2E4UA

Crystal structure of the extracellular region of the group ii metabotropic glutamate receptor complexed with l-glutamate
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
538
structure length
512
Chain Sequence
RREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDNYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNICIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAANRVNASFTWVASDGWGAQESIVKGSEHVAYGAITLELASHPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQCSLQQVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPQTTKLCDAMKILDGKKLYKEYLLKIQFTAPFNPNKGADSIVKFDTFGDGMGRYNVFNLQQTGGKYSYLKVGHWAETLSLDVDSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYLVDEFTCMDCGPGQWPTADLSGCYNLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Metabotropic glutamate receptor 3
publication title Structures of the extracellular regions of the group II/III metabotropic glutamate receptors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 160
structure length 512
sequence length 538
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
A PF07562 NCD3G Nine Cysteines Domain of family 3 GPCR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.50.30 Mainly Beta Ribbon Tumor Necrosis Factor Receptor, subunit A; domain 2 Tumor Necrosis Factor Receptor, subunit A; domain 2 2e4uA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2e4uA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2e4uA01
4TN5A 2PMCA 4Z4HA 3HJFA 1ZESA 3BILA 2HQRA 1QQBA 4MAAA 3ROFA 4Z4GA 4UHKA 3EGCA 1RNLA 4QYWA 4RU1A 1DBPA 5JNWA 3DGFC 3NHZA 4EUKA 4EYGA 3OLYA 4YGXB 3LOPA 2OENG 4RKRA 3JS5A 4D74A 3RVNA 5KC8A 1BDIA 2FXIA 2B4AA 3JVDA 3DLHA 3RVLA 2A9OA 2FTKE 2R25B 4JP1A 1RXEA 4N0PA 1NXPA 4MQEB 4MLDA 3HK2A 1FFGA 3GL9A 3LUAA 3DZDA 1EWKA 1HEYA 4G0YA 1PUXA 2MYUA 4PZ0A 4Z99A 3RVKA 1CEYA 5CHYA 1ISRA 5IC5A 1L5ZA 3DLBA 2MYNA 1JF8A 3EDCA 1KMIY 3W9SA 4MS4B 3EQZA 2W42A 2FVYA 4N41A 4LDZA 5TQ2B 2RGYA 3QK7A 2VUIB 2RJOA 3Q7SA 3MM4A 2HQBA 1ZH4A 4KZKA 1TJYA 2CHFA 2FEPA 3QLUC 3QLTA 3IP6A 3LUGA 3Q9SA 4O1HA 4HNRA 1U2PA 4DN6A 2CHEA 4ZPJA 4E7PA 3LTEA 1M5UA 4WXMA 4G0ZA 4G0MA 1AB5A 4MR9A 3JY6A 1E6MA 2LP4Y 4OLAA 2OQRA 5BRAA 3OMXA 3GBPA 4KPYA 1DRKA 3H5OA 4H3KB 2BGGA 1M2FA 4ZMRA 4KREA 1M2EA 2GI4A 1YIOA 5IBQA 5TE9A 1QP7A 4ETNA 3ROTA 3HO1A 3N0RA 3QEMB 2H3HA 2WWVD 3VNAA 1JFTA 4G0XA 4QICA 3IPCA 1U04A 2HQOA 3TD9A 5JS1A 3LUKA 3URMA 3N0XA 1JLKA 1QP0A 4RXTA 3GA5A 4WWHA 4Q6BA 3A10A 3H5WA 3A0UA 3OLWA 5EWJA 5JNRA 4EGSA 2PUBA 4RKQA 1DC8A 5DLEA 2QVGA 2FLWA 3SY8A 1Z2EA 1ZHHA 4G0PA 3RQIA 3O21A 2FN8A 3EQ2A 3H5IA 3CKMA 1K68A 3NNNA 5FWXA 3O1HB 4UHJA 3HV2A 1J56A 3MMNA 5DGCA 3C97A 4JA2A 4ETIA 3KYJB 4IF4A 5TQ0B 3F7NA 2F8SA 1YMUA 3CFYA 4RSMA 4EY3A 1L5YA 5FWXB 1VRVA 1JL3A 3HDGA 4PYRA 4RV5A 1Z15A 2E4XA 1JDNA 1PHRA 1A2OA 3KHTA 4RY0A 3G1WA 2IPAB 4IGAA 1D1QA 2JK1A 1YK0A 2PKXA 4L85A 1C4WA 3GT7A 4JB0A 6CHYA 5JNVA 3C6QA 1DZ3A 5KQPA 3N8IA 4EVQA 3DBIA 5IUJC 1MAVA 2MYTA 1CHNA 1XHFA 3CRNA 3RVJA 1Z13A 4PICA 2AYZA 2GX6A 3LMKA 1ABFA 4MPTA 9ABPA 3KS9A 5KWSA 4G0QA 2HPHA 5EWMB 3JVIA 5TPZD 1K66A 4M88A 3T6KA 5IX8A 3FMVA 5ABPA 2V0NA 4Z4IA 1TVMA 1I3CA 3C3WA 3A3KA 2MSWA 4YR7A 5T7BA 3O2JA 4EYQA 1PEAA 5C5EA 3CLKA 5DTEA 4XFKA 1ISSA 5JNUA 2PL1A 3N53A 4RK5A 3NBMA 2JVIA 1AB6A 5GOTA 3OLXA 4MR7B 3HCWA 3UK0A 5CNIA 4RXMA 2N9UA 2QZJA 4YO7A 1Z26A 3P9YA 3HDVA 4KVFA 3LUHA 2LIVA 4RK1A 3HXMA 4Z4CA 2FKAA 3UUGA 1Z2DA 2AYXA 5KQLA 2WJAA 1KGSA 3F6PA 4LE2A 2X7XA 2H0AA 1GCAA 3GRCA 5IUNC 2CD7A 5I4CA 2FQYA 3O2SB 4MQEA 2E4WA 1ABEA 1DRJA 2FMFA 4RWEA 4RXUA 1DC7A 5TPWB 5FWYB 1NXSA 1QO0A 3LFTA 1FFWA 2JVJA 8ABPA 1IIBA 3BREA 2IPMA 3GBVA 1W25A 1S8NA 2FMKA 4Z9AA 3GWGA 3QLUA 2QR3A 2E4ZA 7ABPA 4MS4A 1LJUA 5JS2A 5PNTA 3T95A 2WRZA 2J48A 4MS3B 5TQ2A 4NCAA 4RK7A 5IEBA 3OMWA 4EYKA 1QPZA 4MGEA 1DCMA 5FBKA 1JX6A 3FFWA 2A9QA 2IKSA 2NT3A 2IPLA 1ZAYA 2HJ9A 3OLVA 3LUCA 3CZ5A 1QNLA 4O1IA 4KV7A 3HUUA 4D6XA 1BAPA 5EWLB 4YRZA 4Z9BA 4CBVA 2VUHB 3GV0A 1QQAA 4RDCA 1FFSA 2GBPA 4FE7A 5JNTA 1DJMA 4B09A 3IP9A 3BRQA 3CG4A 1JYFA 3QEMA 3L6UA 2QU7A 5KQGA 3R0JA 4G97A 3E3MA 4W5RA 1MB3A 2M98A 2ZAYA 1P6UA 1NXWA 2NZVG 4NICA 4XLTA 3LUDA 5C5CA 3CNBA 4OTZA 5E3JA 2LPMA 1USGA 2QSJA 4NQRA 3S99A 1ZITA 3IP7A 4PEVA 1NXXA 2LBPA 2RJNA 3JPYA 3LUJA 3Q15C 3HS3A 3D02A 4H60A 2P4UA 4MYRA 2A9RA 4RY9A 1YTUA 3N75A 1TLFA 4XARA 3SAJA 1Z12A 3IPAA 5FBHA 3RH0A 2R47A 5CNJA 3D8UA 5TQ0A 1T34A 2ZWMA 4Q7EA 3QELB 1ZVVA 1A04A 1Y1LA 4KRFA 3T8YA 4S04A 1W9HA 4MS1B 1D5WA 1P6QA 1Z16A 4Y9TA 1USIA 5IUKC 3I42A 5DKFA 2E4UA 3IDOA 4G86A 3FDFA 1SD5A 2PUCA 2PLNA 4Z4FA 3QX9A 4JAVC 1F51E 5BQ3A 3RVPA 1A0OA 2WB4A 2P9HA 1URPA 1NATA 4N03A 4WT7A 1MIHA 4EVSA 3L49A 1DP4A 1JHZA 3KCNA 2M1ZA 3RVRA 3RVOA 5KI6A 4EVRA 2FMHA 2A9PA 4EYOA 3I09A 1YS6A 1XHEA 4WZZA 1VLZA 3M6MD 1DBWA 1NXOA 5EWMA 1F4VA 3FFTA 4FE4A 3K4HA 4IILA 4YP9A 2GWRA 1DCFA 2L19A 2NUBA 4NV3A 5KQMA 1LJLA 4LDAA 1FSPA 1D2AA 2IDMA 3GYBA 1PNRA 4P1ZA 3H5VA 2FLKA 2IYNA 2MSKA 1BDHA 4RY8A 1P8AA 1QKKA 2FW0A 3E61A 1LBIA 4MR7A 1VPWA 3KLOA 4RS3A 1Z17A 3A0RB 1GLGA 3MA0A 4FB4A 5CNMA 2E4VA 4LX8A 1RPJA 2FSPA 4MRMA 1JYEA 3I5AA 4F8JA 3IP5A 4F11A 3HVRA 1XWWA 2HSGA 2F8TA 2PE5A 2L2QA 4L4UA 4MR8B 4YCSA 3KTOA 4YWHA 3H5LA 3CS3A 