2E4JA

Solution structure of mouse lipocalin-type prostaglandin d synthase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
167
structure length
167
Chain Sequence
b'GSQGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKAVLYMCKTVVAPSTEGGLNLTSTFLRKNQAETKIMVLQPAGAPGHYTYSSPHSGSIHSVSVVEANYDEYALLFSRGTKGPGQDFRMATLYSRTQTLKDELKEKFTTFSKAQGLTEEDIVFLPQPDKAIQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostaglandin-H2 D-isomerase
publication title Solution Structure of mouse Lipocalin-type Prostaglandin D Synthase
rcsb
source organism Mus musculus
molecule tags Isomerase
total genus 22
structure length 167
sequence length 167
ec nomenclature ec 5.3.99.2: Prostaglandin-D synthase.
pdb deposition date 2006-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2e4jA00
4AYHA 1BJ7A 5D4AA 1EPBA 5IO5A 1XCAA 4ZH6A 1MX7A 4IAWA 2LBVA 2AKQA 5L8OA 2FR3A 1SY2A 1QFVA 3HWEA 4A60A 4N7DA 1HN2A 4EDEA 1LFOA 4ODDA 2L67A 1GT1A 3BX7A 3UEWA 1KXOA 2MO5A 1LKEA 2Q39A 3HWFA 1S44A 3KFIA 1QABE 5EDCA 1YUPA 3ZUIA 2GC9A 2AT8X 5HCDC 5LJHA 4A1HA 2WWPA 2A2GA 4HPAA 3FEKA 1VYGA 3C77X 3I0AA 4YMYA 2RD7C 2A3FX 3D95A 2L9CA 3BY0A 1IFBA 4OMWA 1B4MA 1HQPA 5F7GA 5F6BA 1PBOA 3APVA 3P6CA 3STNA 1YP6A 4ZR2A 1YWCA 5D47A 2ANSA 2X46A 4OS0A 4DQ4A 1GGLA 1KZXA 5HZ6A 1NGLA 3WVMA 1QWDA 3NPOA 1FTPA 1HMTA 3CBSA 5EDBA 5B27A 2ASNX 1MDCA 3NX1A 1OEJA 3BDRA 4XMCA 1IW2A 1ZNDA 4IMNA 2R73A 3Q6LA 3FIQA 5JR8A 3VG2A 3HWGA 4XMHA 3STMX 5HZQA 2POAA 5KIDA 1A18A 1HBQA 5F58A 4YFPA 3VG4A 5EZ2A 4HPDA 1FENA 2RQ0A 4ZHHA 1X8UA 4MVKA 4XMDA 4AZRA 1FEMA 3TGBA 1EIIA 3JSQA 2WEWA 1ALBA 1ZNLA 1JJXA 5LJCA 2FTBA 4QAEA 3STKA 2Q4NA 5HCCC 3L4RA 2K62A 3KFFA 3FR4A 1DFVA 1I04A 3KQ0A 5HTEA 3FENA 4QYPA 5H9LA 1GM6A 4ARHA 5H9AA 1LF7A 5LKEA 1G5WA 4MVIA 1GT4A 3KZAA 3KFGA 2EU7X 3FEPA 1RBPA 3B2KA 1ERXA 4AW8A 1T8VA 4EFGA 1U17A 1T68X 3CQRA 5LJBA 4RUUA 3QKGA 4I3BA 4QZTA 2OFMX 2HZRA 2XKLA 2GJ5A 1I4UA 5L8NA 4YFQA 2NNDA 3FA7A 2E4JA 4TLJA 1FDQA 2R74A 5IO7A 3WJBA 4NLIA 1DZKA 3C78X 2DM5A 3P6GA 1O8VA 4LKPA 4WFUA 1BSYA 3U03A 1OEEA 2QO4A 4AZQA 1ZNGA 5F6ZA 2K23A 1KT4A 1BEBA 4QZUA 1AB0A 2Q9SA 4NYRA 4M7MA 1CRBA 1BSQA 2ALLX 1YWBA 3TF6A 3C76X 3P6DA 1S7DA 1I05A 2A13A 3WXQA 1GKAA 3U0DA 1HMSA 2MM3A 1ZNHA 1OBPA 1UZ2X 4QYNA 1T0VA 4BQUA 2KTDA 2CBRA 2OZQA 2QO5A 4BVMA 2FS6A 1VPRA 1X8NA 5FENA 1QQSA 2W2FA 2RCTA 2HNXA 2NP1A 4WFVA 2QOSC 4Y0RA 1U0XA 4UU3A 3O22A 3PH6A 4QGVA 2CZUA 1I06A 1QY0A 4XMGA 4ALOA 3BU9A 1B56A 2OFRX 1KT7A 2LFOA 3JS1A 2WR6A 1DV9A 4R0BA 2QO6A 3PPTA 3RZYA 3DSZA 4GNYA 4ORWA 1KOIA 4ALBA 4AZMA 5HZ9A 1N0SA 3B2HA 5HA1A 4BOEA 5D48A 1EALA 2AL0X 1BRPA 5D8JA 1OBQA 2CBSA 2WUTA 4TKHA 3G7XA 2CZTA 4MVLA 1O1VA 4TKBA 1LIDA 4YDBA 3IA8A 3VG3A 1TW4A 3NX2A 3P6FA 1BRQA 1QFTA 3WJEA 1A3YA 2JN3A 1JZUA 1IKJA 3PEDA 4XMFA 4Y0QA 1CBSA 3KFHA 2AT3X 1KZWA 4ORSA 4WBKA 2FWVA 1X8OA 1OPBA 2WEXA 4ZHGA 1R0UA 1G74A 1TXLA 5BVSA 3B2IA 1A2DA 4YKMA 1CBRA 5LJEA 1IKEA 3B2JA 1SXYA 3EMMA 4YGZA 4I9SA 1XKIA 3ZQ3A 4ORXA 4NNSA 2Q2PA 3CBCA 3FLLA 1D3SA 4D6BA 1LPJA 4I3CA 4PSQA 1CBIA 5EPQA 4I3DA 5HA0A 1ZNKA 5K06A 1SA8A 1ML7A 4RUNA 2WQAE 1ZRYA 4KIIA 1PMPA 1GX9A 1AQBA 1KT3A 1BBPA 3BLGA 3EM0A 5B29A 5KHPA 1OEKA 4ORRA 1GKAB 1PEEA 5D45A 4ES7A 1YIVA 4XMEA 4OMXA 1TVQA 4GNWA 1DZPA 3CR6A 4ZHCA 3FW4A 4AZPA 4IB6A 2RA6A 1JBHA 2CM4A 1E06A 2AT0X 4YBUA 1BLRA 3PECA 1EIOA 1YWDA 1D2UA 1DZJA 5L8IA 5HZ8A 3EYCA 2L68A 5EEDA 3WJFA 4EXZA 1KT5A 1NP4A 2W2BA 3D96A 1ERBA 1LIBA 1X71A 1JYDA 2P8GA 3CMPA 1QY1A 4ZFXA 1SXXA 4IMOA 3FR5A 3TZSA 1LICA 3K3LA 5BVQA 3FMZA 2AH7X 5H8TA 3AKNA 2LKKA 3VG5A 1JJJA 2MJIA 3MBTA 4DQ3A 5CE4A 1PM1X 5DG4A 1DC9A 2FR2A 3UEUA 2JU8A 2WSJA 1KGLA 1NP1A 1LNMA 5LJKA 2QM9A 1GT5A 1A57A 3TGCA 4TNNA 5KICA 3EBWA 1JYJA 5IO6A 4Y0SA 2F73A 1X8PA 3HK1A 4GE1A 1H91A 4IB8A 2FRSA 1HMRA 4Y0PA 1BM5A 1CBQA 3ZUOA 2N93A 4YCHA 5HZ5A 1FE3A 4QGXA 2O62A 3FA8A 4NLJA 1JV4A 3B2LA 5AQ6A 4ZH9A 2ACOA 2JU7A 1TOWA 4I9RA 3VG7A 2YG2A 2G78A 1AELA 4YBPA 5BVTA 1ACDA 4TKJA 3BX8A 3I17A 1ADLA 2W2AA 2NNQA 3NQ9A 4HFOA 3NR3A 2HLVA 3BSZE 4IB7A 2FT9A 2L5PA 1IIUA 4LKTA 1ZNEA 1MUPA 4YFRA 2KT4B 5HAEA 3CWKA 2HMBA 1EXSA 3D97A 1AVGI 3PP6A 4IBAA 1X89A 2LBAA 3HWDA 1X8QA 4YGHA 1GX8A 4YGGA 4EEJA 2A0AA 4M6SA 4IB9A 3S26A 2LB6A 1B0OA 2G79A 1Z24A 3WJDA 4TQ2A 1SXWA 3F8AA 3AKMA 1OPAA 1E00A 2A2UA 3FA6A 2OVAA 4YCEA 1E5PA 3O19A 5F1EA 1G7NA 4OS8A 2FLJA 3APUA 1QG5A 4AZNA 3UEVA 2AT6X 2PY1A 4ZJ0A 3DTQA 1EW3A 1G85A 1OBUA 4UU2A 4ORUA 1SY3A 1BWYA 5H9NA 4HPCA 3NADA 5FFHA 2JU3A 3FELA 1UREA 3WJGA 1GXAA 5DPQA 3BS2A 1SY1A 1S2PA 4HPBA 2Q2MA 1MX8A 3ELXA 4LZVA 3T1DA 1B8EA 3APXA 5LJGA 2ACPX 5LKFA 5EEEA 4NP1A 2NNEA 2JOZA 1RLBE 2R56A 5FAZA 3EBKA 4GKCA 2FS7A 1BSOA 1HBPA 3WJCA 2OVDA 1KT6A 5HCEC 1VYFA 4ZCBA 4YDAA 2HYSA 3MVFA 4N7CA 3ELZA 4ORYA 2OVEA 5HWZA 1YP7A 3CQNA 3NQ3A 3UEXA 1EQDA 2CM9A 1SY0A 1LIFA 4LZUA 1IFCA 3BRNA 1P6PA 3VG6A 3FW5A 1U18A 3WBGA 1EUOA 3BU1A 4YKOA 2AMMX 4AZOA 4ZGUA 3TGAA 3P6HA 3NP1A 1TOUA 3PH5A 1DZMA 4OS3A 2AT5X 5C0NA 4D6AA 3U9PC 1DF3A 2GTFX 4GH7A 3RSWA 4A8ZA 2BLGA 4K19A 4CK4A 1KQXA 2IFBA 1MVGA 3SAOA 5HTDA 1EPAA 1ICNA 2HZQA 2G7BA 5H9KA 4GETA 1KQWA 3IFBA 4A1YA 4ZHFA 4NNTA 4GRJA 1E02A 3OJYC 5LJDA 2XSTA 4NYQA 1LIEA 3FA9A 2WQ9A 3F9DA 2X45A 3P6EA 1ICMA 5HBSA 4YH0A 4O9SA 4TJZA 1CJ5A 4ZHDA 1QY2A 1L6MA 1SXUA 3GAQA 1FELA 1YWAA 2RCQA 1GT3A 4IAXA 3O2YA 4QGWA 1O1UA 3FR2A 3APWA
chains in the Genus database with same CATH superfamily
