2E4QA

Crystal structure of bpha3 (reduced form)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
TFTKACSVDEVPPGEALQVSHDAQKVAIFNVDGEFFATQDQCTHGEWSLSEGGYLDGDVVECSLHMGKFCVRTGKVKSPPPCEPLKVYPIRIEGRDVLVDFSRAALHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Mechanism of the Redox-dependent Interaction between NADH-dependent Ferredoxin Reductase and Rieske-type [2Fe-2S] Ferredoxin
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Electron transport
molecule keywords Biphenyl dioxygenase ferredoxin subunit
total genus 19
structure length 108
sequence length 108
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2e4qA00
5KKZC 4HM8A 3GZYA 4HKVA 1BE3E 3C0DA 2JO6A 1NDOA 4QCKA 4QDFB 4HM6A 1O7HA 2IBZE 3FOUA 5CXMA 2YFJA 3GTEA 4NBAD 2FYUE 4HM3A 4EMJB 1SQBE 3VMID 1NTKE 1O7GA 3L70E 1KB9E 1WQLA 3L71E 4NBBD 1NTZE 2DE6D 1G8KB 1NYKA 2D2CD 2NUMA 1FQTA 1ZRTE 2XR8A 3GTSA 2HMLA 3EQQA 1VM9A 1JM1A 3GZXA 1VF5D 4QUPA 2CKFA 5HL4A 1ULIA 4P1BH 2QPZA 2E4QA 4HJLA 2NUKA 2YFLA 2E76D 2JZAA 2XRXA 1UUWA 1SQPE 1G8JB 1ULJA 1O7MA 4NBDD 2NWFA 2A06E 3EN1A 5BOKA 3H1IE 1NTME 2GBWA 4QUQA 3D89A 1EG9A 3L75E 1RFSA 2Q3WA 4H44D 1O7WA 3GB4A 3AZCA 3DQYA 3VCAA 4HM1A 3H1KE 4PV1D 4NB8D 3H1JE 3L72E 1BCCE 3GL2A 1PPJE 1SQVE 2QJYC 2HMNA 2GBXA 3GKEA 1NU1E 1SJGA 2E74D 1O7NA 1P84E 2HMMA 2BMRA 4HM0A 4QDFA 3H1HE 2BMQA 4QDDA 3CXHE 4NB9D 1Q90C 4HM4A 5AEUA 5KLVE 3TGUE 2HMOA 3L74E 4P1CH 4QDCA 3CX5E 4AIVA 2NVGA 4H13D 2DE7D 2E75D 2ZT9D 2BMOA 2ZYLA 2NVEA 3CWBE 4AAYB 2BCCE 2XSOA 4PD4E 4HM5A 1O7PA 3L73E 4NBHD 4U3FE 5AEWA 2QJPC 2B1XA 2YVJB 3VMGD 4HM7A 3BCCE 2QJKC 1L0LE 1EZVE 2HMKA 4OGQD 2YFIA 3H1LE 2FYNC 1VCKA 1RIEA 4HM2A 2B24A 2NVFA 1UUVA 4NBCD 2YIUC 2HMJA 3VMHD 1SQQE 3GOBA 4NBED 4QURA 3VCPA 4H0LD 2E4PA 5KLIC 2I7FA 4NBGD 1PP9E 1SQXE 4NBFD 2XSHA 3GL0A 1L0NE 3N0QA 1KYOE 2DE5D 3GCEA
chains in the Genus database with same CATH superfamily
