2E4UA

Crystal structure of the extracellular region of the group ii metabotropic glutamate receptor complexed with l-glutamate
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
538
structure length
512
Chain Sequence
RREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDNYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNICIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAANRVNASFTWVASDGWGAQESIVKGSEHVAYGAITLELASHPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQCSLQQVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPQTTKLCDAMKILDGKKLYKEYLLKIQFTAPFNPNKGADSIVKFDTFGDGMGRYNVFNLQQTGGKYSYLKVGHWAETLSLDVDSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYLVDEFTCMDCGPGQWPTADLSGCYNLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Metabotropic glutamate receptor 3
publication title Structures of the extracellular regions of the group II/III metabotropic glutamate receptors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 160
structure length 512
sequence length 538
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
A PF07562 NCD3G Nine Cysteines Domain of family 3 GPCR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.50.30 Mainly Beta Ribbon Tumor Necrosis Factor Receptor, subunit A; domain 2 Tumor Necrosis Factor Receptor, subunit A; domain 2 2e4uA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2e4uA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2e4uA01
2NT4A 4MR8A 2QW1A 1Z26A 4XASA 3JPYA 1PHRA 2V0NA 2WJWA 3OLWA 3HUUA 1PNTA 1CHNA 3GT7A 2QXYA 1RNLA 2FKAA 3CRNA 4MQFA 2VUIB 3EULA 2IKSA 3EAFA 4IGAA 5IUKC 1GCGA 4RV5A 4M88A 1USKA 5CNMA 3SNKA 4EYQA 4MS4B 3RVNA 9ABPA 1VLZA 1SRRA 3I09A 4F12A 3MIZA 4W5RA 3KLOA 4MR8B 2PUBA 2HQOA 3KS9A 3KHTA 3IPCA 3HDGA 4KQCA 2ID9A 1QMPA 4XLTA 4WUTA 3M9WA 2X7XA 4MQFB 5KQLA 2FMKA 1P6UA 4N0PA 1LJUA 5BQ3A 3IP5A 4RK4A 1QKKA 3E3MA 4YP9A 4XFKA 3HK2A 2FN8A 1CEYA 5HKOA 4G97A 1AB5A 2NZUG 2ZAYA 2PL9A 1JHZA 1QO0A 1U0SY 4G0QA 5KQGA 3MM4A 4MR9A 4Z99A 4MLDA 3H5OA 3DLHA 1U2QA 1JBEA 5HQJA 3IP7A 3DZDA 3OO0A 2PUGA 5FBKA 2JVKA 3H5TA 4LRQA 5JNVA 1QP4A 1WETA 2ID7A 1YTUA 2Q5CA 3ILHA 5JNRA 3O1JC 5B3JC 2MYTA 4W5NA 1DCKA 2GX6A 3DGEC 4YO7A 1E6KA 4OBBA 3CNBA 4ZJPA 2IPLA 1S8NA 3QLUC 1DRJA 4RY9A 1VRVA 3SY8A 1LBHA 3CG4A 4L4UA 4GNRA 4KQ9A 5EWMB 3TD9A 5DKFA 2FXIA 1TM2A 2I6FA 3Q41A 3QK7A 3H1FA 3LUFA 3RVPA 3E61A 1ISSA 2QVGA 3P9YA 3FFXA 1E6MA 3CG0A 4Q6BA 5BRJA 2FEKA 1PEAA 2QR3A 2IPMA 2R4QA 2JBAA 3MA0A 2FTKE 4D74A 2NZVG 1K66A 3TO5A 4D6XA 3LUDA 4G0XA 6ABPA 1TLFA 4P1ZA 4WZZA 4HNQA 2OENG 1MB3A 2IDMA 3HO1A 2GWRA 3UK0A 1JFTA 1M2FA 5CNIA 3MF4A 2FQYA 3JTEA 1ZGZA 5T3YA 4FE4A 3RVOA 3CZ5A 4KREA 2ZWMA 3NNNA 1BA2A 1NXVA 4H3HB 2HQBA 5IUNC 3O1HB 4LDAA 2IYNA 3EGCA 2GKGA 2JBAB 3GBPA 2WB4A 5IEBA 1NXWA 3H5IA 4Z0NA 3GV0A 1D1PA 1ZY2A 3BBLA 2IOYA 2KYRA 2R48A 3HVRA 3CKMA 2PLNA 3M6MD 2NT3A 4MRMA 3OM0A 3NBMA 2LPMA 3KYIB 4LE1A 2AYXA 4CBVA 3QLVA 2GBPA 3RVRA 1U04A 5DTEA 1GUBA 5CNKA 1NXOA 3HDVA 3IDOA 5JNUA 4KK4A 4MS1A 5TQ2A 4OTZA 2WJAA 3A0RB 3HXMA 1ZN2A 4YGXB 3C6QA 5HM6A 3Q15C 3H5WA 3MQ4A 3F6PA 4FB4A 5FWXA 3GL9A 3T6KA 1EAYA 4OLBA 1YK1A 4KFCA 2IPAB 5TPZA 4NICA 3KSMA 4MRMB 4PZ0A 4RS3A 3D02A 8ABPA 4YR7A 2WMYA 4KVFA 4RY8A 5D2CA 4RWEA 5ED4A 1KRXA 1DBQA 5FWYA 6CHYA 2FQWA 3OM1A 1L5YA 4RKQA 2PJUA 4KMRA 2L17A 5TQ2B 1USGA 4RK6A 3KTOA 2JB9A 4S05A 2LP4Y 1FFGA 3OMXA 4OG2A 1DCMA 1JDNA 1BDJA 4RK7A 4EYOA 5FWXB 2M98A 3MYYA 1RXIA 4ETNA 4WXMA 1Z16A 1YK0A 3HEBA 1JLKA 1ZITA 3GRCA 1RXEA 3QELB 4RK1A 3ROFA 4N03A 4Q6WA 4EYKA 1LJLA 3FGZA 1U2PA 5FWYB 1W25A 1GCAA 3FMVA 3O2QB 1DC7A 2E4VA 4QYMA 4EYGA 4MQEA 1H9CA 3T38A 4P98A 2VUHB 3SQNA 1D1QA 5BRAA 3H5LA 3RVKA 1Z17A 1URPA 2JRLA 3CZCA 5ABPA 3RQIA 3BILA 5KQMA 3L49A 3HM9A 1DZ3A 3LTEA 1A2OA 1ZGGA 5GOTA 2W42A 5TQJA 1JWLA 3CTPA 3B2NA 5TPWA 3CS3A 5IUJC 5IEJA 5TPZD 5CHYA 3UUGA 1YMUA 1U8TA 5JS2A 4GPAA 3ILYA 3LUHA 4MQEB 1C0EA 2IPNA 1DC8A 1F51E 2RDMA 4OATA 3OMWA 1JH9A 3C97A 3KYJB 3C3MA 1NXTA 4G0MA 4NV3A 1QPZA 3LOPA 5CNJA 2PL1A 2VYCA 4JP1A 4Y9TA 1EWKA 2CHEA 1YVUA 5TPWB 4RK5A 1D2AA 1NY5A 3N0XA 4MR7A 4JAVC 4MR9B 1M5UA 3HUTA 3FFTA 4EVRA 5EWJA 3BREA 5DGCA 5JNWA 3TB6A 2PUCA 2AYZA 3D8UA 1GUDA 3OQOA 1DCFA 2R47A 2HPHA 5IC5A 3OO1A 2FSPA 2L18A 2WY2D 1NXXA 1XHFA 1W9HA 2FEWB 4MPTA 4WWHA 4LE0A 4PYRA 4O5AA 2JVIA 4MR7B 4HNRA 3QX9A 1DP4A 3EQ2A 4TLMB 2A9QA 2WWVD 1NATA 1RZRD 1DBWA 5KQPA 1ISRA 4B09A 1T34A 1ZHHA 2YHAA 3HSYA 2A9PA 1D5WA 4FE7A 1I3CA 4YWHA 2P4UA 3LKBA 3GWGA 1MIHA 1PUXA 2O20A 1ABFA 1SD5A 3A0UA 3C3KA 3NNSA 4KV7A 3OLVA 4PEVA 3DLBA 3JPWA 4Z4EA 1B00A 4UHJA 4Z9AA 2CWDA 2RJNA 1SXGA 3R0JA 1E2BA 1JYFA 3CHYA 3F73A 4QPJC 4Z4GA 3SAJA 2B1JA 1NXSA 1P6QA 3KCNA 2FMHA 4JASB 1TVMA 3HS3A 2PE5A 2MYUA 4OLAA 3FFWA 3BRQA 2MYPA 3URMA 1APBA 1NXPA 3HJFA 4NCBA 2QZJA 4MLCA 4TMYA 3EDCA 2F8SA 1XWWA 3GYBA 4ZYLA 4G0ZA 5TE9A 3N0RA 3MMNA 4G0YA 3LUJA 1VKRA 2FN9A 3O2JA 1BVHA 4Z4IA 1LK0A 5JS1A 3VNBA 1SXIA 3K4HA 1GLGA 1E6LA 2H0AA 1L5ZA 4S04A 4F3TA 3HCWA 5T7BA 3LUKA 2HQRA 1PEYA 1ZESA 3H6HA 3K9CA 3N53A 4H60A 2WRZA 3QEMA 5B3JA 4DADA 5JNSA 1ABEA 1EFAA 5FBHA 1QP0A 2PMCA 5DLEA 1J56A 4RSMA 3QEKA 3H1EA 1ZH4A 2LBPA 3LFTA 4YRZA 2JCGA 2N9UA 4RY0A 4MS1B 4ETIA 4IILA 1QP7A 2F8TA 1JL3A 