL 1UZ8B 3TC9A 2XI9A 3UERA 2JIXD 3N55A 1TQBC 1DFBH 3LRSA 4MSWB 1Q72H 2YMTA 3HZKA 1HZLA 1YNKH 2FEDC 4X4MA 4XE5B 4E42B 3IGLA 1JF1B 3TWYA 2O5ZL 4R96B 2EXYD 2I07B 1BVOA 4N87A 3QXAB 2VXTL 3BGFB 2DLFH 4R7NA 5F6IC 3ALWA 1TNMA 1AFVL 4AYSA 3PFUA 1NDTA 4J8QA 5D8JH 3DURB 4MXQD 1KT2B 3QXWA 2Y1YA 4RWYH 3U6XS 2D7QA 3VD3A 3JWNG 4OF3A 4F5CA 2FQDA 3OF6D 2K4AA 4AQZA 2ZJSH 3S4SB 5KWYC 4EUPG 4Z7VB 1OOWA 1LDPL 3WFBH 3QPXL 4N9OB 5EV7A 4DJMA 3GHPA 4PJAB 1VFBA 2FHBA 4GAYB 1J5HA 1QATA 1KCLA 2ZWZA 1KUMA 3D18A 4XNQB 2ZYRA 1UQSB 4JZOA 3Q6GL 4MBRA 4KXZH 1MQKH 4GRWE 4I0PA 2OL3L 3UJTL 4AH2B 3VE0B 4AEHH 1QI5A 3VD9A 1CVRA 2R2EB 4HKBA 4LFHG 4X5WA 2PR4L 4IOIB 3GMMA 3PWNA 4P23B 1HI6A 2XIIA 5IV2B 5JPMC 3FSZA 1U33A 1A1OA 2FUTA 3DV4A 4MA3A 3KHQA 3ESPA 3AT9A 3IXAB 3MLWL 3OXSB 3MV7D 3S48A 2Q7NA 3IJYB 3SGKA 2EDJA 2ZCHL 3WTXA 3BT2H 2BSED 4M3KB 1AAJA 4EEEA 4Z76B 3PNWB 2AQSA 4GP5B 2CK0H 1W6LA 1KNOA 5E4EB 1TQCC 3DMMD 3HE6B 1KGCD 1XX9C 4DP1X 1OK8A 1VEPA 3LKNA 2YAMA 5HP5A 1KV3A 4KKQA 4ODTH 3L4TA 3FUJA 5TQ0H 4WI3A 1DBMH 5EULV 4EN3D 5D1QA 3FPYA 2NDGA 3RDJA 3QUZC 2OS7A 1GGIL 3N44F 3ORJA 3MRQB 5E8DL 1KB5L 1N9PA 2CUAA 4JCMA 4OD3H 4UILL 1WA0X 4JKMA 5E8NA 2BNRD 2KPWA 1ZE3C 1Q90A 3II3A 4M29A 4W1TA 1TQUA 4TSAH 5IROD 3SCMD 3WYRA 1OSZB 3F7PC 5E8PB 3IM1A 3O0RH 3BAYA 4J4PC 1RUAH 4GQRA 4JREC 4L4JA 4WNSA 4MTMA 4RNRB 4EZMA 3ZDYB 4YR6A 3N41F 4DK6A 2FBOJ 4OGQC 4KY1H 1ANUA 5DD6B 2Z1KA 4KUCD 1L9QA 5I8CB 3F7YB 3VGEA 1AY1H 5F7LB 1C5BL 2NY2B 4GAYA 4Q56A 2AHIA 4R0LA 3MBWB 2C7FA 2XLLA 3MUGA 1JWMB 3NFNA 2YAOA 3PS6A 2EDRA 3U4KA 3QQDA 5DMGC 3EYFB 5MEQA 1QPKA 5A3ID 3GXMA 4N0CC 1HCZA 4OFQA 3BP4B 5CU5A 5SX4H 4LL4A 4OM1H 5BO1L 4MDIA 2IH9A 4OFVA 4L5FE 2G0KA 1MW3A 1QFWI 2ZCLL 3MOQA 4BK8A 4DGWC 3DXAA 1M2OA 1ODAA 5IEKB 2EIBA 2X87A 4X42A 4L4VD 3EF4A 5LN4A 4PM1A 1T6VN 4KX7A 4GQZA 1WYJA 4UUJB 4IGBD 5EOCH 4NQCA 4I3RL 1BV8A 3S3SA 4ABVA 2XG5B 2OMVA 4ZD3H 5I76A 4A2HA 5I18L 5JOPE 3QNXA 3HE7C 1XF3A 3VDBA 4XI5D 2W0KA 1F13A 1BLNA 1MNUH 5EU6E 1A6TB 3WIHH 3T8XB 1A7NL 1R3KA 2BY3A 5B3NA 2UZIH 3P30L 1AS8A 2FEEI 5L4JA 1H5BB 5FK9A 5EU3A 1J1OH 1N8ZA 3WXWL 3K5RA 4YFLI 4PGZA 5BUGA 2G3ZA 2ZSWB 2AK4B 5DZAA 2HT3D 1TJMA 4TF4A 1ORSA 1WPCA 2OZ4L 5CCHE 1IAKA 3T77A 2UUDH 1UC6A 4Y8AA 5E6ID 4UWQB 5FF6A 3HKZA 4P3DA 2XXCB 4GO8A 1OTSD 3BVNA 2BXZA 4ENED 5CEZD 3E8VA 4KFMA 4OVVA 5JHLL 5L8KB 4N24A 3DX2A 1I8LC 4N2DA 1H6EA 4R26L 3G5XB 2D9CA 1E40A 1UUSA 2DMHA 4N0RA 4W9KC 1KWGA 3WTYA 4ZSOA 1ETZB 3EXLA 1RUQH 2D3JA 5IOPB 5JW4N 1G1CA 2WXFA 2YZ8A 4QNPF 5HHNB 3S97C 2IH1A 4H26B 4N28A 4RMSA 4N5EC 4TUOB 1K4CB 1JAEA 4ACPA 3Q5OA 4NQQA 3OJVC 1AZUA 1JUFB 3AY2A 2RBLA 1Q0EA 2XVGA 3QQDB 4PY8J 1OKEA 3MGTA 3VXQB 1A3RL 2EDQA 1AXTH 3D1MC 4KX8A 5I1DA 4JHAL 4RESB 1AGBA 1BBDH 3SE4A 3VH8G 4C55A 5C0NC 5CM1A 2BX5A 3C5SA 4FNLL 2VLKB 4KKCC 6FABH 1IGIH 5I8OL 4R4BA 4LSVL 4DPRA 3QDAA 3H53A 1XEUA 4G1EB 4ZS7H 4F9PA 4ZXBC 2CAKA 1OEZW 2HG5B 4U33A 2DM3A 2R1YA 4IQHA 4XC3L 3SKMA 1IBYA 5KSUB 1BM3L 7TAAA 4RWHA 2R56L 4X8JB 1TMQA 2VN6A 4JKNA 1M42A 2JI1A 3BPOC 4XNUL 3T3PB 3VU2A 1T7XA 1MCJA 4NO3B 4WI2A 5IJVA 3M1OA 3VRIB 2ENYA 5C3IA 4NI6A 4XZUA 3GPEA 3HG2A 3D51A 3QORD 1RZ7H 3F7VB 1RZKH 2O61B 4NPYA 2A4CA 1CF8L 2HKFL 4PJFE 2H45A 5HHME 1J0KA 3HUJA 2OP4H 1YNLH 4LLDA 5ISZA 3TBTA 4YAQA 1FHNA 1NCTA 2ZSWA 1RZGB 2XZCH 3KYMB 3TBBA 1HT6A 5BXFA 3ZVVA 1LO4L 4WIQA 5TK2A 1LEGA 3LEYH 3W9EB 4GKSB 2VN3A 5H94A 4WF7A 4TTDC 1NLBH 3BKCL 5HGGS 3Q9QA 2EDDA 2K6YA 5DZPA 3UDWC 3VXTB 4OZIB 1QFHA 3X1NA 4JFPB 3R18A 3KVDD 5LAXA 3UIZA 4ENZA 4X7TA 1RHHB 1DLHA 4I13B 4UQDA 1X9LA 4ORZC 2J57A 1TCMA 3ETTA 5D1XB 1QACA 3TP4A 1D6VL 2HN7B 4NP9A 3BH9B 3BMWA 5J12B 1JZ8A 4PTUA 3BUTA 2DTMH 5IMKA 4E5XG 2UZYB 4G1MB 2DQEL 1BW8A 3E9UA 3FB7A 4GUPA 2OMNA 2NLJA 4HUCA 3SKJH 2FHCA 4OZGE 1LK3H 3NJMA 1EBAA 1T21A 2P9RA 3CN0A 2E46A 4JFEB 3WSQL 2HFEB 2H3XC 1RLBA 4CVUA 3SDDA 1QFWM 4QWWC 5C8JA 2DQIL 3MGTB 3VXQA 2IPUK 3IWUA 4PJAF 4QHNB 1RUKH 3UAFA 5EUOE 3RTQC 5ABDE 4NZRL 3QFGA 4BFRA 2GBTA 4L8BB 2ZX8A 2BFGA 4WUKH 4WTQA 1R5VB 3IEAA 4FYSA 1H9DA 1I1AC 1BD2B 1D5ZB 5GSVA 4JPIB 4D2NA 5I6NA 3B7SA 1JNLL 3D50A 2FNBA 4UANA 5FYKU 2OQJA 4Y5XB 2CO3A 1KCWA 5I66B 4DERA 4TVPH 1YQ2A 1X5AA 2WQWA 3OJ2C 2GSIA 4U1KA 4X5XB 3T0EE 4TQHA 