4AYHA 1BJ7A 5D4AA 1EPBA 5IO5A 1XCAA 4ZH6A 1MX7A 4IAWA 2LBVA 2AKQA 5L8OA 2RTDB 2FR3A 1SY2A 3HPEA 2OY7A 5BYPA 1HXZA 4I95A 4BX7A 1QFVA 2RTLA 3EC5A 2OF9A 3HWEA 4N7DA 1HN2A 4A60A 1LFOA 1SWKA 4ODDA 4EDEA 2IZHB 2L67A 1GT1A 3BX7A 4U8UO 3UEWA 1KXOA 1SLDB 2LA7A 2MO5A 4EKVA 3PQSA 2OFAA 4GGTA 1LKEA 2Q39A 3HWFA 1S44A 3KFIA 1QABE 4CPHB 5EDCA 4FBVA 1YUPA 4INNA 2GC9A 3ZUIA 2AT8X 4O4UA 4CV7A 3HOEA 5HCDC 5LJHA 3PDFA 4A1HA 2WWPA 2A2GA 4HPAA 1HY2A 3FEKA 1VYGA 5B10O 3C77X 3I0AA 3F6ZB 1WUBA 4YMYA 2RD7C 2A3FX 3D95A 5CYBA 1SMPI 2L9CA 3BY0A 3QQ2A 2OF8A 1IFBA 4OMWA 3RDSA 1HQPA 5F7GA 1LELA 4JHQA 1B4MA 5F6BA 5FQ8E 3VGWA 1PBOA 3APVA 3P6CA 3STNA 1YP6A 2IZDB 4ZR2A 3VHMA 3ZW2A 1HXLA 1YWCA 5D47A 4I6SA 2ANSA 4IB7A 2X46A 3OD9A 4OS0A 4DQ4A 3SZHA 1GGLA 1I78A 1UYNX 3RY1A 4CPIA 1KZXA 5HZ6A 1NGLA 2BT9A 3WVMA 1QWDA 3LTWA 2Y3FA 3NPOA 1FTPA 3OBLA 1HMTA 3CBSA 5EDBA 5B27A 3RY2A 2ASNX 1MDCA 1VYOA 4LQZA 3NX1A 1OEJA 3BDRA 4XMCA 1IW2A 1ZNDA 4IMNA 2R73A 3Q6LA 3FIQA 5JR8A 3VG2A 3HWGA 4XMHA 3STMX 3D9WA 1LDOA 3SLTA 2PI3O 5HZQA 2POAA 5KIDA 1A18A 1HBQA 5F58A 3X00A 4YFPA 1Y52X 1LUQA 3VG4A 5EZ2A 4HPDA 1FENA 2RQ0A 4ZHHA 1X8UA 4MVKA 4XMDA 4AZRA 2VFBA 1FEMA 3TGBA 1VWRB 1EIIA 3JSQA 2WEWA 1ALBA 4ON1A 2FHNX 1ZNLA 1SRJA 3SLOA 2QOMA 1JJXA 5LJCA 2FTBA 1WBIA 4QAEA 3STKA 1LCVA 2OL6O 2Q4NA 2RTCB 2DJFA 3L4RA 5HCCC 3T6LA 5AJBA 2K62A 3KFFA 3FR4A 1DFVA 1I04A 2RTKA 3KQ0A 3PK2A 5HTEA 4CDFA 3FENA 4QYPA 5H9LA 1GM6A 4ARHA 5H9AA 2C1QA 1LF7A 5LKEA 2OFBA 1G5WA 2RTQB 4L1NA 4MVIA 1GT4A 3KZAA 3KFGA 2EU7X 4ML7B 3FEPA 1RBPA 4BCSA 3B2KA 3HOLA 5CHKA 1ERXA 3CKFA 3RBYA 4AW8A 1NC9A 1T8VA 1W6FA 3FYFA 5CSEA 1U17A 1T68X 3CQRA 4EFGA 4FQBB 1IJ8A 4RUUA 5LJBA 3QKGA 4I3BA 4QZTA 3RE5A 3VE1A 2OFMX 1W5RA 2HZRA 2XKLA 4BX7B 2GJ5A 4FBOA 1SWQA 1I4UA 3ZW0B 5L8NA 4YFQA 5FQ7E 2NNDA 3FA7A 4GU8A 3WZOA 2E4JA 4GD9A 4TLJA 2IZGB 1FDQA 2R74A 5IO7A 3WJBA 4NLIA 1DZKA 1JMZA 2DM5A 2F01A 1O8VA 3C78X 3P6GA 4LKPA 4WFUA 1BSYA 1NDJA 1OEEA 4CDDA 3U03A 1SREA 2QO4A 4AZQA 1ZNGA 4O4OA 2X8FA 5F6ZA 2K23A 4FBRA 1KT4A 1BEBA 4QZUA 2ZSCA 1AB0A 1N9YA 2Q9SA 2KTSA 4NYRA 4KCAA 4M7MA 1CRBA 3EW2A 1BSQA 2ALLX 1YWBA 2ZAGA 2Y32A 3C76X 4GGRA 3N91A 3P6DA 3RDQA 1S7DA 3TF6A 1I05A 2A13A 2IZCB 3WXQA 1GKAA 3H3IA 3T2XA 3U0DA 4Z2VA 1HMSA 2I5ZO 2MM3A 1ZNHA 1OBPA 2IZBA 1UZ2X 2RTEB 4DCBA 4QYNA 1T0VA 4BQUA 1SWSA 2OY8A 3S5VA 2KTDA 2CBRA 2OZQA 2QO5A 4BVMA 2FS6A 1VPRA 1X8NA 5FENA 1QQSA 4QQ1A 2RTNB 2W2FA 4PJ2A 2RTFB 2RCTA 2HNXA 2NP1A 3JQOA 2QOSC 4WFVA 4Y0RA 1U0XA 1AVDA 3ZWEA 1SRFA 4UU3A 5F2BA 4ZGFA 1KL4A 3O22A 3PH6A 4YVBA 4QGVA 2CZUA 1VWNB 1I06A 1QY0A 1VWAB 2RN4A 3RDUA 4XMGA 4ALOA 3BU9A 1B56A 2OFRX 2Z4HA 1KT7A 2LFOA 1N9MA 2WR6A 1SWPA 3JS1A 4O3YA 1DV9A 1Y55X 4R0BA 4MISA 2KW1A 2QO6A 2GTLM 2X8SA 3PPTA 3RZYA 3DSZA 4GNYA 4ORWA 1KOIA 4ALBA 4AZMA 5HZ9A 1N0SA 3B2HA 1N4JA 1MK5A 5HA1A 3VHHA 4BOEA 5D48A 1SWNA 4O4SA 4CDEA 2KD2A 3D4RA 1N7YA 2AL0X 2IZJA 4BJ8A 1BRPA 2RTHB 1EALA 5D8JA 1OBQA 1SWUA 2CBSA 2WUTA 3PQUA 4TKHA 4I60A 3G7XA 1RSTB 2CZTA 1JMXA 4MVLA 1O1VA 4NW4A 4TKBA 1LIDA 2BS6A 2BSZA 4YDBA 1I9HA 3IA8A 1EI5A 2WPUA 3VG3A 1TW4A 3NX2A 3P6FA 1SWTA 1BRQA 1QFTA 3RKGA 1A3YA 2JN3A 3CKGA 3WJEA 1JZUA 1SWDA 1SWRA 1IKJA 3PEDA 1SLEB 4XMFA 1LCWA 4Y0QA 1CBSA 3KFHA 2AT3X 1KZWA 3LHNA 4ORSA 4WBKA 1VWGB 1VWHB 2FWVA 2OY1O 4JNJA 1X8OA 1OPBA 2WEXA 1LCZA 1R0UA 4ZHGA 1AVEA 1G74A 1TXLA 1VWJB 5BVSA 3B2IA 1A2DA 4YKMA 1CBRA 5LJEA 1IKEA 3B2JA 1SXYA 3EMMA 4YGZA 2JMBA 4I9SA 1XKIA 4OKAA 5B11O 3RE6A 3ZQ3A 4ORXA 4NNSA 2Q2PA 2M4LA 4MIRA 3CBCA 3FLLA 4GK9A 1D3SA 4O49A 4KH8A 1HQQA 1LPJA 4I3CA 4D6BA 2X4MA 4PSQA 2G5LA 1CBIA 1MM9A 5EPQA 2OY5O 4I3DA 1JJUA 4BX5A 5HA0A 1ZNKA 5K06A 1SA8A 1ML7A 4RUNA 2RTPB 1SWJA 1MOYA 2WQAE 3AEHA 2GH7A 1ZRYA 2BS5A 1PMPA 4KIIA 3EW1A 2ZAIA 5AJCA 1GX9A 1AQBA 1KT3A 1BBPA 2IZAA 3BLGA 3EM0A 5B29A 5KHPA 1OEKA 2AVIA 3WOVA 4ORRA 4C5PA 1GKAB 1PEEA 5D45A 4ES7A 1YIVA 4XMEA 4OMXA 1VWLB 1TVQA 4GNWA 4WHIA 1DZPA 3CR6A 4CPHA 4MEEA 4ZHCA 3FW4A 1STRB 4MVEA 4AZPA 4GJSA 4IB6A 1SWFA 2RA6A 1JBHA 2CM4A 1E06A 2AT0X 4OEMA 1FJ1E 1VWMB 4YBUA 1SRGA 3PECA 1BLRA 1EIOA 1YWDA 1D2UA 1DZJA 2QCBA 4O4XA 5L8IA 5HZ8A 3EYCA 2L68A 5EEDA 1SRIA 3WJFA 4EXZA 1KT5A 1NP4A 1VWKB 1VWFB 2W2BA 3D96A 3HTYA 3RDMA 3WYPA 1ERBA 1LIBA 1X71A 1JYDA 2P8GA 1VWEB 3ZZVA 3CMPA 4B55A 2F09A 4U46A 1N43A 3AUMO 1SWHA 1QY1A 4ZFXA 1SXXA 4IMOA 3FR5A 3TZSA 1LICA 3K3LA 5BVQA 3FMZA 2AH7X 1Y0GA 4IRWA 5H8TA 3AKNA 5AEOA 1VWBB 4Y5DA 2LKKA 3VG5A 5JD2A 1JJJA 2MJIA 2YMSA 3MBTA 1JIWI 1VWOB 4DQ3A 5CE4A 1PM1X 1SRHA 5DG4A 1DC9A 1RAVA 2FR2A 3OE3A 3UEUA 3WZPA 1VWQB 2JU8A 4BX6A 2WSJA 2OL7A 4Z27A 1KGLA 1NP1A 1LNMA 5LJKA 2RTIB 2G8CO 3VU1A 2QM9A 1GT5A 5IRUA 4KC8A 1LDQA 1SWGA 3FIDA 4COTA 5K67A 3TGCA 4TNNA 1A57A 5KICA 1SWEA 3EBWA 1JYJA 5IO6A 2A8GA 4Y0SA 2F73A 1X8PA 3HK1A 4GE1A 1H91A 4IB8A 1OSPO 1NQMA 2FRSA 4NV8A 1HMRA 5FQ6E 3V8UA 4Y0PA 2RTGB 2JW1A 1BM5A 4ID2A 1CBQA 3ZUOA 2N93A 4YCHA 5HZ5A 1FE3A 4QGXA 2O62A 3FA8A 2VDFA 1Y53X 2RTBB 4NLJA 1RXHA 4NV7A 1JV4A 1W4TA 3B2LA 5AQ6A 4ZH9A 2ACOA 2JU7A 1TOWA 2C4IA 4I9RA 4IABA 3VG7A 2YG2A 2G78A 4JO6A 1AELA 4YBPA 5BVTA 2OYBO 4GJVA 1ACDA 1VWDB 3BX8A 4TKJA 3UAQA 4CPFA 3I17A 1ADLA 2W2AA 2NNQA 3NQ9A 4HFOA 3NR3A 1DF8A 2HLVA 3BSZE 3ZI8A 2FT9A 4O3WA 2L5PA 4BX5B 1PBYA 2JGSA 1IIUA 4LKTA 1ZNEA 4BBOA 1MUPA 4YFRA 2KT4B 2A5BA 5HAEA 3SZJA 3E3CA 3CWKA 2HMBA 1EXSA 1RSUB 2OVSA 1AVGI 3D97A 3PP6A 3SZIA 4IBAA 3ZW0A 1X89A 2LBAA 3HWDA 1X8QA 3P24A 3RDOA 4YGHA 1GX8A 1VWIB 3MM0A 3NQKA 4YGGA 5B2AO 1RXKA 2A0AA 4M6SA 3RWXA 4EEJA 4IB9A 3S26A 2LB6A 1B0OA 2G79A 1SLGB 1Z24A 3WJDA 4TQ2A 1SXWA 3F8AA 3AKMA 1OPAA 2MWHA 4GZVA 4DNEA 3T2WA 4U8UM 1E00A 2A2UA 1RXJA 3SOTA 3FA6A 2OVAA 4YCEA 1E5PA 2A5CA 3O19A 1G7NA 5F1EA 4OS8A 2FLJA 3APUA 4JGLA 1QG5A 4AZNA 3UEVA 1K24A 2AT6X 4Z6JA 3SLJA 3ZW1A 