4Z4FA 2E4ZA 1A0OA 3W9SA 2L19A 3JVIA 3QLUA 4W5OA 3LKVA 4HNSA 2FLKA 3JVDA 1OXBB 5JNTA 3F6CA 2MSWA 4ML3A 2MSLA 5KWSA 4W5QA 4H3KB 2PUAA 3O75A 3I42A 1FFSA 1QQBA 3RVJA 1R8JA 1Z2EA 3LUAA 4D6YA 1QNLA 2GI4A 3Q7RA 1PNRA 3QX8A 1ZDMA 5KI6A 1UDRA 4ZMSA 3Q7SA 5C5CA 1ZAYA 4RXTA 4MS3A 4N0QA 2A9RA 1JF8A 3CLKA 1KMIY 5F64A 1JYEA 3JS5A 4LZLA 2QSJA 1FQWA 2P9HA 4YLEA 1QQAA 1ZVVA 2PUEA 1A04A 3FDFA 4IF4A 2HJ9A 2NUBA 2VK2A 4XAQA 5EWLA 4RK0A 3NNDA 4F06A 3IP6A 5BR1A 2R25B 4RKRA 3VNAA 3DBIA 3HZHA 4TLLB 5KC9A 1RZRA 4G0OA 3RVMA 4MS3B 3QLTA 5DCLA 5TQ0A 3H6GA 2PUDA 4Z4HA 2PKXA 1FFWA 1Z18A 2A9OA 2CD7A 5IBQA 3RVLA 3SM9A 3JY6A 2LIVA 2BGGA 1ZH2A 1D4ZA 4EUKA 1C4WA 5EWLB 1JFVA 2LUOA 4E7OA 4N76A 3KKEA 2CHFA 3KG2A 5PNTA 4LDZA 3OLYA 1MAVA 4RXMA 4RXUA 4NCAA 3QLVC 4JB0A 4ZPJA 3IP9A 4N41A 2FVYA 3A3KA 3Q7TA 2FEPA 1RPJA 2E4XA 3DGFC 1YIOA 3Q9SA 5TQ0B 5C5EA 4KNYA 5IULC 3N8IA 4EVSA 4ZMRA 3EJWA 2PAFA 5EWMA 2B4AA 4TN5A 4Z9BA 2E4WA 1EWVA 4MGEA 3OQNA 3I5AA 1Z2DA 4KRFA 1K68A 1USIA 1JDPA 3O74A 4IMJB 1Z13A 3NHMA 4O1IA 1FSPA 3IPAA 2QV0A 3H1GA 3RVQA 3F7NA 1M5TA 1CYEA 1TMYA 4PE5B 4IMIB 1YS7A 3LUCA 3KJXA 3OQMA 4YV7A 5EWJB 3T8YA 4RZSA 2QU7A 2XDYA 1VPWA 4EVQA 3G85A 3M9XA 2FQXA 1Z25A 4G0PA 5I4CA 4G86A 1XHEA 4KK3A 1Z15A 4N47A 2OQRA 4UHKA 4DN6A 4O1HA 2JVJA 1KGSA 1MVOA 4XXHA 3LMKA 4EY3A 4MAAA 4IRXA 1HEYA 1YS6A 1Z12A 4XARA 1BDHA 4YS6A 4HYEA 3H75A 4DQDA 1BDIA 2RGYA 4Q7EA 3L6UA 2FMIA 1YMVA 3T95A 3O1IC 3EQZA 4ETMA 1KRWA 4LX8A 1QO0D 4F11A 3GBVA 2E4YA 3UKJA 1NTRA 3G1WA 3N75A 1JX6A 3RVSA 2FLWA 3C3WA 3EODA 1SXHA 3KLNA 1OXKB 4RDCA 1DJMA 2HSGA 2PUFA 2YHBA 4Z4CA 1DG9A 2FMFA 3A10A 5KC8A 3NHZA 4QYWA 3O21A 3N0WA 4WT7A 4YCSA 4JA2A 3CFYA 5GQSA 1Y1LA 3OLZA 3I45A 3OLXA 3SG0A 4QICA 4PICA 3O2SB 3S99A 4EGSA 5HSGA 4KPYA 1IIBA 2MYNA 1TJYA 1EHCA 1P8AA 3ROTA 4JOQA 1BAPA 2JK1A 4MYRA 1EWTA 2QVCA 3H5VA 2E4UA 3N6VA 3RH0A 4F8JA 4NQRA 4JB2A 2DRIA 4WXEA 4LE2A 1DBPA 1AB6A 2M1ZA 3LUGA 1JFSA 1MB0A 3CU5A 1DRKA 2FW0A 1P2FA 4RU1A 1M2EA 5E3JA 2H3HA 1LBIA 3GA5A 3TX6A 2J48A 3HV2A 4KZKA 4L85A 2RJOA 2TMYA 2L2QA 7ABPA 4W5TA 4MS4A 5IX8A 3QELA 3QEMB 4E7PA 1F4VA 3TMYA 2MSKA 3BRSA
chains in the Genus database with same CATH superfamily
3KKZA 5AI4A 2NXJA 3JPYA 4AFNA 4MWDA 1QZUA 5JMWA 3NXKA 3TD2A 5B57C 2FKAA 3THMF 1Z37A 3A9UA 4GI7A 2X42A 3RVDA 2AX3A 1IBLB 3S2FA 2QUIA 5CW1A 2X4IA 4D57A 3QXCA 2FFAA 1EFLA 3JQ9A 2V65A 3GA0A 1RHQA 3WVTA 1J23A 4UDNA 4IV0A 4DYHA 2WMDA 2W2VA 5B36A 2HDOA 4MS4B 3TCNA 9ABPA 4XTCS 5DK6A 1VC2A 1W46A 2KPOA 2AE1A 4W5RA 2Y71A 2EV9A 5BUZA 2Y93A 3O26A 3KJEA 4WBXC 4CMAA 3PXUA 1C1YA 1UZMA 4AXXA 4CUJA 4Q15A 3SC3A 3I6YA 4WNIA 1QE5A 4KPYA 4XCXA 1O95C 1ORRA 1XELA 2R4TA 3FCYA 4XWOA 1CUGA 1DE0A 1X1BA 4GPBA 3E7DA 1D2RA 1BWQA 3PEVA 3F2IA 4AY4A 5LMCA 4IX1A 2PLRA 4IJKA 1KH1A 1NOKA 2D2FA 3AHGA 3BTSA 4LSWA 4CM7A 3K4QA 4ZIRA 5LYJF 3OIVA 2YJNA 3HB9A 1VJ1A 4L0MA 5K1ZA 3HCAA 2NVBA 3IEPA 3GN1A 4OP1A 5IBCA 1OY1A 4EF6A 5IASA 1HFEL 1Z2AA 4XM1A 3E82A 2J32A 2D7DA 2ZREA 4UZFA 4G0QA 4AULA 1GUFA 1Q3TA 2QYHA 3IB6A 3IHWA 3L9XA 2TYSB 3PGXA 4FX5A 2X0FA 2RHMA 1I94B 5AK5A 2Z2YA 1YXMA 2O3SA 2GRAA 3F4BA 4CTNA 1OAOC 3HFRA 1J1IA 3H2SA 5U4XA 5HF9A 2PSHA 4KPGA 1AX9A 1DTSA 4EMUA 1GNQA 3V8VA 2DUMA 1YUMA 2GBLA 2Q41A 1T6NA 2XKBA 3AEUB 2VHJA 3NYQA 2Z2XA 3Q11A 3WISA 4DQVA 4C7BA 1DRJA 1UJMA 4E15A 1W36C 2JGLA 1QRSA 2ODTX 3OQHA 1BNCA 4L4UA 4PSUA 1L5RA 2XZPA 3LQKA 1R50A 1EUQA 4BTVA 4ZEOA 4F86A 4UVIA 2Y9MB 5AJWA 4LF6B 1ID8A 2D62A 1VKHA 2ZE8A 3LBAA 3RFCA 2Q07A 2X2FA 3BDAA 4HDSA 3S1AB 3DBVO 3OKCA 1GUAA 3QU2A 5CIRE 3A4VA 3U39A 1O6ZA 2QSUA 4L3VA 3S8MA 3WBJA 2X3YA 3KQHA 2WPNA 4G0XA 2Z8YA 3U5ZB 2HR1A 4F5EA 3PNOA 2BDTA 2JFYA 2O2SA 4KR6A 2VDPB 1OH8A 1GLVA 1E7YA 3ADKA 2OY0A 1BMFD 3MWFA 4HB0A 2GARA 2OZLB 4ZI3A 3L1KA 2FE4A 1Z5NA 2WUEA 2PO7A 3MMXA 2FQYA 4UUAA 1BFKA 2IW1A 4WZAE 3O90A 2ZYHA 4U7HA 4Y9RA 4H08A 1I4DD 1J39A 1MC5A 4ZYWA 3PFWO 4L28A 2CDCA 1YRQA 3E23A 4LXXA 5CA0A 1X7XA 4X97A 1GYQA 4AJIA 4DY4A 1PNQA 1P0PA 4RKFA 1Q0QA 3GBPA 4WXPA 4W1QA 1VB3A 3UUEA 2WHXA 3DV2A 5FPQA 4JLBA 3WC4A 3OFVA 2IOYA 2PBRA 2VHXA 2VJMA 1IHYA 2W4IA 3C5EA 3UMSA 3KETA 1QHHB 1E1QD 1XXHA 4WFKA 2YFKA 1P7WA 1K98A 1R4NA 3GG2A 3GEEA 2DUJA 3D1LA 5EJMA 2PKEA 1F8YA 2H1WA 4CBVA 2O8CB 1CHDA 5JZBA 2H5EA 3PQ3A 1W87A 2QM0A 2O2XA 2PGOA 2RAFA 3KWMA 4XX0A 5CH5A 4DCSA 1DNPA 1UDBA 1N2HA 2B5OA 4CM8A 1WBDA 2APJA 3L41A 4O4LA 4BX2A 5LMNB 3AVYA 4TSKA 1BRMA 2FPPA 4B3TB 3T9BA 4HUQA 2JLBA 4X6LA 1X19A 1KI2A 3NAQA 2G08A 3R9IA 3WLKX 3QWHA 1TFRA 4I4TA 2C8LA 1XOIA 1SKAA 1YK1A 2O7RA 2I9PA 3VTZA 4MRMB 3RUPA 4EVIA 2V5VA 4MV0A 3QU5A 2Y6UA 3MTJA 4X65B 2WMYA 3LNTA 2DHCA 1BTOA 2IA5A 3RYHB 2FQWA 2YVUA 2JAWA 2JIDA 2YN4A 3O8DA 1DMSA 2XB6A 5CA1A 1QDEA 4XH9B 3CRMA 1BVYF 4JT2A 3TD6A 1C4OA 3TF5A 2EFEB 3C3AA 3JZAA 3W5IA 3GJXC 1K2WA 1M7HA 4TVBA 1E2JA 1YS1X 4TS9A 3RRJA 1QXSA 1RMQA 4C30A 1KORA 3JQAA 6LDHA 1F06A 1ORDA 3CEHA 3Q8WA 2IEZA 1RYZA 3BQNB 3EK2A 2FOIA 2WAMA 3FSEA 3N2EA 3EFOB 1CRQA 2G04A 2RHTA 2VJAA 3PX2A 4KV9A 3AY0A 4RK1A 3GVHA 3N3BC 3Q5GA 4UM5A 1KOLA 4M9CA 5HIMA 2HYIC 5LBUA 3UEOA 4US0R 3DHYA 4KQFA 3RRFA 1K8RA 4CF6A 1PV1A 2FR8C 1GY8A 1DC7A 4PZEA 4R2IA 4A8TA 1FL9A 2A0WA 1UPAA 3G0GA 3RR2A 1FMCA 1R6TA 2IJGX 3DSRA 4L15A 4ALJA 1EQ2A 2VF2A 1V48A 1XMJA 2FFQA 2JFNA 2RGNA 