2E4QA

Crystal structure of bpha3 (reduced form)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
TFTKACSVDEVPPGEALQVSHDAQKVAIFNVDGEFFATQDQCTHGEWSLSEGGYLDGDVVECSLHMGKFCVRTGKVKSPPPCEPLKVYPIRIEGRDVLVDFSRAALHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biphenyl dioxygenase ferredoxin subunit
publication title Molecular Mechanism of the Redox-dependent Interaction between NADH-dependent Ferredoxin Reductase and Rieske-type [2Fe-2S] Ferredoxin
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Electron transport
total genus 19
structure length 108
sequence length 108
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2e4qA00
1NYKA 3VMGD 2B1XA 1NTZE 1L0NE 2HMMA 2HMJA 3DQYA 3VMID 3GZXA 1EG9A 4NB9D 3EN1A 2CKFA 4EMJB 2NVEA 2E4PA 3H1IE 4QDFA 2D2CD 1FQTA 2Q3WA 5AEUA 1UUVA 2JO6A 3N0QA 3GB4A 1P84E 1WQLA 2DE6D 4QURA 1ULIA 5AEWA 3GTEA 2B24A 2HMOA 2E75D 4NBAD 2GBXA 1SQVE 4H13D 3GCEA 2ZT9D 4AIVA 1RIEA 3EQQA 3GKEA 5KLIC 3VMHD 2QJKC 2QJPC 1O7HA 2NVFA 1NDOA 3H1LE 2I7FA 2JZAA 2E76D 2NUMA 4U3FE 2HMLA 1VF5D 3BCCE 2BMQA 3D89A 2XSHA 5KLVE 4NBBD 3GZYA 4HM3A 1UUWA 4OGQD 1NU1E 1SQQE 2BMRA 3L72E 1SQXE 2ZYLA 5CXMA 4NBHD 1SJGA 1VCKA 3CXHE 2BCCE 3L73E 3FOUA 1G8KB 4NBDD 2DE5D 2YFJA 1NTKE 4P1CH 2DE7D 4HKVA 2E74D 4P1BH 2E4QA 1Q90C 1VM9A 2XR8A 4NBFD 4H44D 3H1JE 2QPZA 3GL2A 3H1HE 3H1KE 2FYUE 2YFLA 3CWBE 1O7WA 1JM1A 1PP9E 4HJLA 4QUQA 3AZCA 3C0DA 4HM2A 3L74E 4HM5A 4PV1D 4NB8D 3CX5E 1BE3E 2HMNA 3VCAA 2BMOA 4AAYB 5KKZC 3L75E 3VCPA 5BOKA 1KB9E 2FYNC 2NVGA 3GTSA 3TGUE 3GOBA 1O7MA 2NUKA 4HM0A 4HM1A 2XSOA 1O7GA 1KYOE 4QDDA 4HM4A 2A06E 4HM6A 4H0LD 2HMKA 1O7NA 1NTME 2XRXA 1SQPE 2GBWA 4QUPA 2IBZE 1ZRTE 3L71E 1PPJE 1ULJA 4HM7A 3L70E 1BCCE 1RFSA 4NBCD 2YFIA 4HM8A 2YIUC 2NWFA 1EZVE 2QJYC 1G8JB 4QDFB 1SQBE 4QDCA 1O7PA 3GL0A 4PD4E 4NBED 2YVJB 4NBGD 5HL4A 4QCKA 1L0LE
chains in the Genus database with same CATH superfamily