5KZCB 2VDOH 2DL9A 1KXQA 1MFEL 3CHPA 1NINA 2XUWA 4FRWA 1AKJB 1WWAX 3JQOB 4BCZA 2P8LB 1F1AA 4GP8B 4P46C 3O4LD 5HGDB 1E4WH 2E7HA 2FWOB 1GH7A 4PJXA 4Y5VB 4CSPA 1R6VA 5D7LD 3WIFA 4ELKA 3GRWH 3LPFA 2F8VA 1VEOA 2HT4D 1NMAH 4KRNA 4PLJC 3MLSL 1CU4H 3ZKMC 2VXVL 4BCYA 4Y5YC 1TZAA 4ELDA 4H2CA 4HS8L 2AAAA 2HJKA 3ZQ9A 1B3IA 2QMKA 3QZWA 3HFMH 4PRHD 5KVEE 4M43L 3LEVH 3G08B 1AO7E 2B5IC 2GEEA 4P23D 1KBGH 3E7JA 4WO4A 3J07A 2LU5A 4M4RB 3ZZ1A 4PJ7B 5DHXB 4P9ML 3VI4E 1T2XA 2VLRA 4DVRL 1FZJA 4G7YL 5AOMA 3RDTC 2ZXEB 2AJVL 3SGEI 5ITBL 5F96H 1I3GL 2J88H 1JI2A 3L6FA 3QUYD 2UZXB 4KQ3L 5D2NC 5EIQA 5FF6B 1BZ9B 3KGUA 3OXRA 1ND0A 1HHJB 2JKJA 3GJFK 2NTFB 2BNRA 2D9QB 1SY6A 4F1ZA 4HDIB 1J1PH 4YSUA 5IBLD 3H3PL 3VRLF 4TNWF 5JW4R 2HJFB 1ASPA 3AFLA 3CFDA 4O9HL 5ADOL 5FLVA 4NO0A 1U8PB 4L1HA 1D5MA 1VESA 1NAMH 2VL5B 5IOPA 4MMYB 4YSTA 1ZHBB 4NKIL 4W6WB 2F74B 1T66C 2FD6H 5BRZB 1DUYA 3SZKC 2OL3B 4NKDB 5C7ZA 3QFJB 1UH2A 1X44A 4Q89A 3C6LB 4X6FA 2WTPA 5K5YA 2BIIA 4XO3A 1KPVB 3EO1A 4EI6B 3DTUB 3V7AG 1QEWB 3GSRB 1JK9A 4XPAL 3MODL 3OG4B 3S35H 3QPXH 1DEDA 2YPLD 4JL2A 4HHAB 3ZDXF 1YAIA 1ZTXL 3FQWB 4DT2A 3IETA 4F15B 2BMKA 5AW9B 4B9PA 4KY1L 4Y1AD 1S78D 5I1CH 1XGYH 1FAKT 1T89C 2ED7A 3ECBA 5IKCB 2Y2TA 4DPAX 3LKPA 1DQJA 4HEME 3BAKA 4M56A 5DUPH 3U4BH 1JGUH 4PSPA 4XN8A 4G8GB 4PAZA 3AXLA 2BVOA 3TXAA 4AL8H 1FAIH 2WSDA 3DVGB 4XPBH 2X6MA 3Q1EA 2XIDA 4KK9D 3RWCB 3RZCC 2X4TA 5BVPL 3D0VB 4LLUA 2G5BA 4MRBA 4RQQB 5I74B 1T1WB 4DEPC 5BO1H 3FCSB 4Q6IB 3QO1A 2YD5A 3BO8B 1H8LA 3KYKL 3S37X 1CFTB 3EW3B 1JF5A 1N6UA 3QEUB 4N9GA 2IH3A 1JCVA 3HBZA 1QSVA 5J1SC 2GQHA 4ZTPL 3MOAH 5DRZB 2ICEA 5CFAA 3CVHB 3PLYA 5IQ7H 3P73B 2DS4A 1FF5A 2I5YH 2FIKA 1CLYL 5CR8A 3MN8A 2RD0A 2OBGA 1G6RL 3UZVB 2Q0ZX 2WO4A 4H2AA 1FORL 3WNKA 3EF7A 3DVNA 3FRPB 4ZMAT 1SOSA 3E6HB 1QKZL 4FQ1L 5EZJA 3MRBB 1GOGA 1IGTA 2CO7B 1UB5B 5FCUL 1LM8V 2CU9A 2NY6C 3U30C 3FUDA 5CJ8A 2Q8AL 4HIJB 4ZUUA 5AVVB 3UL4A 3V4VB 1NL0H 8CGTA 3LCYA 3ILEA 4PUBL 3BH8B 5I9QB 1KIPB 4QHLA 1IC1A 2VLKA 2AEQL 4W9LC 4LZKA 4RGMC 1IJNA 4BQBA 5FV1L 5AZEH 4MMYA 1E4WL 3EJZD 4BV1A 2XA8H 4F7KA 5IW3A 1JHKL 2G3XA 1S3KH 2Z93A 3IS1X 3GBNL 2FX9L 4P05A 3AXHA 2QQLH 4QCIA 5SV3A 3RL1B 2Q2EB 2HVBA 1M6OB 4H0LC 1T0OA 4JJOA 3TN0A 3FTGB 1NOAA 1L0YA 5F0LB 1GS6X 3V4PH 3TS8A 4M6NL 4QHNA 1XZWA 2AJZB 4AKOA 2XX0A 5IJVB 3MLVL 4QIRA 3ALPA 2GHWB 3CDCA 2C9PA 3NQIA 3TZVD 4OD1L 4IBVA 1HOEA 3UP6A 3VGDA 1GOHA 4XXCC 2Y06L 2OQJB 4Y5XA 3CC5B 5E08H 1J8HA 1UYWH 4ZPVA 2YEZA 1KCVL 1JGIA 3GSVB 4MZRA 4HK3J 4QKTA 4YZWA 4B9IA 4ZQKA 3CPUA 2CLRB 3PG2A 1A7QL 4EIBA 1FNEA 1HHHA 2Y3AA 1FQ9C 2AI0H 3RY4A 2EE3A 2F19L 2W07A 3NSXA 1BQLL 3QO1B 4TLUA 1ZLWH 2DF3A 2DDQH 3KPRA 4QR7A 3VXTA 3GD1C 2FLRT 4LEEA 3C6SA 3WFCL 1GZHA 1NOLA 1A14L 3I75B 2B14A 1NFDF 1MXDA 2J12B 3GEWB 5IF0B 3GSQA 5B8CA 5HVHB 4EIGB 4GKNB 4LHUD 2WQAA 4MQ7B 1QSEA 3FAXA 3HAEA 1NAMB 1OPOA 4O02A 1N18A 2JKNA 1JF1A 3F3HA 5DJ0B 3S37H 3KLHD 3FO9A 2X4RA 5SWQB 3GT6A 1CTNA 3IMWA 4BE5A 3DVIA 2NTSP 2NZ9C 4MMZC 3ILPA 3BGFC 5F6IB 4UYPA 5CBAA 4Q9QH 1SJMA 2V8LA 5GGVY 1RK1A 1FL3A 2HRHA 3GYRA 4R4ND 2VCOA 2XZCL 4GPVA 2CJTA 2FJGB 3SE9L 2WLLB 3VXUA 3EG9B 3PJSA 2B08A 3BH8A 1YEHH 3ZKQD 3UCQA 2I32A 2JB6A 3MV9A 4NHCL 2VQ1B 4LOUC 3EGXB 1YLBB 3Q13A 4YDNA 4PWFA 3L3KB 2WWKO 4R7DA 4DUXA 1NC2B 4GAJH 5EUOF 3RKDD 1QRNE 4V1DD 4V11A 3C9NB 3ESVF 4O00A 2BIOA 4OTXL 3VMPA 4OB5H 1TJHL 4QXUL 3D69B 1FL6B 5H2BA 4MX7A 4L3EE 3U2SB 3QYNA 2FWOA 2IQAA 4MAYC 1SHXA 4F7MA 2F0CA 2OW7A 5MEOB 2EYSB 5INCB 1JV5B 3K81A 4HK0B 5ALBH 4DESA 3P0YL 4FQHA 5GZNA 1XQ4A 4EI6A 3J8F7 3I9GL 3VQMA 2QKIC 3RKPA 3UMTA 3KBEA 4JRYE 3H3BC 5E9DA 1TOXA 2ODIA 2Z1PA 2XV6B 3WUWG 4ODXB 2EDTA 5TGBB 3DPBA 4XN1A 3VFGH 4APXA 3K2UL 4P2RA 1DQQA 4ZT1A 2ZUXA 3OD3A 3FRPG 4WENB 4GAGL 2YN5A 2VDOB 3HI6L 4FFVC 4EOWH 4LSQL 3FUNA 1TZIA 2AQRA 1PLAA 3ZZQA 2YIHA 3OHXA 4WNQA 1WITA 1YQVL 3VFSB 4WSGA 1KN4L 4HFUH 3ZTEA 1OANA 4XVSH 1RZKL 3QEQE 5A1AA 4NM4L 4OZHB 2K1MA 1HQRB 3PWUA 2IAMC 3E3QC 4L29A 4RIRB 5FGBC 2OR9L 4XMTA 3AADB 2UZXA 1MI5A 2WKGA 5E70A 4E9XA 2Y9RT 3ARDD 4GQQA 3O6FA 2XA8L 2X4OA 4R97C 5I5IA 4MFHA 3MJ7B 1PZ5B 5L0QC 5FHAL 1KSRA 1IM9D 4KNSA 2JCCA 3F04A 3QI9B 4U31A 4PW9A 2Z35A 2LU3A 4NM8L 2HJFA 1ZLEA 1F4WL 1CT8A 