4Y59A 2PY1A 4CPEA 2RTOB 4ZJ0A 1SWAA 3DTQA 4U9CA 1EW3A 1G85A 1OBUA 3KVNA 1SWLA 2X32A 4OELA 4UU2A 1VWPB 4ORUA 1SY3A 1BWYA 1SWBA 5B3MO 5H9NA 2X56A 4HPCA 3NADA 5FFHA 1SLFB 5B5FA 2RTAA 3Q34A 2OL8O 2JU3A 2RTJA 3FELA 1UREA 3WJGA 2UZ2A 4L3RA 5K68A 1GXAA 2X34A 5DPQA 3S60A 3BS2A 3VE2A 4BX6B 4EQAC 1SY1A 3T6FA 2BC3A 1S2PA 2RTMA 4HPBA 2Q2MA 2FKJA 1MX8A 3ELXA 4LZVA 1NBXA 4HWMA 3T1DA 1B8EA 3APXA 5LJGA 2ACPX 5LKFA 5EEEA 4NP1A 2NNEA 5L3YA 2JOZA 1E2TA 1RLBE 2R56A 5FAZA 3EBKA 3FDCA 2IZFB 4GKCA 4GDAA 3APWA 2FS7A 4BGFA 4O3XB 1BSOA 1HBPA 3WJCA 2OVDA 1KT6A 4GGZA 5HCEC 1STPA 1VYFA 4ZCBA 4YDAA 2HYSA 3LV4A 3MVFA 4N7CA 5IRAA 3ELZA 4ORYA 5B5GA 2OVEA 4QNIA 5HWZA 1STSB 1YP7A 2GTLN 3CQNA 2QMIA 3MX7A 3NQ3A 3UEXA 1EQDA 2CM9A 2X55A 4KT5A 1SY0A 1K3BA 1LIFA 2IZLB 1KL5A 1Y9LA 2MHDA 4LZUA 2I5VO 4O3ZA 4Z2OA 1IFCA 3BRNA 1P6PA 2BHVA 1VWCB 3VG6A 4QRLA 4Z28A 1JQPA 1U18A 3FW5A 4GUZA 2FKGA 2Y3EA 3WBGA 1EUOA 1KFFA 3BU1A 4YKOA 2AMMX 2RTRB 4AZOA 4ZGUA 3TGAA 3MG5A 3P6HA 5IRWA 2X8TA 2HKDA 2IZIA 3WZQA 1PTSA 2VFCA 2CAMA 3RDXA 3NP1A 1SWOA 1TOUA 2Z4IA 1SWCA 1DZMA 1MEPA 3PH5A 4OS3A 5IXGA 3P02A 2AT5X 3VPJE 1UYOX 5C0NA 4D6AA 3U9PC 1DF3A 4U8UN 2DJGA 2GTFX 2IZKA 2FHLA 1Y9TA 4GH7A 3RSWA 4A8ZA 2BLGA 3GE2A 4K19A 1KQXA 4CK4A 2IFBA 1MVGA 3SAOA 4KC7A 5HTDA 1EPAA 4CSBA 1ICNA 2HZQA 2G7BA 5H9KA 4GETA 1KQWA 3IFBA 4A1YA 4Z2PA 2MF6A 4ZHFA 4NNTA 4GRJA 2UYWA 1E02A 3OJYC 5LJDA 2XSTA 4NYQA 1LIEA 3FA9A 2WQ9A 4FGIB 3WYQA 1NQNA 3F9DA 3NBXX 2AF5A 2C1SA 2X45A 3P6EA 4U3QA 1ICMA 5HBSA 3WZNA 4YH0A 3VHIA 2GTLO 4O9SA 4TJZA 3ZW1B 4CDCA 4ZHDA 1KL3A 1CJ5A 1QY2A 4GDZA 1L6MA 1SXUA 2FGSA 3GAQA 1FELA 1YWAA 3S5XA 2RCQA 1GX3A 1GT3A 4IAXA 3O2YA 4QGWA 1O1UA 3FR2A 2IZEB
chains in the Genus database with same CATH topology
4AYHA 1BJ7A 5D4AA 1EPBA 5IO5A 1XCAA 4ZH6A 1MX7A 4IAWA 2LBVA 2AKQA 5L8OA 2FR3A 1SY2A 5BYPA 4I95A 1QFVA 3HWEA 4A60A 4N7DA 1HN2A 4EDEA 1LFOA 4ODDA 2L67A 1GT1A 3BX7A 4U8UO 3UEWA 1KXOA 2LA7A 2MO5A 3PQSA 1LKEA 2Q39A 3HWFA 1S44A 3KFIA 1QABE 5EDCA 4FBVA 1YUPA 4INNA 2GC9A 3ZUIA 2AT8X 4O4UA 4CV7A 3HOEA 5HCDC 5LJHA 4A1HA 2WWPA 2A2GA 4HPAA 3FEKA 1VYGA 3C77X 3I0AA 3F6ZB 4YMYA 2RD7C 2A3FX 3D95A 5CYBA 1SMPI 2L9CA 3BY0A 1IFBA 4OMWA 1B4MA 1HQPA 5F7GA 5F6BA 5FQ8E 1PBOA 3APVA 3P6CA 3STNA 1YP6A 3ZW2A 4ZR2A 1YWCA 5D47A 4I6SA 2ANSA 2X46A 3OD9A 4OS0A 4DQ4A 1GGLA 1KZXA 5HZ6A 1NGLA 2BT9A 3WVMA 1QWDA 3NPOA 1FTPA 3OBLA 1HMTA 3CBSA 5EDBA 5B27A 2ASNX 1MDCA 4LQZA 3NX1A 1OEJA 3BDRA 4XMCA 1IW2A 1ZNDA 4IMNA 2R73A 3Q6LA 3FIQA 5JR8A 3VG2A 3HWGA 4XMHA 3STMX 5HZQA 2POAA 5KIDA 1A18A 1HBQA 5F58A 4YFPA 3VG4A 5EZ2A 4HPDA 1FENA 2RQ0A 4ZHHA 1X8UA 4MVKA 4XMDA 4AZRA 1FEMA 3TGBA 1EIIA 3JSQA 2WEWA 1ALBA 4ON1A 1ZNLA 1JJXA 5LJCA 2FTBA 4QAEA 3STKA 2Q4NA 5HCCC 3L4RA 5AJBA 2K62A 3KFFA 3FR4A 1DFVA 1I04A 3KQ0A 5HTEA 3FENA 4QYPA 5H9LA 1GM6A 4ARHA 5H9AA 1LF7A 5LKEA 1G5WA 4L1NA 4MVIA 1GT4A 3KZAA 3KFGA 2EU7X 4ML7B 3FEPA 1RBPA 3B2KA 3HOLA 1ERXA 3RBYA 4AW8A 1T8VA 3FYFA 4EFGA 1U17A 1T68X 3CQRA 4FQBB 4RUUA 5LJBA 3QKGA 4I3BA 4QZTA 3VE1A 2OFMX 2HZRA 2XKLA 2GJ5A 4FBOA 1I4UA 3ZW0B 5L8NA 4YFQA 5FQ7E 2NNDA 3FA7A 4GU8A 2E4JA 4TLJA 1FDQA 2R74A 5IO7A 3WJBA 4NLIA 1DZKA 3C78X 2DM5A 3P6GA 1O8VA 4LKPA 4WFUA 1BSYA 3U03A 1OEEA 2QO4A 4AZQA 1ZNGA 4O4OA 2X8FA 5F6ZA 2K23A 4FBRA 1KT4A 1BEBA 4QZUA 1AB0A 2Q9SA 2KTSA 4NYRA 4KCAA 4M7MA 1CRBA 1BSQA 2ALLX 1YWBA 2ZAGA 3TF6A 3C76X 3N91A 3P6DA 1S7DA 1I05A 2A13A 3WXQA 1GKAA 3H3IA 3U0DA 1HMSA 2MM3A 1ZNHA 1OBPA 1UZ2X 4QYNA 1T0VA 4BQUA 3S5VA 2KTDA 2CBRA 2OZQA 2QO5A 4BVMA 2FS6A 1VPRA 1X8NA 5FENA 1QQSA 4QQ1A 2W2FA 4PJ2A 3JQOA 2RCTA 2HNXA 2NP1A 4WFVA 2QOSC 4Y0RA 1U0XA 3ZWEA 4UU3A 4ZGFA 3O22A 3PH6A 4QGVA 2CZUA 1I06A 1QY0A 2RN4A 4XMGA 4ALOA 3BU9A 1B56A 2OFRX 2Z4HA 1KT7A 2LFOA 3JS1A 2WR6A 4O3YA 1DV9A 4R0BA 4MISA 2KW1A 2QO6A 2GTLM 2X8SA 3PPTA 3RZYA 3DSZA 4GNYA 4ORWA 1KOIA 4ALBA 4AZMA 5HZ9A 1N0SA 3B2HA 5HA1A 4BOEA 5D48A 4O4SA 2KD2A 3D4RA 1EALA 2AL0X 1BRPA 5D8JA 1OBQA 3PQUA 2CBSA 2WUTA 4TKHA 3G7XA 2CZTA 4MVLA 1O1VA 4NW4A 4TKBA 1LIDA 2BS6A 4YDBA 3IA8A 1EI5A 3VG3A 1TW4A 3NX2A 3P6FA 1BRQA 1QFTA 3RKGA 1A3YA 2JN3A 3WJEA 1JZUA 1IKJA 3PEDA 4XMFA 4Y0QA 1CBSA 3KFHA 2AT3X 1KZWA 3LHNA 4ORSA 4WBKA 2FWVA 1X8OA 1OPBA 2WEXA 4ZHGA 1R0UA 1G74A 1TXLA 5BVSA 3B2IA 1A2DA 4YKMA 1CBRA 5LJEA 1IKEA 3B2JA 1SXYA 3EMMA 4YGZA 2JMBA 4I9SA 1XKIA 3ZQ3A 4ORXA 4NNSA 2Q2PA 2M4LA 4MIRA 3CBCA 3FLLA 4GK9A 1D3SA 4O49A 4KH8A 4D6BA 1LPJA 4I3CA 4PSQA 1CBIA 5EPQA 4I3DA 5HA0A 1ZNKA 5K06A 1SA8A 1ML7A 4RUNA 2WQAE 1ZRYA 2BS5A 1PMPA 4KIIA 5AJCA 2ZAIA 1GX9A 1AQBA 1KT3A 1BBPA 3BLGA 3EM0A 5B29A 5KHPA 1OEKA 3WOVA 4ORRA 1GKAB 1PEEA 5D45A 4ES7A 1YIVA 4XMEA 4OMXA 1TVQA 4GNWA 4WHIA 1DZPA 3CR6A 4ZHCA 3FW4A 4MVEA 4AZPA 4IB6A 2RA6A 1JBHA 2CM4A 1E06A 2AT0X 4YBUA 1BLRA 3PECA 1EIOA 1YWDA 1D2UA 1DZJA 4O4XA 5L8IA 5HZ8A 3EYCA 2L68A 5EEDA 3WJFA 4EXZA 1KT5A 1NP4A 2W2BA 3D96A 3HTYA 3ZZVA 1ERBA 1LIBA 1X71A 1JYDA 2P8GA 3CMPA 2F09A 1QY1A 4ZFXA 1SXXA 4IMOA 3FR5A 3TZSA 1LICA 3K3LA 5BVQA 3FMZA 2AH7X 5H8TA 3AKNA 5AEOA 2LKKA 3VG5A 1JJJA 2MJIA 2YMSA 3MBTA 1JIWI 4DQ3A 5CE4A 1PM1X 5DG4A 1DC9A 2FR2A 3OE3A 3UEUA 2JU8A 2WSJA 1KGLA 1NP1A 1LNMA 5LJKA 3VU1A 2QM9A 1GT5A 4KC8A 4COTA 1A57A 3TGCA 4TNNA 5KICA 3EBWA 1JYJA 5IO6A 4Y0SA 2F73A 1X8PA 3HK1A 4GE1A 1H91A 4IB8A 2FRSA 1HMRA 5FQ6E 3V8UA 4Y0PA 2JW1A 1BM5A 4ID2A 1CBQA 3ZUOA 2N93A 4YCHA 5HZ5A 1FE3A 4QGXA 2O62A 3FA8A 4NLJA 1JV4A 3B2LA 5AQ6A 4ZH9A 2ACOA 2JU7A 1TOWA 4I9RA 4IABA 3VG7A 2YG2A 2G78A 1AELA 4YBPA 5BVTA 1ACDA 4TKJA 3BX8A 3UAQA 3I17A 1ADLA 2W2AA 2NNQA 3NQ9A 4HFOA 3NR3A 2HLVA 3BSZE 4IB7A 3ZI8A 2FT9A 4O3WA 