2E4UA

Crystal structure of the extracellular region of the group ii metabotropic glutamate receptor complexed with l-glutamate
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
538
structure length
512
Chain Sequence
b'RREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDNYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNICIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAANRVNASFTWVASDGWGAQESIVKGSEHVAYGAITLELASHPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQCSLQQVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPQTTKLCDAMKILDGKKLYKEYLLKIQFTAPFNPNKGADSIVKFDTFGDGMGRYNVFNLQQTGGKYSYLKVGHWAETLSLDVDSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYLVDEFTCMDCGPGQWPTADLSGCYNLPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Metabotropic glutamate receptor 3
publication title Structures of the extracellular regions of the group II/III metabotropic glutamate receptors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 160
structure length 512
sequence length 538
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
A PF07562 NCD3G Nine Cysteines Domain of family 3 GPCR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.50.30 Mainly Beta Ribbon Tumor Necrosis Factor Receptor, subunit A; domain 2 Tumor Necrosis Factor Receptor, subunit A; domain 2 2e4uA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2e4uA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2e4uA01
4GNRA 3JY6A 4HNSA 5FWYA 1MB0A 5DKFA 3UK0A 3LUAA 4MRMA 5KI6A 5TQJA 1LJUA 2YHBA 5EWJB 2PL9A 4NQRA 4B09A 4ZJPA 1GUBA 4RWEA 4EYQA 3MQ4A 1RZRD 3OO0A 2IPLA 4JP1A 4ML3A 1ZY2A 3Q7TA 4QICA 4PZ0A 4Z4IA 1HEYA 1PEYA 2LIVA 2PUFA 4RY9A 1NATA 1APBA 3G1WA 3HDGA 1EHCA 5T3YA 3EGCA 1MAVA 4TN5A 3H6HA 3CTPA 1PEAA 2FLKA 1XHFA 1NXOA 3LKVA 5TQ2B 1NXVA 3JS5A 5E3JA 1YK0A 1M5UA 1U2PA 1RPJA 