5J13B 4XMPH 4I1RA 3OV6A 1DVTA 2XWTB 4NN5C 5FM5O 4A7GA 5KSAA 4MCNA 4AG4L 2NNFA 2QBWA 3FFCA 4N8VA 1QYGH 1V5JA 4L8SC 5E94B 4BSVA 2OL3A 3B5GA 5KVMC 2R1WA 2XXGA 5JR1L 2WJ5A 5EOQL 4APQA 5MEQB 1R5IB 5A7EA 2EDFA 2PPDA 3LAFA 2WWKT 4QRBA 1EX0A 2JWYA 4J5VA 4CGUB 4UTAL 3CWGA 1MHHB 2PXYB 2P5WB 4RMWA 4JO3L 4PJHA 1J88A 4K94H 4N2CA 4H25B 3IPEA 5I1HL 4NRZB 3V9CA 3GBML 4K0OA 4UIKH 1T1XB 3Q5TA 4YDJA 5LNEA 3QG7H 3O8XC 1PIFA 3HCVA 1I8UA 3R0NA 5GHWH 2WXHA 2UZIL 3VXUE 1JNLH 5D7JA 4QDGA 3CFCH 4XMKL 2B0SH 4LDEB 4ZAKA 1JZFA 4YHNA 5D72L 3PXJA 4D0CB 1FNAA 4MNGA 4TNFA 4YBHA 3MV8B 5C0CD 1HEJC 1FL5A 1KJ2L 1HEHC 1VADB 2KLRA 4X0KA 1FO0B 4S2SB 3GBDA 4XVUD 4G6MH 4C59B 3QI9D 3S35L 2CBOA 1ZVNA 2PP7A 4EDXA 5KBKA 3C09B 5AFAA 4PJGB 3M86A 1YQVH 3RYMA 5CN3A 4DPBX 3GWJA 1R34A 4M5TA 4L2YA 4ZJ9A 2MJWA 2XX1A 4UNTA 4XXWC 3ULUD 2H1PH 4L3ED 5HYQB 1C8PA 1QMUA 2F53D 3FB5B 3M1BA 1WK0A 2E27H 3IDUA 2W38A 4LPVA 1Q0XH 2XG4B 4WK2B 1FP5A 2JJSC 4FG4A 4KTDH 4HG4J 2CPUA 1WTLA 5DK2B 4BZ2L 3MRJA 1JVOA 3T0EC 3DV6B 3T0EA 2BP5M 2X6AA 3APDA 3NFSL 4PJDE 4YSEA 5JNYB 4LVNB 1N7ML 1HOCA 2VSDA 1N8ZB 2F54D 4LP8A 3VFNA 4BWUA 3U82B 2A9NL 3QIUA 1E28A 4EQ2A 1A7NH 4L1BA 4FNLH 1TQVA 1D7DA 4PLKD 4TSCH 4QRRA 3SE3A 4K15A 3VI3E 3LH9A 3U4EA 3GS0A 3RIFK 3ULVD 3AITA 3T65A 1IQDA 4JM2F 1NGWA 1I8LA 4ZW3A 2X6UA 4G8GD 4WHTB 5HSFA 1WWBX 4J3VA 4KH2A 4KY2A 2VJ8A 3VD0A 3OKMB 5DD5L 1U36A 2I60L 2EC9T 4PJDF 4FQPA 5CF3A 2V4LA 2X40A 1MHEA 3EZJB 5C0AE 4HSQA 1K72A 1EO7A 2EEBA 4GAFB 5EF2A 3M6DA 1FLRL 2DICA 3IGFA 3KPLB 3QC5X 3WS3B 3ZIYA 4Q2ZA 5KW9L 2BDNL 5AL0A 1E9PB 2IJ0C 2ZOWA 1PZBA 4MJ5A 3ME0B 3OMZA 3D12B 1HHKA 1UWXK 3EBHA 4PJFA 4M48L 2SEBA 1W72H 4HMDA 4FX5A 1OF2A 4Y2DB 5I30L 5EA0L 3LRSB 3PABA 3OZLA 4M6MH 3IRCA 1FH2A 1WHPA 3SE3C 3FT3A 5J9PB 3IFOA 5BRZD 2J1XA 5SWSE 2YQ2A 2OTWB 2BWIA 5I1DB 4M1GL 4GKZB 5HY9A 2KL6A 4FMFA 4LASH 3JVGA 1G9MH 1QZ1A 4EI5C 4R4FL 1B0WA 1FC2D 1SBBA 3KXFB 3B3BA 4P59L 3X12A 5BQ7A 4JHWL 2JJTA 3IDYC 4HBCL 4JPWH 1MG3C 4K5OA 1MUJA 3TTSA 5IB4A 3W0WA 1GGYA 3SKMB 1BX2A 1VPOL 3D8MA 2DJMA 2JLLA 1YNKL 3H9YA 5HHQA 4LQ1A 1VGKB 4BFOA 4DN4L 2RCSL 5DK2A 1CYXA 1U8HB 3KH4A 3MOBH 5IGXH 1BDYA 4KJPD 2O61A 3FS9A 3IB4A 4UIMA 1GHFH 2YMXH 2DQUH 2WTOA 2OL3H 2XOTA 1S7WA 2E7MA 3T6XA 1P9MA 5DO8A 1ZKAA 1OP5K 1WBZB 1IGMH 1QOKA 3OKDB 4FXGA 4I0PB 2EUVA 3BMVA 5SWSB 3QSKB 4PRHB 3CE1A 1O75A 3DUSB 3QJFB 2HJLA 4JM4H 3CHRA 3KR3L 2YPVA 4URKA 3EYOA 4YBLC 2VABA 1AYRA 2BOBB 4AQEB 3BX7C 1D9KC 4HKJA 2IAAC 2XWXA 3OJDA 4P5TD 5LCVL 4N2GA 2XY2A 1KN2H 1F8TL 2V2XB 5KTEL 2B9AA 4PTUB 1NKOA 1QLRB 1XB3A 3EJQA 1XO8A 3OAYH 5E8OA 2PLTA 1ZANH 3GUTA 2WINB 4KKLD 5I1AB 4NC2B 2XN9B 1I8IB 4HK3N 3BUYA 4NBXB 4NHCH 4PYGA 5AVWB 2BDNH 5PAZA 4MDRA 4IGBB 2C3GA 5B7FA 1QNIA 2Y36H 4AIZA 4HJ0C 4HX1B 4PJ7A 4YVNA 1Z7JA 4DOHE 4MMXA 1KCUL 4UB0L 3LZPA 5HI5C 5FGCB 1G1YA 1KTDA 3LN4A 1ZJAA 3JT0A 4XODA 2EC9U 3KXFA 4JRXE 4KO5A 4D8PA 5KSBE 1EXUA 4HV8B 5JMOC 5MENA 4PJAA 3CBKB 2DIAA 1S78C 2P5PA 4Z7VE 3IDXH 1ZSDB 1YMHB 3GHBH 4QRPA 4JQIH 1MREH 4QXWA 4YL4A 3Q6FA 4J4PD 2B5IB 1FZOB 1SEQH 2YO3A 3VWJB 5E6IB 4DAGH 4JPWL 4K4KA 4GSUA 1WEJL 3L2NA 5C0BB 2GJ6B 2L04A 1BZ7A 4FFZL 4PY7A 3MJ7A 1N59B 4RX4A 1RULL 4D0BB 4XPTH 5CHNA 3PIQB 1ZEAL 3BESR 4JHUA 4K71C 1HI6B 5AOZA 3GTVA 4U0RC 3QRFM 3DX6A 1WCBA 3NFNB 4PJGF 2DKUA 3KPMA 4RGMB 4DWHA 4P48A 3AQZA 2WOBA 5DSCB 1NBQA 2BNRB 4YE4L 2VMCA 5J12C 3QJVB 2W65B 3VFWA 5CU9A 3LXBA 4D3CH 2V2WA 3NDYE 4AEIL 3RWIA 4ZUVA 3NCXA 1CZ8L 4JG1L 3L3IB 1MDAA 2AQ2A 1C1EH 3LMJH 1DQTA 2WNKA 3FPXA 2W95A 3MRLB 1QWHA 2UXVA 3BSZA 5CMAB 3RDTD 4H25A 1JHTB 4AIOA 4NRXA 2C4FT 4CKQA 2FATL 3U6RB 3GUTB 1QTSA 4W6XB 2V9RA 3CIAA 1OK0A 3S5LB 5GJSH 1GZQA 2E86A 3UXFA 1QR1A 3FO1A 2VAJA 3RL2B 3AROA 4DZ8B 2BVTA 3ZO0A 3HZYB 3LHAA 1PSKH 1MXGA 4JHVA 5JORB 4N86A 4LMQE 1EJ6A 1L4IA 5I18H 4N8CL 5ETUA 4N2KA 1M57B 1PF3A 3OMIB 5K39B 3IGAB 4HSAC 1NCOA 2BNRE 3L3OA 4NO0B 2QVKA 4C4KT 3IDJA 3V4PB 3ZDXE 3PHSA 5DDHA 1SLXA 3BZDA 3D07A 3DGGA 4N0UB 3O9WC 4X2UA 3VH8B 2OLDA 2DYPB 4ZZKA 4BQ6A 1F18A 1MIMH 2WC7A 4LMQI 4ONGH 3GTTA 3K2MC 1ZDSA 2WYIA 1U92B 1YUHB 2B1AH 4K94L 3GSRA 3B2VL 5TH2B 3CLFH 3PAUA 4HCRH 2ILLA 5KANI 3TA3A 4AE1A 3P4MA 4WUUE 4LOUD 3U9UA 2BP8A 1E6OL 1IBFA 4M7JL 3BWUF 1OAXL 