2E4QA

Crystal structure of bpha3 (reduced form)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
b'TFTKACSVDEVPPGEALQVSHDAQKVAIFNVDGEFFATQDQCTHGEWSLSEGGYLDGDVVECSLHMGKFCVRTGKVKSPPPCEPLKVYPIRIEGRDVLVDFSRAALHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biphenyl dioxygenase ferredoxin subunit
publication title Molecular Mechanism of the Redox-dependent Interaction between NADH-dependent Ferredoxin Reductase and Rieske-type [2Fe-2S] Ferredoxin
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Electron transport
total genus 19
structure length 108
sequence length 108
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2e4qA00
3GTEA 2XSHA 1VCKA 4P1BH 1NTKE 1NU1E 1G8KB 2GBXA 4QDCA 4H0LD 1BE3E 1ULJA 3FOUA 1KB9E 1ULIA 2YFLA 4HM4A 5KKZC 4QCKA 1SQBE 2HMOA 4NBBD 3VCPA 3VMHD 2HMKA 3H1HE 2NVGA 4HM0A 1P84E 1O7GA 4NBDD 2NVEA 3GKEA 2XRXA 2NUKA 1L0LE 1SQQE 4HM2A 1G8JB 2FYUE 2I7FA 2E75D 1O7PA 2YIUC 4HJLA 4HM5A 4NBHD 3GB4A 1BCCE 3CXHE 2E74D 1EZVE 1NYKA 3C0DA 1NTME 5AEWA 4HM8A 3H1KE 5KLIC 3DQYA 2QJYC 2DE6D 3L71E 3VCAA 3GCEA 2NVFA 2E4PA 3GOBA 1O7HA 3D89A 2HMJA 4H44D 1VM9A 2BMQA 4QUQA 4NBFD 4PD4E 2A06E 3N0QA 1SQVE 3L70E 1RFSA 1WQLA 4HKVA 2B24A 4QDDA 1SQXE 3CX5E 4AIVA 3L72E 1VF5D 1KYOE 2QJKC 1UUWA 4P1CH 5CXMA 1O7WA 2B1XA 2D2CD 2YVJB 2HMMA 1ZRTE 2E4QA 2XR8A 4HM1A 1PPJE 1NDOA 3AZCA 3CWBE 3H1JE 4QDFB 4NBED 1O7MA 2ZT9D 3VMID 1SQPE 1JM1A 3BCCE 5HL4A 4NB9D 2YFIA 3H1IE 3L73E 1O7NA 3EQQA 4NBGD 4PV1D 2ZYLA 1NTZE 4HM3A 4NBCD 4H13D 2FYNC 1UUVA 3VMGD 3GTSA 2DE5D 2E76D 3GZXA 2NWFA 2Q3WA 2GBWA 4QDFA 4QURA 2JO6A 2QPZA 1PP9E 4OGQD 3GZYA 3L75E 3GL0A 4EMJB 2YFJA 4AAYB 1EG9A 2IBZE 2NUMA 2CKFA 4HM7A 2BMOA 2QJPC 1SJGA 4HM6A 1FQTA 2BCCE 4NBAD 2XSOA 5AEUA 2DE7D 2HMNA 5KLVE 3GL2A 3TGUE 1Q90C 5BOKA 4QUPA 2HMLA 3H1LE 3L74E 3EN1A 1L0NE 4U3FE 4NB8D 1RIEA 2BMRA 2JZAA
chains in the Genus database with same CATH superfamily