2NT3A 3BILA 1J56A 1ABEA 3O1HB 5JNTA 2IYNA 1VPWA 2GKGA 1DRJA 4N0PA 3C3WA 1W25A 1JFVA 1YK1A 3LTEA 3TMYA 4FB4A 1BDHA 1SRRA 1K66A 1FFGA 5FWXB 4W5NA 4F3TA 4F12A 1ABFA 3GBVA 3L49A 3T8YA 4OLBA 2OQRA 1A04A 1Z17A 1JYEA 2MSLA 3KYIB 5HSGA 5KC8A 4N47A 1ZGZA 4MR8A 2FMIA 2WB4A 4XASA 2IOYA 2PMCA 3CG4A 5EWMA 1C0EA 1KRXA 3JTEA 3TD9A 4M88A 3IP7A 5FBHA 1A2OA 2L17A 4KK3A 3CS3A 1YS6A 7ABPA 3KCNA 1PHRA 3C3MA 1EAYA 4KV7A 3EAFA 4N76A 5ABPA 1Z16A 2HJ9A 1DJMA 1JX6A 3GYBA 2IPNA 2JVKA 5DGCA 2O20A 3DLBA 4G0QA 3D02A 3I42A 3Q7SA 3QEMA 4Z9AA 4XARA 2QR3A 3GT7A 3QLTA 3JVDA 3KG2A 4MYRA 3RVNA 3KSMA 4N41A 3FGZA 1YTUA 5D2CA 5FWYB 1DCFA 4RK6A 4MRMB 1LK0A 4LDAA 3S99A 2QSJA 2F8TA 2ZAYA 2MYTA 3D8UA 4LZLA 6ABPA 2KYRA 2PL1A 2WMYA 1Z12A 1RZRA 4OG2A 3C6QA 4CBVA 1U0SY 5IUJC 3HUTA 3HVRA 4Z4GA 4PE5B 4QPJC 4ZYLA 2L18A 1JBEA 3OO1A 3F73A 3QX8A 4MS3A 4F11A 1Z26A 2B4AA 3DGEC 1QO0D 3H5TA 4Y9TA 4LDZA 1NY5A 2IPAB 3H75A 3RVLA 3GA5A 1P2FA 3VNBA 2VK2A 4ETMA 4G0ZA 1DBWA 5KQPA 1PNTA 5GOTA 3E3MA 1NXSA 2PUDA 1BVHA 4MLDA 3IP6A 3CFYA 3HSYA 5JNVA 2E4YA 2RJOA 1IIBA 3JPYA 3MYYA 4LE0A 3H6GA 4UHKA 1YMUA 4ETNA 3HCWA 2TMYA 4G0XA 3HS3A 3NNDA 3Q41A 4MR8B 4P1ZA 1BAPA 3FFTA 3G85A 2XDYA 4MQFA 5EWMB 2CD7A 2DRIA 1E6KA 2FMFA 3B2NA 1L5YA 3JVIA 3IP9A 1D2AA 4Z99A 1FSPA 1ZGGA 2E4ZA 3SY8A 1JFTA 1DC8A 4RZSA 2FEWB 2FMHA 2IDMA 3OLVA 4E7PA 2WJWA 1DZ3A 3N6VA 3P9YA 1D1QA 3M9XA 3I5AA 2F8SA 3QEMB 1H9CA 4RK7A 2BGGA 2R25B 5IC5A 2E4WA 4RK0A 3CRNA 2PUBA 4JOQA 3O1JC 5TQ0A 1UDRA 3F7NA 2ID9A 4MQEA 1DCMA 3LUFA 1U8TA 3H5LA 5HQJA 3OMWA 1PUXA 4EVSA 3QLVA 1Z13A 2J48A 3QEKA 4YGXB 1Y1LA 2HQBA 3K9CA 2HQRA 4TMYA 3RH0A 3DBIA 4RXTA 3SAJA 1F4VA 4N0QA 4RXMA 3NHMA 3QLVC 3O74A 4ZPJA 2FTKE 1TVMA 3SNKA 4LX8A 3F6PA 4MR7A 4YS6A 3ILHA 4NV3A 3OM0A 4RU1A 1JDNA 1USKA 2JVJA 1D1PA 2NZUG 3JPWA 3RVJA 3K4HA 4RKRA 2PUCA 2HSGA 4MS3B 3RVKA 2I6FA 1DG9A 2R48A 2IKSA 3CZ5A 4KREA 1E2BA 3M6MD 3NHZA 