1PKQE 2EC8A 4IDJH 2CCLA 4GRWF 4QCIB 4OR1A 5DVLA 3RL1A 3MXVL 3QEGH 5DQ9B 5KUMA 1M4KA 4L1LA 4GS7B 4OZ4A 1JGEB 4UQ2B 2DWDA 1DO5A 2PWHA 1BQHG 5CIPH 1RIUH 2ZXQA 1UOLA 3QEHB 3VD5A 2R8SH 3RWCA 5IUCA 1WICA 3RVWC 5CFHA 2FECI 2WTRB 3DHUA 5AYUH 2Z65C 3LV3B 1T0PB 5C2UB 3KLHC 2XN9E 2GTWA 3CFNA 1LO5A 1HDMB 2ODHA 3CFEA 2OK0L 1N4XH 5FYLE 1E4XH 2J8UF 2H2SD 4KV5F 4A7VA 4CW1B 2AK4A 1GYVA 2HH0L 3HG1E 1WVZA 1OWRM 1FNEB 2G3NA 2Q3ZA 2Z3FA 2VR7A 4XMVA 5TQ2L 2X4PB 3D33A 4E2OA 1HINH 1M7IB 1N5AA 2VE6B 4MA1C 3TH3T 5FO9B 3DX3A 4WI8A 3H6JA 4IRSA 4WUUB 5JO5A 1QFWL 1BZEA 5KZCD 5D93B 3NJKA 3DNKA 1S5IL 1F3DH 3EJZC 5D4HA 4CSSA 3RWFA 3TBSA 3DK2A 2AJUL 2VLKD 5IQMA 1DBJL 1KT2A 5JQ6H 3VA2C 5DURB 4P2QE 1F1DA 1A6UL 1FDLH 1YEFH 4XP6H 3ROOB 1T2JA 3BEVB 4AT6B 1CTOA 4WI7A 1PSKL 4I0CC 4XN5A 4A7GF 2VLLB 3GLDA 5BS0A 3UC0H 2VJ0A 3K7UA 4WW2F 3G04A 2IFFL 1JRHI 2DI8A 5B1BB 4TQIA 4U0RB 4P9HH 4JQVC 3FQTA 3CDGA 1S7SB 2XTJC 4HWBL 2EH8H 1G6RA 4GUPB 4LPTA 2KUTA 4AVHA 3DROB 4F7EA 5GS0C 3FUIA 1J86A 1XIWC 5A2CA 3N0PB 5DJ0A 2X6BA 4M48H 5C0EB 1MLCB 2J1YA 2LFGA 3VRLE 3V52L 1ZGLB 5G4OA 1QNZH 2HPOA 2ZWSA 4WEBL 3B56A 5L2JB 4OJDH 3FU7B 3Q6FB 5HYSB 4LEXH 2Y2WA 1M05B 5IVNA 1ZS8B 3WFHA 1TG8A 1R5VA 3H8NA 3R4RA 4KTYA 5CSBA 1PZUB 3HA0A 3U9PL 3O81A 1NLBL 3BKCH 4HIHB 4JHBA 4JE0A 4KJYB 4MDIB 4MLSA 4JHWH 4L1SA 3VU1A 1CLVA 2CMRL 1KJ2B 3TJEL 2KZKA 4PVNA 2JK5B 7PCYA 1VPOH 2AV1B 1JNHB 1TQTA 5IREA 2YPLA 2NY5L 2R69H 4ZXBD 5I6PA 2V2XA 1VKXB 2KERA 4NZRH 2BCMA 2MRYA 3DJRA 1KLUA 3CSBA 1FCGA 1TJIL 2I9LB 4EO5A 2QEJA 2LFEA 2DV6A 1GY1A 5I0ZA 4WKZA 2IEPA 3PNRB 1GHFL 2OSXA 2Z0UA 3H9SA 1UXSA 1RXLA 4WFGD 3U2SA 1LO0H 2VKWA 1NCJA 1YEDA 5EBMA 4DPCX 3PP4H 4ODWA 3MRLA 5J6GA 1J9RA 4LSUH 2ZOOA 3X14B 3QJUB 1IC4H 4NOFA 2L7EA 2VLJB 4OLVL 2RB8A 4D9RE 2VDLL 3NCFB 3FT9A 5J7CC 3MROB 1O5PA 4B60A 1WC7B 2FJFA 2I60H 3AU1A 5HHOE 3KWWB 1MIEL 2DM2A 5GRYA 1WFUA 3MREB 4OM0L 5CEXA 3OKOB 1NMAL 4JQXC 4OV6F 2PPEA 2I9TB 1GIGH 1RP9A 4AYDC 3BJLA 4NWUH 5JQHC 3WO4C 5C9KA 1RIVH 4WNQB 1KXTA 2G4GA 3MCLL 2CA4A 3IGAA 3BRDA 5K9QI 4XX1E 5JUEH 3X17A 3FUMA 1R3HA 3EBAA 4UZGA 3O3BB 3L7FB 3NZHH 3P3RA 1KXVC 2YD0A 3VI3F 1XD1A 3FU7A 1OHZA 1WCBB 3QK0A 4HS3A 4PGCA 4QRSB 2Y7SA 5E6YA 5F0PB 4HOMA 4H8PA 1BF5A 5CLXA 5KSAC 1FN4A 1UASA 5I5JA 5SWZE 3PFQA 1S9XB 2QGBA 4XWOD 4P4RB 5DT1H 2EVFA 5A2JH 3U7YH 5JIHA 5I19L 1DUYB 4PRDA 3L7EB 2FQEA 2AEPH 3ZDWA 1AO7A 1LXMA 2CO4A 4LCWE 4UV4H 5D7LA 1GZPB 3BYYA 1JWUB 4QXGH 4UQ2A 2QVFB 4S11A 4DQOL 3LVEA 4YC2C 4J1UB 1MFDH 3V8OA 5KBDA 2BSDA 3FB6B 1R33A 3TNNA 5DHYB 2BMKB 4YOKA 4CBZA 3ZTNH 2AGJL 1E4HA 1PG7L 1UJ3B 4LHQB 5ANMA 3TF4A 1EZVY 4IRSC 3O8XD 4XPBL 2WVVB 4FQIL 2XPGB 5A6IA 2GY7B 4I9XA 4L4TB 3MLTB 3NDZE 4MS8C 3WL9A 5EBMB 1S7VA 2XQYG 3ZUCA 4E36A 1QHOA 1Y7VA 5IM7B 1ZA6A 5AAWA 1J9SA 3BQUA 3EHBD 1FVDB 2X2IA 3JVFC 5KVDE 2FSEA 2BW4A 3T0DA 3PGCA 1MLBA 3QDMB 2J5LC 2AJ3B 2EH8L 4FTVB 3WAKA 1MCSA 4FERA 5H94B 3P3UA 1M7IA 5CXPA 1TETL 3B1UA 4JHZA 3CV5A 5FO9A 3SDDD 1P7QB 4OLWH 3VI4B 3CX2A 4AM0B 3EJPA 3V0GA 3PDDA 3IDJB 4Z18A 1UWEH 2A74C 2IAMD 3M88A 4P2QB 3CAFA 3OKOA 3MLPA 4XMPL 2P8PB 4G6ML 3SDDC 5LXVA 1OD7A 4E9LA 4LAJH 5D7IA 4JY4A 4LPUA 3O0LA 2QJDA 3B3IA 2WB1A 1FGVH 3BKYH 3UZVA 4G7VL 3MLUH 1IEAB 4KNQA 1EEYA 5EOQH 2YAFA 4YHLL 5GISH 1AXSA 4Z95L 2ZUTA 4FAAB 1S7XB 4M8QA 3W5NA 5FYLL 1T1XA 4C56D 5DQ9A 4IRJA 3G6DL 4H8UA 2MKLC 4JPQA 4KNUA 5D71L 2KI6A 3H3KA 1EEZA 3OJMB 1BXVA 1KIQB 2EDMA 3VNZA 3P69A 2XIBA 4F7EB 2OMWB 4HCRA 4Z8FH 3NIDE 4ZRGA 3MLWH 3SIKA 1DJYA 3D39E 2VH5L 2GIXA 3HR6A 1DSYA 4XMKH 3SDCA 3QORA 2CJUL 5L9DH 2W0FA 3F2LA 5I19H 1E28B 5DA0B 5HYJE 1HL8A 3GQFA 4FFWC 4OLVH 4UTAA 2E9JA 4Z7WB 4U7MA 2EZ0C 4X4YA 1TO5A 1SVBA 1ZTXE 1BJMA 5TQ0L 1BM3H 3GXNA 3UCRA 5FDWB 3GO1H 1J8HB 4LQFL 4GEJA 3UTQB 4BRJA 5ADPH 1NFIB 4M5SA 1OGAE 3Q1SL 3SBRA 3V0AC 3ZTJG 1KB5H 2XG4A 4MS6A 3H54A 3RE0A 2ZD0A 2NNAA 3DRTA 1MHEB 2NUPA 2YA0A 3HZKB 5D96C 4NENB 5CCKH 2BIHA 4NSKA 1GS8A 3KLQA 3BH9A 3W38A 2E74C 3HN3A 3TT3H 5CZVL 1NGQL 2F5AH 5FA4B 3S3PA 4QHMB 3O2DH 2GW5A 4H8WL 3N42F 1WCQA 1IX2A 3E9TA 3JVGC 1H15A 3NRFA 4IBLT 5L2KD 3QYCA 5F9OH 4RGND 3B37A 3NYKA 2VLJE 3K1DA 2QPFA 4WTZG 3HS0A 4JFEA 1E5YA 4MQ7A 1A8ZA 5D7IB 2EIKB 1IBBA 3ULVC 3ESUF 4QYOA 3E38A 5LJYH 