3GTEA 2XSHA 1VCKA 4P1BH 1NTKE 1NU1E 1G8KB 2GBXA 4QDCA 4H0LD 1BE3E 1ULJA 3FOUA 1KB9E 1ULIA 2YFLA 4HM4A 5KKZC 4QCKA 1SQBE 2HMOA 4NBBD 3VCPA 3VMHD 2HMKA 3H1HE 2NVGA 4HM0A 1P84E 1O7GA 4NBDD 2NVEA 3GKEA 2XRXA 2NUKA 1L0LE 1SQQE 4HM2A 1G8JB 2FYUE 2I7FA 2E75D 1O7PA 2YIUC 4HJLA 4HM5A 4NBHD 3GB4A 1BCCE 3CXHE 2E74D 1EZVE 1NYKA 3C0DA 1NTME 5AEWA 4HM8A 3H1KE 5KLIC 3DQYA 2QJYC 2DE6D 3L71E 3VCAA 3GCEA 2NVFA 2E4PA 3GOBA 1O7HA 3D89A 2HMJA 4H44D 1VM9A 2BMQA 4QUQA 4NBFD 4PD4E 2A06E 3N0QA 1SQVE 3L70E 1RFSA 1WQLA 4HKVA 2B24A 4QDDA 1SQXE 3CX5E 4AIVA 3L72E 1VF5D 1KYOE 2QJKC 1UUWA 4P1CH 5CXMA 1O7WA 2B1XA 2D2CD 2YVJB 2HMMA 1ZRTE 2E4QA 2XR8A 4HM1A 1PPJE 1NDOA 3AZCA 3CWBE 3H1JE 4QDFB 4NBED 1O7MA 2ZT9D 3VMID 1SQPE 1JM1A 3BCCE 5HL4A 4NB9D 2YFIA 3H1IE 3L73E 1O7NA 3EQQA 4NBGD 4PV1D 2ZYLA 1NTZE 4HM3A 4NBCD 4H13D 2FYNC 1UUVA 3VMGD 3GTSA 2DE5D 2E76D 3GZXA 2NWFA 2Q3WA 2GBWA 4QDFA 4QURA 2JO6A 2QPZA 1PP9E 4OGQD 3GZYA 3L75E 3GL0A 4EMJB 2YFJA 4AAYB 1EG9A 2IBZE 2NUMA 2CKFA 4HM7A 2BMOA 2QJPC 1SJGA 4HM6A 1FQTA 2BCCE 4NBAD 2XSOA 5AEUA 2DE7D 2HMNA 5KLVE 3GL2A 3TGUE 1Q90C 5BOKA 4QUPA 2HMLA 3H1LE 3L74E 3EN1A 1L0NE 4U3FE 4NB8D 1RIEA 2BMRA 2JZAA
chains in the Genus database with same CATH topology
3GTEA 2XSHA 1VCKA 4P1BH 1NTKE 1NU1E 1G8KB 2GBXA 4QDCA 4H0LD 1BE3E 1ULJA 3FOUA 1KB9E 1ULIA 2YFLA 4HM4A 5KKZC 4QCKA 1SQBE 2HMOA 4NBBD 3VCPA 3VMHD 2HMKA 3H1HE 2NVGA 4HM0A 1P84E 1O7GA 4NBDD 2NVEA 3GKEA 2XRXA 2NUKA 1L0LE 1SQQE 4HM2A 1G8JB 2FYUE 2I7FA 2E75D 1O7PA 2YIUC 4HJLA 4HM5A 4NBHD 3GB4A 1BCCE 3CXHE 2E74D 1EZVE 1NYKA 3C0DA 1NTME 5AEWA 4HM8A 3H1KE 5KLIC 3DQYA 2QJYC 2DE6D 3L71E 3VCAA 3GCEA 2NVFA 2E4PA 3GOBA 1O7HA 3D89A 2HMJA 4H44D 1VM9A 2BMQA 4QUQA 4NBFD 4PD4E 2A06E 3N0QA 1SQVE 3L70E 1RFSA 1WQLA 4HKVA 2B24A 4QDDA 1SQXE 3CX5E 4AIVA 3L72E 1VF5D 1KYOE 2QJKC 1UUWA 4P1CH 5CXMA 1O7WA 2B1XA 2D2CD 2YVJB 2HMMA 1ZRTE 2E4QA 2XR8A 4HM1A 1PPJE 1NDOA 3AZCA 3CWBE 3H1JE 4QDFB 4NBED 1O7MA 2ZT9D 3VMID 1SQPE 1JM1A 3BCCE 5HL4A 4NB9D 2YFIA 3H1IE 3L73E 1O7NA 