1U2QA 4IMIB 3HSYA 1LBHA 4KMRA 4MRMB 3DGEC 1PEYA 4QPJC 2WJWA 1KRXA 5TPWA 5FWYA 5B3JC 3RVSA 1E6KA 1P2FA 2KYRA 2I6FA 1OXBB 1ZY2A 4GPAA 4DADA 3VNBA 2FQXA 3HZHA 4F3TA 3O1JC 3TMYA 5HSGA 4JASB 4LZLA 3NHMA 1APBA 5JNSA 3CTPA 3KLNA 4MS3A 2PUDA 3KJXA 2QV0A 2JBAB 3EAFA 4KK4A 3SM9A 1EAYA 1QMPA 3SNKA 3C3MA 3N6VA 2PAFA 1SXGA 1JFSA 3MQ4A 4HYEA 3EJWA 4OLBA 3FGZA 4RK6A 5HKOA 1JH9A 3QLVC 3C3KA 2QW1A 3MF4A 2PUEA 4H3HB 5TPZA 1EWTA 4RZSA 5EWLA 4W5OA 4IMJB 2FEWB 1RZRD 2IPNA 1JBEA 3BBLA 3O74A 4ML3A 4RK0A 4YV7A 1NXVA 3K9CA 3N0WA 1MB0A 3H1GA 3Q7RA 3LKVA 4ZMSA 3M9WA 1Z25A 2IOYA 4F12A 4YLEA 4N47A 4W5TA 2QXYA 3OO1A 1KRWA 4E7OA 4JB2A 1NY5A 1GCGA 4W5NA 1SXIA 1LK0A 1ZN2A 1C0EA 2NT4A 1WETA 5HM6A 3M9XA 2QVCA 4N0QA 1TM2A 3EULA 3KKEA 4XAQA 3BRSA 2FMIA 5KC9A 3O75A 3KG2A 3H1FA 5T3YA 1JDPA 4MQFA 2L17A 3JPWA 5BR1A 4XASA 4S05A 1QP4A 5D2CA 1YMVA 3Q7TA 1DCKA 2TMYA 3JTEA 4KQ9A 4XXHA 4OATA 3UKJA 3ILYA 4MQFB 3CZCA 5HQJA 5IULC 3B2NA 4TLLB 4LE0A 2JCGA 4O5AA 1R8JA 1E2BA 5ED4A 4KQCA 2ID9A 1JFVA 1UDRA 2FN9A 3QELA 1MVOA 4LRQA 3T38A 3LUFA 3TB6A 1GUDA 4ZYLA 4RK4A 3G85A 4MS1A 3CU5A 4W5QA 3O2QB 2PUGA 1ZH2A 3H5TA 2NZUG 4MR9B 3H6GA 3OLZA 3CG0A 4IRXA 1RXIA 3TO5A 1RZRA 3I45A 2YHBA 4JOQA 1M5TA 1YVUA 1U0SY 3QEKA 2MYPA 4N76A 4DQDA 1ZGGA 3HUTA 1CYEA 2ID7A 1Z18A 3OQOA 2VK2A 3F73A 4OBBA 3FFXA 1DBQA 5DCLA 4ZJPA 1ZDMA 1EHCA 1FQWA 4TLMB 2R48A 2WMYA 4NCBA 2PUFA 2FEKA 2JB9A 3HEBA 2FQWA 1BVHA 4PE5B 3NNSA 1PNTA 2RDMA 2XDYA 5EWJB 3KYIB 5GQSA 5TQJA 4QYMA 3OM0A 1U8TA 3O1IC 1E6LA 2CWDA 4F06A 4KFCA 2PUAA 4P98A 2O20A 4Z0NA 1BDJA 4TMYA 1YS7A 2DRIA 2MSLA 1NTRA 3LKBA 3NNDA 3MYYA 2PL9A 2B1JA 3KSMA 6ABPA 3OM1A 1SXHA 1BA2A 2JVKA 3OO0A 1TMYA 1YK1A 2WY2D 3H1EA 3OQMA 2R4QA 1D4ZA 1USKA 5F64A 4KK3A 1VKRA 1EFAA 1QO0D 3OQNA 3QX8A 5B3JA 3SG0A 4G0OA 3H6HA 4MR8A 4GNRA 1EWVA 3ILHA 4OG2A 4Q6WA 1NXTA 5BRJA 1SRRA 2JRLA 3Q41A 1ZGZA 4Z4EA 1GUBA 5IEJA 1H9CA 2YHAA 4WUTA 4MLCA 4D6YA 2VYCA 3HM9A 3MIZA 1B00A 3TX6A 2PJUA 1DG9A 4HNSA 2LUOA 3EODA 3QLVA 2GKGA 3CHYA 4LE1A 1D1PA 3F6CA 1OXKB 2JBAA 1JWLA 4KNYA 2Q5CA 4WXEA 3RVQA 3SQNA 4ETMA 4HNQA 3RVMA 5CNKA 4YS6A 2E4YA 2L18A 3H75A
chains in the Genus database with same CATH superfamily
1A9PA 4RMIA 1FYDA 4G81A 4UNRA 3KR2A 4GGMX 1YNSA 1ZESA 1Y1SA 2ZBVA 2VF4X 3CVYA 3ZHZA 1QAQA 1GPKA 1YZGA 3M6WA 2HEVR 5BNQR 1GZ7A 1Z7EA 2YRWA 4J0FA 4MAAA 3WLFA 2XF2A 4JYBA 4NIMA 5JNLA 4F5EA 1DBPA 4HDCA 2FY8A 4L08A 4C0KA 1WQ4A 1QS0B 4IDOA 4J91A 4BNKA 3JS5A 3L4KA 4W63A 1R4ZA 2XNKA 1YZFA 3VR0A 1OBHA 3AKDA 4JJEA 3ALQR 1WHSA 2IZ0A 5T5QA 3RVNA 1N77A 1BDIA 3GFGA 4OHKA 1RQLA 4WJLA 2X15A 5BUCA 4F97A 2WTMA 3KEGA 2PD3A 1JIIA 1VHQA 2QTZA 2WYUA 2I2BA 5J23A 1NRIA 4C04A 2NV2B 3TL3A 3UMGA 2XWJI 1FVXA 4G0YA 3N39C 2WTNA 4P7BA 2QKYA 4CLEA 4TM8A 1K63A 1RQPA 1SG0A 4AJ9A 3H8VA 4FPXA 3SC6A 1E59A 5IH7A 3L1UA 3DLBA 3UK1A 3TLBA 1IPHA 1UUFA 1VSUA 1QH8B 1KMIY 2ZG6A 3TQQA 1Z74A 2D5CA 2YVKA 3LQQA 5LQRA 1QX4A 5B2FA 1NJ6A 5K0ZA 2RGYA 3JQRA 3UT6A 2OC9A 3DB2A 3M0EA 3NFRA 2JGIA 3QPDA 1GQYA 1JR3E 4ZRMA 3UN1A 2X0NA 3HM2A 2DWPA 3V46A 4MWZA 3CE9A 1G66A 1PLLA 3K1TA 3ZXXA 2XMZA 2P2GA 3ESYA 2FWBA 4FGWA 2QXUA 1AB5A 4WOJA 4BVEA 1YRBA 1NDQA 5B3KA 4X6XA 3B6IA 3GJYA 3A1EA 3GDFA 4HDNB 2FW9A 4JJ6A 4KPYA 1E5VA 5IVKA 3GC6A 1I6MA 4NONA 5EGNA 4YRBA 4P38A 3IVRA 3UENA 1M1YE 4U7FA 4MCJA 4KQGA 1I32A 1E3IA 1ONPA 4P3KA 4ETNA 5BR4A 2QOEA 4MPJA 2AE2A 1RC0A 3BCHA 4JOBA 2H1CA 1QGED 4JA0A 1IVSA 4FM9A 2IS4A 3STYA 4M1YA 2WR8A 3PEFA 3CPJB 1RVV1 3ADKA 5FYQA 5DCWA 5BW5A 4QUHA 3ULKA 5JNRA 5CEJA 3GN2A 3H2ZA 1X7DA 3CNQS 5DLEA 1NYLA 1JILA 1RZUA 2GD6A 3PF8A 1I3OA 1Z2EA 2QIPA 2BR4A 3TLZA 1VL0A 3G7SA 4G9BA 1XFAA 3E8SA 2XVXA 5KKCA 2GBIA 2QQ5A 1ZRHA 1GUFA 3O1HB 1CW2B 2CDAA 3J81k 2WVAA 3WIUA 2JIRA 3SE7A 4R4JA 2F8SA 4EY3A 2GJ4A 4OBXA 2P3SA 3WAKA 3UJPA 4QBKA 3RNOA 1FF9A 3RS0A 2B82A 4WQMA 5B12A 1JQAA 4N3NA 1AZSC 2DPLA 1TL7C 2WWIA 5BVHB 2RE8A 5A4FS 1JZTA 1A2OA 2HWWA 3ZYZA 5GADl 3KHTA 3TIVA 2XA9A 2Q29A 2VQ6A 5HE8A 3WFIA 1QVAA 4QUJA 4YCDA 5C80A 2XMRA 1GQOA 2QTGA 5KX5A 4HH4A 5KQPA 1UBTS 2XAUA 4V38A 1NW4A 3H2IA 2LE0A 5THXA 3VJRA 1CHNA 1AUPA 3AVPA 1A27A 3H5NA 5GP1A 4AUKA 3IQXA 1ABFA 3KETA 2UUAB 1THTA 3KKQA 3T35A 3MJ4A 5AVUA 4ZKDA 4WK4B 5JLAA 4ES6A 1E1NA 1RQNA 4MQBA 3MINA 3WLLA 3GA0A 4AZ3B 3H99A 2OBYA 4D0GA 3LH5A 1RHMA 2WUGA 4EW6A 1FS6A 4LBYA 3GX1A 1I3CA 1RBYA 1Z28A 3GPIA 2DBQA 2SKEA 2JKZA 1YV9A 3OUZA 1T6ZA 2YXNA 4WY5A 3VH2A 3ZWPA 5C3UA 2OB2A 3QG1A 4DIFA 5C5EA 1HXHA 4G23A 5DXAA 3VBCA 2ZRJA 1EJ0A 1DXQA 2ZIWB 3KXLA 1CFZA 3K20A 3QMPA 3H2HA 2ZYDA 2QVYX 4P5DA 4BWGA 1PJRA 1V1MA 3DWFA 5EKUA 2F7SA 4G25A 4AUEA 1U8YA 3R09A 1U2TA 2HR1A 1Q0UA 3FWKA 3QV2A 1CQIA 3KP1A 3OF3A 2IUYA 2AZXA 4FYHA 3BL8A 4B75A 1M75A 3ONWA 5LXTF 5BOSB 5KQLA 3OOWA 1Q17A 4H7KA 1LQTA 2HA6A 4P5PA 1T0HB 1SVWA 5I4CA 1JFFB 2XTZA 5EAIA 3LC2O 2B1QA 2RBGA 5D01A 3U4IA 3DL0A 4BLVA 5FJIA 1MOSA 2BDUA 2OCXA 1Q0LA 4YWJA 1ECGA 2AN9A 3G8CA 1OXMA 3G0GA 4KWHA 1KC1A 1E7YA 2I9PA 3BREA 3NEJA 3IXLA 3KAQA 2FJ0A 4BQOA 3NIFB 4HX5A 1GTG1 2JFUA 3UF0A 1EUDA 3S6JA 2V5UA 4C3UA 3FOEC 3BMQB 2OXIA 3NVAA 1QZ3A 2WTEA 4WBNA 3CX8A 1K5PA 2C59A 3EXIB 3OSZA 1O5OA 2FFHA 3FFWA 2AOTB 1Z47A 2X7HA 4P4SB 2ZM6B 3OETA 1XPRA 1PJTA 1BXRB 1VJCA 2Q2QA 2WT8A 2RHJA 3KU4A 5AKHA 5K0BA 2G82A 3I2KA 4BL5A 