1PIGA 3FH7A 5EU4B 1CD9B 3HRZB 4PRNB 3QUMH 1SN0A 4Q58C 4F2FA 4ZG1A 3LKSA 1K6QH 3TEUA 5C0DA 4F9PC 1JK8A 1MN4A 1V3LA 2N0KA 2ATKB 1EVUA 3BW9A 4XVOA 1S5IH 2LTQB 5HHMB 4Z3EA 3DJTA 1NIBA 3ZDYE 2EXYC 2XA3A 2WOYA 4LDCA 3RWJA 3VFPA 3X1GA 1KBBA 3Q2WA 3QFDB 4D8OA 5C07B 4BD4A 4DSYA 3K6IA 1LK3L 4TUJB 5T1KA 1AKJA 2MPVA 3GZQA 2BW5A 3MU3A 4LLMA 4V2BA 1BQRA 3RIFF 2FGWL 3GZOA 2L7JA 5IFJA 1M2VB 3L45A 1H19A 2B8OT 2ITCA 3GSNA 2PYFA 3K6SA 2IOIA 2VDRB 1F2XK 4QJ4B 3V4VL 1MWOA 4PWJA 1J87A 3TA4D 4MMZB 3QWRD 2ROXA 4WI4A 1JK9B 4FL4B 4XNMB 3DOHA 3B9KA 4KBPA 3T8MA 3WUWA 8PAZA 5AW7B 4NN5B 1NCUA 4NZFA 2HLFD 4X8GA 4IGBA 4J3OC 4O2EA 4NUGL 4B9YA 3I9PA 4L4VA 1CL7L 4I1NB 4MMXB 3UTOA 1IGJB 5FO8A 5HHQB 5CJBA 3QDGA 3QQNA 1Y18A 3GO1L 4LQFH 4JN2B 2W1NA 3WIIH 3VSUA 2VXQL 1OM3H 1F86A 3QJOA 4N0YL 4LB8A 3EDDA 1MPAH 5CD5C 2XQ0A 2HXAA 3K6FA 1N64L 4WHDA 3D39D 2WINA 1ZMYA 3HG1D 3L4XA 1QSFE 4Y4FD 1E4XL 5LCVA 2VDMH 1I82A 2O6FA 2HH0H 3MI6A 3PWPD 3FL7A 2B3IA 5L8JB 1TFPA 1MAML 2XN9D 3QJSB 5CD5D 4RISH 3DX7A 1A66A 1EAJA 5I26A 1AQHA 1BAGA 3CLWA 2AJXH 1NGZB 1G9MC 2GUYA 4MCYB 1H8NA 3CFIC 3FCBA 3OX8B 2VQ1A 5BZWB 2FO4B 4QRTB 1I1FA 4WNJA 3EYUH 3PRZA 1EFQA 4FEIA 4XWGL 1SHWA 2AJUH 5L7XH 1LE5B 3LX9A 4LK4A 3F7YA 1JNNH 2A6IA 2NW2A 1LVEA 4XHQA 3GM0A 4FI7A 3NP4A 5EFIA 4F8TA 4Q9RL 1U3NA 5IHLB 3ETBJ 1G5AA 3TCTA 4BFNA 2EQDA 5ICYB 1OHQA 5E9DE 4M9OA 2KZ1B 3KPQB 1DLFL 3QCVL 3HAEG 1DYZA 3D85B 4WZ9A 1F8TH 5I0DA 5JR1H 5KTEH 4KWUA 4P4RA 4E9SA 4PJBF 2FYYB 2EEAA 2WBJD 4G2AA 5CMAA 1BP3B 5MEOA 2ICES 1AQMA 3HPLA 3DI2B 3GMLA 4KU1A 4P3CL 3WJMB 3K6NA 3B9KB 2HKHH 3NIDB 1FSKC 4HVBA 2QL1A 1KG0B 3D87B 1UHVA 1TZOA 2FD6L 2VDMB 4NS0A 5D2NA 4YSDA 4ZTOL 1HVXA 2CLZB 3RZCD 3WEOA 2FR4B 4OI8A 2X88A 4G5ZH 1BLNB 2A38A 3HJEA 4PCKA 5F8QC 2K9UA 3IKCB 3CDFA 3KEHA 1PX3A 2XKNA 3GIVA 3CFCL 1GSKA 5B1AB 1QLEB 3ILDA 4G7RB 4KRPB 5D8JL 1FFTB 2LABA 2EIZB 1H8OA 3OPZL 1G5GA 1XZ0A 1EDHA 2VM3A 1JP5A 4X80H 1BQSA 5ESAA 3H4FA 1JRHH 3HUJE 4HETA 1KPRA 4TSBH 4CAGA 2WAQA 1EXHA 1ZK5A 5C0FA 1KTJA 3FRUA 1U92A 5FDWA 2O5XL 2VW6A 4ORGA 1S46A 1J05B 5TDOB 3QJQB 4GXFA 4S2SA 2Q10A 2FEEL 3GMPA 3HHSB 4R84A 4R4BB 4UT6L 2MHAA 1I1RA 1TIUA 3BN3B 3LZQA 3W9EA 2BNUA 1OAYL 2Z0BA 1I1FB 1KZYA 2DI9A 4XR8C 3L13A 3LRLA 4KZDL 4LL1A 1YPZA 2NRDA 3BLBA 3TA3C 3VYOA 4XVJL 5IFAL 4U3XA 3JV0A 2QMJA 3K2IA 3KM2A 4DGVH 1WP6A 2ENQA 4K3EL 4JFQA 4PJ6A 5FOBB 2ZOUA 2YK1L 4NUQA 3FQUB 1FUNA 5KYUB 3LHPL 3PJSB 3MBEB 2FEDD 3FSOA 5F8RC 4YK4B 2D0GA 4WCYL 4YSPA 2BC4B 2Q20A 2VYRE 5I5MA 1EHAA 3AY4A 4KMTL 5D72H 5EBGA 5DVMA 1J9QA 4FFYL 4G6FD 3CFMA 4V1DE 3RVXD 3KPTA 4Y4KD 2ZG1A 3QQ3B 5AW8B 1LHZA 5C97A 4GUOA 5IB5B 2OMXB 3L3DB 4PUBH 1T1YB 4BCXA 2X4PA 5BJTB 1N6QH 1YNTA 4IKIA 4CN6A 5I75B 1EO8H 1G7HA 1A25A 2FT7A 2ZUYA 1RU9L 2HWZL 1SXNA 5CGYC 1ODUA 5E99H 2CLZA 2LVEA 1BQHB 2D8KA 2HMID 3MLSH 1I7UA 4A7TA 4KI5E 2B20A 4ANKA 1D5ZA 4M6OL 4DP4X 3FT4A 3EJUA 4PJCE 2H9GA 3VSQA 2PTUA 1P5UC 2IGFH 4WW2C 3MLZL 2R7EA 1KB5B 5ACZA 1HIML 1LQBC 4XGZB 1BPVA 3BPLC 5DT1L 3N1FC 1KV7A 1KCSH 1B2YA 3GMRA 4NPKA 5EF0A 3S96A 3A0OA 2NZ9D 4L8DB 5M7QA 3DURA 5INDB 2EADA 4M8UA 5LBGA 3IGKA 1Z3GH 5DVOA 4IRSB 4WUUA 4Y2OB 4DGYH 4HIIA 1M1XB 3MA9L 4U1JA 3ZTDC 2FZ3B 2JTDA 3LB6C 5EORL 3ZE2B 5CBAB 1DL7H 3M7OA 1ZLWK 4RAUA 1UH3A 2N1TE 5T1MB 1JZ5A 1RURH 1QSZA 5GZOD 3GRBA 1SPDA 3V9EA 1O7SA 3ZTCC 2XQYA 3FBQA 3V7MA 5BQ7B 4G9DA 1GR7A 4JFSA 4KVNH 4BGDA 4Z7WF 5IEHA 3ARFA 2ZOLB 3VFVA 1IZKA 3AAZA 1CFVL 1J8RA 1HXYB 3BT0A 3MV7E 4PRNA 4LU5H 3WHXA 2JI2A 5DD5H 2EECA 4X6EB 1SYVB 2W9EH 4WK4B 3IJHB 3II2A 4UMGA 3KZ8A 1QASA 3K8KA 2DWEB 4PG9A 2F18A 3TASA 3H6AA 1FYTB 1PZDA 3EJSA 4JGNA 2ITFA 4I3RH 1FNSH 5AEAA 2EYRB 2KDGA 1CE1H 4GQ9H 4ZODA 5ID0A 1MCRA 2Z35B 1Z9LA 2CCWA 4LESA 4FNQA 4BHUA 4E9VA 2BNQB 3P4OA 2IO5A 2WBKA 4YHYB 3R0MA 4PBVC 1QSFD 4HUWA 3QUKA 3WO3B 1HAUA 4OZIE 4PRHE 1XGZA 3VXMA 1R5WA 4BKTC 1F11A 2R27A 3D9AH 1MRDL 1MW1A 2R0LL 2GSIB 4LCIH 5LLIC 1MCCA 4PJ9A 1DVFD 1G9ML 3AWGA 2JKXA 2YJLA 2PPAA 1T5XA 3MXWL 2QHLA 2VDKB 1GTNA 1YEDB 3C09C 2FEJA 3FFCE 4OFYA 1F58H 3AG4B 1AMYA 2DLIA 2P43B 4G6JH 5HDLA 5FR3A 3NACL 5JIIA 3H0TB 2R7EB 3EDEA 3EJYC 3NIFF 1FLTX 2D3NA 4A7UA 4X6BB 5D2LF 2A4EA 2XQBH 2E76C 1AIFA 2VR4A 5IGXL 1YZZA 4UAOB 5B1CA 1AC0A 