1AB5A 1ZH2A 5BQ3A 4JB0A 4MGEA 2WRZA 1WETA 1M5TA 4RK4A 3A10A 4F06A 3MF4A 3N75A 3KHTA 3KLOA 1QO0A 4HYEA 3RVMA 2WWVD 4Q7EA 5TPZA 4OLAA 4XXHA 2WY2D 4TLMB 3OQNA 3HDVA 3CHYA 2CHFA 1QQAA 3H5VA 3IP5A 3OLWA 5T7BA 1JH9A 3Q15C 4L4UA 3BREA 4ZMSA 3MMNA 4Z4HA 5KWSA 4H3HB 1Z15A 1TM2A 1S8NA 5TPWA 4MR9A 4MQFB 4W5QA 4FE4A 5BRJA 3OQOA 1K68A 3CLKA 4RK1A 1E6MA 1F51E 4Z4EA 3HXMA 3FFXA 4IMJB 2QV0A 3RVSA 3Q7RA 2PUEA 3NNNA 1U2QA 4MS4A 2FEPA 1QP0A 4YR7A 1KMIY 1DP4A 4W5RA 2FVYA 3HEBA 5CNJA 1OXKB 2LBPA 3C97A 2MYUA 1TJYA 2QVCA 3I45A 4GPAA 4UHJA 2GX6A 3DGFC 5ED4A 3HO1A 3KJXA 1M2EA 5TQ0B 3URMA 3MIZA 2M98A 3FFWA 1P8AA 2RJNA 5IUNC 2QVGA 4MQEB 4EY3A 1ISRA 1MVOA 1VRVA 3DZDA 3OMXA 4XFKA 1ZH4A 3LOPA 4W5OA 4MS1A 4MPTA 1KRWA 3N0XA 4EYOA 4YWHA 2RGYA 4RV5A 4YCSA 2P9HA 2JB9A 4O5AA 4WT7A 2QU7A 1YS7A 2PUGA 3H1GA 1LBIA 3LUHA 2PE5A 4RS3A 4KVFA 1QMPA 4MR7B 2A9PA 5TE9A 1RNLA 5C5EA 4JB2A 5EWLA 1GCGA 4YLEA 4WXMA 4JA2A 5JS2A 3BRSA 3T6KA 1EWTA 1B00A 1TLFA 1YIOA 1W9HA 5IULC 5GQSA 3W9SA 3ROFA 3H1EA 5DLEA 1EWVA 3QK7A 4OTZA 4WZZA 2AYXA 2QZJA 1SXHA 2FLWA 4ZMRA 3GL9A 3O2SB 2QXYA 1CHNA 1QP4A 2FN8A 1ZDMA 1C4WA 4TLLB 2NZVG 1SXGA 1P6QA 1ZAYA 3LUDA 4PEVA 3UUGA 1ISSA 4Z9BA 3EQZA 2Q5CA 4OATA 1BA2A 3HK2A 3O75A 2PJUA 2PUAA 4F8JA 1QQBA 2ZWMA 4PYRA 4Z4CA 3HV2A 2MSKA 4G0PA 5TPWB 1EWKA 1L5ZA 4MR9B 5FBKA 1JHZA 3LUGA 1QPZA 3O1IC 2FN9A 2E4VA 4G0OA 2L2QA 2L19A 2FXIA 3SQNA 1QNLA 4LE1A 4RY8A 1JWLA 3BRQA 1PNRA 3HJFA 5CHYA 4D74A 3CNBA 4MS4B 3GWGA 5BRAA 1USIA 4G86A 1KGSA 2V0NA 4Z0NA 2NUBA 4RDCA 1DBPA 3EULA 1D5WA 1JF8A 3TO5A 9ABPA 1D4ZA 1FFWA 1ZVVA 3O21A 2HPHA 4KFCA 4S05A 3OLXA 2GI4A 1FFSA 5CNMA 5JS1A 1Z18A 4KRFA 3IDOA 4KZKA 2E4XA 3H5WA 4MS1B 1TMYA 2WJAA 4D6XA 2JK1A 3T95A 2PAFA 6CHYA 2GWRA 5KQGA 5HKOA 3OQMA 2A9RA 4IGAA 5CNKA 5F64A 2FQYA 1MIHA 3RQIA 3CKMA 4H3KB 4KQ9A 3VNAA 5EWLB 3H5IA 4G0MA 2JVIA 4IMIB 1FQWA 3CZCA 5JNSA 2PLNA 4KQCA 1EFAA 1Z2DA 