3EQQA 4NBGD 4PV1D 2ZYLA 1NTZE 4HM3A 4NBCD 4H13D 2FYNC 1UUVA 3VMGD 3GTSA 2DE5D 2E76D 3GZXA 2NWFA 2Q3WA 2GBWA 4QDFA 4QURA 2JO6A 2QPZA 1PP9E 4OGQD 3GZYA 3L75E 3GL0A 4EMJB 2YFJA 4AAYB 1EG9A 2IBZE 2NUMA 2CKFA 4HM7A 2BMOA 2QJPC 1SJGA 4HM6A 1FQTA 2BCCE 4NBAD 2XSOA 5AEUA 2DE7D 2HMNA 5KLVE 3GL2A 3TGUE 1Q90C 5BOKA 4QUPA 2HMLA 3H1LE 3L74E 3EN1A 1L0NE 4U3FE 4NB8D 1RIEA 2BMRA 2JZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTE A;  2XSH A;  1VCK A;  4P1B H;  1NTK E;  1NU1 E;  1G8K B;  2GBX A;  4QDC A;  4H0L D;  1BE3 E;  1ULJ A;  3FOU A;  1KB9 E;  1ULI A;  2YFL A;  4HM4 A;  5KKZ C;  4QCK A;  1SQB E;  2HMO A;  4NBB D;  3VCP A;  3VMH D;  2HMK A;  3H1H E;  2NVG A;  4HM0 A;  1P84 E;  1O7G A;  4NBD D;  2NVE A;  3GKE A;  2XRX A;  2NUK A;  1L0L E;  1SQQ E;  4HM2 A;  1G8J B;  2FYU E;  2I7F A;  2E75 D;  1O7P A;  2YIU C;  4HJL A;  4HM5 A;  4NBH D;  3GB4 A;  1BCC E;  3CXH E;  2E74 D;  1EZV E;  1NYK A;  3C0D A;  1NTM E;  5AEW A;  4HM8 A;  3H1K E;  5KLI C;  3DQY A;  2QJY C;  2DE6 D;  3L71 E;  3VCA A;  3GCE A;  2NVF A;  2E4P A;  3GOB A;  1O7H A;  3D89 A;  2HMJ A;  4H44 D;  1VM9 A;  2BMQ A;  4QUQ A;  4NBF D;  4PD4 E;  2A06 E;  3N0Q A;  1SQV E;  3L70 E;  1RFS A;  1WQL A;  4HKV A;  2B24 A;  4QDD A;  1SQX E;  3CX5 E;  4AIV A;  3L72 E;  1VF5 D;  1KYO E;  2QJK C;  1UUW A;  4P1C H;  5CXM A;  1O7W A;  2B1X A;  2D2C D;  2YVJ B;  2HMM A;  1ZRT E;  2E4Q A;  2XR8 A;  4HM1 A;  1PPJ E;  1NDO A;  3AZC A;  3CWB E;  3H1J E;  4QDF B;  4NBE D;  1O7M A;  2ZT9 D;  3VMI D;  1SQP E;  1JM1 A;  3BCC E;  5HL4 A;  4NB9 D;  2YFI A;  3H1I E;  3L73 E;  1O7N A;  3EQQ A;  4NBG D;  4PV1 D;  2ZYL A;  1NTZ E;  4HM3 A;  4NBC D;  4H13 D;  2FYN C;  1UUV A;  3VMG D;  3GTS A;  2DE5 D;  2E76 D;  3GZX A;  2NWF A;  2Q3W A;  2GBW A;  4QDF A;  4QUR A;  2JO6 A;  2QPZ A;  1PP9 E;  4OGQ D;  3GZY A;  3L75 E;  3GL0 A;  4EMJ B;  2YFJ A;  4AAY B;  1EG9 A;  2IBZ E;  2NUM A;  2CKF A;  4HM7 A;  2BMO A;  2QJP C;  1SJG A;  4HM6 A;  1FQT A;  2BCC E;  4NBA D;  2XSO A;  5AEU A;  2DE7 D;  2HMN A;  5KLV E;  3GL2 A;  3TGU E;  1Q90 C;  5BOK A;  4QUP A;  2HML A;  3H1L E;  3L74 E;  3EN1 A;  1L0N E;  4U3F E;  4NB8 D;  1RIE A;  2BMR A;  2JZA A; 