4I6EA 4RMJA 4RM2A 4RM3A 5EQJB 4BO0A 2CXQA 2PWZA 1J07A 4FFBA 2P9FA 2FI1A 1DJLA 1C9YA 4TWZA 1K86A 4R5HA 4O6VA 5IUJC 1DC5A 5EOVA 3W8FA 5J5VA 4R7ZA 4WAUA 3UGJA 2CT8A 1F3OA 1NJSA 1NNEA 2FDXA 3GEIA 1NZJA 1CPYA 2UWIA 1TIPA 1UFQA 4U4AA 4NJEA 4X60A 1X7WB 2P4EA 4ZT6A 2WQ7A 5DLQC 1ZUD1 3DE6X 1B41A 3C97A 3IAM6 4I4CA 2I6SA 3MTAA 4MIYA 4DILA 2NAFA 1I7QB 3SJZA 4QGHA 4LJRA 5CNJA 1Z63A 1E3MA 2QJTA 1XTPA 2XYQA 2I80A 3HBJA 5B7GA 2FQ1A 1PU2A 3P2EA 4GMXA 4N3NA 3V2GA 1PAUA 2D1RA 4BBPA 2AVDA 2VYVA 4ZOBA 4EAAA 3UPTA 5IWCA 1E2EA 5JFTA 4HADA 3WGQA 4C0HA 1H42A 4FCTA 4CMIB 4I5DA 2QZZA 3DS8A 1PUIA 4BNZA 1GPLA 5EWJA 4NR0A 1QPBA 1V4VA 3KBOA 4JSRA 2P90A 1N6IA 5ERYA 3F3SA 4LRYA 1E1NA 4IFEA 3WKCA 2PSFA 1VI5A 2JW5A 1BE0A 1XJ5A 2XE4A 4EGJA 4TLEA 1DCFA 1F2VA 4M38A 4EPYA 4QXQA 3LZDA 4KXLA 1Z8FA 2AUMA 3VFDA 4M1MA 1ZFNA 2PFSA 1J5XA 3NAZA 3KLMX 3DXXA 2BDUA 2DWUA 4G0VA 4RETA 3C45A 4B73A 4ZO7A 4I6JA 3WLPA 4URVR 3F71A 3Q10A 3I9MA 3QE2A 2HRRA 1MB2A 3OT5A 9LDBA 1DFIA 1Q1BA 4XTRA 1AXRA 5T4HA 2X40A 1TIBA 3OE5A 4Z1MD 3IULA 4J0KA 1BVUA 3MGCA 4H0NA 3TFOA 3GDFA 5JCZA 3K8OE 3U17A 2H4XA 4EL0A 2V7XA 4QJ4A 1YUBA 3FAKA 5KHLB 2CE7A 4F4JA 5LP6F 4UE6A 2WSYB 1OPRA 4V0NA 4NQZA 2IQIA 5BSMA 2C92A 5CA0F 2CHUA 2H63A 1P6QA 1WJGA 1PQPA 1C9JA 3LYAA 5ALFA 1AQJA 5TXGA 3RFUA 3DE1X 1L1EA 3IAS1 2PD3A 3PIIA 3VC3A 2PZAA 4F7DA 1QX4A 5LVAA 1AV7A 2V0CA 4ZYYA 2AFIE 2IX9A 1L4UA 2C61A 4GE3A 1NNUA 4FU0A 4M4SA 2AOXA 3LUJA 1I7NA 5AW2A 1CEQA 5EPUA 1BVHA 2R5FA 4W6ZA 3G0OA 4A6PA 5B2FA 2H1IA 2P79A 2O3UA 2V3VA 4HVCA 3WB1A 2QRGA 2X8WA 3VNRA 4XJSA 1ENZA 2C7VA 4TUYF 4F9GA 1DDIA 1NVWQ 5GZ3A 2R6CA 1M7BA 1OIWA 4JYAB 4F3TA 2C4WA 1UDWA 5CBPB 4ZDWA 3E03A 4DAOA 1GSOA 1JPUA 4HLUA 3Q2OA 4BTLA 4BNLA 4CDMA 3A2KA 2JCGA 5HHTA 4M6WB 1ESEA 1L2TA 1G8HA 1PO7A 1ZVJA 3V80A 4JJAA 4R69A 1Q7RA 1GAEO 1BO6A 3KHKA 4QVKA 5G0WA 2MSWA 3X1KA 3IBSA 3OZVA 3O75A 1UBJS 2VKQA 3QVVA 2RGEA 4OLFA 3R74A 3KQQA 3LUAA 3HR4A 4ZT3A 2NU8A 3KC2A 3IMEA 2VSOA 3NWJA 2FG6C 3EQ7A 3UJAA 2NZYA 4CL3A 3MWLA 5KNDA 5HP4A 1SHKA 1SWWA 3KQSA 4AZ3B 4K0RA 2PYDA 4N39A 2R7MA 4RJLA 3GLFA 2Q3CA 3DLCA 4JMPA 4CKXA 2VR1A 3ZCQA 1JF8A 1SIWA 2V98A 3TQSA 1E6CA 4NARA 3ZH9B 4FOLA 3A28A 3L92A 4RSUD 1A04A 3G6WA 4DLLA 4FZJA 4XGKA 1GKYA 4F45A 2JLSA 4M36A 5CJPA 2WTNA 1HMPA 1KZ9A 2AG1A 2QTBA 2QAGA 5DM0A 2ZQZA 1HXHA 3LQRA 5BSRA 4Q16A 4C7KA 5JCOA 4EFLA 4IYRA 5JPCA 5F3WB 2ZXUA 5H8WA 2Q3EA 5FQOA 1YFJA 3BYZA 3C6KA 4Q37A 4MW5A 2CL7X 2GM3A 1W581 2QX7A 5AUPB 2DLCX 1UKCA 3PGJA 2HMTA 4OJMX 1WAMA 4PONA 4DSTA 3IL2A 5CYOA 4PO3X 1E3IA 4W5WA 4HK4A 4E7OA 5JH7A 1F8FA 4R4JA 2FPMA 2QW8A 3FSRA 1NVVR 3OLYA 3QUQA 1FYEA 4I1IA 4L4YA 4RXMA 4BFLA 4FB5A 4MSVB 4L0DA 5F52A 5JAHA 3IURA 3W05A 3WRYA 5KX5F 4E51A 1RPJA 3IKJA 1HTWA 2E18A 2JFWA 1KRHA 1UXKA 3AEXA 3I2JA 5TQ0B 3OMLA 5ALZA 3UCXA 1KJYA 3GXOA 5EE1A 1MFZA 5LWQA 4DA0A 1MV8A 2IYAA 1JJVA 2P35A 3AG5A 1U28C 3P2OA 4N3CA 3L6EA 4B1FA 2Q49A 4B2YA 1RKUA 3UAZA 1KDVA 1AUXA 3OQNA 4TZTA 5G0VA 2GLUA 3TQHA 5SZJA 3F8SA 3R0ZA 3WLSA 3FD8A 3JASB 4IIBA 1P4AA 2C1XA 1PFQA 4WY5A 3PC8C 4AJ2A 1PEDA 4R1MA 2JANA 3D3WB 3RS4A 1OHHD 1RBZA 1UZUA 4JR0A 4YRFA 4YV7A 5HE8A 4EDHA 3I2HA 4UTXA 3Q0TA 1RW4A 4FNOA 1OWPA 4HDAA 1IE3A 3FCAA 4R3WA 2HJHA 1O58A 1T3SA 4ZCMA 2BKEA 3IIEA 4K6FA 3ITKA 3HGQA 4GZMA 1OZGA 2R7NA 3M9XA 5DHFA 1LBQA 1Z82A 1G7CA 4Y2UA 4P7JA 3ZJ4A 1YD7A 4BZPA 2CCKA 2OCKA 2C42A 5AFSA 2RGRA 1SA0A 1E92A 4GFDA 4N4AA 2VUUA 2AJBA 1H65A 4MITA 4WXRA 3TTUA 1UWKA 3TG2A 3QTBA 3G8YA 1YCGA 2X22A 2GCEA 2Z98A 3UA4A 2ZIAA 3DZFA 4HNAB 1WKCA 2HF8A 4XOUA 1J0EA 1K08A 2JAPA 5EAIA 2UUOA 3ZV3A 5AW6A 3DBHA 5KJEA 3O1IC 1JQJC 3FRIA 2G5TA 1NKVA 1MQAA 2E5LB 1MU0A 4UHHA 4UUOA 4DIDA 1TVCA 1EK5A 2KJQA 2PYZA 3MJ4A 1TB4A 1DTWA 4IH1A 1WXWA 3MUFA 3G7NA 1R2QA 3PTAA 1KZ6A 4CTMA 4CEHB 1J8FA 4QDUA 4KMOA 3STWA 3LOQA 4FGLA 2PUFA 4TMTA 4BNJA 1SBHA 3EOAI 3H2HA 4C0JA 1XG5A 4W82A 1R0LA 4YAKA 1HR0B 2J4DA 4N48A 4NMMA 2O8EA 5LQCA 4DLBA 3NTRA 4RY2A 1Y48E 4U2CA 5E6UA 3KFVA 1ZNZA 2O3QA 2CDRA 1YDGA 1XZHA 4MEBA 1TLLA 3EZXA 3OP4A 5HQTA 3PDUA 1NIPA 4BPRA 5BR8B 4BEJA 4G0UA 4I5IA 2OO5C 5DTMA 2QVCA 1DJOA 3GGPA 3BQMB 3MRSA 1L4LA 2H2IA 4GOOD 2BFNA 3M0EA 1JHXA 4B7UA 1DBPA 1MC4A 1JFSA 3EXG1 1V1RB 3BIFA 1EP3B 4GOJA 3E8MA 1J70A 4H16A 1SB8A 3IO5A 5E3JA 1ZOIA 2CYBA 3C85A 1T43A 2I5PO 2PWYA 3GZTB 1T2UA 4G09A 1BSVA 4ZQEA 5K51A 3THWA 1N2SA 3PC2A 1Q11A 3SSNA 5I9MA 2B1RA 4LJYA 5FA8A 1DVRA 2I6GA 1F4VA 4TXHA 5LNK1 2MSKA 4U7GA 3GLHA 1MJGM 4TV8B 1ZHOA 4A2QA 3EN0A 4ANFA 1UJCA 2PWPA 2V0NA 4N6NA 3ZJ5A 4KBFA 5E2AA 1KFKB 1J99A 2BBSA 1CS0A 1OXMA 4GKAA 4C4YA 4AYWA 3CRNA 4V1CA 2WSIA 3F3YA 3D3QA 1W59A 2ALJA 3QVTA 3OWHA 2FWPA 5C46F 3SR4A 3P9ZA 2ZIVB 4BAUA 4EW2A 1ZZEA 2HHCA 1ZICA 2NO7A 3VO2A 5FLXA 1ZBQA 2VSQA 3CLRC 3P27A 1Y3IA 521PA 1BS1A 1Y5NA 2QROA 4O25A 5E9JA 3M4JA 2HA0A 4M1SA 4Z0TA 3WWYA 2AKEA 1CX9B 4MRPA 3R0VA 2OCPA 4KSCA 1U4NA 4FMCF 4UKDA 2SKDA 4UUNA 5FLEX 2BGWA 2XHZA 2H1CA 1TMGE 1MH1A 4RK4A 2IS6A 4RQBA 4G8JA 1IZ0A 3NC1C 2IPOA 3SDZA 2C4NA 3BL5A 4C3UA 5F1KA 5C53B 4CT4B 4IP0A 5AW1A 2GK7A 4KQWA 3DT8A 1ZD5A 4XD7D 1EJ6A 1DKRA 1ZIPA 3LNCA 3OZRA 4LXYA 3V1NA 2E82A 3RABA 3AL3A 4YDQA 1YHZA 1YRAA 4MLDA 1U2QA 4E4RA 1PR5A 1XD2A 1PL8A 1VXOA 3B9QA 4TN1A 3RJZA 4L3OA 3VZBA 4HDNB 1KZGB 3ZIAA 8MHTA 1UEXC 