2H3HA 3DLHA 5JNUA 3KLNA 1LJLA 4ETIA 4KMRA 4MLCA 4P98A 3N8IA 4EYKA 3NBMA 3QELA 5KC9A 1T34A 2X7XA 3M9WA 5BR1A 4QYMA 4XAQA 2MSWA 1ZITA 3CG0A 3H1FA 1RXIA 3I09A 5DTEA 5IUKC 4DN6A 4KPYA 1MB3A 1DC7A 5HM6A 3L6UA 8ABPA 2A9OA 1GLGA 5KQMA 4EYGA 4YRZA 2FW0A 3QLUA 5IBQA 4H60A 3GRCA 4G0YA 5I4CA 1NXPA 1QKKA 4NICA 4Q6BA 1GCAA 2FMKA 2LP4Y 1QP7A 4NCBA 2FQWA 3UKJA 3QLUC 3LUCA 1YMVA 3KYJB 4LRQA 2GBPA 3LUKA 5PNTA 4O1IA 3QX9A 4NCAA 3SG0A 4HNRA 4HNQA 3MA0A 4IF4A 3EQ2A 2IPMA 2JBAA 1URPA 3A0UA 1XWWA 2HQOA 1JLKA 2JCGA 5IEBA 4FE7A 3RVOA 3RVPA 3RVQA 2FQXA 3LFTA 5JNWA 4Z4FA 4EVQA 3RVRA 3O2QB 3ILYA 4LE2A 1GUDA 2R4QA 4E7OA 2ID7A 3KTOA 3CU5A 4WWHA 4O1HA 3MM4A 5EWJA 4YP9A 2AYZA 4G97A 4RK5A 4KK4A 1DRKA 2FKAA 4MAAA 1ZN2A 3KS9A 1NTRA 2QW1A 2VYCA 2VUIB 1OXBB 3KKEA 1P6UA 4DADA 2M1ZA 3EDCA 3IPAA 2YHAA 2VUHB 4L85A 3GV0A 1VKRA 5B3JA 1SXIA 3N53A 2LUOA 4JASB 3F6CA 3IPCA 5JNRA 2H0AA 3O2JA 4IRXA 3OLYA 4Q6WA 5TQ2A 3HUUA 5CNIA 3TB6A 4S04A 3E61A 5B3JC 2FEKA 5DCLA 1NXWA 1R8JA 1SD5A 3HZHA 1Z2EA 3LUJA 3TX6A 3C3KA 4RSMA 5IEJA 4D6YA 4OBBA 3FDFA 4WXEA 2B1JA 1I3CA 2MYPA 3BBLA 3NNSA 5FWXA 5IX8A 1JYFA 5TPZD 4RY0A 2JRLA 1YVUA 2NT4A 2N9UA 2R47A 3QELB 4YO7A 5KQLA 3ROTA 2PKXA 1NXXA 4KNYA 4N03A 1JDPA 3EJWA 3T38A 4RXUA 4IILA 4EVRA 2E4UA 4W5TA 2CHEA 3GBPA 4RKQA 1AB6A 3N0RA 1BDIA 1U04A 3Q9SA 4XLTA 2LPMA 3LKBA 4PICA 5C5CA 1DBQA 1A0OA 2P4UA 3H5OA 4YV7A 2W42A 2CWDA 1CYEA 1M2FA 1ZESA 2A9QA 4WUTA 4EGSA 1JL3A 1VLZA 1DCKA 1USGA 1ZHHA 2RDMA 3N0WA 3OLZA 2JBAB 3EODA 2FSPA 4QYWA 3SM9A 3FMVA 3LMKA 3A3KA 3R0JA 1XHEA 1Z25A 1LBHA 1E6LA 1JFSA 4EUKA 1BDJA 1RXEA 4JAVC 2MYNA 3A0RB 4DQDA 2OENG 1CEYA 1NXTA 3HM9A 3OM1A
chains in the Genus database with same CATH superfamily