5KKZC 4HM8A 3GZYA 4HKVA 1BE3E 3C0DA 2JO6A 1NDOA 4QCKA 4QDFB 4HM6A 1O7HA 2IBZE 3FOUA 5CXMA 2YFJA 3GTEA 4NBAD 2FYUE 4HM3A 4EMJB 1SQBE 3VMID 1NTKE 1O7GA 3L70E 1KB9E 1WQLA 3L71E 4NBBD 1NTZE 2DE6D 1G8KB 1NYKA 2D2CD 2NUMA 1FQTA 1ZRTE 2XR8A 3GTSA 2HMLA 3EQQA 1VM9A 1JM1A 3GZXA 1VF5D 4QUPA 2CKFA 5HL4A 1ULIA 4P1BH 2QPZA 2E4QA 4HJLA 2NUKA 2YFLA 2E76D 2JZAA 2XRXA 1UUWA 1SQPE 1G8JB 1ULJA 1O7MA 4NBDD 2NWFA 2A06E 3EN1A 5BOKA 3H1IE 1NTME 2GBWA 4QUQA 3D89A 1EG9A 3L75E 1RFSA 2Q3WA 4H44D 1O7WA 3GB4A 3AZCA 3DQYA 3VCAA 4HM1A 3H1KE 4PV1D 4NB8D 3H1JE 3L72E 1BCCE 3GL2A 1PPJE 1SQVE 2QJYC 2HMNA 2GBXA 3GKEA 1NU1E 1SJGA 2E74D 1O7NA 1P84E 2HMMA 2BMRA 4HM0A 4QDFA 3H1HE 2BMQA 4QDDA 3CXHE 4NB9D 1Q90C 4HM4A 5AEUA 5KLVE 3TGUE 2HMOA 3L74E 4P1CH 4QDCA 3CX5E 4AIVA 2NVGA 4H13D 2DE7D 2E75D 2ZT9D 2BMOA 2ZYLA 2NVEA 3CWBE 4AAYB 2BCCE 2XSOA 4PD4E 4HM5A 1O7PA 3L73E 4NBHD 4U3FE 5AEWA 2QJPC 2B1XA 2YVJB 3VMGD 4HM7A 3BCCE 2QJKC 1L0LE 1EZVE 2HMKA 4OGQD 2YFIA 3H1LE 2FYNC 1VCKA 1RIEA 4HM2A 2B24A 2NVFA 1UUVA 4NBCD 2YIUC 2HMJA 3VMHD 1SQQE 3GOBA 4NBED 4QURA 3VCPA 4H0LD 2E4PA 5KLIC 2I7FA 4NBGD 1PP9E 1SQXE 4NBFD 2XSHA 3GL0A 1L0NE 3N0QA 1KYOE 2DE5D 3GCEA
chains in the Genus database with same CATH topology
5KKZC 4HM8A 3GZYA 4HKVA 1BE3E 3C0DA 2JO6A 1NDOA 4QCKA 4QDFB 4HM6A 1O7HA 2IBZE 3FOUA 5CXMA 2YFJA 3GTEA 4NBAD 2FYUE 4HM3A 4EMJB 1SQBE 3VMID 1NTKE 1O7GA 3L70E 1KB9E 1WQLA 3L71E 4NBBD 1NTZE 2DE6D 1G8KB 1NYKA 2D2CD 2NUMA 1FQTA 1ZRTE 2XR8A 3GTSA 2HMLA 3EQQA 1VM9A 1JM1A 3GZXA 1VF5D 4QUPA 2CKFA 5HL4A 1ULIA 4P1BH 2QPZA 2E4QA 4HJLA 2NUKA 2YFLA 2E76D 2JZAA 2XRXA 1UUWA 1SQPE 1G8JB 1ULJA 1O7MA 4NBDD 2NWFA 2A06E 3EN1A 5BOKA 3H1IE 1NTME 2GBWA 4QUQA 3D89A 1EG9A 3L75E 1RFSA 2Q3WA 4H44D 1O7WA 3GB4A 3AZCA 3DQYA 3VCAA 4HM1A 3H1KE 4PV1D 4NB8D 3H1JE 3L72E 1BCCE 3GL2A 1PPJE 1SQVE 2QJYC 2HMNA 2GBXA 3GKEA 1NU1E 1SJGA 2E74D 1O7NA 1P84E 2HMMA 2BMRA 4HM0A 4QDFA 3H1HE 2BMQA 4QDDA 3CXHE 4NB9D 1Q90C 4HM4A 5AEUA 5KLVE 3TGUE 2HMOA 3L74E 4P1CH 4QDCA 3CX5E 4AIVA 2NVGA 4H13D 2DE7D 