2EYQA 2IELA 1MDFA 4GI2A 4ZIRB 3I0MA 5ADWA 3ZBTA 3PNLA 1V5FA 1YHNA 4JJ8A 4DNXA 4W5NA 2O2JA 1NW5A 3DDCA 3LBIA 5HZKA 4IJWA 7REQA 1IZ7A 1R00A 2BJWA 5AW0A 5LN1A 4HS4A 1EK1A 2REQA 2YXDA 1P3JA 1F1BA 3CNBA 1HEIA 3CYFA 3EVAA 2CBZA 2VZ8A 5EQFA 4ENUA 4XOIA 2OVBA 5AKJA 4E22A 3LHDA 5I7WA 4MKHA 5JS7A 3NASA 2EQAA 2ZJOA 3KAJA 3R3YA 4GNRA 2X0DA 2GXAA 8GPBA 1SVMA 1X13A 3CEJA 2IUUA 2NSLA 3SD7A 1FYDA 3LC1O 3AIIA 4MINA 1M2OA 2HZBA 3AUUA 5HE9A 4DMMA 3P19A 5GZ1A 2CL0X 1YDMA 1FP6A 2L69A 3AY6A 2Z5FA 4CKEA 1CJUC 1TT5B 2V1XA 4Y2GA 1XRRA 4WKBA 1IN5A 4H4EA 4GO1A 2O8VA 4CLOA 4V0RA 5A0VA 4M9QA 3GJZA 4TT3D 5EGNA 2PS3A 1RRCA 3PEYA 1T0BA 2A57A 4W9NA 1Z0IA 2ZJ6A 5JARA 1EFKA 1IUKA 5E7MA 4LC9A 4HDSB 4KI0A 5DVZA 5FL3A 4ZFNA 4U2GA 4U1RA 5A9SA 4H3HB 1E1MA 1XDBA 2YHIB 4NL4H 4R31A 4RWZA 3M6UA 1RXVA 4LNUA 1ORIA 2GHIA 3RADC 5L4LA 1JFLA 3RBZA 3E2IA 2GBFA 2C7QA 3ZDBA 1OTYA 1R0XA 2DSNA 3MYRA 1A5TA 1DEHA 2BEWB 2F2TA 1TF7A 4DSUA 2GWHA 4YJGA 2KM1A 4QFBA 5EN4A 3UV7A 1B7GO 1HYHA 3C87A 3WGHA 1GL9B 1LXCA 4MPJA 2LPMA 1EBBA 5BV7A 4E33A 1ZJ5A 4NOLA 3JR3A 4G81A 1H4SA 4MHSA 3CN7A 2WVJA 1E6UA 1E66A 3PEUA 2NZ8A 1X7XB 2AHOA 2C5AA 5CA0B 4D0SA 3ITEA 3E7PA 1P2SA 3DTVB 5ESDA 1EXDA 1GQ2A 3VO8A 1XQ1A 3QKUA 4NHEA 5MN6A 4HKTA 4FOPA 1NJ1A 2DTEA 4IS2A 5T57A 1E2PA 5HM6A 4H6PA 3QU7A 1XXHB 3KPUA 2ZZMA 3ZJUA 4Y2TA 5JYEA 4IO1A 1NRWA 4RV4A 1G3RA 4RS3A 3U40A 3AGPA 3R7SA 2EATA 1TA4A 1B3RA 1SK8A 3CLHA 3LXMA 2FK7A 1TE2A 2HH9A 5EIBD 5C7OO 3D5EA 2MSCB 5JT1A 5H1YA 4XX0B 4YMUA 1F17A 3FR8A 1OKKA 3R3VA 1ISHA 3AONB 3CR7A 3KE8A 4O4LB 4O0MA 4COKA 1J49A 5JHHB 1WEHA 1DC4A 2ATXA 3PEFA 3REGA 1K5PA 1N1DA 1FFGA 2AWNA 1C80A 2DFVA 2FPPB 3Q2KA 4F71A 4DBLC 4EYOA 4EB8A 3L7IA 4LX0A 4I4TB 3KZVA 3M1YA 3MYYA 4HH3C 5KO2A 4JH0A 8OHMA 3NTLA 4CLHA 2DSTA 1LDYA 1WLSA 1C9NA 2FSUA 2ASEA 2I99A 2VLIA 3NBQA 4NKRA 4OXQA 4YDHB 4UDOA 1DQPA 3QVGA 3IJPA 4QXRA 3TKAA 1KJJA 2R97A 5JEEA 4LPKA 1W25A 4LCJA 2O8BA 4FTWA 4J94A 2VTDA 2PVCA 4Q0MA 5IKMA 3O8RA 1E4VA 3HZRA 2ZG6A 4G5SA 1KZ4A 3TAXA 1QGUA 4I6GA 4YXFA 1J2RA 1H4TA 5FI5A 3RRXA 4Z53A 2NPOA 3RSSA 3JQAB 2I4MA 3PXAA 1Z4MA 2C2KA 3EZ7A 1KH3A 3N8NA 4MUEA 1IHUA 3GT4A 4MP8A 3MBWA 4G0WA 2HU5A 1Q77A 4FFOA 3CS3A 4MARA 5C4MA 3ILXA 4KJXA 4BQPA 4BP8A 4FLMA 3UUGA 3PPXA 2QIPA 4BNGA 1OIXA 1ZWKA 4GPAA 3ENZA 3ILYA 4RSHA 1ONNA 3H1PA 3O4HA 5HKAA 3ETDA 2ZI4A 5IKEA 2GS9A 5K3CA 1YJXA 3R4CA 2VHWA 4OATA 1L6IA 5A7GA 4BCCA 1Y6JA 5L3QA 1AC5A 2JHGA 3KDPA 3O1LA 4G0MA 1U7UA 4I1VA 4PZPA 2VDWA 5E1OA 4ZAGA 4YRKA 3GO4A 1P0IA 5NULA 1YE8A 2EGUA 1MDBA 3KRTA 4MTCA 4S24A 5A02A 3R9KA 3G02A 3RU2A 1TNRR 4YJHA 2JFBA 4CEIA 1EWKA 3ZZ1A 2X6RA 1JQEA 3DJYA 4GBED 4OHVA 2PT9A 3WL5A 4CTJA 4NZYA 4V38A 1ZGCA 1OWMA 2IXFA 4KQJA 1KDYA 4CM4A 1T4BA 1DRVA 2ERYA 2EYUA 2YJ4A 4MV7A 4WEQA 1TEHA 2QI9C 2R00C 4EVRA 4OJYA 1U5BB 2ZTUA 4QEZA 4MMYB 3JRNA 4NX2A 3IAHA 4UBOA 1U3VA 1NBIA 1ZRHA 1SWVA 5K3DA 1FVFA 4MW0A 4K9SA 3TSYA 1MJHA 1WMAA 2IZ1A 3AR7A 4KE6A 1NKTA 4Y1RB 4DIEA 4ED9A 1SM4A 2C3UA 2Y0CA 1HY3A 1NX9A 3G2OA 4JVMA 3ZUGA 3A37A 1DV2A 1W9HA 3S1LA 3S4YA 3TL3A 3W3ZB 2LRHA 5D6NA 3ZBPA 2HJRA 4QAQA 4LE0A 1PVVA 4A5SA 1ZN9A 1P29A 4O5AA 3V2UA 3H7IA 3DV9A 4OEHA 1EK2A 3KE9A 3QX9A 3WBKA 3NT2A 2OGTA 1CUZA 1V5EA 4RACA 3E1KA 2O14A 4D80A 3MJSA 2O9JA 2WTAA 3EDRA 5JDIC 2MSNA 1ZHHA 1NG9A 4DCNA 3WE7A 4LMAA 4LOKA 4OMUA 5J4YA 2O20A 4HS9A 4GEGA 4JLVA 4RQUA 3DLBA 2A8YA 3QP9A 4I19A 4M1KA 1R64A 4S2UA 4BB9A 4UNSA 5TRTA 4MYSA 2VQ6A 4KAAA 5EXEA 5JO0A 3HYRA 2XMZA 1E0AA 3F73A 2AJCA 2NQTA 4H17A 2NSDA 1JI3A 2AFHA 2YMMA 1E59A 4I8DA 5CEJA 3ZXUB 4EY8A 1QHSA 2EEZA 1SQ5A 3PEWA 5FEMA 5BT8A 4CT0A 2Z57A 1QHIA 3VDNB 1PJQA 1T91A 4A1OA 3KXPA 4Z86A 4NCBA 3HJFA 4INOA 2J9FB 4TM8A 2XKJE 3F8WA 1Q83A 2AG8A 5CT6A 1RQ2A 3ZGXA 4HMOA 4UUBA 5JSYA 4ASUD 5KWVA 3NJ4A 1V39A 3AM1A 2BE9A 5EZ5A 3IX7A 4UZSA 5LCXA 3UUWA 3V4SA 5K0JA 3A7DA 4Y3UA 4EG6A 1DRUA 3C1TA 3IAUA 2XUPA 1Y9ZA 4DLNA 4KXMA 3IQEA 2WZBA 2QE7D 4YJ3F 4QBFA 1O7JA 3ORSA 3G0HA 2ZWOA 3QVWA 3LUKA 3A1SA 3OP1A 2IHYA 4O4IB 2ST1A 4S2EA 5D6OA 3T94A 1UT8A 5B3JA 1OB5A 5JWOA 3LQFA 1X87A 2XYGA 3NKFA 4JOSA 3BD7A 2PN1A 4RSMA 1T1GA 3R0IA 5KYUA 1F7UA 3NI2A 1TW2A 4JVNA 4M53A 2LBPA 5AJUA 5DHRA 3VZQA 5IC4A 1O5TA 5KNBH 1DOZA 1F6BA 1I2ZA 1ZD4A 3GEBA 2A94A 3L4EA 4PCUA 5BQ5A 1CERA 1E3WA 2VJKA 3AZPA 4L22A 4Z4FA 4EB6A 3B6MA 1N25A 2AMLA 1NLYA 4IDAA 2PTHA 3D6AA 4WA8A 3V9AA 4F5ZA 3F6CA 2I4NA 3OD5A 5KNBA 1PG2A 2PZLA 5CXSA 1V1MA 1LLDA 4DWVA 3NXSA 1T9CA 1CEEA 4RABA 1HO3A 4DIOA 3ABZA 1L4BA 3RV3A 3VTAA 3N07A 2Q2NA 4GM1A 4M7RA 3T7KA 1U8EA 821PA 2WT9A 4BNVA 5BV8A 3B36A 5HKKD 1PNRA 4HDQB 4ZJYA 1M1NA 2GD2A 1IVSA 1GT91 4FDUA 4M87A 2OGSA 5KDOA 3LHSA 4PIPA 3CVJA 3H1AA 1WSWA 4G0NA 3MBIA 2FW1A 3NC0C 1NW3A 1GHTA 1O97D 3B5EA 8ATCA 3HA5A 5BSKA 2Q28A 3GFSA 2X5JO 2ZWIA 4EFDA 2JAXA 4XAQA 4KXUA 5TV2A 1EA7A 3U31A 4AAYA 3IAEA 3EVDA 1XRNA 3MJFA 2A1IA 2NU8B 2V9ZA 2FZEA 3NBAA 1NL3A 1LPOA 1RKQA 3NUQA 4ZHSA 1RLJA 3DYBA 3DZ8A 2GAAA 4JBGA 1N8KA 5JMOA 4O4JF 1KWKA 3JZIA 1SOUA 2BR4A 1N0IA 3V32A 4YT4A 5KSOA 4RHYA 5I4KA 2PUDA 1NULA 3DWIA 3T5BA 2I54A 1F48A 3GZ4A 5ALSA 5I7VA 3RVLA 1YR2A 3LY9A 4Z8YA 1ZH2A 2YNMD 2YXEA 3PD1A 4GICA 3VR2A 5KAMA 3N58A 3HJTA 2NV2B 3AF3A 1PN3A 4PLGA 3OC0A 4PU0A 4OK6A 4RXUA 4E88A 4NCAA 4MCJA 1NLZA 3EDOA 4JK3A 3MPOA 3U3OA 