1USQA 3VWKD 3JWDH 4IS6B 4PIBA 4R8WH 5ADOH 3VGBA 1ZGLA 1SJHA 3EDFA 3RJDA 1BX2B 1BVLB 1BD2E 2A77L 4I4WA 4Y2LA 5D1ZA 2HVJB 4ATWA 3SJVD 1R3JA 4JRLA 3O6FB 1SHMA 2VRKA 4F92B 4UZUA 3TVMA 2OYKA 3DECA 2F5BL 1TLMA 4D8PB 2X12A 3HC3H 3WNMA 1VACA 2ITDB 1A3RH 3LHPH 4GRWH 5AKRA 3BAIA 4JKPL 3VXRE 3S88H 3GMNB 2IMMA 3UBGA 1AYOA 3VFTA 2E5EA 3U7WH 3ZYOA 4EDWL 3PPEA 4KMTH 1CQKA 1K8IB 3NK3A 5FHBL 5C2BL 4KVNL 3UTTA 4AGLA 4EQ3A 3GBEA 1KELH 3KPSA 32C2B 3FFCB 3HTLX 3SKOB 2I9TA 2UVEA 5F6HJ 3VXPB 3NZUA 3JV4B 2P48B 3BI9X 4N0FA 3K0WA 3PY9A 1XR9B 4YNYA 3CZEA 2VLJD 2FX9H 5IQOA 2ADFL 2ZOKB 5JQIB 2BY0A 5EB9A 4D7PA 1N64H 2XYCA 4AI7A 3H42L 1YEJL 2P24B 3WEXA 3SOBH 4HD9A 5DJXA 3LZFL 4NQUA 5KG9B 3VFNB 1R3HB 1JE6A 2IFGA 4K7PY 4B7IA 2NY3C 1INEL 4NM8H 2VC2H 3HVNA 3US0A 1TVBA 1YAZA 1YEEL 5SX5H 2XTJB 4NDMA 1SXCA 4M7LT 3IJ7A 3U4EB 4APQC 1OGTB 3KWXA 5LG6A 1RD6A 4HSCX 4LRIA 3VAEA 5AB2A 5J89A 4KXBA 1F3JA 4PB0L 4ZO9A 3TPUB 3GSWA 3VDAA 2HTLC 3AABA 3DBXB 5ESVA 2KPNA 4ADJA 7CGTA 5IB5A 1DDHB 4POZC 1SEQL 2W9DL 4S0SD 1GZPA 4XNUH 4K71B 1DVFC 3DX9B 5KVEH 4OGXH 2DKMA 2WXQA 2BRQA 1BIIA 5E4OA 4G9FB 3MRIA 3DVNB 3FRPA 2BVUA 1JWSB 3SQOL 3TO4C 1N2RA 2CQVA 1J48A 1EJOL 1KY6A 1OF2B 4Y2DA 1RJYA 4UIKL 4U1MA 5HDBF 5HYSG 4RCAA 1ED3A 2WNWA 2PTTB 2YC1B 5DR5L 3X3FH 4P07A 5FUCC 3LB6D 5DVKA 4FMVA 4NNXB 1OAQH 3V0WH 5C0GB 2PYEE 1NUFA 2HKHL 2H1XA 5IVOA 4D3CL 3MRGB 1ZPLA 1HL4A 2FJUB 4PV8A 5DJCB 2Z9TA 4NNPH 2X38A 4KX9A 3QZPA 4NKOB 4PJBA 1KJ2H 3IBOA 4RZCA 2EINB 5HVGB 3RY6A 3VMNA 4K07A 4BFGA 2WQRA 1M6OA 4IRSD 4XPHH 1O7DC 2J1WA 4TOYH 2WANA 1WJ3A 3D4GA 4DP2X 3SKOA 2DMKA 4PLJD 4JY5L 4QRRB 3DIVA 3V55A 3PQYA 1U95B 1AQDA 1UD3A 4LCIL 2XACC 3IJSB 3LNIA 4AIXA 2L8AA 2DIEA 3AREA 2UXGA 2C3HA 2GC7C 5E0QA 1XAUA 4FQXB 5HGBA 3S9DB 4GKOA 5EC1A 3H9SE 3UJTH 1AKPA 3C8HA 2R0KL 1PD1A 3IRZA 4NLHA 1W91A 4N8PA 1AXSB 4CSZA 3ARXA 3U6RA 2Y7OA 4RA3A 4F7CA 3QARA 2EYRA 2IBBA 2KKQA 3LZOA 4N1CA 1S3RA 2H3NA 2NW3A 4Y5YA 3GSXB 5L7XL 2R2BA 4JKWA 1HDMA 3CFEB 4M7JH 4PJ8A 5K33A 5ID1A 2WXRA 5FYJD 4DCQB 3LEVL 3FT4B 3BDXA 3LKRB 3Q44A 5I74C 2A77H 5IP4A 5I5RA 1AD9B 4GP4B 5L88L 1T6WA 4HCRL 5GRZA 2C9SA 2LHAA 1T20B 2VT0A 4PJ9B 3UMNA 3LZRA 1G9NH 1N0XL 1ZHNB 5LQBL 4LSQH 2OJ1A 4CADA 1LP9A 4UMSA 2P44B 5K59E 2ZYSA 3FONB 3MLUL 4PJAE 2VUOA 4XH2A 5IFHH 4JRYB 2UXFA 3K0YA 4YWGL 5IB2B 1LLAA 3O41B 4N85A 5T1MA 3ECUA 1YN7A 3QAQA 4W9CC 1E9QA 5I8KH 3UEZA 1ROCA 2NX5D 5MI0B 5ES4B 2HFGH 1OAQL 3L3GB 4OF6A 3KVPA 4G70B 4M6OH 3WNLA 1JTOA 4JG5A 2XQYK 5LDSA 3CDGB 3IF1A 4UINH 1R3JB 2IQ9L 4P9MH 4WLCA 5HGHB 1RUPL 2J20A 3LNDA 3V5KA 4WGVB 4FJYA 3EJCA 2EIMB 4M1DH 3UAJA 5MENE 4Z0BH 2B4CL 3ZU8A 5E9NA 4QGTA 1KCRL 1F4XL 1MZYA 1CS6A 3IFLL 3QUXB 4PRBA 2YXVA 4R90H 4DQAA 4LLDB 3TBTB 3VGHA 3C08H 5ISZB 3IU3A 5HYSA 3BEWB 4FQ2L 4CN1A 5KBNC 3FQNA 2G3MA 3RG1C 1FDLL 1YEFL 3Q8FA 3U1PA 3TIDA 4PS4H 1VHPA 5HBBA 3V6ZB 4XX1G 2V9QA 3C2SA 3A67H 5D70L 2ZOKA 3FQ1A 3TURA 2D7TL 3B2UC 1RJZB 1UZ8A 1JPSH 4FQQB 5HJGA 4LU5L 1DJSA 4PV9B 3SD5A 3ISWA 2ZCZA 5KSAB 1JNHA 4AX3A 1UA7A 4H8WC 3O2DL 4WJ5B 3RNKB 1AD9A 3RUGF 2H5UA 4RRPA 3FQXB 3B7RL 4XBGB 2R1WB 4QYOB 3PHQA 3R7QA 3LRHA 2BHYA 3TH4T 3ZKMD 4PJHE 4FG0A 3LD8C 3V2AR 3RTQA 1YY8B 2X4OB 1BQ5A 1DQQB 1EHKB 4I88A 5DJ2B 2W60A 3MRHB 5MEND 1EO8L 2RIKA 1LGVA 1GL4B 1Q4NX 1PZ5A 5CKGA 4NO5A 4G9FE 2B59A 1P5UB 4AL8L 1U8KA 2G2PA 1VGEL 4E0RB 3MO1B 3PE9A 1WA1X 4IKLA 5DI8A 4GBXA 1GIGL 4WWID 4AW4A 2Y36L 5I1LB 4IGBC 2MQGA 1QD0A 3WDJA 1UWYA 3O6KH 1HQRA 3MCLH 2XNAA 3PWUB 3BN9D 3IPBA 4UQIM 1A7RH 1XBDA 1R3LA 3OC8A 3AQYA 3K71A 4IBZA 2HFGL 2WCSA 1VADA 3OC5A 4U1GB 1INDH 3AM8C 1SDAB 2P80A 4YHOH 5G5DB 4MD4A 1NC4B 4JQIA 5TDNA 2XWJB 1XWVA 4NHUB 3VRJA 4C83B 5JPMB 4X4KA 2X0VA 1D3CA 3MBEC 2HTKC 4EVNB 4QRQB 4Y4FC 3TCLB 2CK0L 5SWZB 1EPFA 4NUGH 4OZ4B 3VD4A 1PZ3A 3ZDZB 1WHOA 4GMTH 1KLGA 3QR1A 4F1SA 4LCVA 4F93B 1OSPL 3V4UL 2I9LA 5JOEA 2EABA 4NQTA 5IESL 1GZQB 2WBXA 1R75A 3WMQA 2ETWA 2NCEA 5J0BA 4OY9A 3P54A 3PL6A 4KDTC 3GKWL 3VI3B 5I8EA 4W9JC 4IRZA 4JFEE 5I1IL 2DBLL 3KPNB 4LSPL 1K8DA 5BV7C 1ZAGA 2FJFB 1WFNA 1X5MA 1JGDB 5DC2A 4ZUTA 3CMOH 3SDXF 5M94B 7FABH 4TVPL 2DIJA 3G5ZA 3LPGA 1AGEB 1TETH 2D03L 1B2WH 4PR5B 2IOMA 2ZQKA 4Q9QL 3HB3D 4NO5B 4KV5E 4XHJD 1EV2E 3T8VA 3QDJB 