2E75D 2ZT9D 2BMOA 2ZYLA 2NVEA 3CWBE 4AAYB 2BCCE 2XSOA 4PD4E 4HM5A 1O7PA 3L73E 4NBHD 4U3FE 5AEWA 2QJPC 2B1XA 2YVJB 3VMGD 4HM7A 3BCCE 2QJKC 1L0LE 1EZVE 2HMKA 4OGQD 2YFIA 3H1LE 2FYNC 1VCKA 1RIEA 4HM2A 2B24A 2NVFA 1UUVA 4NBCD 2YIUC 2HMJA 3VMHD 1SQQE 3GOBA 4NBED 4QURA 3VCPA 4H0LD 2E4PA 5KLIC 2I7FA 4NBGD 1PP9E 1SQXE 4NBFD 2XSHA 3GL0A 1L0NE 3N0QA 1KYOE 2DE5D 3GCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KKZ C;  4HM8 A;  3GZY A;  4HKV A;  1BE3 E;  3C0D A;  2JO6 A;  1NDO A;  4QCK A;  4QDF B;  4HM6 A;  1O7H A;  2IBZ E;  3FOU A;  5CXM A;  2YFJ A;  3GTE A;  4NBA D;  2FYU E;  4HM3 A;  4EMJ B;  1SQB E;  3VMI D;  1NTK E;  1O7G A;  3L70 E;  1KB9 E;  1WQL A;  3L71 E;  4NBB D;  1NTZ E;  2DE6 D;  1G8K B;  1NYK A;  2D2C D;  2NUM A;  1FQT A;  1ZRT E;  2XR8 A;  3GTS A;  2HML A;  3EQQ A;  1VM9 A;  1JM1 A;  3GZX A;  1VF5 D;  4QUP A;  2CKF A;  5HL4 A;  1ULI A;  4P1B H;  2QPZ A;  2E4Q A;  4HJL A;  2NUK A;  2YFL A;  2E76 D;  2JZA A;  2XRX A;  1UUW A;  1SQP E;  1G8J B;  1ULJ A;  1O7M A;  4NBD D;  2NWF A;  2A06 E;  3EN1 A;  5BOK A;  3H1I E;  1NTM E;  2GBW A;  4QUQ A;  3D89 A;  1EG9 A;  3L75 E;  1RFS A;  2Q3W A;  4H44 D;  1O7W A;  3GB4 A;  3AZC A;  3DQY A;  3VCA A;  4HM1 A;  3H1K E;  4PV1 D;  4NB8 D;  3H1J E;  3L72 E;  1BCC E;  3GL2 A;  1PPJ E;  1SQV E;  2QJY C;  2HMN A;  2GBX A;  3GKE A;  1NU1 E;  1SJG A;  2E74 D;  1O7N A;  1P84 E;  2HMM A;  2BMR A;  4HM0 A;  4QDF A;  3H1H E;  2BMQ A;  4QDD A;  3CXH E;  4NB9 D;  1Q90 C;  4HM4 A;  5AEU A;  5KLV E;  3TGU E;  2HMO A;  3L74 E;  4P1C H;  4QDC A;  3CX5 E;  4AIV A;  2NVG A;  4H13 D;  2DE7 D;  2E75 D;  2ZT9 D;  2BMO A;  2ZYL A;  2NVE A;  3CWB E;  4AAY B;  2BCC E;  2XSO A;  4PD4 E;  4HM5 A;  1O7P A;  3L73 E;  4NBH D;  4U3F E;  5AEW A;  2QJP C;  2B1X A;  2YVJ B;  3VMG D;  4HM7 A;  3BCC E;  2QJK C;  1L0L E;  1EZV E;  2HMK A;  4OGQ D;  2YFI A;  3H1L E;  2FYN C;  1VCK A;  1RIE A;  4HM2 A;  2B24 A;  2NVF A;  1UUV A;  4NBC D;  2YIU C;  2HMJ A;  3VMH D;  1SQQ E;  3GOB A;  4NBE D;  4QUR A;  3VCP A;  4H0L D;  2E4P A;  5KLI C;  2I7F A;  4NBG D;  1PP9 E;  1SQX E;  4NBF D;  2XSH A;  3GL0 A;  1L0N E;  3N0Q A;  1KYO E;  2DE5 D;  3GCE A; 