2QAGB 4YRBA 3U4MA 2BFBB 3PC7A 3C3BA 1GQRA 3U19A 2QMHA 4NAHA 2F43A 3BOSA 3VZDA 4QU8A 4V2UA 3GVPA 3AEYA 2CLMB 4P8RA 1TNDA 1YCFA 2G63A 4MWCA 4D0GA 2WG2A 1ATIA 4M1QA 2BEUA 3GG9A 5AKEA 3KQUA 3I5AA 4Q3KA 2GHRA 1UJ2A 3AXTA 3DZGA 1K68A 4FBMA 3SNHA 5JH7B 4OCZA 4C14A 2LZ0A 1QK5A 3KYBA 3J81k 1TQ8A 3LBYA 2YHUA 3AVWA 1WNTA 2AI1A 3WMGA 1Z06A 3QJ5A 2IITA 3KJXA 3FF4A 1MGPA 5ES4B 3BJEA 4WIAA 3V8RA 2GVZC 2W8ZA 3TW0A 1V8ZA 5KU1A 4MDHA 4ZN6A 4GMFA 3JZFA 1RHJA 4QVIA 1SUAA 2HA3A 1B23P 4UAJA 1T1JA 3K32A 2R11A 5LYJA 4ZVMA 1LSJA 1U9YA 1FNDA 1RJGA 1XHEA 3H8VA 3LPLA 2WHEA 1FE8A 3B8EA 4ZVPA 1RYEA 3EZ2A 4A03A 5HOQA 4DN6A 1EGVB 4GMHA 2PNFA 4F7WA 1YB7A 3OU6A 3RHZA 2ZJZA 3T4XA 3BZBA 2IYQA 1QH8A 1J2JA 3ZQJA 2DBZA 2VPYA 1SZPA 2QN2A 4KN9S 3HFSA 4OGLA 4D92A 5K8VA 2B8EA 3WDSA 2HT6A 3FLEA 4ILKA 4PRZA 1RRGA 4JS0A 2HF2A 4DREA 1QCYA 2Y1WA 4LOHA 5HFAA 1RRKA 4BZQA 2W6ID 3OKFA 5I47A 1C7QA 3AP1A 2VTEA 3D4BA 2JIQA 3V4ZA 1SA0B 3GXBA 3K2IA 3NHLA 2YJ3A 4UOEA 1WUYA 1EFPA 4ER0A 5CXQA 1BWSA 1FQOA 3S2EA 2GN8A 5JALA 3LVQE 1GXSA 4BPBA 2NG1A 1SB9A 4FJ1A 1GPYA 1YE3A 2VPPA 1DXQA 2GZ1A 5B37A 2VP2A 4XM0A 1A7AA 3DBHB 5AI8A 5G4KB 2IXTA 2PSJA 1SIBE 3VXKA 4DTIA 5LXTF 3VYWA 1H1DA 5I6DA 2G17A 5LFAA 4BATA 1LF0A 3QY9A 3C7AA 1DTWB 2FXVA 3F74A 2WDPA 2VYQA 3NBXX 2WILA 4RDHA 4RH3A 3RT9A 2GM4A 1N8TA 2PKQO 2D4HA 1Q7GA 2LKCA 3O0TA 3LXRA 5CG2A 1GPKA 1P8AA 5KJCA 2VTBA 3MOIA 2E4UA 1O5OA 3DB2A 2MR6A 1Z6GA 3D9QX 1NU8A 1ZC3A 4OF4A 3IA2A 4KXNA 2DZDA 3LUGA 4XVRA 4AMGA 2NTEA 5JAZA 2ZSKA 3OJCA 4CR6A 3WGVA 1SAYA 2B6NA 3F5QA 1E7SA 1DFGA 2G7MC 2O8EB 2R751 2CVFA 2P3SA 5E6UB 1KERA 2FPIA 3DFUA 2VZ9A 3O3OB 1FRQA 3V1TC 5L8VA 1E3LA 1K7YA 2K5UA 1I33A 3G68A 3VR6H 1DQSA 5T5QA 1OAKA 1TZBA 2PAAA 1E99A 3MI8D 1EM8A 3FUUA 3STTA 4A0GA 4S0XA 2XF8A 4U6QA 1LY1A 2XQKA 4A36A 5FBZA 5A4AA 2C8KA 1AUOA 1J5PA 2ACWA 2QMYA 3DEAA 4FYMA 3UMGA 4HQ6A 1TQ2A 2WHPA 3A6JA 3ACBA 5DX0A 1GZUA 1DARA 3JQGB 4AZSA 4FHQA 4F6RA 3C3DA 2J0UA 2UU9B 1T2CA 4AN0A 3THWB 4DLWA 3OKAA 1AO0A 3IA7A 1EVLA 3L7LA 3QV2A 1SR8A 3DDWA 3KEFA 5DXAA 2FUKA 4J6FA 3MIZA 1P2UA 2D2IA 2IXDA 2O07A 2VSXA 3GY0A 4JFAA 5EXSA 1W93A 1QLWA 2ID9A 4P84A 2F17A 4QYIA 2XIQA 4LSGA 3SBXA 1CS0B 1TD9A 3R3ZA 1D6SA 5CDGA 1QVRA 2X7XA 2X6QA 3I01A 5E1DA 2RC5A 4D46A 4E11A 4V1CB 5F3DA 1JA0A 1Y5LA 1EINA 4J6EA 1YJQA 3EXFA 4Q3DA 4DG8A 4BC1A 4PZYA 1H6AA 1IDOA 4DLZA 3BC1A 1FRZA 1R1DA 2FN8A 5BSFA 2J5BA 2FN7A 4L9AA 1EEHA 1UEIA 3M6FA 2ZI9A 1T36A 4D9CA 2X9NA 1CIJA 1XA3A 1UBRS 4TYMA 1GCUA 4IVNA 1JHZA 1K3TA 1RT9A 2C9ZA 2IUEA 3CWQA 1U3WA 2HUPA 3PEEA 3MM4A 5BN5A 2Y4NA 3JQCA 1VHJA 4W5HA 1P4HA 2YVAA 2FMXA 4YH1A 4MXDA 2WU8A 2XHEA 3DZDA 3PJFA 3VYTB 1NAHA 3AVUA 1RM3A 4FLEA 2QZ4A 5DNWA 4CNQA 4EABA 2DT8A 5KYYA 4X20B 5LOVB 2QKYA 2A33A 1DCKA 1M6NA 4QLAA 3G5MA 4P0PB 3GRZA 1C9KA 4UBLA 5E6RA 1RP7A 2DY1A 2X6TA 3KTAB 4HDRB 4YAUA 2GCIA 3WIEA 1Y6QA 1YTLA 2F1HA 2IPLA 2A6PA 2H1HA 2OT3B 4OQEA 1XMOB 1CR6A 1J0CA 1QLHA 3F67A 3SF8A 3NDPA 4LJ8A 1VYHA 5KIAA 1ZGAA 2H59A 4X7RA 3CEPB 3U0VA 4RKYA 3WKDA 3P0FA 4ADSG 1FSFA 2CDBA 3ZE6A 2VAMA 2WIKA 4JLJA 3A3YA 3E3LA 1PLJA 4NBTA 2F8LA 5F35A 4KSBA 3V8PA 1Q0SA 2R6FA 1VM6A 3WQSB 7REQB 5BOSB 1IOZA 2JLAA 4GQBA 4EDFA 2QRNA 4GH5A 4QHYA 1K5HA 3LUDA 2G25A 4HYQA 1TLFA 1EFRD 4I7EA 1QQ5A 5I7FA 3E7FA 1M33A 4I9HA 3ZDFA 1AXEA 1JEOA 4GXNA 2AF4C 1MB3A 3HO1A 4CQJA 2HMVA 4ZI2A 4CFSA 3Q1KA 2B1GA 5INTA 5B4UA 3DT9A 4K2HA 3QE3A 1C8VB 3QWBA 2PXCA 4CYMA 1N75A 1G6OA 2A3RA 5K0LA 2Y8EA 2VT6A 3OTHA 3HVJA 3SIWA 4KDFA 4BFXA 2HQBA 1HORA 2XGOA 5KREA 1JQDA 4KO3S 4KQ1A 5LWHA 1E20A 2IXEA 3GCZA 2OE2A 5C1DA 3OU2A 2IOQA 3BKXA 4C7OA 2PR7A 3FETA 2EIHA 4CLOB 2HWUA 1NY6A 1BWPA 1X3SA 1QFJA 2FEMA 2EZ8A 4L95C 4MB0A 5ICMA 3DD5A 1BU5A 4YRIA 2EX4A 1JIVA 2NTVA 2OBBA 2DFPA 1WD7A 3H9BA 3GEDA 1U0FA 3ELBA 2OSVA 3QU4A 4N49A 5FT9A 1QAMA 3Q7PA 2BLLA 5A9SB 3LQQA 1GUBA 1OF1A 1OZ0A 2ZRAA 4PLWA 4WBSA 3JAKA 3I5XA 3F4LA 1R0RE 3NFRA 3K6SA 4OTZA 4JZYA 4GS5A 2GK6A 2I0FA 3EWNA 5K0TA 3BAFA 4IFIA 3T5DA 2PX4A 2CCJA 2ZSBA 1AZSC 3BCRA 2GSWA 3CLTD 4BNYA 4NECA 4WFQA 4XEUA 4YJGB 2ZRIA 1E62A 1UPXA 5HG0A 1G5TA 1BX3A 2LCQA 2RH5A 3RRMA 2O0MA 4JMLA 4ZT4A 3BDVA 5IVDA 5FYDA 4QSHA 2P5YA 4DLXA 4E2WA 3TVTA 1R0ZA 3QVKA 3BL8A 1CUFA 2XUQA 4MRRA 5HCIA 3MAAC 3OHSX 4DCCA 5TEWA 4AP5A 4LYEA 4UHEA 2E9SA 2H1VA 2DCUA 4DV2B 2C4MA 1FW6A 1L5VA 3VMMA 3BCHA 2XRMA 1BXKA 1T35A 2CJWA 2NYAA 4RENA 4DM3A 1JVBA 3RF7A 2QRVA 1I6WA 1PT8A 3G13A 4EYKA 1Z2PX 5CT4A 2D7CA 2FW7A 1XYYA 4TWIA 3STVA 2VDJA 3GFVA 3MT9A 4HPJB 1ULUA 5F5XA 3WLNA 2E4VA 1QTQA 2XBMA 5REQA 2ONCA 1DKMA 1XVAA 2XVMA 3H3JA 2CFRA 2IOHA 5G4LA 2XQJA 2BFCA 1NJFA 1R74A 1TTPB 5BRAA 3ZV4A 4KOEC 1Z17A 2GO1A 4CMKA 4GLOA 1UMKA 2YMLA 3QXJA 4CIVA 4AKEA 2ZUFA 3DLPX 4ZYUA 5EIWA 4BHTA 3NGXA 4M99A 2ECKA 4YUAA 1TRHA 5ALIA 1DZ3A 3LTEA 2FRDC 4OQZA 1DL5A 1LZLA 2YRXA 3QVGB 3FHJA 3H1BA 2IUTA 3RDPA 2H92A 3HN6A 5CHYA 1CBUA 3DLTA 3QXGA 2BDEA 2F00A 1NV8A 2O8BB 5K8IA 1Z8HA 1V0JA 1RVV1 1K97A 1Q0UA 1VHDA 2WFLB 2X1MA 3ETGA 3LBHA 4WZ6A 3WYBA 1QVAA 1DGQA 2XB8A 2RDMA 2IUFA 1G60A 1KFCB 2OFXA 4GKBA 4LJAA 1NGSA 3MJHA 1KY5A 2DT5A 3L40A 3TOCA 1NXTA 4N6GA 3S2GA 5TLSA 2JLWA 1CVIA 1XXHE 2OFPA 2WJIA 3BMOA 3RGGA 4D8VA 4RSGA 1FTYA 1U02A 1JSRA 1FMJA 3N87A 4J90A 3ZY5A 3ZTTA 5F77A 1SGWA 5JAPA 5BP7A 4J0EA 