3BGIA 3PJGA 4O1IA 2F55A 1KFKB 4JNCA 3ZBUA 1O0BA 3OOHA 3KV1A 4LNUB 3W8RA 3AXSA 1PGQA 4QLAA 5B4TA 4ER0A 4M7WA 5HOEA 5JAIA 3LHDA 5KJ1A 3SS9X 3CUSA 1GM5A 2Y2VA 4MW4A 1KO4A 2CDNA 4QU8A 3VVCA 5EE1A 1EFCA 3AVWA 4EVIA 4GQBA 4IWXA 1OX4B 5HZGA 3QVMA 5DNWA 1TZMA 1TZKA 1N2HA 4JJ8A 1DJMA 4MJ3A 3IERA 2Y1KA 4BY9E 5HS4A 3U1BA 1XVTA 4KQ2A 2HIAA 4N49A 2XIJA 5BN3A 5I7OA 5KQGA 1P73A 1PG5A 2XQIA 3PHJA 1O2DA 3EIQA 4V2UA 4EENA 1OPXA 1OY1A 4CF7A 2ZS8A 4YDSA 3CR7A 3V1LA 3ETGA 2HSEA 5E3JA 3KHSA 4FQ8A 4BPBA 3NHRA 5JSFA 2GAIA 2VR1A 2RGXA 4Z8YA 2ZUDA 1XAHA 2W6ID 5JJBA 2V3CC 3N6XA 2WHQA 3H1TA 1UT6A 4ZHQF 3RYIA 3K9FC 3PBKA 4OQLA 2IE8A 2PM8A 2V4ZA 2X6RA 3EQ6A 4DLUA 2BUBA 2OBLA 4GL4A 4OFWA 4RJLA 4ZOLF 4UDNA 1IN6A 4QPPA 3UJ3X 1UAGA 3RH0A 1M74A 2B20A 3GMSA 2C5FA 4RNCA 3UGTA 4YY3B 3TLEA 2BHRA 3F9IA 5DM4A 3RJZA 4DJEC 2FWNA 4KQHA 1T6XA 2QP3A 1A72A 4EY4A 3WBJA 1ZD4A 1ZD9A 4N3CA 3UQZA 5A2GA 3FDFA 1SD5A 1ZH6A 2UZ0A 2VK8A 4KO2S 4O4JF 2HO5A 3VU0A 3DMYA 3OJCA 1U7ZA 2AUTA 1P9NA 1U7HA 2IYQA 2VP9A 3Q7EA 4RE6A 2A5GA 3TQCA 5KZMB 1MF7A 2K87A 2P91A 2BYTA 2YQ4A 1ACLA 1C9YA 3QKRA 1GUYA 1FTQA 1ZMTA 5AXCA 3VR5H 2B0JA 2H08A 1G6KA 4WINA 2QD2A 4MXDA 5J2TF 2XVMA 2C9ZA 4ZALA 1U0LA 1Y1QA 1N9ZA 1ULUA 3K4HA 1DKQA 2I2DA 4R9RA 3SXPA 3WTCA 2Q4RA 4K28A 4ZGBA 5EHZA 3R3HA 1E92A 1HTBA 4LA4A 4MWGA 3BGDA 2I67A 3OE1A 4W99A 2UVPB 4WNAB 4LFBB 3N70A 3IUMA 3EZGA 2FPOA 4N54A 4PV7A 1B0AA 3ZV7A 3DONA 2VOEA 3A4TA 5FPTA 5IBCA 3WJAA 4O2RA 1NWCA 1KMHA 2VF7A 2C4TA 4QSHA 3QE3A 1AGXA 5TF4A 2GNAA 4FIZA 1Z8DA 4WDQA 1MIOA 3G49A 4R2MA 1BQEA 1GPYA 3PGJA 5BW4A 4KKXB 3LRPA 5HQ3A 3DE1X 4N0EA 5HYVA 3PHBE 3EFOA 4CFZA 1RBZA 1KMCA 1FRQA 4G1EB 3D8HA 3QG5A 5GJWC 1C3JA 5EUMA 3HNRA 4LG1A 2XE7A 4YMIA 3BSYA 3WRVA 4EB3A 5KINB 2LXNA 4Y2TA 1N2GA 4J0IA 3ZH9B 3KUKA 3RS5A 4KPFC 5HXAA 3HSYA 3FVWA 2VNAA 2H16A 2SKCA 2Y9MB 3TFWA 1NRXA 2B4RO 2YL2A 1E3WA 4WECA 5ALEA 3V34A 2CLEB 1Y5LA 4DZRA 3KZOA 2L82A 3CZRA 1RKQA 2H07A 3SQWA 2QAGB 4HDRB 1R4NB 4DADA 3FCAA 3S2FA 3KUCA 3OT1B 4AJ2A 1QHHA 2XX3A 4HLNA 4XYBA 1N2CE 1P1HA 2AMYA 2A0YA 2G25A 2O07A 4JOSA 5EP1A 4BOYA 5BORA 1GU1A 4LRWA 3TECE 4C7OA 4WNCA 3EVZA 1NHWA 4QTZA 3ZY4A 4WOBA 4NJOA 4IJKA 3K5IA 3SYTA 4JELA 3EPPA 3ZIUA 2E4AA 3KSBC 1NMZA 1NI3A 1UPBA 2Z4SA 4GOMD 3R74A 1Y9EA 1F20A 3AU9A 1DBRA 3A3NA 3NH6A 3SE0A 4AN0A 1I4DD 2QG6A 4FOSA 5C7OO 2DH5A 5LSAA 4DUZB 3MF4A 4H3HB 3ET5A 3ZCPA 2HQ1A 2HLDD 4HY3A 4N1AA 4RFLA 1NULA 1N92A 2QY9A 2F3TA 4RK0A 4P5EA 4B43A 2HEYR 1JV2B 1XMJA 2PMDA 2D8AA 4AZWA 1W9MA 3V8MA 3RFUA 3H11B 3MTDA 3HTXA 5ILQA 1XZPA 4BNXA 4F12A 1LNZA 5CAEA 3QSYA 1FW6A 2DBZA 1W94A 4IS3A 2X19A 4F2PA 2HU8A 3TRHA 4F4UA 2VATA 1G7TA 2ZRAA 4B6QA 1DL5A 1UIRA 5HM6A 3HY6A 4MB6A 2P1DA 1H6BA 3II6X 5IUNC 2HCTA 3EULA 4X7RA 8MHTA 5JZ9A 3U3ZA 2Z6QA 3IDAA 3SJZA 4D97A 1JDPA 1I8TA 5J2UF 1ORHA 2HK8A 1KRHA 5NLLA 1JJIA 2XYGA 1YMVA 1PR9A 1LBEA 5A6SA 1XD2A 3F8TA 1DLJA 2BEWA 1OAOC 4Q4HA 4BO4A 4MQ4A 5JDIC 5IULC 1TK3A 1MPXA 2HJVA 1KJZA 2A7QA 1ZIPA 1RI3A 2DBRA 2QSUA 3PUJA 3JAKA 3WQHA 1VMEA 3DXYA 5AKJA 2XTMA 1EX7A 4FNGA 4MV1A 5IAGA 1CF9A 2OV4A 2IX9A 3AUJB 1N6LA 2EBFX 1Z8HA 4QDOA 4KWTA 4QDXA 2V54A 2ZANA 3HN7A 1BRMA 3OCXA 1VMAA 4LXHA 4R5MA 4RHCA 1GXSB 4DS3A 3S8YA 1ZUIA 2ESRA 1PCXA 2O3QA 3HV0A 1IUPA 4IRXA 5IJAA 3IUJA 1G18A 1YCHA 3IDQA 5C4MA 2IH5A 5ULLA 4OM8A 1M5TA 3DXXA 4HAIA 2QJWA 4QUDA 1S2MA 2EJWA 2W7TA 3PYLA 4GGPA 4OBWA 2I4MA 4F9TA 5HDQA 3MK31 3ZG6A 1E64A 4U7HA 3IE0A 2ASVA 4F1WA 1HLGA 2OAGA 3GNSA 4P08A 5JAHA 4BWFB 4Y6GB 2DHRA 4QVKA 3SEQA 2WMYA 1SC1A 2I4RA 4HH1A 5LQUA 4K5QA 2DFVA 5DO9A 3TTXA 5JAOA 3AEZA 3NNSA 1VIYA 2XUAA 3O47A 4S1NA 5F7ZA 3AR9A 3BPSA 4JROA 1R3DA 1ZPDA 2QLMA 1LDNA 4JI1B 3PVZA 3I1FA 2P62A 3ZXUB 3KHUA 4CTJA 1SUIA 4J6GC 1G16A 2L42A 1KI8A 2FPGA 1XDUA 4JUFA 4P98A 4TMYA 3QFTA 4D8XA 1F8YA 2P77A 3HDQA 3DOOA 4LSGA 4F71A 5EP4A 2R9VA 3E9CA 5IM4F 1EA5A 4AKGA 4YH1A 2VN8A 1RPZA 1T8SA 1PLKA 3B7WA 5AHRA 2EKDA 5TEWA 3O8NA 4ESHA 4WCFB 1FIUA 1P5JA 2C20A 5DWVA 3DD5A 5E3HA 2VWQA 2VH1A 4OU5A 5LXTA 1OTYA 4DCVA 1ODCA 2IVZA 4WJZA 4ED9A 5J5VA 4TVKA 3S28A 2DBYA 3TXAA 2E0IA 1JU4A 3BIXA 3IT1A 5DM1A 2A67A 4KQWA 1CXZA 2Q5LA 5I48A 2NPOA 4OK3A 3TLGA 1E6UA 3DV0B 3TX6A 3GLHE 3GEHA 1L4FA 3A6LA 5AKYA 2WTAA 1AZTA 1IAVA 4YCJA 3PDHA 5KNCD 1IXYA 1E2FA 2OLJA 3KE9A 3O9VA 4QGAA 4ENPA 3HYSA 1VDZA 2PS3A 3EEIA 4OUKX 3FN4A 4HNQA 4DYVA 1BXGB 4HNGA 3PSAA 4P4UA 4GXRA 4Q66C 4XFJA 3ROEA 1I33A 2H6EA 4QUIA 3S8EA 2P9GA 1G8JA 4KX5A 1VJRA 4UZEA 1WBBA 4KQFA 1JG2A 1F1BA 4TXJA 4DLAA 5I7FA 5JCPA 5CH3A 2OILA 3ZGLA 4CHTA 3H04A 3OZGA 4Z4GA 3TM5A 4UHKA 2D06A 4I36A 3UAXA 3L8YA 3FTFA 3TNLA 5COQA 3C2QA 4EUKA 3MUFA 1WCIB 5HZMA 2O5VA 3UEOA 4PN7A 2QQ0A 3AH8A 3MVEA 3PIRA 2D2FA 4Q1DA 1T8YA 4I4NA 3RVLA 2G1JA 4OB7A 4AWAA 1KDPA 1RXEA 1VFNA 2VKTA 3VOAA 3GDHA 2PRZA 3U3QA 1U4OA 3FVTA 3W6OA 1NLMA 1C3OB 2YNMD 3P2JA 4NCIA 1BQ3A 3GVPA 4XI9A 2DETA 1KMMA 1CY1A 4FDUA 1NI4B 2NTYC 4R2JA 4XUCA 4AQDA 2V8BA 1BCRB 2CSUA 3UT0A 3FRJA 2A4MA 4JP8A 2NOAA 3IULA 3KQYA 4U1RA 5KU7A 3OLQA 4DLBA 3M1YA 1ZR2A 3C3EA 3IB3A 1PR0A 1LA2A 2HIGA 4HDSB 4NI5A 5AHXA 1E66A 5TGZA 4OHBA 4D79A 2RJOA 4DLPA 3EVGA 4ZHQA 5LQJA 1SIUA 5KNCA 3BXFA 5LR6A 4ZOLA 2VBIA 3WKEA 3BGWA 1MO6A 4KXVA 3K09C 3BIWA 4PSCA 1JLHA 3G0BA 1L7NA 3VZQA 5JRDS 4ZAGA 1SZJG 