1NYKA 3VMGD 2B1XA 1NTZE 1L0NE 2HMMA 2HMJA 3DQYA 3VMID 3GZXA 1EG9A 4NB9D 3EN1A 2CKFA 4EMJB 2NVEA 2E4PA 3H1IE 4QDFA 2D2CD 1FQTA 2Q3WA 5AEUA 1UUVA 2JO6A 3N0QA 3GB4A 1P84E 1WQLA 2DE6D 4QURA 1ULIA 5AEWA 3GTEA 2B24A 2HMOA 2E75D 4NBAD 2GBXA 1SQVE 4H13D 3GCEA 2ZT9D 4AIVA 1RIEA 3EQQA 3GKEA 5KLIC 3VMHD 2QJKC 2QJPC 1O7HA 2NVFA 1NDOA 3H1LE 2I7FA 2JZAA 2E76D 2NUMA 4U3FE 2HMLA 1VF5D 3BCCE 2BMQA 3D89A 2XSHA 5KLVE 4NBBD 3GZYA 4HM3A 1UUWA 4OGQD 1NU1E 1SQQE 2BMRA 3L72E 1SQXE 2ZYLA 5CXMA 4NBHD 1SJGA 1VCKA 3CXHE 2BCCE 3L73E 3FOUA 1G8KB 4NBDD 2DE5D 2YFJA 1NTKE 4P1CH 2DE7D 4HKVA 2E74D 4P1BH 2E4QA 1Q90C 1VM9A 2XR8A 4NBFD 4H44D 3H1JE 2QPZA 3GL2A 3H1HE 3H1KE 2FYUE 2YFLA 3CWBE 1O7WA 1JM1A 1PP9E 4HJLA 4QUQA 3AZCA 3C0DA 4HM2A 3L74E 4HM5A 4PV1D 4NB8D 3CX5E 1BE3E 2HMNA 3VCAA 2BMOA 4AAYB 5KKZC 3L75E 3VCPA 5BOKA 1KB9E 2FYNC 2NVGA 3GTSA 3TGUE 3GOBA 1O7MA 2NUKA 4HM0A 4HM1A 2XSOA 1O7GA 1KYOE 4QDDA 4HM4A 2A06E 4HM6A 4H0LD 2HMKA 1O7NA 1NTME 2XRXA 1SQPE 2GBWA 4QUPA 2IBZE 1ZRTE 3L71E 1PPJE 1ULJA 4HM7A 3L70E 1BCCE 1RFSA 4NBCD 2YFIA 4HM8A 2YIUC 2NWFA 1EZVE 2QJYC 1G8JB 4QDFB 1SQBE 4QDCA 1O7PA 3GL0A 4PD4E 4NBED 2YVJB 4NBGD 5HL4A 4QCKA 1L0LE
chains in the Genus database with same CATH topology
1NYKA 3VMGD 2B1XA 1NTZE 1L0NE 2HMMA 2HMJA 3DQYA 3VMID 3GZXA 1EG9A 4NB9D 3EN1A 2CKFA 4EMJB 2NVEA 2E4PA 3H1IE 4QDFA 2D2CD 1FQTA 2Q3WA 5AEUA 1UUVA 2JO6A 3N0QA 3GB4A 1P84E 1WQLA 2DE6D 4QURA 1ULIA 5AEWA 3GTEA 2B24A 2HMOA 2E75D 4NBAD 2GBXA 1SQVE 4H13D 3GCEA 2ZT9D 4AIVA 1RIEA 3EQQA 3GKEA 5KLIC 3VMHD 2QJKC 2QJPC 1O7HA 2NVFA 1NDOA 3H1LE 2I7FA 2JZAA 2E76D 2NUMA 4U3FE 2HMLA 1VF5D 3BCCE 2BMQA 3D89A 2XSHA 5KLVE 4NBBD 3GZYA 4HM3A 1UUWA 4OGQD 1NU1E 1SQQE 2BMRA 3L72E 1SQXE 2ZYLA 5CXMA 4NBHD 1SJGA 1VCKA 3CXHE 2BCCE 3L73E 3FOUA 1G8KB 4NBDD 2DE5D 2YFJA 1NTKE 4P1CH 2DE7D 4HKVA 2E74D 4P1BH 2E4QA 1Q90C 1VM9A 2XR8A 4NBFD 4H44D 3H1JE 2QPZA 3GL2A 3H1HE 3H1KE 2FYUE 2YFLA 3CWBE 1O7WA 1JM1A 1PP9E 4HJLA 4QUQA 3AZCA 3C0DA 4HM2A 3L74E 4HM5A 4PV1D 4NB8D 3CX5E 1BE3E 2HMNA 