4Z3OA 1KU0A 3T61A 1QDUA 2C29D 3TECE 2F4VB 3AI3A 3FHTA 5LD2B 1L3BA 3OPYA 5E38A 4GKJB 4BMPB 3HABA 3RC9A 2QNRA 2J31A 2QPAA 4DCUA 3FHLA 2OAQ1 1G1MA 1KR5A 1OI7A 2X9VA 3IRUA 4OXXA 3WLHA 4BC0A 2PUCA 1TFUA 5ILQA 4BGDA 1EJ0A 5K4GA 2SKEA 4PC6A 2IDKA 2VDWB 1FU7A 2H1LA 2IXBA 1KNXA 1GAJA 5DISB 2NP6A 1ZM3A 1PSDA 2L18A 2VZEA 3OF2A 1MEJA 3MHPA 2GZ2A 2QT1A 3CPEA 4DM4A 1EU1A 3IR6A 4N01A 4ZU6X 2ZT5A 5C80A 2FMUA 2WTMA 5JC1A 4KJZA 4EEXA 2JD0A 3QPDA 4KHPB 3AM4A 3DEHA 4B6OA 4CM4B 5JRZA 4NCXA 1PZNA 1OJLA 3BUSA 5FIUA 1MX3A 2AYYA 4H7PA 2D8AA 1GAXA 3JV7A 3EVZA 3GZNA 1J90A 5D01A 5IARA 4C4PA 1A82A 3HSYA 3NS7A 2I3GA 2ZRDA 3FPSA 5BYAA 1P1RA 1E9DA 1W94A 2LXNA 3OH8A 1SD5A 3L7MA 1ZUWA 4BNDB 1XUOA 4Z4EA 2O50A 1OX6A 2ZGVA 4UATA 5FOQA 1X0VA 5A71A 2EQBA 4HWPA 1E2BA 4JLAA 3UZUA 4COOA 2IYRA 5JMTA 4QPJC 3ANMA 4AURA 1TZ2A 4LC0A 1P61B 4RLFA 4PW0A 5HZGA 3P5BA 2VCEA 4CQMB 4B3SB 2PS1A 1U94A 5KOJA 1GRRA 2W2PA 3ZWOA 4DBZA 3TNDA 1FS4A 1PQ4A 4AM8A 1Y7PA 3EIXA 4Q7JB 2NQ2C 4KYIB 1A5BB 3PDHA 2K7ZA 2PR2A 3D0QA 3GYBA 4JR2A 2E0IA 4RLHA 4M4PA 2Q0SA 4ZYTA 4JJGA 4O33A 4B4UA 1LK0A 3HUFA 1O89A 2KI5A 3PU6A 4MKFA 2P6RA 3VR5A 4HEA6 4RW0A 2YDYA 1U7WA 4UCQA 2FHPA 2C2WA 3BE6A 3TE7A 2QRMA 4UEWA 4MWZA 2QRHA 3KXLA 4OHBA 4ZAZA 2FRVA 3SWWA 3T7RA 4X7PA 1MVNA 3R5XA 3X1YA 3R24A 4O4HA 2QTGA 1JFFA 1JDTA 3IOEA 4A0FA 3KWLA 1XTZA 5JVDF 3LFTA 1V11A 5C5DA 2JFPA 2D0OB 3O8QA 4IILA 3S2UA 2W58A 3R5HA 2RJ3A 4GD3Q 3T5MA 2YICA 4BVGA 2Y0BA 5K8JB 4D98A 2WG0A 1L4GA 3EPRA 3F78A 4U7DA 1J7KA 3B6KA 1OFTA 4FEAA 2V3CC 2ZJ2A 1R8JA 3DL2A 3RC8A 4E08A 4D6YA 1W0KD 3H9QA 4LTNA 2R96A 4M8KA 3N0TA 1E1RD 2ZJYA 2PMEA 3DUFA 5J43A 2DHDA 3DBRA 1XTIA 3M3HA 3V7UA 5KYUB 1Y7HA 3ER9A 4DSNA 1ZAYA 4BQQA 3IR7A 3TXAA 2W2KB 4YUVA 1WULS 5AUNB 1P45A 3DDHA 3ZY4A 3FCOA 1E3WB 4XWTA 3W06A 1USWA 2HB6A 2Z1NA 3KUUA 2P9HA 4QAJA 5EG5A 1RYDA 4EB6B 4AW9A 2Q5OA 3WICA 4BMYA 1G5QA 4GOXA 4JC4A 4RK0A 5FPPA 3D7KA 4DG9A 3N0VA 2P6UA 2MWMA 1PI3A 2AZTA 2SNIE 5AQ1A 1TAUA 3KD3A 5ALHA 3T7JA 2PTGA 4O2BA 3I6BA 3H2JA 1MN6A 2ID4A 2P9BA 3FFAA 1ZKDA 3HYSA 4GSKA 4M1TA 1DAFA 3V7FA 3NTOA 1M8KA 4EG8A 4IHJA 1X7ZB 3ZDAA 4BJ1A 3ROZA 4D8UA 4DUGD 5KDLA 3WA7A 1JDUA 1L4EA 1UDXA 4JIMA 4WADA 2A0YA 3WRXA 5EUMA 1QIIA 3JAWA 1JLSA 1Q1AA 3A3KA 3AFIA 2YV4A 1TK2A 4BLWA 1AY0A 3ZU5A 5JD5A 4UTZA 2AOUA 3DGFC 5DGIA 4JYMA 1L5LA 1PL0A 2C7OA 4KR7A 3ABSB 3BRCA 4WZBB 1ZS9A 3W79A 3HP4A 4NEHB 3FWPA 1UQTA 3MMZA 2QDXA 3TMAA 5T67A 3H9GA 5BMVF 4BKOA 1K5GA 3AIOA 2PZEA 4TKVA 2WD9A 1NRXA 2HYDA 1WXXA 2Z2JA 4XSGA 4KRFA 3AB7A 4HH0A 5F33A 4IMJB 4JP2A 1U31A 4K05A 4KYVA 1UP6A 2VWHA 2H52A 3HDYA 3R5TA 4MHOA 3RHFA 1M6YA 2G76A 3RIEA 3ZNNA 4R71A 4LF9B 1ZA2A 2FSIA 3PUIA 4QHSA 1OFHA 4OSPA 4DV1B 1GGHA 1O1YA 3UQYS 1YWGO 1SD1A 3MCVA 1VP3A 2F43B 2IF2A 4WBNB 9MHTA 5JISA 2GXSA 2X5NA 2BYTA 3EBPA 1YMQA 3L1JA 2CHQA 1SG1X 1YC2A 4KGVA 3QUTA 4E2ZA 3W5BA 4EHFA 1NW6A 2BEUB 3S2IA 3E9MA 4YA6A 1LF5A 1ZISA 3GOQA 4LDPA 4WLEA 1Y5RA 2HCTA 4Y30A 2W6CX 3FPGA 3GD5A 1BDMA 4HOYA 5LBIA 1A5AB 4IDNA 4RD1A 3UMJA 3WMRA 1HOXA 1RM5A 4MRVA 1JI0A 1V4BA 4O29A 4UM8B 3ZHSA 2QQGA 3JZDA 4PZUA 4ZICA 2FUG6 1CYDA 1KZHA 3L43A 3W5UA 4AMVA 1HTBA 3AHCA 1L4MA 3AYXB 3LX6A 1IZ9A 2MDTA 1N9ZA 4MUBA 3ITNA 4P3PA 3X3FA 4Y2RA 4KR9A 3ZYCA 4BNXA 2R8EA 3PJRA 3HCRA 4KO2S 4C3OB 5MHTA 1J33A 4AG6A 1XQ9A 4UD2A 5CYFA 2A0XA 1C1XA 4M0UA 2IWRA 4KFUA 5DNVA 3EODA 2RBGA 4BCDA 1DJMA 1QS0A 4J75A 4NG5A 4JODA 3UK2A 4NBRA 4BLUA 2CV0A 4OI4A 1RM4A 1OILA 3V7NA 4YPFA 4Z2YA 1AGPA 2UYCA 5TJHA 3MS4A 1NBOA 4KX5A 1V9CA 3FPLA 5I8ZA 2H4YA 2UZ1A 1X80A 2EKZA 3GZJA 4N3BA 2C2BA 2GBCA 2KBFA 2Z3ZA 2ZYAA 3I45A 5LDGA 1ZGBA 3ICEA 3GVIA 4LWOA 4UREA 2UVQA 3U9SA 1IIBA 1QZTA 1Y5MA 3TTSA 4BNTA 3AIKA 4XSHA 3U0BA 4EPXA 2I7DA 4UBNA 1Q19A 2DBQA 3N6VA 1EFPB 2QRUA 3UGKA 3HY6A 3HH8A 5CFQA 2LD4A 1H69A 1GXSB 1M54A 2ANBA 2V7UA 4NI5A 4GBMA 4TL6A 4TMZA 3RROA 3S70A 3W2GA 2WWYA 3FUTA 1PV4A 1LU9A 4ZAXA 1CUYA 1VHLA 2P91A 3HLTA 4AIRA 2QL5A 3D1JA 3KZKA 4XD7A 1Z8DA 1N6KA 1GQOA 2YN2A 1UF9A 2QZSA 3LCUA 3SXJA 3E2MA 3UXHA 1WXGA 5BUCA 3WG9A 2HI0A 1BMQA 1E0JA 1Y8QA 1KAMA 4TRRA 1IK4A 1YDWA 1NKSA 3OM8A 4TXJA 5EKXA 3TEFA 1WUHS 1YJBA 2P69A 3AF4A 4HQOA 2X86A 2XB9A 3R6DA 1L7AA 5JS6A 1I4WA 4YEDA 4GEKA 4IHQA 4ZOQI 5TT0A 4D45A 1DEKA 2EHJA 5CM8B 1RNLA 3WNBA 5C4IA 1KEEA 2I66A 3L0SA 4DB2A 5CLQA 3GUZA 1T4CA 1GIAA 4MRSA 4IGAA 4JJEA 1DJNA 3V7WA 2Q1XA 2QN6A 3TLMA 5KVCA 3KQLA 3OZEA 5J1TB 4HLQB 4QDZA 3SNKA 3ITDA 3T35A 1EZ4A 3RVNA 1ETHA 2E49A 1IBSA 3CB2A 4WK4B 1Q2UA 2VP0A 5DRTA 1P31A 3UJ3X 4HYTA 5C3UA 2BKLA 4BAZA 4XB2A 3SZMA 4IL5A 4US2R 1JDBB 2GRUA 3B1KA 3IVCA 1ZI9A 4QC2A 3MK31 3ZQKA 4F6RB 2NMVA 2J0UB 4OFBA 5TGDA 4QBIA 5C2JB 2ZJ7A 3C5HA 4FD2A 5A4DA 3BT7A 2XPCA 3HCCA 2YV3A 1E4EB 4LFAB 1CEYA 4H59A 1A8IA 4N5IX 1JKMA 4YHHB 1G9TA 2EW8A 2IVFA 2NZUG 4RQTA 5AOVA 1T2VA 4TT3A 1AM4D 1UAYA 3L82B 1QO0A 3I04M 3JQPA 1Q74A 4NVRA 4QYIB 4PR3A 4CUKA 2Z6AA 5DNYB 4Y2PA 5AVZA 3IP7A 4R7GA 3ONVA 4R2MA 5FBKA 4LRQA 3OIYA 1WR8A 2EFHB 4OQFA 1TRKA 5IDVA 3KJIA 3EXFB 3B3AA 4F91B 3U7IA 3EDQA 4EOGA 3T7DA 1I3KA 4AZTA 4PLHA 3JATA 3F6EX 4C21A 1T36B 2RGWA 3HVKA 1T0JB 2WAXA 3PWSA 1D03A 1XRLA 6REQA 2G3YA 4NS4A 2PRZA 3HYLA 2WNSA 5HF6A 1XZLA 1OTHA 2JFUA 1RAGA 2GM5A 3DDSA 4KP7A 3GJ4A 4TQUS 1AG9A 2QM3A 3BFXA 3CG4A 3LPNA 4MQ6A 