4LSZA 2AFHA 1SCDA 3KZ1E 4GEGA 4MR9A 5B1DA 4Z2YA 3I9KA 1RWKA 3W8DA 4YPVA 2Z4TA 1TM5E 2OHHA 3GY0A 3IT0A 4GZ5A 4ZOEA 5L3VA 2YR0A 1OH7A 3JW8A 1MXHA 4O4JA 4E3WA 4DDUA 3ZLJA 4KREA 1C4KA 4J4TA 1YRHA 2QSYA 2GI4A 2XE6A 3BMOB 4XUDA 3ZHXA 3LXXA 5TE9A 2C9MA 4BC0A 1SBNE 2DHDA 2CNKA 2I6QA 3ORSA 4M9RA 5DLDA 4EEXA 1PFVA 2FZEA 2DPYA 1RM3A 3LUPA 2BLNA 5CIQA 1Z83A 1RI5A 1H1DA 2D54A 1PZHA 1XYVA 2R7AA 3A9CA 4HN4B 2AQIA 4F4JA 2VDPB 3AZQA 2VUTA 4K3VA 5J2TA 4BE4A 1G3IA 5FOQA 3C5WP 4NFSA 3AHGA 1KBZA 3RYFA 2Z98A 2YNMA 2BKXA 5FL7D 1QC5A 1HMPA 1YRAA 5JH7B 4Q1AA 4YJGA 3DWEX 3F6RA 4TRJA 1E4VA 2VVTA 1YS4A 3OU7A 1H6AA 1H1LB 1NNLA 2QN6A 2M1XA 5I7VA 1QYIA 3CKMA 5ITSA 3HJTA 1U3UA 2UZ1A 1JG1A 2GZDA 1JHVA 1DZIA 2GM5A 4R9NA 3RKSA 1R6DA 2EHJA 3DOCA 4LVCA 3UKOA 2G1PA 3GFBA 1MC1A 4L9WA 2XHEA 3HVKA 3MWGA 3ICOA 4PVDA 4YTEA 5KVAA 2HJHA 1ZRMA 1KE1A 4MARA 4KH0A 4FOPA 3ZVNA 3USCS 5K0FA 1I7QB 1UMBB 4K3UA 2J46A 4C9BA 2NNWB 4KNVA 3R0QA 1MAHA 1UCFA 2WOJA 1G42A 1CUDA 2HWUA 3FBGA 1U9IA 2B6NA 4L27A 4J1SA 4B3GA 4JB0A 4TROA 2C5SA 1NF9A 4DEXA 3AILA 1XRQA 3D7NA 5ALTA 1VZ2A 4CCSA 5JS8A 5DGTA 3A8TA 2RD2A 2J1LA 4MSUA 1RKVA 4CR7A 3HJHA 2GX6A 3RJ9A 2NUTA 1S2LA 3C8MA 2YMMA 3GW8A 2HA0A 3MT8A 5KWSA 1MQSA 5B1YA 2KLHA 5EEHA 5YASA 4PWZA 4KIWA 3ZLVA 2CNBA 4RF2A 1IDOA 4Z4IA 1TVMA 4D0SA 3LL4A 1WXWA 5DBFA 1I7LA 1P9RA 1ZEMA 1PG0A 2TECE 1M2WA 3SHOA 3UV6A 1YULA 3WGZA 1ZP6A 4LMAA 1XX6A 3PXEA 2WF5A 3R3JA 4JZKA 2DWUA 3OX4A 2QM0A 1OYOA 4OJTA 2PD6A 5FL7A 3JU3A 1P7ZA 3HKDB 3N53A 3FMOB 4YP6A 5H4HA 4J75A 1FJGB 1E89A 3OFJA 1X2BA 4PBRA 4YGYA 1EIZA 2O2YA 4MRAA 3L93A 2N47A 3PPWA 4RXMA 2EX4A 3I1IA 3VKGA 3P5BA 2CJPA 3UMJA 4QPDA 4BO7A 3E58A 1X80A 2N0SA 5CLQA 2ZETA 1AGPA 1U3CA 3E9ZA 3LUHA 3PUIA 1UZLA 2LIVA 1GTVA 4TKMA 3TMAA 4ALJA 2QRQA 3QIVA 4YAOA 4ECAA 5JSZB 3K5PA 3UUGA 4QDUA 3SX0A 5LYJF 1XVIA 2H0AA 2ZUFA 1GCAA 2GO7A 4KIJA 1O97D 2WU4A 3Q9UA 4YFYA 3RG8A 3UW3A 1F2DA 2NSJA 1JSXA 4G67A 4NU6A 1N2SA 3BSFA 1PX2A 3U60B 2FMFA 1AY0A 2AR0A 2XHZA 4RXUA 5TX7A 3GLTA 3QVTA 4JXXA 1JQBA 4AROA 1W46A 3H1AA 2M6SA 3JZFA 4JL6A 3EVEA 3RU3A 2DJ5A 5LUBA 2Q4OA 3D2CA 3HUDA 3M6IA 2QRUA 4TYNA 1E6EA 2QORA 2ZRDA 3AU8A 3H9UA 4M1WA 4L5AA 5ALQA 3IODA 2QM7A 2X0RA 4PO1A 2C2ZA 2OD7A 4QXQA 1PNQA 1M8JA 3SFVA 1UBKS 3GGPA 2H8KA 3BH0A 2WSSD 2J9FB 4DQXA 3V4RA 1S2NA 4I5EA 1TYCA 5KHOC 5FEMA 2EFCB 1AK2A 2PJZA 2R7LA 3ZK9A 4HNVA 2GN2A 1JLLA 1CP2A 1FDTA 5EFOA 5ALVA 1YAJA 4XYGA 1GD1O 5GOZA 1F06A 2H29A 4DBLE 4EP1A 1LVUA 1C9MA 2I4IA 3GFQA 4YACA 3H05A 3X2SA 3GEMA 4C6SA 2YJ4A 1HE8B 4CCAA 3U6BA 3ETJA 1OJLA 4AJOA 3TZBA 1FQKA 1MGPA 2VTBB 4OSEA 5CT5A 3DMRA 2J87A 4RDXA 1RM4A 5DGIA 2FSFA 4EMUA 2P67A 2FP4B 2PAAA 4MWSA 4WCDA 4CKCA 3ETEA 3QMMA 5JYEA 4MYDA 1GNSA 3EMBA 4D26A 3CG4A 1OKKD 2BLLA 2V6GA 4A16A 5I7UA 2JH8A 1MU0A 7GPBA 2XBLA 3L6UA 3P2EA 3OIFA 2PWAA 2M98A 2XXBA 3A1WA 3DV9A 3RIGA 1V3UA 4Q4LA 3ZGOA 4KPGA 3GRKA 3ANNA 3V1MA 3VZCA 5J58A 1E62A 1FUEA 3NOQA 3CF4G 4Q4DA 1ARZA 2VZ9A 4X1OA 3IVAA 3SBXA 1XZNA 2HUNA 3JQGB 1T25A 4ZOCA 4IUDS 1WPGA 1FFXA 2J7PD 2ZIXB 3OFND 4JJ7A 1J49A 3AJ8A 3H4TA 4HYQA 1EZZA 4MWEA 4NR0A 1E3SA 1MEJA 3X3HA 4NNOA 3WAJA 2PDAA 2GDZA 2CLCX 3O4IA 3EGOA 4LOHA 3VTKA 2WSSA 2FSIA 1LX7A 4BYMA 5IM4A 1D5WA 1D3AA 5DSZA 1B43A 2PHZA 2BR3A 4JEMA 2JFXA 4NP6A 5TQVA 1ZN8A 2WK1A 2QN2A 1X1TA 3T1TA 1B23P 4D9EA 3NS7A 1A71A 4FCCA 2F62A 2OD9A 2JIZD 2C92A 2SCUB 4AS3A 3E3LA 3HEAA 4URZR 4YUXA 4BKRA 2G6TA 2SBTA 3EH1A 2QPOA 4WKCA 2JFOA 1K7YA 3UJCA 1JU9A 4PO9A 5B37A 4C0HA 1XZGA 2FMHA 1NJFA 4DY4A 2VNSA 4R7ZA 4KTTE 1DT5A 4FFMA 2F4NA 2JLBA 4WZZA 1II9A 2J6CA 1OKKA 2C1EA 1Y5NA 2XA1A 2SICE 2Y99A 3WSWA 1HT2E 1R6AA 1RTKA 4PWYA 5C31A 1I7PA 2DKNA 2GM3A 4B3TB 2X2PA 2DB3A 1L7BA 3L79A 1LJLA 4DILA 2HIMA 1IBCA 4BZZA 4HAZA 1U2GA 2H2FA 2ODAA 4L6CA 5D3MB 3WGGA 3BMCB 4D9GA 4R83A 5JROA 2C61A 1Y4UA 1FU4A 2C2YA 1TGVA 1K9VF 1PD0A 2A1IA 2ZUUA 3KPUA 4HAWA 5F76A 1CUBA 4UEOA 2C88A 2J7PA 5G0WA 1LPAB 3OFNA 1R0BA 1WDKA 1RWWA 3HWX1 2C4WA 3O4RA 2CV2A 4U39A 3QXXA 1GDHA 1HZZA 1MORA 2P9ZA 2E4VA 3G02A 5AW5A 2JI9A 3AFGA 4O1MA 3W5IA 2NMVA 4IW3B 4JI5B 1N33B 1I3KA 4R2KA 4GVPA 2AW3A 1ZLXA 4DQ0A 4V2IA 3TJRA 3QE0A 1TAHA 4EGAA 5AOBA 3IOBA 4ZO4A 1DWUA 1XF9A 1ZD2P 3QMVA 2V03A 4L4ZA 1ML3A 1WSDA 3CUUA 2RMKA 3QBTA 4HDQB 4RGBA 4E14A 4KO8A 3BE8A 5H02A 2XVYA 4ZI7F 4HTAA 1QORA 4HZUB 2HJRA 1A7KA 2JIZA 2ZKIA 4URWR 1BW9A 4ASUD 4Z3KA 1NURA 3Q7QA 5AM0A 3SZRA 3FTCA 2JZNA 3CXRA 4UHFA 3DOUA 3OE5A 5I3CA 2QB5A 5HGXA 3A4NA 1XCPA 4S1WA 4I9XC 5IASA 3MHPA 4IHKA 3H86A 1Y3FE 2ZJ7A 2GKOA 2P6OA 3PE6A 1QAMA 4AZTA 4EJSA 1N2OA 4QX6A 1K27A 5I4BA 1LFAA 4RHTA 2O7RA 1G1MA 3EBOA 5LBUA 2ON6A 3U0VA 3FGZA 3DE3X 3ORYA 3HCOA 4GU5A 1M76A 1ZCBA 4U8HA 1FMFA 3WRYC 3PTLA 3AF1A 3VC1A 1EWTA 4Z7JA 1SOUA 3FXAA 1CZRA 3T9DA 4YMUA 3P4XA 4B3DA 4PF1A 4U7TB 2FEWB 4OGFA 3BBLA 2DG2A 3O74A 1UM9A 4HO1X 3SS8A 3TZHA 4BMYA 4EJ2A 3MHTA 2X8BA 2PBLA 3EGXA 2ATIA 1NC3A 1S2IA 2VYQA 3IQFA 2JI6A 1P4JA 3BHMA 3M9WA 3QPBA 3WWCA 1OFTA 2ZCJA 3B13B 2HZ7A 3HNOA 1AGRA 3OQBA 4UBNA 3VTAA 1T8TA 2EWMA 2PL5A 5LQKA 3IEVA 4P3OA 3CRMA 5J5CA 2J08A 2G40A 1GQRA 1S2OA 2FUNB 2I8CA 1LK0A 2GXAA 1AKMA 2H1FA 1Q7GA 1V8FA 2ERXA 5JSUA 4JXZA 4GH5A 5TVGA 3CVVA 3U4AA 2INGX 2PZAA 3Q8WA 4K86A 4HLUC 3DBOB 3AVVA 5BN5A 2ZIVB 1M2OB 4OHPA 2W2QA 5IABA 