2VDNB 5FWYA 4G26A 4I8XA 7MDHA 2D0IA 4R8RA 3NYWA 1HTTA 2IDJA 4MEJA 4DDWA 3OZDA 1TEHA 4U2FA 1W29A 4J0HA 3WJ1A 4C03A 1J0BA 2QN1A 4MYTA 1VXOA 1V7PC 1JDSA 3D7MA 4ME6A 4L4RA 5CFQA 1NW6A 1AKEA 1N3LA 3CV3A 1GR1A 1OLXB 1Y7HA 4OAQA 2EW2A 4RY9A 3P94A 3ZGLA 4JLPA 3L7BA 1Z9BA 2EJUA 3N8KA 2NUTB 1EDOA 4X7MA 2HA2A 2NU8A 1F4PA 2Q5EA 4K26A 1I3KA 5FOUA 2M6SA 3RS2A 2VDOB 3SSMA 2NPFA 2G6TA 4OA8A 4HAZA 1N92A 1QIDA 1Y1QA 2KLHA 2WWTA 1E3TA 3IXLA 3KVOA 1N6PA 2ECKA 3TM4A 3WLQA 4B4WA 4CM4A 4D8YA 2XTJA 2DQ4A 1N1DA 1OHHD 3TPFA 3CWQA 2H8GA 7REQB 1C0IA 5JH7A 1GZ7A 1SIUA 3PNMA 2P6UA 3WAJA 4U7TB 1O8CA 3UCEA 1L5VA 4DT1A 1AZWA 2ZR0A 3B51X 1A04A 5JDIA 2A0XA 4I81A 1WY5A 3WWOA 3DLPX 2HHHB 1GILA 4N47A 5EZSA 2Q7OE 4O3FA 2I7CA 5I3ZA 1Q3KA 2BGIA 2H5IA 3EHDA 4HDNB 1BEUB 3S5JA 4Z7QB 1E5LA 1KRXA 1Z08A 3OEWA 1GAJA 2NTEA 4R5MA 5F5XA 4EYSA 5KINB 2R8PA 1E1DA 1XU7A 4FYMA 3ZZMA 4G4IA 3KYCA 1I4LD 1EAYA 1TU3A 5CX1B 5KDLA 2QG9A 3FBTA 1CS0B 1JLLA 4WCVA 3K05A 3DLAA 1JIIA 1LU9A 1PR6A 3KAQA 4ZVTA 1CY0A 1OA0A 3HJCA 3RABA 2IPNA 2JVKA 3QHAA 2QNIA 3VTFA 4QX6A 4PXSA 1FUKA 3R77A 3Q9LA 3THRA 2OBLA 2NZ8A 2Q9AA 2A35A 1W8DA 3HNPA 2I0FA 3SJUA 3HPQA 5FP0A 4N41A 1R5JA 2NGRA 3K32A 4QGGA 3AVOA 2YINC 2W8BB 5TJHA 4RADA 3UK6A 5IJ0B 1LK0A 2OBNA 4WZBA 4XGRA 5F9FA 1J2EA 2GZ2A 3D8UA 1CRLA 3CN9A 1UQTA 2VQEB 1SOWA 1SIBE 1XZPA 3BGOS 1KSGA 4V0QA 4I55B 1Y6FA 5EMHA 3CJTA 2PD4A 1PGOA 4MCJA 2UZ3A 4PSAA 1ZCJA 4W9RA 3TI7A 5FAKA 4Z1MA 1U0GA 2UYYA 3U3ZA 1DJPA 1I0LA 5KX5A 5KO2A 4NJOA 4CBVA 1GL7A 1OPXA 1QG4A 3P9NA 5A0FA 5AM2A 5K8VA 1QPBA 4B31A 4ZYLA 1Z5WA 1OTYA 5KWJA 2IYSA 2QMUA 1CZKA 3SGLA 1OGIA 5HCIA 1QHNA 4HS9A 5KYXB 4YUWA 2DY1A 3VNBA 3KK0A 3E7DA 2G6BA 3HWSA 5E4JA 3VPSA 2V7EA 4QYIA 3NBKA 3CLUC 2RHGB 4MWGA 5D85A 2AB0A 1W6UA 3HKEA 3NYRA 4PZUA 4R1TA 3TQHA 3ED1A 2NG1A 3MG9A 1R4NA 1N6KA 1T26A 3UH1A 2D5IA 5AJZA 1I36A 1P0QA 1POWA 1OXXK 1WMFA 1YUBA 2ZJ5A 3W9BA 2FWBA 3NGXA 4CIAA 2CLKB 2OB1A 2DOKA 4PRKA 1KI4A 6AT1A 5KNCH 3EE6A 4J1NA 2EDCA 3H2IA 2YC2C 3VBEA 1ZBDA 3CVVA 3CX8A 4P5EA 4PXYA 1BWPA 4P35A 3JQ7B 1AM4D 4Y2QA 3FPJA 2VVTA 2F4VB 5DNDA 