2L5PA 1IIUA 4LKTA 1ZNEA 1MUPA 4YFRA 2KT4B 5HAEA 3E3CA 3CWKA 2HMBA 1EXSA 2OVSA 3D97A 1AVGI 3PP6A 4IBAA 3ZW0A 1X89A 2LBAA 3HWDA 1X8QA 3P24A 4YGHA 1GX8A 3NQKA 4YGGA 4EEJA 2A0AA 3RWXA 4M6SA 4IB9A 3S26A 2LB6A 1B0OA 2G79A 1Z24A 3WJDA 4TQ2A 1SXWA 3F8AA 3AKMA 1OPAA 2MWHA 4GZVA 4U8UM 1E00A 2A2UA 3SOTA 3FA6A 2OVAA 4YCEA 1E5PA 3O19A 5F1EA 1G7NA 4OS8A 2FLJA 3APUA 4JGLA 1QG5A 4AZNA 3UEVA 2AT6X 3ZW1A 2PY1A 4ZJ0A 3DTQA 4U9CA 1EW3A 1G85A 1OBUA 4UU2A 4ORUA 1SY3A 1BWYA 5H9NA 4HPCA 3NADA 5FFHA 2JU3A 3FELA 1UREA 3WJGA 4L3RA 1GXAA 5DPQA 3S60A 3BS2A 3VE2A 4EQAC 1SY1A 1S2PA 4HPBA 2Q2MA 1MX8A 3ELXA 4LZVA 4HWMA 3T1DA 1B8EA 3APXA 5LJGA 2ACPX 5LKFA 5EEEA 4NP1A 2NNEA 2JOZA 1RLBE 2R56A 5FAZA 3EBKA 4GKCA 2FS7A 4O3XB 1BSOA 1HBPA 3WJCA 2OVDA 1KT6A 5HCEC 1VYFA 4ZCBA 4YDAA 2HYSA 3LV4A 3MVFA 4N7CA 3ELZA 4ORYA 2OVEA 4QNIA 5HWZA 1YP7A 2GTLN 3CQNA 2QMIA 3MX7A 3NQ3A 3UEXA 1EQDA 2CM9A 4KT5A 1SY0A 1LIFA 1Y9LA 2MHDA 4LZUA 4O3ZA 1IFCA 3BRNA 1P6PA 2BHVA 3VG6A 4QRLA 3FW5A 1U18A 3WBGA 1EUOA 3BU1A 4YKOA 2AMMX 4AZOA 4ZGUA 3TGAA 3P6HA 2X8TA 3NP1A 1TOUA 2Z4IA 3PH5A 1DZMA 4OS3A 3P02A 2AT5X 3VPJE 5C0NA 4D6AA 3U9PC 1DF3A 4U8UN 2GTFX 4GH7A 3RSWA 1Y9TA 4A8ZA 2BLGA 3GE2A 4K19A 1KQXA 4CK4A 2IFBA 1MVGA 3SAOA 4KC7A 5HTDA 1EPAA 4CSBA 1ICNA 2HZQA 2G7BA 5H9KA 4GETA 1KQWA 3IFBA 4A1YA 4ZHFA 4NNTA 4GRJA 1E02A 3OJYC 5LJDA 2XSTA 4NYQA 1LIEA 3FA9A 2WQ9A 4FGIB 3F9DA 3NBXX 2X45A 3P6EA 4U3QA 1ICMA 5HBSA 4YH0A 2GTLO 4O9SA 4TJZA 3ZW1B 4ZHDA 1CJ5A 1QY2A 4GDZA 1L6MA 1SXUA 3GAQA 1FELA 1YWAA 3S5XA 2RCQA 1GT3A 4IAXA 3O2YA 4QGWA 1O1UA 3FR2A 3APWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYH A;  1BJ7 A;  5D4A A;  1EPB A;  5IO5 A;  1XCA A;  4ZH6 A;  1MX7 A;  4IAW A;  2LBV A;  2AKQ A;  5L8O A;  2FR3 A;  1SY2 A;  1QFV A;  3HWE A;  4A60 A;  4N7D A;  1HN2 A;  4EDE A;  1LFO A;  4ODD A;  2L67 A;  1GT1 A;  3BX7 A;  3UEW A;  1KXO A;  2MO5 A;  1LKE A;  2Q39 A;  3HWF A;  1S44 A;  3KFI A;  1QAB E;  5EDC A;  1YUP A;  3ZUI A;  2GC9 A;  2AT8 X;  5HCD C;  5LJH A;  4A1H A;  2WWP A;  2A2G A;  4HPA A;  3FEK A;  1VYG A;  3C77 X;  3I0A A;  4YMY A;  2RD7 C;  2A3F X;  3D95 A;  2L9C A;  3BY0 A;  1IFB A;  4OMW A;  1B4M A;  1HQP A;  5F7G A;  5F6B A;  1PBO A;  3APV A;  3P6C A;  3STN A;  1YP6 A;  4ZR2 A;  1YWC A;  5D47 A;  2ANS A;  2X46 A;  4OS0 A;  4DQ4 A;  1GGL A;  1KZX A;  5HZ6 A;  1NGL A;  3WVM A;  1QWD A;  3NPO A;  1FTP A;  1HMT A;  3CBS A;  5EDB A;  5B27 A;  2ASN X;  1MDC A;  3NX1 A;  1OEJ A;  3BDR A;  4XMC A;  1IW2 A;  1ZND A;  4IMN A;  2R73 A;  3Q6L A;  3FIQ A;  5JR8 A;  3VG2 A;  3HWG A;  4XMH A;  3STM X;  5HZQ A;  2POA A;  5KID A;  1A18 A;  1HBQ A;  5F58 A;  4YFP A;  3VG4 A;  5EZ2 A;  4HPD A;  1FEN A;  2RQ0 A;  4ZHH A;  1X8U A;  4MVK A;  4XMD A;  4AZR A;  1FEM A;  3TGB A;  1EII A;  3JSQ A;  2WEW A;  1ALB A;  1ZNL A;  1JJX A;  5LJC A;  2FTB A;  4QAE A;  3STK A;  2Q4N A;  5HCC C;  3L4R A;  2K62 A;  3KFF A;  3FR4 A;  1DFV A;  1I04 A;  3KQ0 A;  5HTE A;  3FEN A;  4QYP A;  5H9L A;  1GM6 A;  4ARH A;  5H9A A;  1LF7 A;  5LKE A;  1G5W A;  4MVI A;  1GT4 A;  3KZA A;  3KFG A;  2EU7 X;  3FEP A;  1RBP A;  3B2K A;  1ERX A;  4AW8 A;  1T8V A;  4EFG A;  1U17 A;  1T68 X;  3CQR A;  5LJB A;  4RUU A;  3QKG A;  4I3B A;  4QZT A;  2OFM X;  2HZR A;  2XKL A;  2GJ5 A;  1I4U A;  5L8N A;  4YFQ A;  2NND A;  3FA7 A;  2E4J A;  4TLJ A;  1FDQ A;  2R74 A;  5IO7 A;  3WJB A;  4NLI A;  1DZK A;  3C78 X;  2DM5 A;  3P6G A;  1O8V A;  4LKP A;  4WFU A;  1BSY A;  3U03 A;  1OEE A;  2QO4 A;  4AZQ A;  1ZNG A;  5F6Z A;  2K23 A;  1KT4 A;  1BEB A;  4QZU A;  1AB0 A;  2Q9S A;  4NYR A;  4M7M A;  1CRB A;  1BSQ A;  2ALL X;  1YWB A;  3TF6 A;  3C76 X;  3P6D A;  1S7D A;  1I05 A;  2A13 A;  3WXQ A;  1GKA A;  3U0D A;  1HMS A;  2MM3 A;  1ZNH A;  1OBP A;  1UZ2 X;  4QYN A;  1T0V A;  4BQU A;  2KTD A;  2CBR A;  2OZQ A;  2QO5 A;  4BVM A;  2FS6 A;  1VPR A;  1X8N A;  5FEN A;  1QQS A;  2W2F A;  2RCT A;  2HNX A;  2NP1 A;  4WFV A;  2QOS C;  4Y0R A;  1U0X A;  4UU3 A;  3O22 A;  3PH6 A;  4QGV A;  2CZU A;  1I06 A;  1QY0 A;  4XMG A;  4ALO A;  3BU9 A;  1B56 A;  2OFR X;  1KT7 A;  2LFO A;  3JS1 A;  2WR6 A;  1DV9 A;  4R0B A;  2QO6 A;  3PPT A;  3RZY A;  3DSZ A;  4GNY A;  4ORW A;  1KOI A;  4ALB A;  4AZM A;  5HZ9 A;  1N0S A;  3B2H A;  5HA1 A;  4BOE A;  5D48 A;  1EAL A;  2AL0 X;  1BRP A;  5D8J A;  1OBQ A;  2CBS A;  2WUT A;  4TKH A;  3G7X A;  2CZT A;  4MVL A;  1O1V A;  4TKB A;  1LID A;  4YDB A;  3IA8 A;  3VG3 A;  1TW4 A;  3NX2 A;  3P6F A;  1BRQ A;  1QFT A;  3WJE A;  1A3Y A;  2JN3 A;  1JZU A;  1IKJ A;  3PED A;  4XMF A;  4Y0Q A;  1CBS A;  3KFH A;  2AT3 X;  1KZW A;  4ORS A;  4WBK A;  2FWV A;  1X8O A;  1OPB A;  2WEX A;  4ZHG A;  1R0U A;  1G74 A;  1TXL A;  5BVS A;  3B2I A;  1A2D A;  4YKM A;  1CBR A;  5LJE A;  1IKE A;  3B2J A;  1SXY A;  3EMM A;  4YGZ A;  4I9S A;  1XKI A;  3ZQ3 A;  4ORX A;  4NNS A;  2Q2P A;  3CBC A;  3FLL A;  1D3S A;  4D6B A;  1LPJ A;  4I3C A;  4PSQ A;  1CBI A;  5EPQ A;  4I3D A;  5HA0 A;  1ZNK A;  5K06 A;  1SA8 A;  1ML7 A;  4RUN A;  2WQA E;  1ZRY A;  4KII A;  1PMP A;  1GX9 A;  1AQB A;  1KT3 A;  1BBP A;  3BLG A;  3EM0 A;  5B29 A;  5KHP A;  1OEK A;  4ORR A;  1GKA B;  1PEE A;  5D45 A;  4ES7 A;  1YIV A;  4XME A;  4OMX A;  1TVQ A;  4GNW A;  1DZP A;  3CR6 A;  4ZHC A;  3FW4 A;  4AZP A;  4IB6 A;  2RA6 A;  1JBH A;  2CM4 A;  1E06 A;  2AT0 X;  4YBU A;  1BLR A;  3PEC A;  1EIO A;  1YWD A;  1D2U A;  1DZJ A;  5L8I A;  5HZ8 A;  3EYC A;  2L68 A;  5EED A;  3WJF A;  4EXZ A;  1KT5 A;  1NP4 A;  2W2B A;  3D96 A;  1ERB A;  1LIB