3H1FA 4KR3A 2ZWPA 4ILEA 5SZHB 3WLQA 2L17A 5AM1A 2V7BA 3RSOA 3LT4A 1FNCA 3H3FA 2VNHA 4G5OA 4V03A 3WIDA 1QHSA 3D3WA 3HADA 2PIAA 5KMGA 1Q0HA 4ASUA 4AVYA 1YDGA 2PV7A 4JFAA 1YGPA 4KXLA 2D8MA 4PPQA 4HUTA 4R0NA 1KNQA 4TTJA 5I4IA 1Y8CA 1E9AA 1QJCA 1N9GB 1FMCA 1B14A 1OFIA 3HFSA 3G2QA 4UUOA 4CDMA 1QX3A 4FHEA 1O6GA 4N90R 3E9RA 1Y9JA 3GMDA 3OZSA 5DGDA 3OPYA 3SS7X 3P19A 1U3TA 2I54A 3LQ2A 4R9VA 5CFOA 3SPXA 2REQA 2NP6A 1GA4A 2F90A 5LLDA 4IM7A 4W7IA 1P4GA 2AKEA 4A10A 1Z4MA 2PX6A 2VTEA 2WYVA 3G9UA 1GSAA 3LPLA 5D87A 1OVGA 4U9IS 4DANA 5CD9A 3O83A 3F6EX 3TQFA 4ECEA 1HE1C 3LPCA 1SXJA 5JFTA 5LQNA 5ANRB 4K9QA 1GZDA 2VK2A 4PR3A 1UDXA 3FFXA 4TTQA 3VKUA 1DO2A 3OQ1A 1B0PA 1P18A 1EGVB 1Z45A 4RUKA 1CJSA 2X4GA 4HRVA 1TC1A 3QYJA 4YPFA 2ECFA 3R44A 4L5CA 2HA4A 2Z8ZA 1W6UA 1NW9B 2C03A 5JD5A 2H1RA 3PGKA 4PSDA 5EWJB 4DMHA 2K6GA 5GQSA 1RRGA 4ZVRA 2F17A 3ED1A 4YJFA 3MWYW 5A4MS 2XOKA 2G0AA 1UXKA 4MMZB 4BQSA 4GOLD 2H9IA 3UXEA 4YFVA 1LJ8A 3DVLA 3R24A 4PNPA 5LIPA 3MYYA 4DV5B 3OZDA 4TSFA 1D09A 4K6GA 3UAVA 1Q19A 4HUQB 1NLYA 2EKPA 2R84A 1LVHA 1XZIA 2QI9F 3EPHA 1KMNA 1YK1A 2ERCA 4ZCQA 3OQMA 2RI6A 4IKEA 1EFAA 5AVQA 4BFYA 4MV3A 1NFRA 2ZRCA 1XTSA 5JQWA 5EPEA 1NBHA 4TYWA 3W06A 3FI0A 1Z0SA 4XD2A 4YAIA 1DSSG 3IYLW 4FDTA 3AW8A 4C78A 4BGEA 4DV3B 3PL5A 5T6MA 1RJGA 2HXYA 4EYEA 1LTKA 3NIWA 3NYRA 2ORWA 3O8OB 4HN9A 5DHPA 3ZWVA 3OTQA 1U0RA 2VCHA 4RQUA 4CDGA 4IZHA 4NAUA 4UCQA 4RVDA 2XUKA 3W0LB 1T9CA 4A03A 3HY4A 2ZYUX 3VNRA 4BGVA 821PA 1I51A 4HNSA 3CVWA 2H1SA 2QGFA 3RYCA 2ZAGA 1XMQB 3Q6IA 3MMZA 3VH4A 1ILEA 1LVGA 2NZWA 3DR3A 1ZMBA 3I61A 4EPRA 1XI2A 3N58A 4O2AB 4DLWA 1OI2A 3IBSA 1K5DA 2FUEA 2OFWA 1HDXA 4G1MB 3OCVA 4PSVA 4ZQFA 5EXPA 3L7YA 3LYHA 1X9IA 4ARCA 3HJFA 1M7BA 4FGJA 1Y33E 1PAUA 4I1OA 4I9FA 2QN3A 2E48A 5T64A 2J3DA 2YN4A 3RB8A 2IELA 1XQ1A 3TB4A 3ZYCA 1WDMA 2Y1FA 4CL8A 2BM0A 1UWCA 3DNFA 1RNLA 5A5FA 2LD4A 4DF3A 1Q20A 3O4HA 3AF2A 1M8KA 4UMVA 2PGLA 4CL0A 5C3MA 3H87A 4ENWA 5I47A 5AI4A 3WLTA 1R12A 2BEUB 3B6JA 3OC6A 3TKYA 4JP5A 3C3CA 4O8CA 3I23A 5AO9A 5KOHB 1UZAA 3NG1A 1WXXA 1E1CB 1G3QA 3GL9A 1CPYA 4BX3A 5JYDA 1EFTA 4LISA 2ZSFA 1JXAA 1GZHB 5LA6A 3UHOA 5JYBA 1JDSA 1OZGA 1BCSA 2PYDA 4RKWA 3A1CA 5ECYA 3VPGA 4AXBA 4B2YA 1LY1A 4D0NA 4C4OA 1SFRA 4BQPA 4D3XA 1DQNA 4BJHB 1DDGA 5L4NA 2P6RA 2QRLA 3VX4A 3ZWBA 4DJTA 4Q1EA 2HQBA 2PNFA 1TZCA 4NECA 2QRNA 4KZKA 4DLKA 3KQHA 4Q1CA 4OYLA 3PCXA 5ALNA 2NVOA 1OBVA 1G38A 3MILA 4HEA1 2ECOA 1L8LA 2C7RA 3RW9A 1N6OA 1R8YA 4BKMA 2BTEA 3AKEA 4AI6A 2LP4Y 1PTKA 4CM1A 4I1SA 4JDUA 3WHIA 3SMQA 1GTJ1 3B2QA 2X0FA 4XRRA 3FCSB 2R6CA 4U6NA 4IIEA 1M2FA 2JAOA 1TI7A 3HBMA 3TYXA 2BGTA 4CL2A 3DT9A 1UDWA 3CBQA 3MXOA 2Y8EA 3KB6A 3SFZA 3V1UA 5JHGB 3CRQA 1H0RA 3KZKA 3EEBA 3EG5A 2D3WA 1RFGE 2YCBA 3UG6A 3HO1A 4DWJA 2GHQA 1UPTA 2OXEA 4LDQA 1IY8A 1QKIA 2AR7A 2X40A 2HRBA 1H5NA 3HA2A 4KGXA 3U56A 2DLDA 2Q0QA 2Q9AA 3ZBPA 2BSAA 4FOTA 4OHVA 4X20A 4X91A 3W2EA 6REQB 2Y05A 4WGGA 5CRIA 4DKXA 3O84A 3HLTA 1L5WA 1A4RA 3W9YA 4DDWA 2EW8A 3TVDA 1NX9A 3RQIA 3QU7A 2FN8A 2XB6A 4M4PA 5KSOA 5LD2C 2PSSA 2C99A 3JQCA 3KAJA 5AUQA 3HP4A 3ICWA 1UP4A 3QMWA 4Q19A 4QFMA 3HV2A 3K0SA 4K6FA 4YCLA 4YIHA 4UAVA 4LJSA 4XDGA 1Z8NA 4IF4A 2WC1A 5DV9A 5HF9A 4N8SA 1VRVA 1S1MA 2VLIA 4M0UA 1Z7GA 4MVJH 4XQ9A 3VH3A 4EYSA 2I7CA 3AIMA 4J0CA 2EP7A 5DI3B 1GRRA 1AQ6A 5FH9A 4U00A 3KLMX 1RQ7A 5CA1A 3CB4A 4QGGA 4HGNA 1UBLS 3ET4A 4CYMA 3P2YA 1UWKA 4JXJA 1B6TA 3HFRA 1JB1A 3BRWD 2YYZA 4DTIA 2FMXA 1YJAA 3BFJA 4AP5A 5AUOB 1QQ7A 2VHQA 4LJ6A 2ZI7A 5DCYA 3A06A 5TRTA 1TT5A 1JR6A 5I8PA 1OXSC 1UBOS 3ZEAA 1DEOA 4NCXA 1GLVA 3V8VA 1UEJA 3SI7A 2EF1A 5BMVB 1OWMA 5IRCD 1E2KA 4C88A 2OGTA 3T5PA 2E21A 4PHHA 1LBSA 1N2BA 1I0LA 5ALFA 3OEEA 3MJCA 2XGJA 3K92A 4LWQA 2ZI5A 4ZU6X 2QYOA 3FLBA 2YN0A 3PNBA 4JBIA 1E79A 4QHYA 1JTVA 1ZCFA 1XEAA 3PUYA 1DBIA 1E1YA 1GA1A 2JVIA 3OQHA 4L3OA 1P39A 5IJ0A 1KOFA 2B6HA 1B6RA 4F2DA 4J49A 2HNAA 2N9UA 3SF8B 3MD0A 1F4LA 4LX0A 1RHUA 3PQEA 4LJ7A 1AK1A 4CIWA 4MW1A 1IBLB 4CF3A 1CR2A 1SY7A 1XN4A 2FWJA 2CXTA 5B1HA 2R62A 4FLFA 4E12A 1KOLA 2A59A 1U1IA 2ZB8A 1Z5ZA 5CB4B 4HS9A 2GNOA 4DGQA 1XEFA 5EMMA 1CQZA 1U2SA 3CPSA 1MH1A 4MUMA 4OEHA 4P34A 3TNJA 4V1CA 1FX0B 1R0YA 1ULAA 3IUPA 4E4TA 4EPTA 1TEZA 3DAFA 4HATA 1BE8A 1IYZA 3N8NA 4PLVA 3O7WA 4ITUA 4M22A 3E27A 1MUUA 2Q6LA 3PNKA 2DBVO 4WOKA 4EPXA 4FGKA 2Z95A 3FOWA 2WG0A 3W6PA 4EF4A 1DAIA 1K1EA 4Q93A 2QTNA 4L16A 3OMWA 4WY2A 4CN8A 5ITVA 4FEYA 2NVUB 1DCMA 1N5JA 2JHCA 3M83A 3CT4A 4NFYA 4CNQA 2A9QA 1N1MA 3OE4A 1HQDA 2WWTA 4QO8A 1U3VA 1HGXA 4QSMA 4JCOA 2QVBA 2VZEA 5EHIA 5BUSA 3GP8A 5ES3A 2QT1A 3ZY3A 5ALUA 2AEJA 1HDOA 2NO7A 3O91A 2QTBA 3NDIA 1YUMA 1T0PA 2QK4A 2QN9A 2XE4A 3KUXA 3P0JA 5DBEX 4ARUA 2PKWA 5C7IO 4YMLA 1M7HA 4DC1A 1C50A 2DFDA 2OGWA 3JAMA 4CBVA 5FO1A 5I5EA 2ADOA 3GV0A 4TOIA 4Q9LA 4E15A 3Q2OA 1ECJA 2PT7A 3GPCA 3JAWB 5JANA 3PJRA 3Q5DA 1C3EA 3L7OA 4C7KA 1CRPA 2KE5A 1YR3A 3OP1A 2WJVA 3MWEA 3ND9A 3DO6A 1PZEA 5B58C 3W4JA 5BQFA 1L4GA 4H0FA 1I14A 3CLRD 4LDJA 4F1JA 6PFKA 1D8AA 4LF8B 1KPHA 4M1KA 2VCEA 3SQXA 1T5LA 5UKDA 1LK7A 3QKTA 4MPPA 4C0AC 4EMBA 1CR6A 1UXHA 2Q7XA 4UDOA 4WV3A 3ZTWA 4D9HA 2AC7A 2R4UA 4ISCA 4P7KA 1KS9A 5JT1A 2J0UB 7AT1A 2BEVA 2YMQA 4U2BA 4F4FA 3BCSA 3PPXA 4P53A 1AMOA 1ZITA 4UQLA 2X77A 4URUR 1KYVA 2XRFA 3IP7A 