1HNWB 2Q46A 2NZXA 1IOZA 1E2DA 4IXDA 3TRFA 3UN1A 3FKSD 1Z5VA 1C81A 4QQFA 3RSGA 5IANA 1OI2A 1JHQA 5AJWA 3GNSA 4O1MA 1B16A 3DE1X 3H2GA 4NARA 1IZ8A 3PQ4A 4Q39A 4QU9A 1W36C 4RZIA 5K3FA 5U4XA 2A57A 4RZSA 3UT5B 2W2MA 1SWWA 2PT9A 3F3KA 3NOOA 4JLOA 4MLPA 4QWWA 2O1WA 3QFHA 4N65A 1STOA 1Y1SA 3CUWA 3KKPA 3CEPB 1U3UA 2H5JA 2Y77A 2E4WA 3DKIA 2OGSA 3OZVA 4HYTA 3VDXA 1FFEA 3GLSA 1I3MA 3GJQA 5BSRA 3DDSA 5P8WA 1MX9A 2WJJA 3PNVA 2GRJA 3KQVA 4UM8B 1CYDA 4B8WA 3PEVA 4MYHA 3OKPA 1WZIA 1DWOA 2VJOA 4DNXA 3QVWA 2QLLA 4FUQA 1PUXA 1U81A 4H7EA 4HDCA 4IDHA 1G0NA 2QZ4A 4KFUA 3UQYS 4TKVA 3U4QB 2XMGA 1DXHA 1KJZA 3D3WB 5L3SB 3KZKA 1X7DA 2IU4A 2VJMB 2D6FA 1AKNA 3DBIA 3LT4A 1HDZA 5CJPA 4BEBA 4TKUA 1PHPA 2CHGA 1O9BA 3LIPA 4MR7A 2H3EA 1B4DA 3IMFA 2DE0X 1QDEA 4KBFA 2VP6A 6PFKA 5I47A 1SD1A 5I7RA 5EY5B 3V8PA 1NBME 2FDRA 1USKA 4BEVA 4EBFA 2EGHA 4BV3A 4NNOA 5HE8A 2OGWA 2OSVA 3AM5A 4GF5A 2CUKA 4YP1A 2QYOA 1AS0A 3UJPA 4N5LA 1VBFA 1GL6A 5LD2B 4IVNA 3CVJA 3LT5A 3P5BA 4GRIA 1E9RA 1KK1A 2JGAA 3D54D 1G4HA 1E89A 1RRPA 5HGJA 3EOAI 1AKYA 2X8JA 3WIVA 4BMXA 5EHIA 2I34A 4WLUA 1VMDA 1WCIB 3WWDA 1L3IA 2A1UA 4KFRA 1YL7A 2DQZA 2FUG6 3DBOB 4LBZA 5CA0A 1F8YA 3MCUA 3QG1A 3X1WA 2C2MA 4WECA 4XXHA 4TLMB 2D8AA 5D6OA 4DEXA 3DNFA 1HLFA 5ED0A 1MHTA 2PKCA 4DLXA 2IHKA 3A6JA 4M36A 1JWAB 4N7RA 5K3EA 1QQAA 5TGTA 1SVMA 4L4UA 1B1CA 1HDIA 3LW8A 3CPEA 5E7IA 1EFVA 1J25A 4OL0A 3TR0A 2Z5LA 3I04A 1XEWX 4OQXA 5KCMA 4BMSA 3IQFA 1YBHA 3B1XA 2O3JA 3IJRA 4MVJH 4MUKA 3BWMA 3ZUGA 4OLFA 1GZHB 4DIKA 5A4KA 3FWHA 5ARDA 1HQYE 3C45A 3N1UA 2I54A 2I66A 1LEHA 1AQ6A 1E6MA 1ZK3A 2IQIA 1KEUA 2YR0A 4E2FA 1WF3A 4HVTA 2QV0A 3HEMA 4RD1A 1NX9A 5AOBA 1ORIA 2FFQA 2OC4A 2ZSUA 4M1EA 4MS4A 5EE5B 1GG8A 1N75A 2LR0A 4OJYA 3SOPA 4HUTA 1CY6A 1GTJ1 3WGYA 1HSZA 1AN0A 2WF8A 4LWPA 5TSDA 2SCUA 3HV0A 2GUWA 1PZEA 3IS3A 3EVAA 2DTEA 2LIPA 2C9MA 1KEEB 2HV8A 3PX7A 3V8VA 3FWKA 1OGYA 5CVDA 