#chains in the Genus database with same CATH topology
 5KKZ C;  4HM8 A;  3GZY A;  4HKV A;  1BE3 E;  3C0D A;  2JO6 A;  1NDO A;  4QCK A;  4QDF B;  4HM6 A;  1O7H A;  2IBZ E;  3FOU A;  5CXM A;  2YFJ A;  3GTE A;  4NBA D;  2FYU E;  4HM3 A;  4EMJ B;  1SQB E;  3VMI D;  1NTK E;  1O7G A;  3L70 E;  1KB9 E;  1WQL A;  3L71 E;  4NBB D;  1NTZ E;  2DE6 D;  1G8K B;  1NYK A;  2D2C D;  2NUM A;  1FQT A;  1ZRT E;  2XR8 A;  3GTS A;  2HML A;  3EQQ A;  1VM9 A;  1JM1 A;  3GZX A;  1VF5 D;  4QUP A;  2CKF A;  5HL4 A;  1ULI A;  4P1B H;  2QPZ A;  2E4Q A;  4HJL A;  2NUK A;  2YFL A;  2E76 D;  2JZA A;  2XRX A;  1UUW A;  1SQP E;  1G8J B;  1ULJ A;  1O7M A;  4NBD D;  2NWF A;  2A06 E;  3EN1 A;  5BOK A;  3H1I E;  1NTM E;  2GBW A;  4QUQ A;  3D89 A;  1EG9 A;  3L75 E;  1RFS A;  2Q3W A;  4H44 D;  1O7W A;  3GB4 A;  3AZC A;  3DQY A;  3VCA A;  4HM1 A;  3H1K E;  4PV1 D;  4NB8 D;  3H1J E;  3L72 E;  1BCC E;  3GL2 A;  1PPJ E;  1SQV E;  2QJY C;  2HMN A;  2GBX A;  3GKE A;  1NU1 E;  1SJG A;  2E74 D;  1O7N A;  1P84 E;  2HMM A;  2BMR A;  4HM0 A;  4QDF A;  3H1H E;  2BMQ A;  4QDD A;  3CXH E;  4NB9 D;  1Q90 C;  4HM4 A;  5AEU A;  5KLV E;  3TGU E;  2HMO A;  3L74 E;  4P1C H;  4QDC A;  3CX5 E;  4AIV A;  2NVG A;  4H13 D;  2DE7 D;  2E75 D;  2ZT9 D;  2BMO A;  2ZYL A;  2NVE A;  3CWB E;  4AAY B;  2BCC E;  2XSO A;  4PD4 E;  4HM5 A;  1O7P A;  3L73 E;  4NBH D;  4U3F E;  5AEW A;  2QJP C;  2B1X A;  2YVJ B;  3VMG D;  4HM7 A;  3BCC E;  2QJK C;  1L0L E;  1EZV E;  2HMK A;  4OGQ D;  2YFI A;  3H1L E;  2FYN C;  1VCK A;  1RIE A;  4HM2 A;  2B24 A;  2NVF A;  1UUV A;  4NBC D;  2YIU C;  2HMJ A;  3VMH D;  1SQQ E;  3GOB A;  4NBE D;  4QUR A;  3VCP A;  4H0L D;  2E4P A;  5KLI C;  2I7F A;  4NBG D;  1PP9 E;  1SQX E;  4NBF D;  2XSH A;  3GL0 A;  1L0N E;  3N0Q A;  1KYO E;  2DE5 D;  3GCE A; 