1NVTA 1DKRA 2YW2A 3FPAA 3QVLA 4QQKA 2UZAA 4WACA 1D1TA 3UK6A 1GUZA 3GUUA 4ADSG 4BNNA 4KDFA 4LRXA 4OQMA 1T4CB 1ZXXA 4RVSA 4E5SA 1MB4A 3H9CA 4X24A 1GSIA 4CT0A 1S01A 3MXTA 4HRYA 5L95A 1QVZA 1DEKA 4OQXA 2ZWMA 1N8NA 3HJGA 3GZJA 3NORA 1CULC 2G8LA 3EYAA 2NAFA 4AXXA 1T1GA 5D7NA 1DQRA 1Z16A 2WTXA 3N6RA 1Z4PX 3H17A 4HGOA 4LNHA 4RAOA 2YHIA 1JR3D 1MLDA 4M53A 3JASA 4G0WA 3P2MA 3IKTA 2XB9A 3GVCA 4E1AA 1G6OA 5BNZA 2FPPA 1C5KA 1XTVA 5CHEA 1VIVA 1ZGJA 4GM4A 4WT7A 4G1CA 3TOXA 3ZDRA 2P9EA 3L6CA 3VJKA 4WW0A 3ZDBA 3FDIA 4BVGA 4FHDA 1AQJA 5CX1A 4C5BA 4L0QA 2XB2A 4B17A 4P3YA 2BGJA 1LRJA 1DFHA 3EPLA 4IGEA 3SKXA 3FJYA 1R27A 3QI7A 4FSHA 3EEYA 4EX7A 5LKRA 2R66A 2BELA 4C7MA 4URFA 1Z33A 3NB0A 2PVPA 4WXHA 4K2AA 2DX7A 1QIJA 2FEAA 1VL6A 2PR2A 3DB1A 3M6UA 3PEVA 5DE3A 4ID3A 4ZEOA 1ZD8A 3R20A 2IV7A 1AOXA 2FZVA 2WWGA 3M34A 4ALKA 1F14A 3G1UA 4LK2A 2WU3A 4DLSA 3A4YA 4GE0A 4PFKA 1IXKA 1ENZA 1NQWA 3LDFA 1F8UA 4PYKA 1Z17A 3W7AA 2AEMA 4CN9A 4Z53A 4NH4A 5TNXA 4D5GA 3ENKA 3V2HA 3F7OA 4HV4A 3RD5A 2ABWA 3AJEA 1RPJA 1WXDA 2QYSA 2FSPA 2H2HA 5FLKA 2C1XA 5L9AA 2L2QA 1P9LA 4PU0A 3CH7A 4ZQGA 4GLOA 3H5LA 1C9NA 4KNWA 2B4YA 2BP7A 4MRMB 4B7UA 1LXCA 1Z6GA 3DMFA 1JR3A 1E20A 1QSGA 1RBQA 1YZTA 4S1VA 3SBDA 4RZHA 2QX9A 1G21B 4X94A 1HORA 3WGHA 5H4GA 3I9JA 4G4SP 3TSZA 3ZD9A 3DNPA 1NWHA 4JVNA 5F77A 2CE7A 2CNDA 1Y5IA 5IKEA 4F3TA 1P2DA 5CJPA 1EBFA 4HWPA 1RLTA 5A9SB 4DMUB 5J4LA 3KOXA 2VPZA 2ZTSA 5JSQA 5C32A 4FILA 4KXXA 3I73A 1P77A 5KYUA 2YVLA 3Q0EA 3U17A 2ZB3A 4J7XA 1X70A 1ZNZA 1CFJA 2AXEA 2PYZA 4RS4A 1KAMA 2WJYA 4KAJA 3DBLA 4QOSA 3EIUA 1SIBE 3DZJA 5IDXA 9GPBA 1NVXQ 1SD1A 1A5BB 2XJ4A 4LV6A 4IEFB 4UM5A 1SJ9A 3DJYA 1GZSA 1SOAA 3DKRA 4GF5A 1RZRD 5EJ9A 3A11A 3KD3A 4ZVQA 3JZDA 4YV7A 2A1UA 3N0WA 3E1GA 1RP7A 2GLTA 5HUHA 2CB0A 1M6WA 1Z25A 2HNBA 2LR0A 3OIVA 2A5FA 4UPEA 5K45A 3IUEA 2CNOA 2X10A 1FCJA 5GONB 3RYHA 1K2WA 3EIFA 1EFPB 4E7OA 2D0PB 4ZRDA 1XA0A 2ZRPA 3KXIA 3NPAA 3AP3A 1F5SA 4TV9F 3CO0S 4KFUA 5LP6B 3LD9A 3UIEA 2VK4A 1SKUA 1W93A 4LHVA 4NENB 4RPLA 4DGSA 4CIYA 5K3EA 3DEJA 5ADHA 4YAWA 1YJXA 4EMSA 2YFHA 1O96B 2IEZA 3D8SA 3OWOA 3VPAA 3C6ZA 3E15A 3A1FA 3E4DA 5CW2A 2DCMA 1MC4A 4AF7A 3WGVA 4LXQA 2PT9A 1PFGA 2A9VA 1UMDA 2H4WA 3U7RA 1SAYA 1KO7A 1GDDA 1E7QA 1NVWQ 5DGXA 4X61A 4F5ZA 2PX2A 1SUWA 2UYGA 5U9CA 2QTVA 2W6CX 1GA6A 1MHTA 3VGJA 1E2LA 1MZPA 1C81A 1HK7A 1EE1A 1ZL0A 2XDWA 1ZO8A 2WD7A 2XXJA 2C0PA 2W43A 2YOFA 3HDYA 3I6ZA 3QITA 3JARB 4ZYLA 1ZHOA 1N0IA 3QPVA 4P4LA 1ODSA 1QDLB 2JAWA 3CRZA 3BVPA 2YJTD 2AFVA 5FTWA 3ZE6A 3FHJA 4E5DA 1VGRA 1FYEA 5IJXA 4B3IA 4MUJA 5E9JA 3KB8A 1RZRA 4L6IA 3K53A 5AJVB 4D2IA 1TF5A 1ECCA 3PC7A 1W7AA 1QM5A 3HUTA 5DVZA 1CYEA 1AXGA 1RP1A 1J70A 1D7OA 2GNPA 3I52A 1P4RA 2GPJA 2P69A 2ZRLA 4IYRA 4RQTA 3HKBA 4DQKA 4C6HA 3K15A 3TLMA 3V5NA 3W7VA 3WWZA 4AC9A 1FQWA 1S4QA 2AOVA 4HN2A 2V98A 4MVYA 2D1FA 4NZMA 4RF5A 2P7IA 1N3IA 2JHPA 2PO5A 1IWPB 1XP5A 2R85A 2V5VA 4O08A 4F92B 2ZRIA 1E58A 3THRA 2QUBA 1XB2A 1NG1A 1GG5A 1PNTA 2AI1A 2J3JA 3RARA 3B70A 4IRMA 1GKIA 1Q57A 1XZ8A 1YSCA 1Z6QA 2OLEA 4UOEA 5CITA 3IEMA 2CWDA 1NE7A 2P35A 4HQRA 4GFDA 1NPYA 4LK3A 1OQAA 5EJ4A 1YA6A 1GZ6A 4F72A 3JD0A 4AY6A 5AYVA 1GPNA 2AUNA 16PKA 1TKAA 1VECA 2G5TA 3EXG1 4MTCA 4HEJA 4UUMA 2IIBA 3RR2A 2YNMC 3V7WA 4YRKA 2EVWX 4H6XA 4L7QA 4QVIA 1IJFA 1Y80A 1ZQ9A 2CLIB 3E22A 5CXQA 2JFBA 1D4ZA 1KH3A 2JFGA 1EK0A 2GSDA 2R4QA 4LMPA 4WGFA 3V48A 5TMBA 2BMWA 1AKTA 2EP5A 2GD2A 3I8OA 1QHNA 4ZI5A 1P74A 3MAAC 3H6HA 1G4HA 2EZUA 1MHPA 5BXQC 1XK7A 3GMIA 1E9DA 1OLUB 3BG5A 3IAHA 3DUFA 3EEOA 2HGZA 3L5KA 4KBFA 2QNRA 4QYXA 2JRLA 3FUXA 3AEKA 3CSUA 3ZDAA 3THWA 3C3DA 2QN7A 3WKBA 3BXPA 3IALA 1JIUA 1CEXA 2RH8A 2DYKA 1NQVA 3DAYA 3UANA 2ZJ8A 2YHAA 4WUTA 3V8EA 4KQ1A 4JEIA 3ZY2A 1XXLA 3PQ2A 4Q18A 3VAAA 3KE8A 4AMVA 2VYCA 5KQSA 1WULS 3H8SA 4XM0A 2PUTA 1O8CA 1UMCA 1W8IA 4WASA 1U9IC 1SH7A 3LVBA 5BXYA 3P9SA 4IEIA 3FD8A 4RVFA 1VLQA 2IOQA 1E2NA 1YR7A 1V8ZA 3M1IA 2WM3A 1I9CA 3PTAA 1PZGA 2HDWA 2DSNA 3MMXA 2Q5IA 2HCJB 3IUQA 4TWBA 2PMCA 3KC2A 3M2TA 1XTIA 4FFVA 1ZUNA 3C8DA 4MH0R 1NT4A 3B1KA 2PIDA 4TMZA 2P75A 2VHZA 5KIAA 1UFQA 1X3SA 4B6GA 3UPUA 3RQSA 3TAXA 1X7ZB 3CUKA 4FHCA 4XSVA 1HI9A 3GIWA 4R8LA 5FI1B 2VJKA 3HRHA 5KTRA 3IAAA 1XFDA 4JKIA 1ZVQA 3OZEA 5JCXA 5LMNB 1QBGA 4UXJA 5L7WA 1YB5A 3CNEA 4XH9B 3WL6A 1X6VA 4GGOA 4QJBA 4F9EA 3NXSA 4GP6A 4XQ0A 3JQDA 3EQ9A 3MCTA 4V1CI 1DPFA 1YI0A 2B9EA 4KVZA 1PR5A 3IE2A 1VP3A 1TMGE 4PC7A 1ZVMA 3AR8A 3AWDA 2PUVA 4EWLA 2CXNA 4EFLA 3OT4A 3ZH2A 3PUHA 4B8WA 1F6DA 1RACA 1YL6A 1X9GA 2GD0A 2J6HA 2W2KA 4UBJA 1B15A 1JVSA 3EDCA 1KSGA 4I55F 1KO8A 3U3KA 3W9SA 1C1YA 2QNIA 1GL3A 4LFCB 1ZSVA 1UBNA 3KVNA 4H1TA 2CXQA 1XXHE 3OIYA 4L8YA 1PZFA 2YWEA 5TARA 1X7HA 3DWIA 2CHFA 4V3CA 4R54A 5KJCA 1AHIA 1M34E 1OXUA 1ISHA 3LUGA 5DP2A 3VPFA 2Q0SA 1KY4A 2DSTA 1K5GA 2G9QA 1E0JA 2JFWA 3D0OA 3KTAB 1JIKA 1XELA 3COSA 2DM6A 3PFCA 2DKFA 1E77A 4CKWB 3TQTA 4V0RA 3R9XB 1GLNA 5HIIA 2EX1A 2IZOA 1TVKB 2OQRA 3AEQA 3LZ6A 3GLVA 2EV9A 4TTTS 1L7EA 1NOJA 3GBPA 1L5FA 1DRKA 2E2WA 3JD4A 3I39X 4ZMRA 3TPCA 3PCRB 3R6WA 1DE0A 2R6AA 5CVUA 5BO5A 2OBFA 2HA5A 4OXXA 2ZIAA 1NDHA 4ZDKA 1LZLA 1XBTA 2NX2A 4NF2A 4YRLA 4CG3A 3I9V6 3AESA 3T9FA 3U61B 3ADPA 3GLKA 4MXWR 3NM6B 2AB0A 4PAQA 1S7CA 2QL9A 4MMYB 4V0KA 3UKDA 3CRW1 2PSFA 5E9AA 