1AU9A 1I24A 4KSCA 3T54A 3HO1A 2I3DA 4KQHA 4RVGA 3F3MA 3QW4B 1I0ZA 3G5AA 2JLSA 4KAJA 3TSZA 2V1UA 1UINA 2FSIA 4QUEA 1A9QA 3LOPA 3PR1A 5KWEA 2C98A 3N0XA 4LSMA 4YWHA 4L72A 2QU7A 2NO9A 3NBXX 5JIBA 4BKMA 1E2EA 2FRDA 2IU6A 2WSMA 4RNCA 1GT91 3IP1A 3SXJA 4PQRA 1MOQA 4WXYB 4IYRA 4AECA 1X15A 2GBIA 3CUEF 2FP4A 4QDZA 3DM9B 4GLFA 4K6FA 1IHDA 3C1AA 4CMAA 3Q7PA 3ZD6A 2FRDC 2X0KA 2HEVR 1GN9A 3AV0B 3HKDB 5ELXA 2Q8QA 1WHSA 2XE8A 1OXUA 1P0FA 3OIUA 1A76A 4NXMB 1WCV1 1HR0B 4RVFA 1YZQA 2UWIA 3ROFA 1USUA 2QQEA 2ZBFA 4JBYA 5JSZB 4X54A 1R6AA 5EGSA 4NG4A 1ZI8A 5EZ6B 5AIBA 3GLIB 2ZRBA 2HWXA 2GVZC 3BCHA 3ETCA 3G8DA 4ZCTA 1TM7E 2AK2A 3ESCA 2ZUVA 3TXAA 3YASA 3ZHVA 1GGFA 1G63A 4UC0A 1DQNA 3UUGA 3GJTA 5K6TA 1UPBA 1XU4A 2JW5A 3O93A 4ZRMA 2QN8A 3A14A 1Q77A 5A6SB 4UQLA 5JFOA 1QG6A 4PBSA 4LHEA 4TZTA 3B2EA 3V1KA 1OZAA 4X91A 5AVUA 1EJ0A 1L5ZA 1CY4A 3UXMA 2X23A 2AG1A 4G8DA 1SRQA 1H66A 1YCGA 2WJYA 3EPPA 3IJ2X 4H2DA 4K3VA 4XH9B 3I9KA 2CDBA 2G7ZA 3UYKA 4ZT7A 2CW5A 3V8QA 4WCFA 1ARZA 2PWYA 4KH0A 4TXJA 5DYIA 1DIGA 1JWLA 1L4LA 2R85A 3BRQA 3ELYA 1DKMA 2E9SA 3KU1A 4KDEA 4YECA 1J70A 3GWGA 1Z28A 5C3MA 2WA1A 3FNRA 4ZT4A 5FNZA 1W44A 5JEDA 3MN1A 3VKGA 1U0RA 5IASA 2R1UA 3WIBA 2WZBA 2F9MA 1KJNA 5I45A 1M6WA 3A28A 5ELMA 1Y8CA 2FVXA 1JKFA 2OFOA 3LDAA 2V6MA 2QYHA 4Q82A 5BN4B 2QQ5A 1VKZA 1GAQA 1HRDA 2GLTA 4HDRA 4L02A 5J5AA 3T06B 2F1JA 3HUFA 3GHYA 1IZZA 1AUOA 3OVMA 3Q6NA 5M5BA 1C1DA 1N1MA 4FEYA 3CRZA 3VPHA 1ICEA 1SCBA 2FPKA 5P21A 2VQ3A 2A9RA 1JG6A 1HF3A 1ZK1A 3ONFA 3WLSA 5JFGA 1KO1A 4LSZA 4JI3B 1G9SA 1OI7A 1XVVA 1YZNA 2DT5A 1V11B 4JROA 1UBCA 3QKUA 4D8VA 5JD5A 4IIJB 4IHQA 4NU8X 3X1MA 4YMTA 1XCGB 1ZH8A 2FNAA 3LX5A 4BKRA 4PS1A 1MJFA 1CZUA 2C57A 2XUHA 3IUSA 4UM5A 9ATCA 1FS4A 3GLHB 1AOXA 2RHRA 4LCBA 1PL0A 1QMGA 4OJNA 2JFZA 3DF7A 3A4TA 3L1VA 5DTEA 1MH1A 3MMZA 4B40A 4BTVA 1LB1B 3GRUA 5TF0A 4EG3A 1SQ5A 4UFPA 1ESDA 5GTDA 2QWXA 5KPDA 