2SHKA 4NY1A 4WASA 4YRAA 1GNSA 3PE6A 3WL4A 5TY0A 1SHUX 1MOQA 3A1EA 4CXMA 2B3DA 2I6FA 4AO7A 5KYYB 2REXB 3PPIA 2WR8A 4ZI5A 3KSZO 4AY3A 4KXVA 3MG9A 1ORTA 2I33A 3BD6A 2NUTA 2D0DA 3P7MA 1E6MA 1C1DA 4JX8A 1EZZA 1JTEA 1UBEA 4KRYA 4CIYA 3TKYA 1RPNA 4P31A 4Q7MB 3ZZNA 3FHCB 5E6RB 3ABOB 1H3FA 4YAEA 1ZMXA 5U1PA 1POXA 1Q44A 1W6UA 2WM2A 4ALLA 1Y7LA 2OENG 1KO4A 4K9RA 4NK4A 5FJJA 3T3NA 3R7NA 1N33B 3H2KA 4TM7A 4HGPA 1ZGZA 4YBRA 3KZXA 2OXEA 3L7KA 1I3LA 1J06A 2GN2A 4Q3EA 4FR2A 4BQNA 1VFPA 4Y6RA 3KR2A 5KTRA 2GFQA 3NT5A 4LDAA 4TL9A 2HFKA 2JGAA 3G9ZA 3GOHA 2YV2A 4LQCA 3RJ5A 2E48A 1T8UA 1JMVA 2WWGA 3GV0A 1OXUA 4U9UA 3TGPA 1T8PA 2ZI3A 3H4TA 5EI5A 3ZDZB 2HWYA 3MXTA 3K72B 1E2NA 2BHRA 2H2HA 1E3QA 4DQKA 5KVVA 5IT0A 1K8QA 2ZT6A 1RAFA 3AJDA 5DN9A 4Y9DA 1KSHA 3O82A 3TEJA 2IEAA 4OKIA 3F96A 3WRYC 4YRRA 3ZLUA 3AR4A 5CGZA 3P0JA 4RTNA 2C2XA 1IXKA 1YBFA 3FE2A 3QWAA 3RSZA 4IV5A 1UKEA 5A5GA 5HJEA 5K6TA 3HXMA 4C7OB 1XJQA 3DZHA 4TZ0A 3RWOA 1Z5UA 2BSQA 5T6MA 3RJTA 1P0CA 3AI1A 3NR2A 3GL9A 1EAYA 2CLHB 3DDNA 4NICA 2O57A 3QX7A 3JYPA 3A6PC 1H2WA 5AJXA 4N3AA 3Q5DA 1E0SA 1G2PA 1Y8CA 3T41A 1LDNA 4IW3B 3EC1A 4K1LA 5IM5A 3NUZA 4MVWA 4PG5A 2E4AA 2R3SA 4X8HA 3TDNA 2L17A 3JAKB 5TB5A 2VNHA 3LK7A 2A0KA 1X0XA 2JB9A 4LXQA 4B48A 3OMXA 3CUTA 4DDVA 4WK6A 5KWJA 2P9JA 3H84A 4DIUA 2GEKA 4URFA 5ILGA 1Q1ZA 2H4JA 1T9GS 4ID9A 3UK7A 3ME4A 5KSPA 5FD8A 4DJJA 1NFRA 2XGJA 1Z16A 3UAYA 4UXIA 3HEBA 4DMRA 1KOGA 1JEJA 4TSRA 1G9XA 3M4ZA 5DDIP 3ROFA 5EINA 1P7VA 1S1MA 1Z47A 1WDTA 3KOXA 3QHPA 4HATA 4L57A 1GGVA 2I2AA 1WDMA 1W0JA 3ER8A 1U2PA 3CW8X 5K45A 3R7WB 7MHTA 3EAGA 1JQAA 1Z7YA 2JJ2A 3O2QB 1DX4A 3R77A 4HAXA 4NFYA 3T52A 2C7RA 1ZNQO 2MINA 3T38A 3TW8A 1KYXA 2VHUA 3FTPA 2QVBA 1UZAA 2RB4A 3EARA 1HA3A 4URWR 3CZCA 3ECAA 1PS8A 3F3MA 3FIUA 3GNSA 5IMSA 2BFEB 5CM9C 4LF7B 2IV2X 2CJWB 3T0GA 2IU3A 4TKMA 4XRRA 2K2WA 4WOJA 1N3LA 4KXXA 4QARA 1DWOA 1A2OA 1E2MA 2QRVB 5A2GA 1KBZA 2B3TA 3ZE0B 3W78A 3DT6A 4FC7A 3GUVA 4WLOA 3BTVA 4XWAA 3PRYA 4DIBA 1QYIA 2C78A 3CEMA 5FTJA 3I9V6 4RCYA 4IO0A 5REQB 2I9KA 2CLIB 4DEXA 2BFCB 2A30A 1TD1A 2FFJA 2C04A 3RIMA 2GNOA 3ZXIA 4ZHQF 1QZ3A 4OSEA 3ZK9A 1O4WA 2IF0A 2UVPA 2YYSA 3IILA 3KYJB 2CMHA 2V96A 1KE1A 4HX5A 3VTKA 4X9XA 4HTFA 4DA6A 1XYVA 3P5SA 4YRLA 3E9QA 3TLCA 5FNVB 4LYGA 2AR7A 5BSEA 3Q7EA 3G7SA 4YRPA 1POWA 4YLYA 2ZBFA 4FLFA 1GRQA 1UPUA 2IYWA 1HGXA 2SECE 4H27A 4WESA 2M6LA 2QGFA 1QP8A 2JI4A 4LRSB 4ZVOA 4QGSA 4YMVA 1O77A 2HRDA 1NOIA 1PBTA 4CV2A 2FK8A 4ASUA 2DXIA 4FC6A 4HXGA 2Q3HA 4IDOA 4LRUA 1YQGA 5JSQA 1I0LA 3BMOB 5EE0A 3SYKA 2XY4A 3SC4A 5HF8A 3FKJA 5KQPA 3T3GA 4E46A 1XAJA 1NXXA 3TPFA 3TTXA 4BE4A 2JIMA 3I8XA 2QE7A 3P9QA 2EZ4A 1FMTA 3OZIA 3WLOA 4FEYA 5JQGF 5M7EA 4L8GA 4RA6A 3OPYB 2YZGA 2WWVD 3C8UA 3LDAA 1LS1A 4RC9A 1NN3A 3EUFA 5EY5B 1PZEA 4BS9A 4FQ7A 4YQEA 3EMBA 4N7RA 3DXZA 4RNDB 1I3CA 4YWHA 1NDQA 2P4UA 3GDGA 3KSDO 4LZNA 1G98A 4JFRA 2FWRA 3G2PA 1IEXA 3UWKA 1KPGA 3PVSA 1KFJB 1LFAA 1GDDA 4KNVA 4MVJA 1HTTA 2CWDA 4Q34A 3I8OA 1J2YA 2AD1A 5CB4A 1YVRA 2RHDA 4HSEA 3WGIA 1Q2XA 1MX1A 4QTZA 5HKBA 4EENA 3B7WA 4Y6QA 4KWTA 2OBYA 4MCAA 4EKNB 2IY9A 1ZI8A 3IO3A 4CL0A 3GZNB 1OSNA 3UHFA 1SURA 3L0YA 2NZJA 5G41A 1XZDA 1T6XA 3V4VB 2V7WA 3URMA 4YYZA 1NXPA 4UU7A 1APBA 1AQ6A 2PGIA 3VKUA 3TQCA 1C5KA 1L5QA 1QF9A 2C94A 4YCJA 4YHBA 2HCBA 3KFXA 3L7CA 2Q6KA 2XWSA 3WS7A 4YREA 1SUIA 2KLBA 2P9ZA 3UPUA 1DXYA 5TE9A 3AHJA 4BVHA 2YCBA 1E0KA 3VJRA 5FV4A 1OZFA 3H0KA 2BHTA 3HXPA 2XDWA 1NHWA 2FB9A 2VS1A 3DAGA 4JXJA 1WE2A 2BF4A 4NEGA 1S8AA 3V46A 1R3UA 4FILA 4DWOA 4IHAA 5KOJB 4QDTA 1ZESA 3QEMA 5A6VA 5TR9A 1O6CA 2A4MA 2PMDA 5ESWA 1IOWA 2R8XA 4GQIA 5LP6A 3JX9A 1FTSA 1H4QA 3QF7A 3TLXA 4YRZA 1VKOA 1VL0A 2XD9A 3BHMA 2QXTA 2KBEA 3W9SA 4F9FA 1XCGB 1M2VA 2UDPA 3EC7A 2ET6A 5IF9A 3LF2A 2IEDA 1X74A 5J4KA 2Y2VA 4X44A 5JSFA 3I2FA 2NVUA 1DHRA 1NQ5A 2HBYA 4O02B 2WYUA 3I0ZA 3V1UA 1WV0A 3BWEA 2ONZA 3EFBA 1HSZA 1OA0A 3NHYA 3OPNA 3RTDA 4O4HB 1JFFB 3UGTA 3DXYA 5EHXA 1UKZA 4PVCA 4TUYA 5CLJA 4MS3A 3QQPA 3IUYA 1V11B 3SS7X 4RZ2A 4DV4B 2NO0A 3O8QB 1JYEA 1G0OA 3HA2A 2DFDA 1MC1A 4H77A 4C04A 4NHOA 1W4LA 4AX4A 4HQ0A 2HRQA 3QSGA 3MINA 3KDAA 4HG2A 3VX3A 5FTNA 3DE0X 4HRYA 2W90A 3DLIA 4INZA 4ZV9A 4F4IA 2V7GA 2M9MA 4W9NC 3V1YA 1UBKS 2ZOSA 1L7OA 5ALLA 4W7HA 1QFMA 1XFAA 2I62A 4BV2A 3DUFB 1T9HA 4TTPA 3SJBA 2G72A 3DBRB 3OQBA 4ARAA 2Y0EA 1QB8A 5EJ5A 3DCJA 2DKNA 1NXQA 2C8VA 2Q6TA 2K2QB 1SCQA 1UWCA 3RYTC 1HDEA 4DXHA 1T8RA 2WWRA 5DN6D 1FFWA 5CHEA 1K8YB 2D74A 1R7RA 4FFWA 3SM9A 3ZHVA 4NPAA 1Q14A 1XFDA 3EZLA 3TYXA 2PM8A 3AF6A 2BGGA 3KT6A 1EFVA 1KVQA 5DCUA 1VMDA 2ZIFA 4N76A 4MULA 2A84A 2VDUE 1W5AA 4F97A 1QFXA 4HBZA 2C57A 2Y99A 3AF1A 3N2ZB 1FFBA 2CUZA 2JFFA 4RIEA 1VLQA 3ZCTA 1FMFA 2RBEA 2HBRA 4FHDA 2VF4X 3UAOA 4XQ9A 4HUTA 1R0CA 5BNIA 5BR4A 2H11A 2NPFA 2E4XA 4EJSC 5J40A 1WG8A 3UJCA 4CV0A 1XJCA 2H7XA 2Z56A 2Y1FA 4TS3A 1R10A 5CDFA 1L5HA 4CKBB 3WGMA 4IHJB 1OLXB 1XC7A 1YZKA 3BXPA 4MGEA 3LZCA 5GJVC 3RIGA 3SDBA 3CLUC 4NLLA 1GSAA 1BE8A 2NZWA 1C2YA 3AR2A 5ANRB 4GQAA 4KO1S 1MPXA 4DLSA 4R1SA 5JYDA 2IHNA 4MQ4A 5BUQA 1RQGA 3T9FA 3BMNA 2PO5A 4OIFA 4B3JA 1PLLA 4FGJA 1WB4A 3PFCA 4JI0B 3IB3A 3ORYA 1M72A 1QIJA 2AOUB 5LPNA 4KN6A 5FXMA 2PGAA 3LH5A 1LLFA 3GEPA 4ACBA 1F38A 3V48A 1C3VA 4ZT5A 2Q1WA 2P2YA 4FFPA 4XD2A 