A;  1X71 A;  1JYD A;  2P8G A;  3CMP A;  1QY1 A;  4ZFX A;  1SXX A;  4IMO A;  3FR5 A;  3TZS A;  1LIC A;  3K3L A;  5BVQ A;  3FMZ A;  2AH7 X;  5H8T A;  3AKN A;  2LKK A;  3VG5 A;  1JJJ A;  2MJI A;  3MBT A;  4DQ3 A;  5CE4 A;  1PM1 X;  5DG4 A;  1DC9 A;  2FR2 A;  3UEU A;  2JU8 A;  2WSJ A;  1KGL A;  1NP1 A;  1LNM A;  5LJK A;  2QM9 A;  1GT5 A;  1A57 A;  3TGC A;  4TNN A;  5KIC A;  3EBW A;  1JYJ A;  5IO6 A;  4Y0S A;  2F73 A;  1X8P A;  3HK1 A;  4GE1 A;  1H91 A;  4IB8 A;  2FRS A;  1HMR A;  4Y0P A;  1BM5 A;  1CBQ A;  3ZUO A;  2N93 A;  4YCH A;  5HZ5 A;  1FE3 A;  4QGX A;  2O62 A;  3FA8 A;  4NLJ A;  1JV4 A;  3B2L A;  5AQ6 A;  4ZH9 A;  2ACO A;  2JU7 A;  1TOW A;  4I9R A;  3VG7 A;  2YG2 A;  2G78 A;  1AEL A;  4YBP A;  5BVT A;  1ACD A;  4TKJ A;  3BX8 A;  3I17 A;  1ADL A;  2W2A A;  2NNQ A;  3NQ9 A;  4HFO A;  3NR3 A;  2HLV A;  3BSZ E;  4IB7 A;  2FT9 A;  2L5P A;  1IIU A;  4LKT A;  1ZNE A;  1MUP A;  4YFR A;  2KT4 B;  5HAE A;  3CWK A;  2HMB A;  1EXS A;  3D97 A;  1AVG I;  3PP6 A;  4IBA A;  1X89 A;  2LBA A;  3HWD A;  1X8Q A;  4YGH A;  1GX8 A;  4YGG A;  4EEJ A;  2A0A A;  4M6S A;  4IB9 A;  3S26 A;  2LB6 A;  1B0O A;  2G79 A;  1Z24 A;  3WJD A;  4TQ2 A;  1SXW A;  3F8A A;  3AKM A;  1OPA A;  1E00 A;  2A2U A;  3FA6 A;  2OVA A;  4YCE A;  1E5P A;  3O19 A;  5F1E A;  1G7N A;  4OS8 A;  2FLJ A;  3APU A;  1QG5 A;  4AZN A;  3UEV A;  2AT6 X;  2PY1 A;  4ZJ0 A;  3DTQ A;  1EW3 A;  1G85 A;  1OBU A;  4UU2 A;  4ORU A;  1SY3 A;  1BWY A;  5H9N A;  4HPC A;  3NAD A;  5FFH A;  2JU3 A;  3FEL A;  1URE A;  3WJG A;  1GXA A;  5DPQ A;  3BS2 A;  1SY1 A;  1S2P A;  4HPB A;  2Q2M A;  1MX8 A;  3ELX A;  4LZV A;  3T1D A;  1B8E A;  3APX A;  5LJG A;  2ACP X;  5LKF A;  5EEE A;  4NP1 A;  2NNE A;  2JOZ A;  1RLB E;  2R56 A;  5FAZ A;  3EBK A;  4GKC A;  2FS7 A;  1BSO A;  1HBP A;  3WJC A;  2OVD A;  1KT6 A;  5HCE C;  1VYF A;  4ZCB A;  4YDA A;  2HYS A;  3MVF A;  4N7C A;  3ELZ A;  4ORY A;  2OVE A;  5HWZ A;  1YP7 A;  3CQN A;  3NQ3 A;  3UEX A;  1EQD A;  2CM9 A;  1SY0 A;  1LIF A;  4LZU A;  1IFC A;  3BRN A;  1P6P A;  3VG6 A;  3FW5 A;  1U18 A;  3WBG A;  1EUO A;  3BU1 A;  4YKO A;  2AMM X;  4AZO A;  4ZGU A;  3TGA A;  3P6H A;  3NP1 A;  1TOU A;  3PH5 A;  1DZM A;  4OS3 A;  2AT5 X;  5C0N A;  4D6A A;  3U9P C;  1DF3 A;  2GTF X;  4GH7 A;  3RSW A;  4A8Z A;  2BLG A;  4K19 A;  4CK4 A;  1KQX A;  2IFB A;  1MVG A;  3SAO A;  5HTD A;  1EPA A;  1ICN A;  2HZQ A;  2G7B A;  5H9K A;  4GET A;  1KQW A;  3IFB A;  4A1Y A;  4ZHF A;  4NNT A;  4GRJ A;  1E02 A;  3OJY C;  5LJD A;  2XST A;  4NYQ A;  1LIE A;  3FA9 A;  2WQ9 A;  3F9D A;  2X45 A;  3P6E A;  1ICM A;  5HBS A;  4YH0 A;  4O9S A;  4TJZ A;  1CJ5 A;  4ZHD A;  1QY2 A;  1L6M A;  1SXU A;  3GAQ A;  1FEL A;  1YWA A;  2RCQ A;  1GT3 A;  4IAX A;  3O2Y A;  4QGW A;  1O1U A;  3FR2 A;  3APW A; 
#chains in the Genus database with same CATH topology
 4AYH A;  1BJ7 A;  5D4A A;  1EPB A;  5IO5 A;  1XCA A;  4ZH6 A;  1MX7 A;  4IAW A;  2LBV A;  2AKQ A;  5L8O A;  2RTD B;  2FR3 A;  1SY2 A;  3HPE A;  2OY7 A;  5BYP A;  1HXZ A;  4I95 A;  4BX7 A;  1QFV A;  2RTL A;  3EC5 A;  2OF9 A;  3HWE A;  4N7D A;  1HN2 A;  4A60 A;  1LFO A;  1SWK A;  4ODD A;  4EDE A;  2IZH B;  2L67 A;  1GT1 A;  3BX7 A;  4U8U O;  3UEW A;  1KXO A;  1SLD B;  2LA7 A;  2MO5 A;  4EKV A;  3PQS A;  2OFA A;  4GGT A;  1LKE A;  2Q39 A;  3HWF A;  1S44 A;  3KFI A;  1QAB E;  4CPH B;  5EDC A;  4FBV A;  1YUP A;  4INN A;  2GC9 A;  3ZUI A;  2AT8 X;  4O4U A;  4CV7 A;  3HOE A;  5HCD C;  5LJH A;  3PDF A;  4A1H A;  2WWP A;  2A2G A;  4HPA A;  1HY2 A;  3FEK A;  1VYG A;  5B10 O;  3C77 X;  3I0A A;  3F6Z B;  1WUB A;  4YMY A;  2RD7 C;  2A3F X;  3D95 A;  5CYB A;  1SMP I;  2L9C A;  3BY0 A;  3QQ2 A;  2OF8 A;  1IFB A;  4OMW A;  3RDS A;  1HQP A;  5F7G A;  1LEL A;  4JHQ A;  1B4M A;  5F6B A;  5FQ8 E;  3VGW A;  1PBO A;  3APV A;  3P6C A;  3STN A;  1YP6 A;  2IZD B;  4ZR2 A;  3VHM A;  3ZW2 A;  1HXL A;  1YWC A;  5D47 A;  4I6S A;  2ANS A;  4IB7 A;  2X46 A;  3OD9 A;  4OS0 A;  4DQ4 A;  3SZH A;  1GGL A;  1I78 A;  1UYN X;  3RY1 A;  4CPI A;  1KZX A;  5HZ6 A;  1NGL A;  2BT9 A;  3WVM A;  1QWD A;  3LTW A;  2Y3F A;  3NPO A;  1FTP A;  3OBL A;  1HMT A;  3CBS A;  5EDB A;  5B27 A;  3RY2 A;  2ASN X;  1MDC A;  1VYO A;  4LQZ A;  3NX1 A;  1OEJ A;  3BDR A;  4XMC A;  1IW2 A;  1ZND A;  4IMN A;  2R73 A;  3Q6L A;  3FIQ A;  5JR8 A;  3VG2 A;  3HWG A;  4XMH A;  3STM X;  3D9W A;  1LDO A;  3SLT A;  2PI3 O;  5HZQ A;  2POA A;  5KID A;  1A18 A;  1HBQ A;  5F58 A;  3X00 A;  4YFP A;  1Y52 X;  1LUQ A;  3VG4 A;  5EZ2 A;  4HPD A;  1FEN A;  2RQ0 A;  4ZHH A;  1X8U A;  4MVK A;  4XMD A;  4AZR A;  2VFB A;  1FEM A;  3TGB A;  1VWR B;  1EII A;  3JSQ A;  2WEW A;  1ALB A;  4ON1 A;  2FHN X;  1ZNL A;  1SRJ A;  3SLO A;  2QOM A;  1JJX A;  5LJC A;  2FTB A;  1WBI A;  4QAE A;  3STK A;  1LCV A;  2OL6 O;  2Q4N A;  2RTC B;  2DJF A;  3L4R A;  5HCC C;  3T6L A;  5AJB A;  2K62 A;  3KFF A;  3FR4 A;  1DFV A;  1I04 A;  2RTK A;  3KQ0 A;  3PK2 A;  5HTE A;  4CDF A;  3FEN A;  4QYP A;  5H9L A;  1GM6 A;  4ARH A;  5H9A A;  2C1Q A;  1LF7 A;  5LKE A;  2OFB A;  1G5W A;  2RTQ B;  4L1N A;  4MVI A;  1GT4 A;  3KZA A;  3KFG A;  2EU7 X;  4ML7 B;  3FEP A;  1RBP A;  4BCS A;  3B2K A;  3HOL A;  5CHK A;  1ERX A;  3CKF A;  3RBY A;  4AW8 A;  1NC9 A;  1T8V A;  1W6F A;  3FYF A;  5CSE A;  1U17 A;  1T68 X;  3CQR A;  4EFG A;  4FQB B;  1IJ8 A;  4RUU A;  5LJB A;  3QKG A;  4I3B A;  4QZT A;  3RE5 A;  3VE1 A;  2OFM X;  1W5R A;  2HZR A;  2XKL A;  4BX7 B;  2GJ5 A;  4FBO A;  1SWQ A;  1I4U A;  3ZW0 B;  