#chains in the Genus database with same CATH topology
 3GTE A;  2XSH A;  1VCK A;  4P1B H;  1NTK E;  1NU1 E;  1G8K B;  2GBX A;  4QDC A;  4H0L D;  1BE3 E;  1ULJ A;  3FOU A;  1KB9 E;  1ULI A;  2YFL A;  4HM4 A;  5KKZ C;  4QCK A;  1SQB E;  2HMO A;  4NBB D;  3VCP A;  3VMH D;  2HMK A;  3H1H E;  2NVG A;  4HM0 A;  1P84 E;  1O7G A;  4NBD D;  2NVE A;  3GKE A;  2XRX A;  2NUK A;  1L0L E;  1SQQ E;  4HM2 A;  1G8J B;  2FYU E;  2I7F A;  2E75 D;  1O7P A;  2YIU C;  4HJL A;  4HM5 A;  4NBH D;  3GB4 A;  1BCC E;  3CXH E;  2E74 D;  1EZV E;  1NYK A;  3C0D A;  1NTM E;  5AEW A;  4HM8 A;  3H1K E;  5KLI C;  3DQY A;  2QJY C;  2DE6 D;  3L71 E;  3VCA A;  3GCE A;  2NVF A;  2E4P A;  3GOB A;  1O7H A;  3D89 A;  2HMJ A;  4H44 D;  1VM9 A;  2BMQ A;  4QUQ A;  4NBF D;  4PD4 E;  2A06 E;  3N0Q A;  1SQV E;  3L70 E;  1RFS A;  1WQL A;  4HKV A;  2B24 A;  4QDD A;  1SQX E;  3CX5 E;  4AIV A;  3L72 E;  1VF5 D;  1KYO E;  2QJK C;  1UUW A;  4P1C H;  5CXM A;  1O7W A;  2B1X A;  2D2C D;  2YVJ B;  2HMM A;  1ZRT E;  2E4Q A;  2XR8 A;  4HM1 A;  1PPJ E;  1NDO A;  3AZC A;  3CWB E;  3H1J E;  4QDF B;  4NBE D;  1O7M A;  2ZT9 D;  3VMI D;  1SQP E;  1JM1 A;  3BCC E;  5HL4 A;  4NB9 D;  2YFI A;  3H1I E;  3L73 E;  1O7N A;  3EQQ A;  4NBG D;  4PV1 D;  2ZYL A;  1NTZ E;  4HM3 A;  4NBC D;  4H13 D;  2FYN C;  1UUV A;  3VMG D;  3GTS A;  2DE5 D;  2E76 D;  3GZX A;  2NWF A;  2Q3W A;  2GBW A;  4QDF A;  4QUR A;  2JO6 A;  2QPZ A;  1PP9 E;  4OGQ D;  3GZY A;  3L75 E;  3GL0 A;  4EMJ B;  2YFJ A;  4AAY B;  1EG9 A;  2IBZ E;  2NUM A;  2CKF A;  4HM7 A;  2BMO A;  2QJP C;  1SJG A;  4HM6 A;  1FQT A;  2BCC E;  4NBA D;  2XSO A;  5AEU A;  2DE7 D;  2HMN A;  5KLV E;  3GL2 A;  3TGU E;  1Q90 C;  5BOK A;  4QUP A;  2HML A;  3H1L E;  3L74 E;  3EN1 A;  1L0N E;  4U3F E;  4NB8 D;  1RIE A;  2BMR A;  2JZA A; 