3T71A 1MLBB 3QDMA 3BKML 4Q2ZB 5DRWB 1UXLA 3D3VB 4G6AC 1IGFH 4XCFL 2GB2A 3ZX1A 3SE9H 1UM5H 3TEYA 4EAEA 2MWCA 2LAAA 4R7NB 4M1DL 1TU2B 4XCEB 2W59A 3GMOB 1T66D 2WO3B 2DQTH 5C0FB 4TPRL 2RCSH 1JV2A 1DQML 4N25A 4OT1H 5I24A 4OM1L 1B4JH 5HHVH 4QHKI 5B8CC 4JS7A 2K7QA 1LE9A 1P6FA 4NZTH 1ZTMA 2EXSA 1MJJA 4ODHH 2NCMA 1KEML 5FPIA 3NCYS 3WKQA 3ZDYF 4R9HA 3NABH 2G4EA 1EGJH 5DTFA 3VI4F 1ZVSB 4IKJA 3L9RB 4FFWD 1QBBA 3MDJA 3QWNA 4QXUH 3RI5F 2EE6A 4EVNA 5CD3A 1XSJA 1ZPUA 4TSAL 5AW4B 3EYVA 5DMIH 4YSOA 3NSJA 4AGPA 2FAUA 1U8NB 4M5ZL 5B4MD 3SDAB 3AC0A 1HYRC 2QTVA 3RGHA 4OCSL 1V54B 4OGYH 3WDIA 1FNLA 4XXDA 4TS6A 2X9WA 3QDHA 2EH7L 3U7WL 4H20H 1G0DA 3ARQA 3LNHA 2BFVH 4PJ5B 5C09B 2BOLA 2YUWA 5LO7A 4TRPH 1DZ0A 1WAAF 2VDOL 1GYCA 5GJTH 2X53A 3DA0A 2DQGL 1LEIA 4N0UE 3RHWK 4WI9A 1AD0A 4L5FL 1KB5A 4U1HA 4XMZA 4LHUG 1TVHB 3HZVB 1P69B 4TQPA 4MSWA 4C56E 1CGYA 4D9LH 4L4TE 4Z7WA 5LAPA 1D7FA 1DQIA 3DJZA 2CO6A 1KXVA 2BP0B 1IC7H 3T77B 3BEVA 4XN2A 4XVSL 4OLXL 3JBG7 5D2LA 1HH9B 4JZJC 4KHTL 3BZFB 2VDNH 3MGAA 5EZJB 1INEH 3SGDH 3RJOA 5ICZA 1ULVA 4PGBB 4Z3HA 3AGVA 4TLSA 5L4IA 2D2CC 3GI8L 3RNQB 1YPZE 4ZUUB 5FC9A 4AXWA 2ZOLA 3VFVB 4AL8C 5B3JF 1H3WM 4LPYA 3RUGB 4P04A 3BCFA 1NEZA 5AB1A 3ULSB 2AXGA 4UQAA 3AT8A 3ECWA 2BSSB 2W88A 5ADPL 1WT5C 2J44A 1MLCA 1AHWB 5D1QE 1UM5L 43CAA 1E5ZA 1YJDH 4OUOA 4OZGF 4F58H 1ONQA 5BMFL 1G43A 3AB0B 4HUUB 5KSBB 2VTFA 3GTNA 4TPRH 1RK0A 4JFFB 3ML9A 4ZPTA 1U8HA 3AGWA 1KTRL 4BGLA 1XH2A 3J7HA 2ZUWA 1E42A 2PXYC 3D30A 1DHKA 2YD6A 1KZQA 2PCPB 5FW7A 2PO6B 1ZY9A 1WUZA 4JGUA 2WM0A 3T2PA 2J4WH 4JAMB 4UQBA 3VD2A 1DVQA 3TN0C 5MEPA 3WJLA 3IXAA 2V7NB 1TMCB 3ZK0A 5I1IH 1CFNA 3ZW3A 3X1BA 1T5XB 5ALCH 4XZUB 1ADWA 2CD0A 1N59A 3LMJL 5DYOA 2IDUA 4CJ0A 2F5AL 3Q05A 4R83A 2CCVA 4NUMA 2W9LA 3REVA 2W94A 2Q7AA 2XV3A 2FZ3A 2ZUUA 2FATH 3CZFB 5DJ6B 5AB9A 5MHSD 2R4RH 5FIEA 4KMLB 2YARA 3MZGB 1TXKA 3FTYA 4KJPC 2VR5A 2X7LA 3WKML 2C4XA 3MA9H 3MYJA 5I28A 4N6RB 4F80A 1EXUB 4HV8A 3GZPA 2EVIA 3NG5A 3HE7B 2XETA 2HZHA 3H4HA 3P2BA 2CMRH 5B7EA 1K85A 3ATFA 5EDXA 3UTTD 1HH6B 4L9LA 4K8RC 4S1RH 4XOBA 5F9WC 4AKQA 1DQDL 1CDHA 4Q6IA 1MI5D 3A4EA 4X7TB 2EDLA 1KGWA 1Z9MA 2A6KB 3UEQA 2DQTL 5KN5A 3VXSE 3MFGB 4NX0A 4UOW0 4MQTB 1TYEB 2Y22A 3MVSA 3B5TA 4JPKL 3VXUB 3WD5H 1ZOXA 3RGVD 4BXVA 3TVMD 3PGCB 5D9SA 3JTSB 4OBRA 5EHFA 3QHFH 3RAJL 2AMGA 2VERA 3HR5A 2GJPA 5F9JB 4Y16A 1RUKL 5ACMA 2O6CA 4BFFA 4UAOC 1EXGA 1NC2A 1F97A 2ALWA 1LD9B 3HZMA 3EJJX 4OFDA 4PTTB 2NR6A 3HFFA 4LNVA 1MF2H 1I8KA 1ZT7B 2F61A 3A6CL 1CR9L 3QFDA 1MCIA 3I6GA 2GVYA 2WYTA 3M8OL 4TQEH 2QPUA 1MQ8A 1X4XA 2ZG3A 3A6OA 4TSCL 5BV7L 5JW4M 3SQRA 4Z1PA 1FE8L 1KYOJ 4WHCA 1CI3M 4X9YA 4U2YA 2P47B 4PGEA 4FZEL 1NL0L 1WBXB 3VFMB 3WFCH 5BZDA 1C08B 3ZL4L 5AWNH 4Q8BA 2X70B 1G84A 5HGAB 1BG9A 2BSBA 5TE6L 1D7CA 1D9KB 1JN6A 1F58L 1JWUA 3E6FB 1AGBB 1F3JB 2VXQH 4LKXA 1SM3H 2PABA 1KBVA 1A4BA 2F9BT 4ODVL 2NXYB 3BP7B 4P4KC 1QSFA 2EXWD 1CWVA 2CKNA 4OLXH 1Q8MA 1DJXA 4O2EB 1EMTH 2QADD 2H41A 3DO4A 2Y07L 4FZ8H 4HA1A 5ETUB 3FFDA 3H2PA 1OO2A 3QXDB 5JIDA 2ZX7A 1UACL 5FYLD 2NXYC 5AVYB 2CSPA 3B9AA 2WN3A 4XC1L 3FDWA 4OFPA 3FUEA 3EFDL 4MBOA 3AXIA 2B9BA 3ZE0B 3WS6A 5DD0L 4PY8I 1AHKA 2JJUA 4JMXA 4OSUH 2WWOA 2E6QA 3FO1B 4WFEE 2XCMC 2F6AA 3ROLA 3CIQA 1OL0A 1I4FB 4Q97A 5GS0H 4M93C 2QGCA 1YEKL 4K5MA 3EH2A 3L5WB 4LNRA 4OGXL 4G5AA 4PR5A 2O5XH 3RGVA 1MRCL 3EOTL 4LHUA 4RETB 3SPVA 5C0IA 4F8NA 4LLYA 4PV8B 2VL4A 3MV8D 5C0CB 4HOWA 4MCYA 5I1GH 1AI1L 2IG2L 3CQFA 2TSAA 3LN9A 4MJJA 3VTTA 5HHOB 3GJFB 2OA9A 1A1NB 3TONA 2VXUH 4WUUD 2OMYB 2JKLA 5E4IA 2WXGA 4N8VB 1YUKB 1W15A 2VM4A 2ZX6A 4OF7A 4ZUWA 2DEXX 1OTUD 2ORBH 5DD1H 2IANA 2YUXA 4LASL 1E7VA 2HN7A 4NKIH 2GAZB 2A2QT 2YHGA 3VFGL 3KPQA 4NNXA 4EIUA 3SB3A 5SWZD 2C9RA 2P7TB 1LILA 4YLBA 1QBAA 3MODH 5IUSA 3KLSA 4LHJB 3EGXA 2ZWNA 4PVBA 4FNTA 2ZG2A 2UY6B 4B9FA 2OJZL 1J1OL 4PFEA 5T1JA 3BGMA 3EYVB 3ARUA 4LSSH 3QORB 1HYSC 4LCWA 4U1IA 1ZLVH 4GBXC 1HFUA 1PAMA 4I3SL 4Y9FA 2ATPB 1OP3H 4RSVA 3W3BA 3VD7A 4V1DB 1P1ZA 4Y4KA 2V9UA 1A7RL 5GGQH 3F7VA 5E99L 2VERN 1GKOA 4OB5L 3I2CL 4EN2A 4AGNA 1L9TA 1U3JA 1A22B 35C8L 1V7NH 1XL6A 2DW5A 1HWWA 1UM6L 1DJWA 3P9MA 4OZIF 2QKIB 1N0LA 3O11B 1M7UA 5EZPA 1VJSA 2C7UB 3RB5A 4A38A 4UB0H 1PL3A 1VCBC 