5L8N A;  4YFQ A;  5FQ7 E;  2NND A;  3FA7 A;  4GU8 A;  3WZO A;  2E4J A;  4GD9 A;  4TLJ A;  2IZG B;  1FDQ A;  2R74 A;  5IO7 A;  3WJB A;  4NLI A;  1DZK A;  1JMZ A;  2DM5 A;  2F01 A;  1O8V A;  3C78 X;  3P6G A;  4LKP A;  4WFU A;  1BSY A;  1NDJ A;  1OEE A;  4CDD A;  3U03 A;  1SRE A;  2QO4 A;  4AZQ A;  1ZNG A;  4O4O A;  2X8F A;  5F6Z A;  2K23 A;  4FBR A;  1KT4 A;  1BEB A;  4QZU A;  2ZSC A;  1AB0 A;  1N9Y A;  2Q9S A;  2KTS A;  4NYR A;  4KCA A;  4M7M A;  1CRB A;  3EW2 A;  1BSQ A;  2ALL X;  1YWB A;  2ZAG A;  2Y32 A;  3C76 X;  4GGR A;  3N91 A;  3P6D A;  3RDQ A;  1S7D A;  3TF6 A;  1I05 A;  2A13 A;  2IZC B;  3WXQ A;  1GKA A;  3H3I A;  3T2X A;  3U0D A;  4Z2V A;  1HMS A;  2I5Z O;  2MM3 A;  1ZNH A;  1OBP A;  2IZB A;  1UZ2 X;  2RTE B;  4DCB A;  4QYN A;  1T0V A;  4BQU A;  1SWS A;  2OY8 A;  3S5V A;  2KTD A;  2CBR A;  2OZQ A;  2QO5 A;  4BVM A;  2FS6 A;  1VPR A;  1X8N A;  5FEN A;  1QQS A;  4QQ1 A;  2RTN B;  2W2F A;  4PJ2 A;  2RTF B;  2RCT A;  2HNX A;  2NP1 A;  3JQO A;  2QOS C;  4WFV A;  4Y0R A;  1U0X A;  1AVD A;  3ZWE A;  1SRF A;  4UU3 A;  5F2B A;  4ZGF A;  1KL4 A;  3O22 A;  3PH6 A;  4YVB A;  4QGV A;  2CZU A;  1VWN B;  1I06 A;  1QY0 A;  1VWA B;  2RN4 A;  3RDU A;  4XMG A;  4ALO A;  3BU9 A;  1B56 A;  2OFR X;  2Z4H A;  1KT7 A;  2LFO A;  1N9M A;  2WR6 A;  1SWP A;  3JS1 A;  4O3Y A;  1DV9 A;  1Y55 X;  4R0B A;  4MIS A;  2KW1 A;  2QO6 A;  2GTL M;  2X8S A;  3PPT A;  3RZY A;  3DSZ A;  4GNY A;  4ORW A;  1KOI A;  4ALB A;  4AZM A;  5HZ9 A;  1N0S A;  3B2H A;  1N4J A;  1MK5 A;  5HA1 A;  3VHH A;  4BOE A;  5D48 A;  1SWN A;  4O4S A;  4CDE A;  2KD2 A;  3D4R A;  1N7Y A;  2AL0 X;  2IZJ A;  4BJ8 A;  1BRP A;  2RTH B;  1EAL A;  5D8J A;  1OBQ A;  1SWU A;  2CBS A;  2WUT A;  3PQU A;  4TKH A;  4I60 A;  3G7X A;  1RST B;  2CZT A;  1JMX A;  4MVL A;  1O1V A;  4NW4 A;  4TKB A;  1LID A;  2BS6 A;  2BSZ A;  4YDB A;  1I9H A;  3IA8 A;  1EI5 A;  2WPU A;  3VG3 A;  1TW4 A;  3NX2 A;  3P6F A;  1SWT A;  1BRQ A;  1QFT A;  3RKG A;  1A3Y A;  2JN3 A;  3CKG A;  3WJE A;  1JZU A;  1SWD A;  1SWR A;  1IKJ A;  3PED A;  1SLE B;  4XMF A;  1LCW A;  4Y0Q A;  1CBS A;  3KFH A;  2AT3 X;  1KZW A;  3LHN A;  4ORS A;  4WBK A;  1VWG B;  1VWH B;  2FWV A;  2OY1 O;  4JNJ A;  1X8O A;  1OPB A;  2WEX A;  1LCZ A;  1R0U A;  4ZHG A;  1AVE A;  1G74 A;  1TXL A;  1VWJ B;  5BVS A;  3B2I A;  1A2D A;  4YKM A;  1CBR A;  5LJE A;  1IKE A;  3B2J A;  1SXY A;  3EMM A;  4YGZ A;  2JMB A;  4I9S A;  1XKI A;  4OKA A;  5B11 O;  3RE6 A;  3ZQ3 A;  4ORX A;  4NNS A;  2Q2P A;  2M4L A;  4MIR A;  3CBC A;  3FLL A;  4GK9 A;  1D3S A;  4O49 A;  4KH8 A;  1HQQ A;  1LPJ A;  4I3C A;  4D6B A;  2X4M A;  4PSQ A;  2G5L A;  1CBI A;  1MM9 A;  5EPQ A;  2OY5 O;  4I3D A;  1JJU A;  4BX5 A;  5HA0 A;  1ZNK A;  5K06 A;  1SA8 A;  1ML7 A;  4RUN A;  2RTP B;  1SWJ A;  1MOY A;  2WQA E;  3AEH A;  2GH7 A;  1ZRY A;  2BS5 A;  1PMP A;  4KII A;  3EW1 A;  2ZAI A;  5AJC A;  1GX9 A;  1AQB A;  1KT3 A;  1BBP A;  2IZA A;  3BLG A;  3EM0 A;  5B29 A;  5KHP A;  1OEK A;  2AVI A;  3WOV A;  4ORR A;  4C5P A;  1GKA B;  1PEE A;  5D45 A;  4ES7 A;  1YIV A;  4XME A;  4OMX A;  1VWL B;  1TVQ A;  4GNW A;  4WHI A;  1DZP A;  3CR6 A;  4CPH A;  4MEE A;  4ZHC A;  3FW4 A;  1STR B;  4MVE A;  4AZP A;  4GJS A;  4IB6 A;  1SWF A;  2RA6 A;  1JBH A;  2CM4 A;  1E06 A;  2AT0 X;  4OEM A;  1FJ1 E;  1VWM B;  4YBU A;  1SRG A;  3PEC A;  1BLR A;  1EIO A;  1YWD A;  1D2U A;  1DZJ A;  2QCB A;  4O4X A;  5L8I A;  5HZ8 A;  3EYC A;  2L68 A;  5EED A;  1SRI A;  3WJF A;  4EXZ A;  1KT5 A;  1NP4 A;  1VWK B;  1VWF B;  2W2B A;  3D96 A;  3HTY A;  3RDM A;  3WYP A;  1ERB A;  1LIB A;  1X71 A;  1JYD A;  2P8G A;  1VWE B;  3ZZV A;  3CMP A;  4B55 A;  2F09 A;  4U46 A;  1N43 A;  3AUM O;  1SWH A;  1QY1 A;  4ZFX A;  1SXX A;  4IMO A;  3FR5 A;  3TZS A;  1LIC A;  3K3L A;  5BVQ A;  3FMZ A;  2AH7 X;  1Y0G A;  4IRW A;  5H8T A;  3AKN A;  5AEO A;  1VWB B;  4Y5D A;  2LKK A;  3VG5 A;  5JD2 A;  1JJJ A;  2MJI A;  2YMS A;  3MBT A;  1JIW I;  1VWO B;  4DQ3 A;  5CE4 A;  1PM1 X;  1SRH A;  5DG4 A;  1DC9 A;  1RAV A;  2FR2 A;  3OE3 A;  3UEU A;  3WZP A;  1VWQ B;  2JU8 A;  4BX6 A;  2WSJ A;  2OL7 A;  4Z27 A;  1KGL A;  1NP1 A;  1LNM A;  5LJK A;  2RTI B;  2G8C O;  3VU1 A;  2QM9 A;  1GT5 A;  5IRU A;  4KC8 A;  1LDQ A;  1SWG A;  3FID A;  4COT A;  5K67 A;  3TGC A;  4TNN A;  1A57 A;  5KIC A;  1SWE A;  3EBW A;  1JYJ A;  5IO6 A;  2A8G A;  4Y0S A;  2F73 A;  1X8P A;  3HK1 A;  4GE1 A;  1H91 A;  4IB8 A;  1OSP O;  1NQM A;  2FRS A;  4NV8 A;  1HMR A;  5FQ6 E;  3V8U A;  4Y0P A;  2RTG B;  2JW1 A;  1BM5 A;  4ID2 A;  1CBQ A;  3ZUO A;  2N93 A;  4YCH A;  5HZ5 A;  1FE3 A;  4QGX A;  2O62 A;  3FA8 A;  2VDF A;  1Y53 X;  2RTB B;  4NLJ A;  1RXH A;  4NV7 A;  1JV4 A;  1W4T A;  3B2L A;  5AQ6 A;  4ZH9 A;  2ACO A;  2JU7 A;  1TOW A;  2C4I A;  4I9R A;  4IAB A;  3VG7 A;  2YG2 A;  2G78 A;  4JO6 A;  1AEL A;  4YBP A;  5BVT A;  2OYB O;  4GJV A;  1ACD A;  1VWD B;  3BX8 A;  4TKJ A;  3UAQ A;  4CPF A;  3I17 A;  1ADL A;  2W2A A;  2NNQ A;  3NQ9 A;  4HFO A;  3NR3 A;  1DF8 A;  2HLV A;  3BSZ E;  3ZI8 A;  2FT9 A;  4O3W A;  2L5P A;  4BX5 B;  1PBY A;  2JGS A;  1IIU A;  4LKT A;  1ZNE A;  4BBO A;  1MUP A;  4YFR A;  2KT4 B;  2A5B A;  5HAE A;  3SZJ A;  3E3C A;  3CWK A;  2HMB A;  1EXS A;  1RSU B;  2OVS A;  1AVG I;  3D97 A;  3PP6 A;  3SZI A;  4IBA A;  3ZW0 A;  1X89 A;  2LBA A;  3HWD A;  1X8Q A;  3P24 A;  3RDO A;  4YGH A;  1GX8 A;  1VWI B;  3MM0 A;  3NQK A;  4YGG A;  5B2A O;  1RXK A;  2A0A A;  4M6S A;  3RWX A;  4EEJ A;  4IB9 A;  3S26 A;  2LB6 