#chains in the Genus database with same CATH homology
 3GTE A;  2XSH A;  1VCK A;  4P1B H;  1NTK E;  1NU1 E;  1G8K B;  2GBX A;  4QDC A;  4H0L D;  1BE3 E;  1ULJ A;  3FOU A;  1KB9 E;  1ULI A;  2YFL A;  4HM4 A;  5KKZ C;  4QCK A;  1SQB E;  2HMO A;  4NBB D;  3VCP A;  3VMH D;  2HMK A;  3H1H E;  2NVG A;  4HM0 A;  1P84 E;  1O7G A;  4NBD D;  2NVE A;  3GKE A;  2XRX A;  2NUK A;  1L0L E;  1SQQ E;  4HM2 A;  1G8J B;  2FYU E;  2I7F A;  2E75 D;  1O7P A;  2YIU C;  4HJL A;  4HM5 A;  4NBH D;  3GB4 A;  1BCC E;  3CXH E;  2E74 D;  1EZV E;  1NYK A;  3C0D A;  1NTM E;  5AEW A;  4HM8 A;  3H1K E;  5KLI C;  3DQY A;  2QJY C;  2DE6 D;  3L71 E;  3VCA A;  3GCE A;  2NVF A;  2E4P A;  3GOB A;  1O7H A;  3D89 A;  2HMJ A;  4H44 D;  1VM9 A;  2BMQ A;  4QUQ A;  4NBF D;  4PD4 E;  2A06 E;  3N0Q A;  1SQV E;  3L70 E;  1RFS A;  1WQL A;  4HKV A;  2B24 A;  4QDD A;  1SQX E;  3CX5 E;  4AIV A;  3L72 E;  1VF5 D;  1KYO E;  2QJK C;  1UUW A;  4P1C H;  5CXM A;  1O7W A;  2B1X A;  2D2C D;  2YVJ B;  2HMM A;  1ZRT E;  2E4Q A;  2XR8 A;  4HM1 A;  1PPJ E;  1NDO A;  3AZC A;  3CWB E;  3H1J E;  4QDF B;  4NBE D;  1O7M A;  2ZT9 D;  3VMI D;  1SQP E;  1JM1 A;  3BCC E;  5HL4 A;  4NB9 D;  2YFI A;  3H1I E;  3L73 E;  1O7N A;  3EQQ A;  4NBG D;  4PV1 D;  2ZYL A;  1NTZ E;  4HM3 A;  4NBC D;  4H13 D;  2FYN C;  1UUV A;  3VMG D;  3GTS A;  2DE5 D;  2E76 D;  3GZX A;  2NWF A;  2Q3W A;  2GBW A;  4QDF A;  4QUR A;  2JO6 A;  2QPZ A;  1PP9 E;  4OGQ D;  3GZY A;  3L75 E;  3GL0 A;  4EMJ B;  2YFJ A;  4AAY B;  1EG9 A;  2IBZ E;  2NUM A;  2CKF A;  4HM7 A;  2BMO A;  2QJP C;  1SJG A;  4HM6 A;  1FQT A;  2BCC E;  4NBA D;  2XSO A;  5AEU A;  2DE7 D;  2HMN A;  5KLV E;  3GL2 A;  3TGU E;  1Q90 C;  5BOK A;  4QUP A;  2HML A;  3H1L E;  3L74 E;  3EN1 A;  1L0N E;  4U3F E;  4NB8 D;  1RIE A;  2BMR A;  2JZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...