3VCAA 2BMOA 4AAYB 5KKZC 3L75E 3VCPA 5BOKA 1KB9E 2FYNC 2NVGA 3GTSA 3TGUE 3GOBA 1O7MA 2NUKA 4HM0A 4HM1A 2XSOA 1O7GA 1KYOE 4QDDA 4HM4A 2A06E 4HM6A 4H0LD 2HMKA 1O7NA 1NTME 2XRXA 1SQPE 2GBWA 4QUPA 2IBZE 1ZRTE 3L71E 1PPJE 1ULJA 4HM7A 3L70E 1BCCE 1RFSA 4NBCD 2YFIA 4HM8A 2YIUC 2NWFA 1EZVE 2QJYC 1G8JB 4QDFB 1SQBE 4QDCA 1O7PA 3GL0A 4PD4E 4NBED 2YVJB 4NBGD 5HL4A 4QCKA 1L0LE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NYK A;  3VMG D;  2B1X A;  1NTZ E;  1L0N E;  2HMM A;  2HMJ A;  3DQY A;  3VMI D;  3GZX A;  1EG9 A;  4NB9 D;  3EN1 A;  2CKF A;  4EMJ B;  2NVE A;  2E4P A;  3H1I E;  4QDF A;  2D2C D;  1FQT A;  2Q3W A;  5AEU A;  1UUV A;  2JO6 A;  3N0Q A;  3GB4 A;  1P84 E;  1WQL A;  2DE6 D;  4QUR A;  1ULI A;  5AEW A;  3GTE A;  2B24 A;  2HMO A;  2E75 D;  4NBA D;  2GBX A;  1SQV E;  4H13 D;  3GCE A;  2ZT9 D;  4AIV A;  1RIE A;  3EQQ A;  3GKE A;  5KLI C;  3VMH D;  2QJK C;  2QJP C;  1O7H A;  2NVF A;  1NDO A;  3H1L E;  2I7F A;  2JZA A;  2E76 D;  2NUM A;  4U3F E;  2HML A;  1VF5 D;  3BCC E;  2BMQ A;  3D89 A;  2XSH A;  5KLV E;  4NBB D;  3GZY A;  4HM3 A;  1UUW A;  4OGQ D;  1NU1 E;  1SQQ E;  2BMR A;  3L72 E;  1SQX E;  2ZYL A;  5CXM A;  4NBH D;  1SJG A;  1VCK A;  3CXH E;  2BCC E;  3L73 E;  3FOU A;  1G8K B;  4NBD D;  2DE5 D;  2YFJ A;  1NTK E;  4P1C H;  2DE7 D;  4HKV A;  2E74 D;  4P1B H;  2E4Q A;  1Q90 C;  1VM9 A;  2XR8 A;  4NBF D;  4H44 D;  3H1J E;  2QPZ A;  3GL2 A;  3H1H E;  3H1K E;  2FYU E;  2YFL A;  3CWB E;  1O7W A;  1JM1 A;  1PP9 E;  4HJL A;  4QUQ A;  3AZC A;  3C0D A;  4HM2 A;  3L74 E;  4HM5 A;  4PV1 D;  4NB8 D;  3CX5 E;  1BE3 E;  2HMN A;  3VCA A;  2BMO A;  4AAY B;  5KKZ C;  3L75 E;  3VCP A;  5BOK A;  1KB9 E;  2FYN C;  2NVG A;  3GTS A;  3TGU E;  3GOB A;  1O7M A;  2NUK A;  4HM0 A;  4HM1 A;  2XSO A;  1O7G A;  1KYO E;  4QDD A;  4HM4 A;  2A06 E;  4HM6 A;  4H0L D;  2HMK A;  1O7N A;  1NTM E;  2XRX A;  1SQP E;  2GBW A;  4QUP A;  2IBZ E;  1ZRT E;  3L71 E;  1PPJ E;  1ULJ A;  4HM7 A;  3L70 E;  1BCC E;  1RFS A;  4NBC D;  2YFI A;  4HM8 A;  2YIU C;  2NWF A;  1EZV E;  2QJY C;  1G8J B;  4QDF B;  1SQB E;  4QDC A;  1O7P A;  3GL0 A;  4PD4 E;  4NBE D;  2YVJ B;  4NBG D;  5HL4 A;  4QCK A;  1L0L E; 