4EUFA 3VGPA 1TT7A 3UCEA 1ISGA 3HVIA 3HJNA 4KU4A 2O8BA 2ORED 5AUPB 4U7DA 4X3OA 3INTA 4J4BA 2WFZA 3A25A 4XUEA 2BAGA 2G8NA 3P71T 2V7WA 3G82C 3UH1A 2XCQA 2FLWA 3GJTA 4IQGA 4EUHA 1C1XA 3NVMB 1V5EA 2YIJA 3HSKA 3EQ2A 4Y2RA 4RMHA 1Q1ZA 3GRFA 1JJVA 1WP9A 1O97C 2JD0A 4DYDA 2WFLB 2RB5A 4QHSA 3OZIA 2UXCB 4JQCA 5D00A 3KSUA 4BNLA 1J56A 3LIPA 4UAGA 1EM8B 1C7EA 1YZHA 2WFAA 2WHEA 4B80A 1FLVA 2QWXA 3OZ7A 5JD6A 2KQUA 3FNBA 3WYDA 4AF6A 4PHGA 2ZRMA 2Q28A 3PT5A 3GCWA 2BFCB 2FU5C 4PYRA 3WISA 4OYYA 1P3JA 3WLEA 5K01A 1OXXK 2XEXA 1HZJA 4KW7A 2B9VA 5ITZA 1QK3A 3Q5GA 2GRUA 3KRTA 3DPIA 4BMPB 4CM7A 1J39A 2EWWA 4F46A 3D4BA 1P1BA 4MPRA 4YO8A 5BP7A 3TCXB 2QTLA 5AIAA 4IWYA 4TL6A 3W77A 1EGHA 3T12A 2C29D 2Q27A 1S3SA 2AYZA 2PMBA 1VCMA 3KB2A 3Q3EA 3QOWA 4ZAYA 1OROA 5CFPA 3LVQE 3KS9A 5DN6D 2HZBA 3ZZMA 3U7GA 2H1WA 4LF4B 2OO3A 3MIIA 4F5WA 1GFZA 4ABTA 4PRKA 5C1PA 5LNK6 1O1YA 3VJLA 1TMKA 2ONJA 1YZYA 721PA 1A9TA 4B31A 1X7YB 1YBMA 3TNFA 2BSQA 2HD4A 2IHUA 3KOZA 2YJ3A 4FDMA 1WBDA 1I6WA 1HM5A 3VC2A 4NEHB 4DLVA 1S96A 4G84A 3EF1A 3GWZA 2A5LA 1Z2OX 2QPAA 2ZUSA 4LF6B 1QO9A 3FGNA 3H2GA 3PWTA 1BIFA 5J63A 4BO2A 1P1RA 4JR1A 2J9RA 3TZKA 2HV8A 3D3EA 4TUYB 5JC8A 1TRHA 2V6JA 5IMBA 4RTOA 1UOPA 3AJDA 1U2GC 2VA9A 4N5NA 4UM8B 2VPTA 4J90A 1QONA 3R6DA 2FH5B 3CYFA 4K0RA 2AZDA 2C8JA 3IIJA 2PTHA 1WR8A 4KVFA 4MYSA 5SY4A 3SLGA 4TKVA 3GK3A 2EBUA 3QLJA 4YCCA 2D5IA 3TTTA 3TF5A 2PX3A 2A0FA 4JZYA 3GT3A 1ND6A 2FOXA 2W71A 5J1SB 3LUBA 4BP8A 2Q2VA 4DJFC 1CUSA 2XCTB 4Q7MB 4KYVA 4Z7NB 1RW4A 1HZZC 4HB2A 1FRFS 1AS2A 2I4OA 4Z6KA 5IXSA 4XB2A 1U5BA 2XXAB 2D3TA 2GN0A 2JA2A 3NOVA 2C7QA 1NNEA 4DSNA 4Z51A 2GZMA 1VCOA 4G2TA 3G68A 1V7QA 1DU4A 1AHNA 4TV9A 4DA6A 4DREA 2UXBB 3JZAA 2P6NA 1KP3A 1YONA 5DN9A 1RHQA 3U6KA 5BR8B 1W5AA 4DV6B 5A5GA 1HG0A 1FSGA 5DMXA 5PGMA 2FPWA 2Q3JA 4C1BA 1E5LA 2JLCA 4DT1A 4ND6A 1XF1A 1X1AA 2PQMA 3MCZA 4NBUA 5FLXA 1V7ZA 4F2GA 4N6OA 4OQYA 5DN6A 1RYHA 3GUVA 4NZOA 2FPIA 2K4MA 2BFFA 3FKSD 1NE2A 4F04A 4EYKA 3UZUA 1E2EA 3FETA 1XP8A 3NFYA 4UBOA 5FTMA 1WKCA 2QIOA 1C7JA 1KY2A 1RAAA 4YJKA 2WHRA 1QYVA 1TUGA 2IGBA 2OAQ1 1GR0A 2LRHA 4LTDA 3T3DA 2YIVX 1LKZA 2Q7OE 3ZU2A 2Q99A 1WZCA 3W9UA 4EL0A 1KEKA 4Q37A 2J9YB 1PFKA 1PZNA 3O6VA 4EJSC 5CB8A 1H4QA 5BVGB 2E49A 4G0NA 3EHDA 4A2WA 1ELOA 3JRNA 4OP3A 2WZQA 3OHPA 4S12A 1LI4A 1W88A 2H9AA 3LCUA 4HMQA 5TB5A 3SHVA 3W4KA 3AKCA 1UZMA 4WL0A 5HRUA 3BULA 1JECA 5JMPA 3TZQA 3HYCA 3G7UA 1KEPA 1OFHA 1M8FA 2Z09A 3SC2A 1ZN7A 2NNLD 3UMSA 1TPYA 1Z88A 3U7QB 4W1SA 2B5WA 1OGJA 1PJSA 2BGMA 5J4YA 2OT3B 4INJA 2FE4A 2B1GA 1TJPB 3QTTA 3TLAA 4C0SA 4MIYA 4BMSA 3AFNA 3HBAA 3A4MA 3HYLA 4I1IA 2YVQA 4V24A 2G76A 4AJJA 1UWLA 1XU4A 3PQ3A 4XM2A 3QH4A 2KLBA 2EQBA 3OPVA 3A28A 3PKJA 2P4UA 4LBZA 1Y8AA 5JQGF 1X92A 1ID8A 3C14C 4PZ9A 1P75A 4R1SA 4B9EA 3I9MA 2X2FA 1XTPA 3RDPA 4XARA 4JJZA 5CBKA 4LAFA 2YQ5A 5IJ9B 3BZBA 1Z5NA 1A9YA 3D8UA 4RM2A 3RUPA 3EPJA 3FKSA 3U09A 4P8RA 2J5KA 4ZTZB 3R1IA 2GBLA 2XMSA 3CSSA 2CFRA 2Y1OA 3GLHA 4NMXB 4RPKA 5JCZA 1QGUB 2P2ZA 5TGTA 3KXKA 3I42A 4JEHA 1I30A 4LOKA 4MQ6A 2JNWA 2ZRNA 1U7TA 3V42A 1ST2A 1BHJA 1CR4A 4QJ4A 2PUCA 4U5QA 4QIHA 3D5EA 3GD5A 4CV1A 5BQ3A 1B8PA 4RL6A 4CLOB 4ZVKA 2C0CA 2AS0A 4LVNA 1P19A 1JAZA 3CGGA 3VDXA 5BNFA 1MX1A 3QXJA 3ZTTA 1DP4A 4LY0A 4RSHA 3D81A 3ZLUA 4DY6A 4DEVA 3PDUA 2CEAA 3I09A 1JPJA 4BLUA 1E0KA 1X1EA 2JGFA 2YZNA 5BSEA 1US8B 4RA6A 3U40A 2XCSB 3ELDA 3FTQA 2G70A 3RRJA 2BTQA 2AG1A 6GPBA 3WXMA 1C7FA 3ZCXA 5K99A 1HTWA 1SXJC 4QG7A 2QUJA 2ZQZA 2WHPB 3NLLA 4TYYA 2PR7A 2R1TA 2OV3A 3VSEA 1D2AA 1TF7A 3FPGA 4QELA 3OAAD 1ENOA 2FLKA 3EXFB 4LRSB 4NS1A 5CX4A 4K9DA 1J42A 2FW1A 5A06A 3FTPA 1L5LA 5J47A 1CIVA 3T34A 1GPLA 4MGKR 1Y1KE 5BQ5A 3KJIA 4MWTA 4D82A 4JLBA 2QUIA 3PJEA 2AHOA 3T3IA 3L02A 3LGSA 2ZS7A 1P5RA 2X22A 3QXHA 4DYHA 4YRJA 2ZU6A 1GAXA 3MJTA 4BMCA 2VJMB 4EO4A 3I5AA 1L4EA 2D2IA 2QPLA 2Z5FA 4J07A 1AS3A 1GUAA 2CNLA 3QF4A 4MV7A 4AULA 4CMKA 4FWIB 2A7XA 3WJ1A 1K7FB 4YWHA 2NO9A 5IK2D 5LFAA 2VSNA 1ORVA 2IW1A 1CUGA 2C4UA 1NZJA 2LKCA 3HRIA 3ROKA 2B3TA 1VE1A 3C3JA 1LEHA 5JBQA 1QQ6A 2XVZA 4J6FA 3I1YA 5WRFA 3U3OA 4LXXA 3QI2A 3DP7A 1J0DA 1II8B 3LY5A 4TVBA 1IAQA 3VOSA 4C30A 4NJEB 1MEEA 1Z2AA 2JCBA 1BHQ1 3EVBA 2BVNA 1NSTA 3GFPA 3NC0C 4JASB 3KQPA 1Y0BA 4FW9A 4RH3A 3V1YA 2Q3FA 5G2OA 2ZYRA 2AMFA 1DUIA 2ZIUB 3V33A 4O4HA 4TYMA 5CIRE 1P0MA 3AP1A 3HLKA 3KYDA 2ZSKA 3WHKA 4UM9B 3I5YA 1YR8A 5C8YF 1Z35A 3JQ7B 2FRXA 1YFZA 2EEZA 3IC5A 4QXMA 3RK4A 1EP9A 1BWRA 2IBTA 2JI4A 2C7OA 1N1GA 2C5BA 2KBEA 2ZZKA 5AVJA 1CX9B 3LNCA 1JA0A 3P9RA 5T4HA 4B82A 5LQDA 3WQSB 4AT1A 3FTEA 3OAAA 1REQA 4HRAA 5E9WA 5DNCA 5KVSA 3QFRA 1WVIA 3C1UA 2PS9A 1QG0A 3ZWWA 4W5OA 2V7UA 1C2YA 2UVDA 3T7SA 2Q5HA 4ML3A 4DHWA 2CVQA 3M4JA 4W7SA 5T67A 4JI3B 2O8EB 2O8NA 5F5LA 4BMNA 3PVCA 3FY4A 3LKVA 5A3QA 3K6SB 3H1PA 2NWQA 3K6RA 4NNPA 4LMRA 5DNVA 1HNWB 2O2EA 3I6MA 3OQIA 1CS4C 2MSNA 2WUWE 3H6KA 3UOGA 4EGJA 1ZN2A 3KWJA 4RYLA 5D5PA 2NT4A 2XUIA 2EX0A 5E6UA 3ZDEA 2GEFA 2V7PA 3G6KA 1ZU4A 4TT3A 2FMIA 3LAWA 1JIXA 3R0VA 2AWOA 3LKZA 1XTUA 4GI2A 5DYWA 3I6YA 1C14A 3AUUA 1IEQA 2VQ3A 1VBNA 4BASA 2TMYA 1ADCA 4JUBA 2EZ4A 4C4SA 1PRYA 3B9BA 3LX5A 1XK6A 5JVDB 1WMFA 4TWZA 2C4MA 5COBA 3VO8A 3HYTA 2J41A 5KUTA 5KNCH 5L45A 3RFVA 2QDKA 1NZDA 1R88A 3ANSA 3D4LA 1J0CA 4RZ2A 3WRXA 