A;  1B0O A;  2G79 A;  1SLG B;  1Z24 A;  3WJD A;  4TQ2 A;  1SXW A;  3F8A A;  3AKM A;  1OPA A;  2MWH A;  4GZV A;  4DNE A;  3T2W A;  4U8U M;  1E00 A;  2A2U A;  1RXJ A;  3SOT A;  3FA6 A;  2OVA A;  4YCE A;  1E5P A;  2A5C A;  3O19 A;  1G7N A;  5F1E A;  4OS8 A;  2FLJ A;  3APU A;  4JGL A;  1QG5 A;  4AZN A;  3UEV A;  1K24 A;  2AT6 X;  4Z6J A;  3SLJ A;  3ZW1 A;  4Y59 A;  2PY1 A;  4CPE A;  2RTO B;  4ZJ0 A;  1SWA A;  3DTQ A;  4U9C A;  1EW3 A;  1G85 A;  1OBU A;  3KVN A;  1SWL A;  2X32 A;  4OEL A;  4UU2 A;  1VWP B;  4ORU A;  1SY3 A;  1BWY A;  1SWB A;  5B3M O;  5H9N A;  2X56 A;  4HPC A;  3NAD A;  5FFH A;  1SLF B;  5B5F A;  2RTA A;  3Q34 A;  2OL8 O;  2JU3 A;  2RTJ A;  3FEL A;  1URE A;  3WJG A;  2UZ2 A;  4L3R A;  5K68 A;  1GXA A;  2X34 A;  5DPQ A;  3S60 A;  3BS2 A;  3VE2 A;  4BX6 B;  4EQA C;  1SY1 A;  3T6F A;  2BC3 A;  1S2P A;  2RTM A;  4HPB A;  2Q2M A;  2FKJ A;  1MX8 A;  3ELX A;  4LZV A;  1NBX A;  4HWM A;  3T1D A;  1B8E A;  3APX A;  5LJG A;  2ACP X;  5LKF A;  5EEE A;  4NP1 A;  2NNE A;  5L3Y A;  2JOZ A;  1E2T A;  1RLB E;  2R56 A;  5FAZ A;  3EBK A;  3FDC A;  2IZF B;  4GKC A;  4GDA A;  3APW A;  2FS7 A;  4BGF A;  4O3X B;  1BSO A;  1HBP A;  3WJC A;  2OVD A;  1KT6 A;  4GGZ A;  5HCE C;  1STP A;  1VYF A;  4ZCB A;  4YDA A;  2HYS A;  3LV4 A;  3MVF A;  4N7C A;  5IRA A;  3ELZ A;  4ORY A;  5B5G A;  2OVE A;  4QNI A;  5HWZ A;  1STS B;  1YP7 A;  2GTL N;  3CQN A;  2QMI A;  3MX7 A;  3NQ3 A;  3UEX A;  1EQD A;  2CM9 A;  2X55 A;  4KT5 A;  1SY0 A;  1K3B A;  1LIF A;  2IZL B;  1KL5 A;  1Y9L A;  2MHD A;  4LZU A;  2I5V O;  4O3Z A;  4Z2O A;  1IFC A;  3BRN A;  1P6P A;  2BHV A;  1VWC B;  3VG6 A;  4QRL A;  4Z28 A;  1JQP A;  1U18 A;  3FW5 A;  4GUZ A;  2FKG A;  2Y3E A;  3WBG A;  1EUO A;  1KFF A;  3BU1 A;  4YKO A;  2AMM X;  2RTR B;  4AZO A;  4ZGU A;  3TGA A;  3MG5 A;  3P6H A;  5IRW A;  2X8T A;  2HKD A;  2IZI A;  3WZQ A;  1PTS A;  2VFC A;  2CAM A;  3RDX A;  3NP1 A;  1SWO A;  1TOU A;  2Z4I A;  1SWC A;  1DZM A;  1MEP A;  3PH5 A;  4OS3 A;  5IXG A;  3P02 A;  2AT5 X;  3VPJ E;  1UYO X;  5C0N A;  4D6A A;  3U9P C;  1DF3 A;  4U8U N;  2DJG A;  2GTF X;  2IZK A;  2FHL A;  1Y9T A;  4GH7 A;  3RSW A;  4A8Z A;  2BLG A;  3GE2 A;  4K19 A;  1KQX A;  4CK4 A;  2IFB A;  1MVG A;  3SAO A;  4KC7 A;  5HTD A;  1EPA A;  4CSB A;  1ICN A;  2HZQ A;  2G7B A;  5H9K A;  4GET A;  1KQW A;  3IFB A;  4A1Y A;  4Z2P A;  2MF6 A;  4ZHF A;  4NNT A;  4GRJ A;  2UYW A;  1E02 A;  3OJY C;  5LJD A;  2XST A;  4NYQ A;  1LIE A;  3FA9 A;  2WQ9 A;  4FGI B;  3WYQ A;  1NQN A;  3F9D A;  3NBX X;  2AF5 A;  2C1S A;  2X45 A;  3P6E A;  4U3Q A;  1ICM A;  5HBS A;  3WZN A;  4YH0 A;  3VHI A;  2GTL O;  4O9S A;  4TJZ A;  3ZW1 B;  4CDC A;  4ZHD A;  1KL3 A;  1CJ5 A;  1QY2 A;  4GDZ A;  1L6M A;  1SXU A;  2FGS A;  3GAQ A;  1FEL A;  1YWA A;  3S5X A;  2RCQ A;  1GX3 A;  1GT3 A;  4IAX A;  3O2Y A;  4QGW A;  1O1U A;  3FR2 A;  2IZE B; 
#chains in the Genus database with same CATH homology
 4AYH A;  1BJ7 A;  5D4A A;  1EPB A;  5IO5 A;  1XCA A;  4ZH6 A;  1MX7 A;  4IAW A;  2LBV A;  2AKQ A;  5L8O A;  2FR3 A;  1SY2 A;  5BYP A;  4I95 A;  1QFV A;  3HWE A;  4A60 A;  4N7D A;  1HN2 A;  4EDE A;  1LFO A;  4ODD A;  2L67 A;  1GT1 A;  3BX7 A;  4U8U O;  3UEW A;  1KXO A;  2LA7 A;  2MO5 A;  3PQS A;  1LKE A;  2Q39 A;  3HWF A;  1S44 A;  3KFI A;  1QAB E;  5EDC A;  4FBV A;  1YUP A;  4INN A;  2GC9 A;  3ZUI A;  2AT8 X;  4O4U A;  4CV7 A;  3HOE A;  5HCD C;  5LJH A;  4A1H A;  2WWP A;  2A2G A;  4HPA A;  3FEK A;  1VYG A;  3C77 X;  3I0A A;  3F6Z B;  4YMY A;  2RD7 C;  2A3F X;  3D95 A;  5CYB A;  1SMP I;  2L9C A;  3BY0 A;  1IFB A;  4OMW A;  1B4M A;  1HQP A;  5F7G A;  5F6B A;  5FQ8 E;  1PBO A;  3APV A;  3P6C A;  3STN A;  1YP6 A;  3ZW2 A;  4ZR2 A;  1YWC A;  5D47 A;  4I6S A;  2ANS A;  2X46 A;  3OD9 A;  4OS0 A;  4DQ4 A;  1GGL A;  1KZX A;  5HZ6 A;  1NGL A;  2BT9 A;  3WVM A;  1QWD A;  3NPO A;  1FTP A;  3OBL A;  1HMT A;  3CBS A;  5EDB A;  5B27 A;  2ASN X;  1MDC A;  4LQZ A;  3NX1 A;  1OEJ A;  3BDR A;  4XMC A;  1IW2 A;  1ZND A;  4IMN A;  2R73 A;  3Q6L A;  3FIQ A;  5JR8 A;  3VG2 A;  3HWG A;  4XMH A;  3STM X;  5HZQ A;  2POA A;  5KID A;  1A18 A;  1HBQ A;  5F58 A;  4YFP A;  3VG4 A;  5EZ2 A;  4HPD A;  1FEN A;  2RQ0 A;  4ZHH A;  1X8U A;  4MVK A;  4XMD A;  4AZR A;  1FEM A;  3TGB A;  1EII A;  3JSQ A;  2WEW A;  1ALB A;  4ON1 A;  1ZNL A;  1JJX A;  5LJC A;  2FTB A;  4QAE A;  3STK A;  2Q4N A;  5HCC C;  3L4R A;  5AJB A;  2K62 A;  3KFF A;  3FR4 A;  1DFV A;  1I04 A;  3KQ0 A;  5HTE A;  3FEN A;  4QYP A;  5H9L A;  1GM6 A;  4ARH A;  5H9A A;  1LF7 A;  5LKE A;  1G5W A;  4L1N A;  4MVI A;  1GT4 A;  3KZA A;  3KFG A;  2EU7 X;  4ML7 B;  3FEP A;  1RBP A;  3B2K A;  3HOL A;  1ERX A;  3RBY A;  4AW8 A;  1T8V A;  3FYF A;  4EFG A;  1U17 A;  1T68 X;  3CQR A;  4FQB B;  4RUU A;  5LJB A;  3QKG A;  4I3B A;  4QZT A;  3VE1 A;  2OFM X;  2HZR A;  2XKL A;  2GJ5 A;  4FBO A;  1I4U A;  3ZW0 B;  5L8N A;  4YFQ A;  5FQ7 E;  2NND A;  3FA7 A;  4GU8 A;  2E4J A;  4TLJ A;  1FDQ A;  2R74 A;  5IO7 A;  3WJB A;  4NLI A;  1DZK A;  3C78 X;  2DM5 A;  3P6G A;  1O8V A;  4LKP A;  4WFU A;  1BSY A;  3U03 A;  1OEE A;  2QO4 A;  4AZQ A;  1ZNG A;  4O4O A;  2X8F A;  5F6Z A;  2K23 A;  4FBR A;  1KT4 A;  1BEB A;  4QZU A;  1AB0 A;  2Q9S A;  2KTS A;  4NYR A;  4KCA A;  4M7M A;  1CRB A;  1BSQ A;  2ALL X;  1YWB A;  2ZAG A;  3TF6 A;  3C76 X;  3N91 A;  3P6D A;  1S7D A;  1I05 A;  2A13 A;  3WXQ A;  1GKA A;  3H3I A;  3U0D A;  1HMS A;  2MM3 A;  1ZNH A;  1OBP A;  1UZ2 X;  4QYN A;  1T0V A;  4BQU A;  