#chains in the Genus database with same CATH topology
 1NYK A;  3VMG D;  2B1X A;  1NTZ E;  1L0N E;  2HMM A;  2HMJ A;  3DQY A;  3VMI D;  3GZX A;  1EG9 A;  4NB9 D;  3EN1 A;  2CKF A;  4EMJ B;  2NVE A;  2E4P A;  3H1I E;  4QDF A;  2D2C D;  1FQT A;  2Q3W A;  5AEU A;  1UUV A;  2JO6 A;  3N0Q A;  3GB4 A;  1P84 E;  1WQL A;  2DE6 D;  4QUR A;  1ULI A;  5AEW A;  3GTE A;  2B24 A;  2HMO A;  2E75 D;  4NBA D;  2GBX A;  1SQV E;  4H13 D;  3GCE A;  2ZT9 D;  4AIV A;  1RIE A;  3EQQ A;  3GKE A;  5KLI C;  3VMH D;  2QJK C;  2QJP C;  1O7H A;  2NVF A;  1NDO A;  3H1L E;  2I7F A;  2JZA A;  2E76 D;  2NUM A;  4U3F E;  2HML A;  1VF5 D;  3BCC E;  2BMQ A;  3D89 A;  2XSH A;  5KLV E;  4NBB D;  3GZY A;  4HM3 A;  1UUW A;  4OGQ D;  1NU1 E;  1SQQ E;  2BMR A;  3L72 E;  1SQX E;  2ZYL A;  5CXM A;  4NBH D;  1SJG A;  1VCK A;  3CXH E;  2BCC E;  3L73 E;  3FOU A;  1G8K B;  4NBD D;  2DE5 D;  2YFJ A;  1NTK E;  4P1C H;  2DE7 D;  4HKV A;  2E74 D;  4P1B H;  2E4Q A;  1Q90 C;  1VM9 A;  2XR8 A;  4NBF D;  4H44 D;  3H1J E;  2QPZ A;  3GL2 A;  3H1H E;  3H1K E;  2FYU E;  2YFL A;  3CWB E;  1O7W A;  1JM1 A;  1PP9 E;  4HJL A;  4QUQ A;  3AZC A;  3C0D A;  4HM2 A;  3L74 E;  4HM5 A;  4PV1 D;  4NB8 D;  3CX5 E;  1BE3 E;  2HMN A;  3VCA A;  2BMO A;  4AAY B;  5KKZ C;  3L75 E;  3VCP A;  5BOK A;  1KB9 E;  2FYN C;  2NVG A;  3GTS A;  3TGU E;  3GOB A;  1O7M A;  2NUK A;  4HM0 A;  4HM1 A;  2XSO A;  1O7G A;  1KYO E;  4QDD A;  4HM4 A;  2A06 E;  4HM6 A;  4H0L D;  2HMK A;  1O7N A;  1NTM E;  2XRX A;  1SQP E;  2GBW A;  4QUP A;  2IBZ E;  1ZRT E;  3L71 E;  1PPJ E;  1ULJ A;  4HM7 A;  3L70 E;  1BCC E;  1RFS A;  4NBC D;  2YFI A;  4HM8 A;  2YIU C;  2NWF A;  1EZV E;  2QJY C;  1G8J B;  4QDF B;  1SQB E;  4QDC A;  1O7P A;  3GL0 A;  4PD4 E;  4NBE D;  2YVJ B;  4NBG D;  5HL4 A;  4QCK A;  1L0L E; 