2Y1WA 5KOJB 4LRQA 3HCRA 2I78A 4OREX 1GGVA 5JCOC 2P68A 4FK8A 5B6JA 4BNDB 3N2EA 3O2QB 4MZXA 4RMGA 3T54A 5C52B 2X0KA 1Y8QB 3ZWAA 1QYXA 2Q46A 3IGFA 4P86A 4WHMA 2WF8A 1VMDA 3ZXIA 2IYOA 4YUWA 4A15A 2O1XA 1VQ1A 2O1SA 1RXIA 4ROSA 4S35A 2GWHA 4MLZA 4TVSA 2DXIA 5ECWA 4JI2B 1NKSA 1J8FA 1ADFA 1QG6A 1U0EA 4RABA 3UPTA 1KU6A 4IH1A 2EKZA 1GKUB 4N7MA 3LX4A 4XWOA 1XRMA 3NAZA 4ZCPA 3DBRB 2GHTA 1OLXA 5JDCA 1S4MA 4IHJB 3IEUA 4G4SO 5DWDA 4PGMA 2WQZA 4LI3X 1EVKA 1P80A 3D8BA 4INPA 4EFNA 1QRAA 2IHVA 3DTVB 4RHYA 4BBAA 1KTIA 1SUSA 4YCMA 3N2GA 3QF7A 2MIIA 4JHLA 4KIFA 4DQLA 2JJMA 3FPHA 3OPXA 5I45A 3SLKA 1Q74A 4GX5A 2B7LA 2OG1A 4LYAA 5JY6A 1WCV1 2XBMA 4BJ3A 2HA2A 4N3AA 4P36A 1BDJA 1RI1A 1YS7A 4HQ0A 4BNVA 4AY3A 3RUIA 3Q3VA 5HKLA 5A3VA 2FA9A 4WK0B 3C0KA 1CS0A 5CP8A 3FUWA 3L3BA 1XNHA 1V8DA 4F0JA 1XLVA 2B7BA 2NXNA 4EFMA 4Y1RA 1JDVA 3L7LA 3V7UA 5B7NA 4BC1A 3UT5A 1TYAE 5AM3A 4C87A 3FPBA 5E6RA 4LQDA 4G5HA 1EWVA 5FI5A 1GITA 1UINA 2NUAA 2H4YA 4W8HA 3E23A 2A5YB 2O8CB 2DQSA 3HH8A 3T3MB 2FWAA 2XZPA 4EB6A 3OESA 4GLFA 5TY0A 1QQTA 1L7PA 3Q40A 3V9PA 2NZYA 3MIZA 4XPZA 2E6UX 5KWIA 4ZAFA 5DM60 4CI9A 2HTFA 2P5UA 2RGWA 4BPRA 4C3VA 5LZ4A 4M1TA 1LPOA 2WFMA 4NZ9A 1U4SA 4M6WA 2F8MA 2G08A 3Q5EA 4FTWA 5K0SA 2ZUVA 4QJ3A 2GLXA 2X8JA 3GCZA 1WF3A 5JO0A 3LGXA 4XTCS 4O3FA 4RIEA 1K8QA 2E4YA 2WA1A 3UATA 4LBWA 2WDPA 3UJHA 4ZZ3A 5KWVA 4IFTA 4M87A 2B30A 1GTRA 3P9KA 1WL8A 2IS6A 1TQDA 1TO2E 1DUVG 1NP6A 1EP1B 1QV6A 2W22A 3NOXA 1M9NA 3LSTA 3L01A 3KDPA 3ZCTA 3LW8A 3L41A 1AMNA 2J85A 1EMDA 2QBYB 2QJRA 3TLCA 1YDMA 2I7DA 3T1QA 4G09A 1N1EA 5AHKA 4OB6A 4FKZA 3ZJ5A 1XNQB 2GBGA 1V9LA 3MNFA 2ZR7A 3HWRA 2ZP1A 1RU3A 4NG4A 1L5RA 1SZCA 1T9ZA 1H22A 1R4MA 4GI3A 5E1BA 1N4AA 2WM8A 4AP9A 4MLDA 4Y2SA 4YHHB 2VT7A 1FFGA 2O6LA 3S2ZA 1T3LA 2AI3A 1XMXA 2UYOA 1G2PA 1BKYA 3LUAA 3DJFA 3MWLA 3TK1A 2FF7A 4G07A 5JJIA 4AJPA 1EFHA 2MYUA 3JCZA 1KC3A 3RVKA 5J59A 4B7AA 5I7HA 3HVJA 3GOHA 1WOYA 1LTQA 4UNQA 3B1ZA 3OTIA 4I1YA 1AE1A 5D3QA 2OCIA 1WDTA 2J30A 2V9ZA 4UTXA 4R7GA 3CNNA 1XKXA 2H7VA 2ZT6A 3E9YA 3FRHA 2G9VA 2HQSA 1HKHA 3F4BA 5TQ2B 3NBYC 4DKJA 5JPCA 1R2QA 3QK7A 3MRVA 2DMRA 4GOXA 4GPTA 1YDEA 1FFBA 2PTGA 4BNMA 3RSZA 5JQGA 2O5RA 1TTQB 2W8BA 3GYGA 3TBFA 3K9WA 2CC2A 2EBWA 3GHYA 3GJ3A 4YPOA 4LBVA 2HDHA 3RU7A 1C1DB 2WUVA 3T3HA 4AJHA 4TL8A 1NQAO 4WCVA 3NTUA 4XIIA 1SQFA 3AERB 3LTEA 4LQLA 5KYXB 5EQDA 2YDYA 3P0FA 4BO0A 3X1XA 5MFZA 2Z2IA 2IU0A 1J90A 2NG1A 3U19A 3FTNA 4HWSA 4DABA 2FN3A 4U3JA 4TZ0A 3QX3A 2HK7A 1H6DA 3H5OA 3KHKA 2ZIGA 4AM8A 1E2HA 1F2UA 2ZULA 4OHOA 5A05A 1AGYA 1A1SA 3AJRA 1RAGA 4BTLA 1OYWA 1ZNYA 1QP7A 1UJ2A 1HNNA 1E0SA 1PKXA 3BORA 5JZVA 1TLLA 4B74A 3BB4A 3MZ0A 1PT7A 4G0UA 1XDWA 3KVYA 2X4LA 2HQOA 2WAAA 3JZMA 1EDZA 3URMA 4Q12A 1YVEI 1JLSA 2CE2X 1TEXA 3EC2A 1YJQA 3K1AB 3GLIB 1G19A 2XMCA 2EFJA 5EOVA 4RKQA 5F52A 2TMKA 2Z6VA 4N65A 2F3QA 1Q0PA 3NYIA 2FG6C 4FR2A 1ZHHA 4ZFNA 1U9JA 4KOAA 5HWSA 3G2NA 3V8PA 1J2UA 1WW2A 3H5IA 3IUBA 4E1BA 1YR9A 4GDMA 4ZQCB 2RAUA 1AV6A 2VHTA 1AKNA 3HKEA 3P27A 4JA2A 2NUPB 4IDCA 4QQNA 5H8WA 2XNSA 2E3JA 1I10A 2C57A 2H63A 1NR5A 3QPAA 1P6XA 1TC2A 1V95A 1D4VA 1WKBA 2HGSA 2YWBA 4L1KA 4X92A 4YJ3B 5F3RA 4D3DA 4GLBA 3DSRA 2V7EA 4RPHA 5EXTA 3T5MA 5CBPB 1OH5A 2ZKLA 1R0ZA 4RV5A 1B26A 1WCXA 2X2OA 2H7YA 4M76B 4RIHA 1Z82A 2O5EA 1ECPA 4XDHA 2E55A 3ANLA 4PAWA 5JCJD 3HDHA 1NV8A 5JNVA 1ZKDA 2QI9C 1N7JA 5IYZF 1BA3A 3IBFA 3ICEA 1V26A 1YD7A 5IUJC 1N2ZA 5JZSA 4KG7A 1XHFA 1RWXA 1XZAA 3LMKA 4KIUA 4RETA 4CCYB 5F2OA 5EZ6B 3FVVA 4JDPA 3U13A 4GL2A 2PXXA 2HPHA 4NBRA 1I6KA 4QBFA 4UXHA 4WRRA 4DJJA 1K66A 5F23A 3K8YA 5B7QA 2YWRA 3KL4A 5ABPA 4WZAA 1TUEA 4ZU3A 4UE6A 3WP1B 1CJTC 1Z0DA 2H00A 3DZHA 3RAPR 2BE7A 3X44A 4JJKA 3CLTD 5C8YA 1U80A 5AW8A 1UWVA 4R0VA 3CLKA 3HB1A 2Z83A 3CLRC 1V3VA 2AE1A 2C8VA 4MAFA 2Z04A 1HRKA 1AB6A 3BGSA 3G2JA 4OY3A 1XZMA 3SQMA 5IHPA 1RJ9B 4WZ6A 5CNIA 1ZW1A 3TAUA 3ZI0A 3D3KA 3IAEA 4GIBA 2FF5A 1Z26A 3QHQA 2PSEA 3EN0A 1V8BA 2XVAA 5AM4A 3WDMA 3O38A 4DMLA 4ZCMA 1U3WA 3TJEF 1X0XA 4DMFA 3FLAA 1QS0A 4L4XA 4X1IA 2UUBB 2PKCA 2SKDA 1SVIA 4ACAA 2GCOA 4FU0A 3U3PA 1KGSA 2O2XA 3MQFA 4WOPA 4IXDA 3HL4A 2R6ZA 1XRRA 3G0IA 4Q3KA 3TOVA 3OHMA 4NDZA 3ER8A 3NONA 1TFUA 2RONA 3F90A 4DQUA 4GSKA 3DYIA 5KNBH 4L07A 4RH0A 1OTHA 5IDVA 1P2VA 2RIRA 1FFWA 3BD6A 2GSWA 4IL5A 5JCJA 3VTZA 3FR8A 3C4VA 3W5HA 5KYTA 3GBVA 2OFXA 5F7JA 3TDMA 1U0NA 1YJ8A 2JD1A 4LGCA 4P9NA 2AOXA 2F9LA 1CUYA 3NHWA 2WKQA 6AT1A 1UKZA 3ILSA 2QR5A 4O0MA 2PV0A 1SCUB 4HB4A 4ZZ2A 1NMYA 1KJ9A 2AMVA 1G9SA 4NPCA 1J0AA 1E60A 1BXKA 1GCOA 1LK5A 1VM6A 4ALIA 3ECCA 3UVEA 3BH7A 2ZPTX 5A7HA 5FNZA 2GFQA 5FI3A 5GV7A 2HU5A 1G21E 1FMJA 3GI1A 4A3SA 3MS7A 4YUZA 2IWRA 4FYJA 3THYB 1SVOA 1WQ1R 3QVOA 4AJ1A 2JC3A 4KC0A 3NO4A 5IFKA 3IVMA 4DUGD 1NPDA 3A31A 4D9IA 3LBNA 2GILA 3LG2A 4HDNA 1OFUX 2BM8A 2GT1A 1RLMA 1GKLA 2OO5A 4XYMA 3PNPA 1PJ4A 1PJ3A 1VJ5A 5G0VA 3CN9A 3I9FA 4HI0E 2GBPA 2VDWB 4PNHA 4MVCA 1KERA 2ZPUA 4R7TA 3IHKA 4DNPA 4Y2XA 1GTL1 1J9GA 2JAQA 1Z22A 3CCFA 4KACA 1EVJA 3QTLA 1FNBA 5FRDA 1JEYB 1IQRA 4HQFA 2ONYA 2ILVA 1ZNXA 4M9XA 3DS8A 4IQ0A 3DE7X 5A2QA 4DJAA 1Z62A 2WP0A 3RYTC 1MFPA 2H9GR 4YXFA 3ADOA 2A9KA 1BX3A 2B0CA 3U1TA 4CLRB 4YUAA 1K6JA 2YXEA 1V47A 1ZOPA 2C4NA 2JZCA 3LQ4A 4QVGA 1UQUA 3FSJX 4ZT4A 3PP8A 2IUFA 4UU7A 3WNVA 3O0TA