#chains in the Genus database with same CATH homology
 5KKZ C;  4HM8 A;  3GZY A;  4HKV A;  1BE3 E;  3C0D A;  2JO6 A;  1NDO A;  4QCK A;  4QDF B;  4HM6 A;  1O7H A;  2IBZ E;  3FOU A;  5CXM A;  2YFJ A;  3GTE A;  4NBA D;  2FYU E;  4HM3 A;  4EMJ B;  1SQB E;  3VMI D;  1NTK E;  1O7G A;  3L70 E;  1KB9 E;  1WQL A;  3L71 E;  4NBB D;  1NTZ E;  2DE6 D;  1G8K B;  1NYK A;  2D2C D;  2NUM A;  1FQT A;  1ZRT E;  2XR8 A;  3GTS A;  2HML A;  3EQQ A;  1VM9 A;  1JM1 A;  3GZX A;  1VF5 D;  4QUP A;  2CKF A;  5HL4 A;  1ULI A;  4P1B H;  2QPZ A;  2E4Q A;  4HJL A;  2NUK A;  2YFL A;  2E76 D;  2JZA A;  2XRX A;  1UUW A;  1SQP E;  1G8J B;  1ULJ A;  1O7M A;  4NBD D;  2NWF A;  2A06 E;  3EN1 A;  5BOK A;  3H1I E;  1NTM E;  2GBW A;  4QUQ A;  3D89 A;  1EG9 A;  3L75 E;  1RFS A;  2Q3W A;  4H44 D;  1O7W A;  3GB4 A;  3AZC A;  3DQY A;  3VCA A;  4HM1 A;  3H1K E;  4PV1 D;  4NB8 D;  3H1J E;  3L72 E;  1BCC E;  3GL2 A;  1PPJ E;  1SQV E;  2QJY C;  2HMN A;  2GBX A;  3GKE A;  1NU1 E;  1SJG A;  2E74 D;  1O7N A;  1P84 E;  2HMM A;  2BMR A;  4HM0 A;  4QDF A;  3H1H E;  2BMQ A;  4QDD A;  3CXH E;  4NB9 D;  1Q90 C;  4HM4 A;  5AEU A;  5KLV E;  3TGU E;  2HMO A;  3L74 E;  4P1C H;  4QDC A;  3CX5 E;  4AIV A;  2NVG A;  4H13 D;  2DE7 D;  2E75 D;  2ZT9 D;  2BMO A;  2ZYL A;  2NVE A;  3CWB E;  4AAY B;  2BCC E;  2XSO A;  4PD4 E;  4HM5 A;  1O7P A;  3L73 E;  4NBH D;  4U3F E;  5AEW A;  2QJP C;  2B1X A;  2YVJ B;  3VMG D;  4HM7 A;  3BCC E;  2QJK C;  1L0L E;  1EZV E;  2HMK A;  4OGQ D;  2YFI A;  3H1L E;  2FYN C;  1VCK A;  1RIE A;  4HM2 A;  2B24 A;  2NVF A;  1UUV A;  4NBC D;  2YIU C;  2HMJ A;  3VMH D;  1SQQ E;  3GOB A;  4NBE D;  4QUR A;  3VCP A;  4H0L D;  2E4P A;  5KLI C;  2I7F A;  4NBG D;  1PP9 E;  1SQX E;  4NBF D;  2XSH A;  3GL0 A;  1L0N E;  3N0Q A;  1KYO E;  2DE5 D;  3GCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...