3TBHA 5KX5A 2Q5QA 1R6BX 1X9GA 4QYXA 4R6WA 3L8MA 4TKVB 2QWXA 4QUEA 4BGUA 5BVGA 1W7AA 1JAYA 4IIHA 4WOBA 1KDTA 2RONA 2ZUCA 3P4XA 4O2AA 1I14A 3X2SA 2FLVA 4UHKA 1NVFA 3A2LA 3JWGA 1CVRA 1BKSB 4GX0A 2H9YA 4MWEA 4IRXA 1GDHA 1Z12A 2O7VA 4WNCA 4GI1A 2W2XA 1E32A 4HF7A 3ZWBA 3QG1A 1Z0JA 4NH4A 1JKJA 5K01A 5EIXA 4NFSA 2ZUVA 3VSDA 2VJBA 3WWZA 4CE6A 1W34A 2PXHA 2BH9A 3ESYA 4HB3A 5ALJA 5AHKA 3ZEAA 3P0IA 2E4YA 4NFLA 2GZMA 4FYJA 3N75A 4GOND 1JE0A 2Z2IA 3ENWA 3OIGA 4Q4HA 1SXHA 5KNCH 2QP9X 2WU0A 4KZPA 4MYDA 1W4CA 4ISCA 1SBCA 1T5LA 4R8SA 4Z4CA 2IQ5A 1DG9A 4FW9A 2J0SA 1J42A 3KELA 3OPVA 3B9BA 4B4WA 3M5WA 1XA0A 2ZWPA 4WZBE 2ZR0A 3KKOA 1FDOA 1FOEB 4CKZA 2LIPA 1I7PA 2C98A 4JELA 1ZJYA 1R4AA 3OLXA 5GINE 3MMSA 4Z7JA 5CVTA 3OKPA 1C1XB 2RGAA 1P9RA 5IF3A 1BHO1 4Y2SA 4LNHA 1QS0B 1D1SA 3H5VA 1L4YA 4UM7A 1NYTA 2A4KA 1QUEA 1ZLXA 2ZSUA 3IBFA 1KFBB 2Z9CA 2ZYWX 4FR5A 4BFCA 4A9AA 4ES6A 4NCIA 1E3TA 1A4IA 1AB6A 4WLVA 4IIVA 3ND9A 2UZ1B 4IIJF 2G1PA 3ONNA 1S6YA 2NO1A 3C4JA 5HBGA 1M2EA 1IN6A 5EERA 1MPTA 4F84A 4FZRA 3VNUA 1CY8A 4KDCA 3S2SA 1RYMA 1GGEA 1Q50A 2D5CA 2NUPA 3E5MA 4NOKA 4N18A 4WHMA 5AUQA 3HEAA 5K3FA 4CLRB 1S3IA 2DHEA 3DVRX 3L06A 2HHHB 1HZZC 3HDJA 4N6OA 2QW1A 3AHDA 4P81A 5B1HA 3HACA 3S5JA 4TMVA 1M8GA 2OD7A 4I66A 3OF3A 3OJFA 4E2FA 3E7XA 1JG4A 3NHAA 2LR0A 1V16B 1DMRA 2HLHA 2JKYA 3AOEC 1E61A 1EGHA 1NF9A 2GOYA 3W5AA 2O8DA 4H4DA 1KHTA 3LI2A 3A6ZA 3OEHA 5CVEA 2FJPA 4C3ZA 3GHYA 1O57A 1USKA 2B2XA 4GP7A 4QJBA 4BUJA 4BWGA 2DTDA 3NIFB 3N5CA 2QN8A 3R6LA 4KOAA 1KSGA 1WCIB 3ZX5A 1Y8QB 5I01A 4G01B 4RF2A 3KLOA 2HQOA 2VNSA 4TRMA 3OJWA 3HDGA 4PGFA 5KPDA 1LSUA 4PPQA 1AUPA 4AU1A 1QMPA 4FFNA 1GZ6A 3FAZA 4JI7B 3FJYA 2DQZA 3CSUA 3IDZA 1OYOA 4BX9A 1LQTA 5BQFA 3IE0A 1ZWLA 1D4FA 2DLNA 1HFKA 1EFRA 1C7FA 2MR5A 2CL5A 3FG9A 3I8SA 1FMLA 2A3NA 4NU5A 2GK3A 3ESAA 4ZAYA 3H5RA 1D6MA 2WYVA 4J7UA 1T5HX 3EOBI 1B6GA 3Q3EA 1FX0A 2A9KA 5EP2A 5BYJA 1V43A 4FOSA 1N2GA 5CITA 1QWOA 2A9VA 2J9RA 4G5QA 2BKAA 4IZHA 4GOMD 4OMCA 4TL7A 4ABYA 1DKPA 4B3IA 4BCBA 3T5TA 2IHTA 2D1YA 1JZQA 1N2XA 1Q22A 2JJQA 2WDZA 2JVKA 3FOBA 4OAQA 1H8ED 2YFHA 4EQ6A 4C2TA 2QTNA 5I48A 5ICGA 2X8LA 5B3JC 1BH6A 3HKCB 3TMKA 3TZLA 1G4HA 2BKXA 4JJZA 5FAXA 4EH1A 2CVOA 4JEHA 4INJA 3CPSA 4QQ8A 3ACCA 3TQOA 1GYRA 5I5GA 3A31A 1S8FA 1JXOA 4AWAA 3EF0A 4FFSA 1YA4A 1TZKA 4P0TA 4R8MA 5BQOA 1MG5A 4DL9A 3KKMA 3LM8A 2RI6A 4UU8A 3T5PA 1E3JA 2VHZA 3UHAA 4FNAA 2ICAA 1LCIA 1O96A 2YRFA 3N3AC 3HCBA 1VL8A 3LY8A 3OJLA 1DT5A 2AKAB 3NTUA 4RCZA 5GV8A 4OXYA 4QLBA 4YT5A 2OHXA 3BWYA 3AR8A 2QPLA 4FYVA 4ZQBA 5HFJA 1RXWA 1WLYA 1ZUIA 1ISSA 2FU5C 1CZHA 1FXUA 2QVGA 4R68A 4UMEA 3R7FA 5BNWA 3JATB 2FFHA 3WB2A 2JBAA 4BYMA 2V8BA 1UT5A 1K66A 3GPDG 1O3YA 1RYYA 2BLNA 2TSYB 3QPAA 6REQB 5HZHA 3O9VA 4N65A 1H1LB 5LYJB 2GZDA 3KZNA 1G9SA 2CF6A 4LISA 4Q48A 4CIBA 3H18A 3DMHA 3G8DA 5HKLA 3TOSA 2QMUA 4DHWA 2XZOA 2ENWA 4IIUA 1ICEA 4ND3A 4CI0B 4R1UA 3RK4A 2JLVA 1ZK0A 1UK7A 3VUFA 3QPBA 4X1OA 1PWYE 2ZVJA 1O0BA 2VK8A 3PT9A 4WACA 4HQFA 1Z7WA 4H35A 5IUNC 3AB3A 3OZDA 1C1DB 1J9GA 3W5HA 4AC9A 1IN1A 2ZYTX 1K7EB 3VVCA 4B17A 2VYNA 4PN3A 1ZY2A 2F1RA 2H9IA 3DYIA 3TTYA 5IS2A 1U63A 3IKMB 3IAFA 4AJKA 1SZDA 4LK3A 4UU1A 3A58B 1FRVA 2PLNA 3AERB 3BB3A 2O6HA 4LHSA 3LGAA 4L5AA 3WYFA 3OM0A 3TKLA 1PJ8A 4YFVA 2WTEA 3BB1A 5JLJA 2AN3A 1HH4A 4M0DA 5CVCA 1E8MA 1DT3A 4M83A 4C0XA 4QJIA 3QRWA 3R0XA 3RIYA 3PR1A 3PDIA 4IDGA 3U3JA 5BNTA 1TIKA 3EF1A 2EXXA 3MJEA 1KP2A 1C1HA 2JARA 4PAWA 3TZKA 2X0RA 4YX9A 4DLKA 2WAAA 2OPBA 1JU3A 1EVJA 3F6RA 2PX0A 4DMKA 4DRXA 1U9JA 5FLYA 1Y5IA 2DQ4A 3DL4A 1YL7A 1BGWA 2JKVA 3WZ2A 1W9MA 5GM2A 2EX0A 3P0RA 4MJ3A 4RFSA 3AM3A 1KVRA 3MGGA 1Q7CA 2QY6A 2PFGA 1B6TA 2B4TO 3H11B 3I6ZA 3LL7A 4C06A 4JOCA 1I1HA 4CW7A 6CHYA 4PBSA 2MSDB 2SKCA 1EUCB 2OVFA 3KAQA 4UNRA 2JHFA 2DU8A 3P9PA 1YB1A 1P73A 3DE7X 3I9FA 4ZEMA 3HYCA 3K71B 4UXJA 4MWGA 3C5WP 3PRHA 3DO5A 3G82C 3NVMB 1TM4E 1KZYC 5DBGA 2AW2B 1NDHA 1DAGA 1IBRA 3OEED 4Q03A 1EVZA 3V8QA 3WJ1A 5BYKA 2OR3A 1TC1A 1A95A 3CISA 1RXEA 4LDJA 1OTXA 5IPFA 3L01A 1TZJA 2I03A 3AR3A 3D6NB 4U2BA 1KK1A 1T1SA 2P9CA 2AJ8A 3EH2A 2AEFA 4Q9HA 2NU9B 2C9BA 2C2MA 1W8DA 1OOEA 3M6IA 4I55F 4QYMA 1SHTX 3W4JA 5JASA 1Y8RA 1GUYA 3CH7A 4MI3A 1BHQ1 3H13A 3FNGA 1YHYA 2WD8A 3GPCA 2EARA 3I53A 2V7VA 4BQIA 2R0QC 1WPRA 4B35A 2IDZA 3RQIA 4AJPA 4G8DA 1VLVA 1YR6A 2FZLA 3OSUA 2VHEA 4F56A 1S2DA 3D43A 6NULA 3E1SA 4Q3AA 2IUSA 3ABRB 3A9SA 5EKSA 1K0FA 1SVUA 1FC0A 3MT8A 2X19A 2AEJA 2C2YA 3SBOA 2VHCA 4FGWA 4RIHA 3ER6A 1U2GC 3BWCA 4OYYA 5JS2A 4MWOA 4FDMA 1GEGA 1UXOA 2MINB 3A4MA 5ETJA 3TW8B 4B3HA 4JLKA 1BHJA 3ZE7A 1KS2A 3K8YA 4FMPA 2W0MA 2F67A 4DR7B 4DRZA 4EB3A 4UQLA 2XCRB 4AS1A 1PJ2A 4U8GA 4W9RA 1UMDA 1CUXA 4EATA 3K0AB 1QKIA 5J2TF 3P4UA 1SUBA 1KI7A 1X7HA 2AFVA 4G5OA 4PCAA 4MI1A 2O1SA 2OV1A 3KEQA 3JQFC 1SG9A 3OOWA 1SKQA 2Q3JA 4N8DA 4M0KA 1V7QA 1M5UA 2IZZA 3BREA 4FMBB 2HPZA 3E5HA 2D54A 3BF7A 2XUGA 1DQRA 2D59A 2AYZA 1GUDA 1RSZA 2A9FA 2ACKA 2UVPB 5B1DA 4DPLA 1M6VA 1Q92A 3LK6A 5A06A 4W7SA 2OCBA 5IC5A 4C7XA 1FSGA 2Y05A 3OTWA 2C4KA 5K0SA 2QW0X 4HTFB 4UHFA 1FNNA 4UMFA 5DWQA 4DF3A 2QMZA 4PS0A 4RSRA 5FWNA 6GPBA 4M76B 2XX3A 3D7NA 1P2DA 1LX6A 3NYRA 4WESB 1J8VA 1B8PA 1XWFA 2ECQA 5FTKA 2OHJA 4IKOA 2G1JA 4A8JC 2JF0A 4NU8X 3U80A 4CHGA 2ZQ5A 3B2QA 3TR5A 1T34A