1RJCA 4ODHL 4DF9A 4ODBD 4GJTB 1SDYA 4NWTH 2V6HA 3BQUC 4D0DB 4KZDH 2C1OA 3HMXL 3OKEB 4LSUL 1E4JA 3APFA 2DL2A 3BD4A 3GXFA 5HI4C 1VLXA 2BCKB 3CFUA 1LNUA 3OHXB 3HHSA 4PMEA 12E8H 1P4IL 5KYXB 2OCJA 3BDBA 3X12B 4PRIA 5D4QA 2X7LB 4KVCL 3D7PA 4WSJA 4FQJL 5C86A 4N2BA 4KI5C 2PCFA 5B39A 3FB8A 4MVBD 2GEQA 1X5YA 3FO0H 3CUPB 4NWUL 3NQKA 3SY6A 1ZEAH 2VLLA 3MPCA 3QG6B 3DMMB 3HE6D 3NRQA 2PNDA 3ARBD 4LVOC 2F1BA 4QEGA 3UABA 3N1QC 1OAUH 2Q8BH 4YSCA 1T4KA 3MBXH 1SUHA 3TBYB 2YUVA 1ZS8A 1KY7A 4GSXA 4HIJA 4KNTA 4B53A 3TCXA 5DO2C 3X14A 5G4NA 1JGUL 3WY3A 5FDYA 4IKKA 1OAKL 4MAZA 1EHXA 1OWWA 5D4JA 4I89A 2I25N 3CN1A 2ERJB 1G7MA 1H3PH 3V4PL 5C71A 4KDWA 4OCYH 1CICD 4PG9B 5L8LB 1LD9A 3KDMB 3RZCA 3WCYA 2A9ML 2Y5QA 1YG9A 2QGEA 1J8SA 1U3HB 4OIIL 3HVDA 4PD4J 4MAYD 4L1DA 5E08L 4WKZB 2Q6WB 1CFBA 1XF5A 5BO0D 4B0MB 5J6HB 4JFOB 4QXGL 1E5AA 5E03A 3FQXA 1I9JH 1AC6A 1JZ7A 1VFOA 1NBZB 3WTVA 2P8MA 3SN6N 1OT2A 2HAZA 4QTIH 2AGJH 3T0AA 1KEMH 1W8OA 5I2IB 1GCFA 1A6VH 3WJMA 5J1TC 3JV5A 2EE0A 3V0FA 1DN2A 1CF8H 1V27A 2QVTA 3DKHA 4UNUA 4PREB 2LOEA 3IETB 5E2UL 3X11B 2E7CA 5EF3A 3ARGD 4NQVB 3W0WB 4PJBE 3WEMA 5GPRA 5BRPA 4HFWB 1VSCA 4L05A 3I75A 1EIBA 1WS7A 5DHVA 3NZHL 3F83A 4ALAL 5ITFA 3QUHA 4JMNA 3V5KB 3D9AL 3RP1A 3DX7B 1TTAA 3CU1A 4ZMYA 4X99B 1UWEL 5IEHB 3W39B 2BINA 2R83A 5KSVA 3TV3H 3ZZLA 1RLWA 5L0QB 4AM0Q 4HC1L 4NPJA 4UT9H 4QNPE 4ZQTA 3X13A 1A5FH 3HI1A 4G9FD 3TBWB 4N8CH 4WWKC 5G4MA 1HSAA 3P3SA 4KQ4H 5JTWA 1GY2A 3GK8H 3JT2A 1VFUA 5EU6A 4FC3E 1XF2B 4CA4A 4X7SL 5ECJE 2NY0D 4UQ9A 1VERA 2D73A 1BG1A 3O0RL 2KLSA 4R8WL 4BKSC 4HUXB 3CHXA 5AQ0A 1J8KA 2VL5A 1X3DA 4LSDA 1X5ZA 2AJXL 3VXOB 4M03A 2XG5A 3MRBA 3H7BB 4P5TC 4U7KA 3CZUB 1C08A 4WU5A 1SBSH 5EOTA 4R2GD 1EFXB 1I7RA 4XNYH 4WWKD 1SF3A 2F68X 3P77B 3QWRA 3MV7B 5CLTA 3B3IB 3WG7B 3F7RA 2GITB 1I8IA 4XAWL 2K3HA 4PHZA 4GXVH 1RPUA 1AGDA 3Q06A 4N5UA 3O9WB 3A24A 3FTXA 5C6TH 3K72B 4EDWH 2J1KA 4NJAL 3KH3A 3BQUB 2YLKA 3A4FA 1YN6B 1OSPH 3V4UH 2BVPA 4FYTA 4RNRA 4ETQA 1JPTH 1RFDL 4NQCB 4K7FB 4ZK8A 3QRGH 5FFGA 2CKBL 3KW8A 3X11A 3G5ZB 1ET5A 4WQOA 5DJ8B 2AEIT 2XFXB 4LL9A 1YMHA 1U58A 5HYJA 1TZIB 3QDJA 1UXWB 1CMOA 3WLBA 4O58L 1NDGA 4DTGH 4ZMQA 3QEUA 4JO2L 4LDLB 4JL1A 3SO3B 1UT1A 2ICCA 1X4ZA 2AVGA 4AEEA 5FYKL 3CN4A 1N2RB 1PVHA 2KYIA 3RIAK 2CE6A 1OGAB 1ORSB 1ZLVK 2HLAA 3EFOB 2NYYC 3D25A 1CGUA 4JY6B 3OKEA 4AOFA 4F7TA 4Y2OA 1DSFH 1JZGA 3MACH 4HXAL 3LXAA 3VFOA 2AS5M 4GKLA 1E8WA 5FUOH 3QNZB 1IGTB 4FZ8L 3CN2A 3P4MB 2NNAB 4XE0A 3KJ6L 1A47A 3G5XA 3GS4A 2GAZA 3QPQC 4HZLB 4S10A 3T8XA 3QWQB 2Y1VA 2N7SA 1SMOA 5DJXB 1HHIB 1COBA 1OARL 1B4JL 1I75A 5FW6A 3SDAA 3NK4A 5TF0A 5C0CE 4KQ0A 4Q6KA 2XV2A 1WGOA 1RZJL 3CXDH 5GGVH 5IMLB 5C07D 1FYTA 2VN7A 2N59A 1LWHA 4JFDA 3C60A 2N7AA 1IKFL 4BK4A 1U8JA 4FQXA 1DBBH 1BZOA 1P2CA 5E5RB 3RI5K 4MNQB 3DO7A 4WGKA 1M6UA 5E5LA 1EJOH 4J3OG 3P1VA 2OMWA 1X5XA 5AW2B 2JXMA 1CR9H 3A6CH 3ULVE 3C12A 4AYEC 3AUWB 5C07E 2FB4H 3H9HB 1A2YA 4QT5A 4H40A 1RP8A 3BWAB 3TNMA 5C6WH 1AJ7L 5HHXL 1A4KA 1XR8B 4MJ2A 5T3XH 1TZ8A 2RH0A 4TVUA 5E00A 3IN0A 4Y5YB 1XSOA 3N40P 3J2PA 4MJID 2Q6WA 1E5CA 4HPYH 4BIKA 1RHHA 4UT6A 3BVWA 3LQZB 4IJTA 1DJZA 2JKSA 3OKLB 3CHOA 4JRWA 4L8DA 4RSYA 2IQAB 2NX5A 4Z3GA 2DIBA 3P9LA 1J5OH 4O51B 4Q6YA 2YBGA 5TH2A 2P1YA 2X0WA 1BZ8A 5CGBA 1CD0A 3S8WA 2E9IA 4JDVB 1L9NA 1FG9C 1KACB 1X5HA 5DWUH 1W72B 1TTBA 2D7OA 1L3NA 3MGOB 2IAMA 2W80C 4CDGC 1E4KC 2DJSA 1GPOH 4P0DA 3E1F1 4X7SH 1HXYA 5CJXC 1OP3K 2X1QA 3KG5A 5J3HD 5IHUH 4LRIC 2FCBA 3I6KB 3UACA 4NT6A 4LSRL 4R7XA 1CTMA 3GXPA 3M7FB 3BQUD 4FNPA 2APWA 4NYLA 5ANHA 5LDUA 3VWJD 2X5PA 5AB0A 1S4IA 3P3YA 2YD1A 1HHIA 2UZYA 4G1MA 5EC1B 3QP3A 3ULUC 1QA9B 3QQXA 3QJZA 4PJ8D 3DSFH 2MH4A 4QRAA 4ZFZA 3L3HA 1TJGH 4I2XB 1KB9K 2G75A 2J8OA 4WI0B 3C2AH 3FQ2A 5F6HI 3UZEC 2M8XA 5DEFA 1U9KA 3RWHB 1WAPA 3LNEA 4E68A 2B15A 1O6SA 2F1AA 1EAOA 1PLCA 5DHDA 2VE6A 1S9VB 2J43A 1Z2KA 4G82A 4M7ZB 2LU7A 1AO7D 1GA2A 3BIKB 5EEVA 3ALXA 4ZNEA 1A7PH 1XF5B 3UTTE 5FM8A 4J2QA 4TKWA 3TZVB 3H9HA 3Q9PA 5LNGA 3K6SB 3FMGH 5IFHL 2NYZA 4WFHE 1GYAA 3HE7A 1EFXA 4PJDB 2MQCA 2PCYA 3QUZA 1BVZA 2CBTA 2PF6A 5HJDA 5ICYA 3BSZH 4DN3H 5H35A 1RZ8B 2AVFA 5AOJA 1MHPL 3RL2A 2P8LA 5DRXB 3IFNL 4APXB 1Z5LB 3U0PB 3RNKA 1E0OB 2B16A 4HZ1A