#chains in the Genus database with same CATH homology
 1NYK A;  3VMG D;  2B1X A;  1NTZ E;  1L0N E;  2HMM A;  2HMJ A;  3DQY A;  3VMI D;  3GZX A;  1EG9 A;  4NB9 D;  3EN1 A;  2CKF A;  4EMJ B;  2NVE A;  2E4P A;  3H1I E;  4QDF A;  2D2C D;  1FQT A;  2Q3W A;  5AEU A;  1UUV A;  2JO6 A;  3N0Q A;  3GB4 A;  1P84 E;  1WQL A;  2DE6 D;  4QUR A;  1ULI A;  5AEW A;  3GTE A;  2B24 A;  2HMO A;  2E75 D;  4NBA D;  2GBX A;  1SQV E;  4H13 D;  3GCE A;  2ZT9 D;  4AIV A;  1RIE A;  3EQQ A;  3GKE A;  5KLI C;  3VMH D;  2QJK C;  2QJP C;  1O7H A;  2NVF A;  1NDO A;  3H1L E;  2I7F A;  2JZA A;  2E76 D;  2NUM A;  4U3F E;  2HML A;  1VF5 D;  3BCC E;  2BMQ A;  3D89 A;  2XSH A;  5KLV E;  4NBB D;  3GZY A;  4HM3 A;  1UUW A;  4OGQ D;  1NU1 E;  1SQQ E;  2BMR A;  3L72 E;  1SQX E;  2ZYL A;  5CXM A;  4NBH D;  1SJG A;  1VCK A;  3CXH E;  2BCC E;  3L73 E;  3FOU A;  1G8K B;  4NBD D;  2DE5 D;  2YFJ A;  1NTK E;  4P1C H;  2DE7 D;  4HKV A;  2E74 D;  4P1B H;  2E4Q A;  1Q90 C;  1VM9 A;  2XR8 A;  4NBF D;  4H44 D;  3H1J E;  2QPZ A;  3GL2 A;  3H1H E;  3H1K E;  2FYU E;  2YFL A;  3CWB E;  1O7W A;  1JM1 A;  1PP9 E;  4HJL A;  4QUQ A;  3AZC A;  3C0D A;  4HM2 A;  3L74 E;  4HM5 A;  4PV1 D;  4NB8 D;  3CX5 E;  1BE3 E;  2HMN A;  3VCA A;  2BMO A;  4AAY B;  5KKZ C;  3L75 E;  3VCP A;  5BOK A;  1KB9 E;  2FYN C;  2NVG A;  3GTS A;  3TGU E;  3GOB A;  1O7M A;  2NUK A;  4HM0 A;  4HM1 A;  2XSO A;  1O7G A;  1KYO E;  4QDD A;  4HM4 A;  2A06 E;  4HM6 A;  4H0L D;  2HMK A;  1O7N A;  1NTM E;  2XRX A;  1SQP E;  2GBW A;  4QUP A;  2IBZ E;  1ZRT E;  3L71 E;  1PPJ E;  1ULJ A;  4HM7 A;  3L70 E;  1BCC E;  1RFS A;  4NBC D;  2YFI A;  4HM8 A;  2YIU C;  2NWF A;  1EZV E;  2QJY C;  1G8J B;  4QDF B;  1SQB E;  4QDC A;  1O7P A;  3GL0 A;  4PD4 E;  4NBE D;  2YVJ B;  4NBG D;  5HL4 A;  4QCK A;  1L0L E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...