3S5V A;  2KTD A;  2CBR A;  2OZQ A;  2QO5 A;  4BVM A;  2FS6 A;  1VPR A;  1X8N A;  5FEN A;  1QQS A;  4QQ1 A;  2W2F A;  4PJ2 A;  3JQO A;  2RCT A;  2HNX A;  2NP1 A;  4WFV A;  2QOS C;  4Y0R A;  1U0X A;  3ZWE A;  4UU3 A;  4ZGF A;  3O22 A;  3PH6 A;  4QGV A;  2CZU A;  1I06 A;  1QY0 A;  2RN4 A;  4XMG A;  4ALO A;  3BU9 A;  1B56 A;  2OFR X;  2Z4H A;  1KT7 A;  2LFO A;  3JS1 A;  2WR6 A;  4O3Y A;  1DV9 A;  4R0B A;  4MIS A;  2KW1 A;  2QO6 A;  2GTL M;  2X8S A;  3PPT A;  3RZY A;  3DSZ A;  4GNY A;  4ORW A;  1KOI A;  4ALB A;  4AZM A;  5HZ9 A;  1N0S A;  3B2H A;  5HA1 A;  4BOE A;  5D48 A;  4O4S A;  2KD2 A;  3D4R A;  1EAL A;  2AL0 X;  1BRP A;  5D8J A;  1OBQ A;  3PQU A;  2CBS A;  2WUT A;  4TKH A;  3G7X A;  2CZT A;  4MVL A;  1O1V A;  4NW4 A;  4TKB A;  1LID A;  2BS6 A;  4YDB A;  3IA8 A;  1EI5 A;  3VG3 A;  1TW4 A;  3NX2 A;  3P6F A;  1BRQ A;  1QFT A;  3RKG A;  1A3Y A;  2JN3 A;  3WJE A;  1JZU A;  1IKJ A;  3PED A;  4XMF A;  4Y0Q A;  1CBS A;  3KFH A;  2AT3 X;  1KZW A;  3LHN A;  4ORS A;  4WBK A;  2FWV A;  1X8O A;  1OPB A;  2WEX A;  4ZHG A;  1R0U A;  1G74 A;  1TXL A;  5BVS A;  3B2I A;  1A2D A;  4YKM A;  1CBR A;  5LJE A;  1IKE A;  3B2J A;  1SXY A;  3EMM A;  4YGZ A;  2JMB A;  4I9S A;  1XKI A;  3ZQ3 A;  4ORX A;  4NNS A;  2Q2P A;  2M4L A;  4MIR A;  3CBC A;  3FLL A;  4GK9 A;  1D3S A;  4O49 A;  4KH8 A;  4D6B A;  1LPJ A;  4I3C A;  4PSQ A;  1CBI A;  5EPQ A;  4I3D A;  5HA0 A;  1ZNK A;  5K06 A;  1SA8 A;  1ML7 A;  4RUN A;  2WQA E;  1ZRY A;  2BS5 A;  1PMP A;  4KII A;  5AJC A;  2ZAI A;  1GX9 A;  1AQB A;  1KT3 A;  1BBP A;  3BLG A;  3EM0 A;  5B29 A;  5KHP A;  1OEK A;  3WOV A;  4ORR A;  1GKA B;  1PEE A;  5D45 A;  4ES7 A;  1YIV A;  4XME A;  4OMX A;  1TVQ A;  4GNW A;  4WHI A;  1DZP A;  3CR6 A;  4ZHC A;  3FW4 A;  4MVE A;  4AZP A;  4IB6 A;  2RA6 A;  1JBH A;  2CM4 A;  1E06 A;  2AT0 X;  4YBU A;  1BLR A;  3PEC A;  1EIO A;  1YWD A;  1D2U A;  1DZJ A;  4O4X A;  5L8I A;  5HZ8 A;  3EYC A;  2L68 A;  5EED A;  3WJF A;  4EXZ A;  1KT5 A;  1NP4 A;  2W2B A;  3D96 A;  3HTY A;  3ZZV A;  1ERB A;  1LIB A;  1X71 A;  1JYD A;  2P8G A;  3CMP A;  2F09 A;  1QY1 A;  4ZFX A;  1SXX A;  4IMO A;  3FR5 A;  3TZS A;  1LIC A;  3K3L A;  5BVQ A;  3FMZ A;  2AH7 X;  5H8T A;  3AKN A;  5AEO A;  2LKK A;  3VG5 A;  1JJJ A;  2MJI A;  2YMS A;  3MBT A;  1JIW I;  4DQ3 A;  5CE4 A;  1PM1 X;  5DG4 A;  1DC9 A;  2FR2 A;  3OE3 A;  3UEU A;  2JU8 A;  2WSJ A;  1KGL A;  1NP1 A;  1LNM A;  5LJK A;  3VU1 A;  2QM9 A;  1GT5 A;  4KC8 A;  4COT A;  1A57 A;  3TGC A;  4TNN A;  5KIC A;  3EBW A;  1JYJ A;  5IO6 A;  4Y0S A;  2F73 A;  1X8P A;  3HK1 A;  4GE1 A;  1H91 A;  4IB8 A;  2FRS A;  1HMR A;  5FQ6 E;  3V8U A;  4Y0P A;  2JW1 A;  1BM5 A;  4ID2 A;  1CBQ A;  3ZUO A;  2N93 A;  4YCH A;  5HZ5 A;  1FE3 A;  4QGX A;  2O62 A;  3FA8 A;  4NLJ A;  1JV4 A;  3B2L A;  5AQ6 A;  4ZH9 A;  2ACO A;  2JU7 A;  1TOW A;  4I9R A;  4IAB A;  3VG7 A;  2YG2 A;  2G78 A;  1AEL A;  4YBP A;  5BVT A;  1ACD A;  4TKJ A;  3BX8 A;  3UAQ A;  3I17 A;  1ADL A;  2W2A A;  2NNQ A;  3NQ9 A;  4HFO A;  3NR3 A;  2HLV A;  3BSZ E;  4IB7 A;  3ZI8 A;  2FT9 A;  4O3W A;  2L5P A;  1IIU A;  4LKT A;  1ZNE A;  1MUP A;  4YFR A;  2KT4 B;  5HAE A;  3E3C A;  3CWK A;  2HMB A;  1EXS A;  2OVS A;  3D97 A;  1AVG I;  3PP6 A;  4IBA A;  3ZW0 A;  1X89 A;  2LBA A;  3HWD A;  1X8Q A;  3P24 A;  4YGH A;  1GX8 A;  3NQK A;  4YGG A;  4EEJ A;  2A0A A;  3RWX A;  4M6S A;  4IB9 A;  3S26 A;  2LB6 A;  1B0O A;  2G79 A;  1Z24 A;  3WJD A;  4TQ2 A;  1SXW A;  3F8A A;  3AKM A;  1OPA A;  2MWH A;  4GZV A;  4U8U M;  1E00 A;  2A2U A;  3SOT A;  3FA6 A;  2OVA A;  4YCE A;  1E5P A;  3O19 A;  5F1E A;  1G7N A;  4OS8 A;  2FLJ A;  3APU A;  4JGL A;  1QG5 A;  4AZN A;  3UEV A;  2AT6 X;  3ZW1 A;  2PY1 A;  4ZJ0 A;  3DTQ A;  4U9C A;  1EW3 A;  1G85 A;  1OBU A;  4UU2 A;  4ORU A;  1SY3 A;  1BWY A;  5H9N A;  4HPC A;  3NAD A;  5FFH A;  2JU3 A;  3FEL A;  1URE A;  3WJG A;  4L3R A;  1GXA A;  5DPQ A;  3S60 A;  3BS2 A;  3VE2 A;  4EQA C;  1SY1 A;  1S2P A;  4HPB A;  2Q2M A;  1MX8 A;  3ELX A;  4LZV A;  4HWM A;  3T1D A;  1B8E A;  3APX A;  5LJG A;  2ACP X;  5LKF A;  5EEE A;  4NP1 A;  2NNE A;  2JOZ A;  1RLB E;  2R56 A;  5FAZ A;  3EBK A;  4GKC A;  2FS7 A;  4O3X B;  1BSO A;  1HBP A;  3WJC A;  2OVD A;  1KT6 A;  5HCE C;  1VYF A;  4ZCB A;  4YDA A;  2HYS A;  3LV4 A;  3MVF A;  4N7C A;  3ELZ A;  4ORY A;  2OVE A;  4QNI A;  5HWZ A;  1YP7 A;  2GTL N;  3CQN A;  2QMI A;  3MX7 A;  3NQ3 A;  3UEX A;  1EQD A;  2CM9 A;  4KT5 A;  1SY0 A;  1LIF A;  1Y9L A;  2MHD A;  4LZU A;  4O3Z A;  1IFC A;  3BRN A;  1P6P A;  2BHV A;  3VG6 A;  4QRL A;  3FW5 A;  1U18 A;  3WBG A;  1EUO A;  3BU1 A;  4YKO A;  2AMM X;  4AZO A;  4ZGU A;  3TGA A;  3P6H A;  2X8T A;  3NP1 A;  1TOU A;  2Z4I A;  3PH5 A;  1DZM A;  4OS3 A;  3P02 A;  2AT5 X;  3VPJ E;  5C0N A;  4D6A A;  3U9P C;  1DF3 A;  4U8U N;  2GTF X;  4GH7 A;  3RSW A;  1Y9T A;  4A8Z A;  2BLG A;  3GE2 A;  4K19 A;  1KQX A;  4CK4 A;  2IFB A;  1MVG A;  3SAO A;  4KC7 A;  5HTD A;  1EPA A;  4CSB A;  1ICN A;  2HZQ A;  2G7B A;  5H9K A;  4GET A;  1KQW A;  3IFB A;  4A1Y A;  4ZHF A;  4NNT A;  4GRJ A;  1E02 A;  3OJY C;  5LJD A;  2XST A;  4NYQ A;  1LIE A;  3FA9 A;  2WQ9 A;  4FGI B;  3F9D A;  3NBX X;  2X45 A;  3P6E A;  4U3Q A;  1ICM A;  5HBS A;  4YH0 A;  2GTL O;  4O9S A;  4TJZ A;  3ZW1 B;  4ZHD A;  1CJ5 A;  1QY2 A;  4GDZ A;  1L6M A;  1SXU A;  3GAQ A;  1FEL A;  1YWA A;  3S5X A;  2RCQ A;  1GT3 A;  4IAX A;  3O2Y A;  4QGW A;  1O1U A;  3FR2 A;  3APW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...