2QBYA 2QTLA 4LK2A 3PQCA 5JATA 1KYTA 4M1KA 4JYCA 4MICA 2XNDA 3C74A 1E66A 1E92A 3E7FA 3S0JA 2ZGVA 1GDHA 4M1QA 4E2WA 2XXAB 3VH4A 4ARIA 1UT6A 4EATA 1FBTA 2OXFA 1FXWF 4OHCA 3SG0A 4QOIA 2VH1A 1QVAA 1CDEA 2IPMA 3HN6A 3W7VA 3A0UA 1WEKA 4LJ4A 1QZ3A 4K9MA 4N6NA 4PSUA 3Q8KA 3UJHA 5FULA 3GCWA 2H06A 2ALJA 2EFDB 1JEJA 3O2QB 4V3BA 3TINA 3LHFA 3V5NA 5KYYA 3F74A 3DAHA 2AZTA 4ESHA 1JJAA 4FINA 1K7CA 4MKGA 3O8DA 2UYCA 1QV9A 1YFJA 2OZEA 1U5BB 1JPJA 2W00A 2G83A 2FKAA 1NQOA 1ZN2A 2AJBA 4GI7A 2VUIB 2RH9B 4HYYA 4P3XA 4JUCA 1XL0A 3TJZA 2E6UX 3AOEC 3E9MA 1T9GR 4W5HA 1FU8A 1NMSA 1OLXA 3ANYB 2IUUA 3M82A 4NENB 1DELA 2C4TA 4YMIA 5I7EA 3WJAA 2H59A 3EASA 4E5KA 3PXAA 2XB4A 4GOJA 2NUTA 5CIQA 1AQIA 2VSOA 4J94A 1ECCA 3W3AH 3MFYA 1ORHA 3DEZA 3B7PA 2XOKD 5BQPA 5JCZA 1R8JA 3WQRA 1NIPA 5C2JB 2RHCA 2WWXA 4RSMA 3KDSE 4J0IA 2AOUB 3RG2A 7REQA 2MU1A 1JEAA 1XKQA 5DMXA 2ZU6A 4EKIA 2H29A 1JNYA 2P0EA 1I3CA 2DU8A 2MYPA 3NNSA 2VPTA 4GZ6A 4I9NA 5H59A 5KNCA 4OAOA 2I4MA 4TXMA 3A05A 4DJDC 1ZISA 1U2SA 4CNBA 1VKHA 2DBQA 1EXMA 1G6OA 5BR7A 1LTQA 3PV0A 4GMDA 4MGZR 3PPXA 4WSOA 3VNSA 4AN1A 2G0AA 1EE1A 2JAOA 3AJ9A 3EJWA 1IHUA 4ASUD 3GBPA 3DTVB 4HDNA 4RKQA 1AB6A 1ULBA 1XC7A 3WRWA 2PEZA 5K8UA 2X1LA 1GGKA 1RJEA 2IYWA 3PXUA 3R7NA 4TWRA 1X42A 1YIAA 2V4UA 4L75A 2O7VA 4YT8A 4CEHB 4URVR 3EDYA 4S2EA 1CS0A 4XWKA 1KEKA 1KH3A 2XUPA 4UVDA 1GV1A 1R66A 2F64A 2JBAB 3OLZA 1TYZA 4UUQA 2OFXA 3W79A 2AW2B 4YV0A 1ZUNB 3FMVA 1HDYA 2C95A 3DR3A 3WLIA 4B6QA 2CNLA 1GNPA 2QTFA 3LRPA 2V8OA 4JZKA 3A4VA 2WV9A 1RD4A 4GGOA 1OVMA 3BIOA 5A3VA 2MYNA 5ADWA 4PS0A 1TYDE 4ZREA 5IMBA 2EFHB 2W8BA 4F5ZA 1U4NA 4B35A 5IJ0A 1XWFA 1N6RA 3P45A 2V7UA 4JEUA 4Z54A 3ZVKA 4FFVA 5K05A 1C1YA 1TA9A 3EVDA 4B48A 3W0LB 2ZVDA 3MOGA 5I8ZA 3HJUA 2ZE7A 2NQ2C 3KQWA 4AKTA 2M1XA 2ZYVX 3CVUA 4QUIA 2G1AA 1ORDA 2XT0A 4OH1A 1O2DA 4RSHA 1EHCA 3AM1A 3LCCA 2C5FA 3BT7A 1JEQB 3IIIA 4EJ2A 2OZLB 3RFUA 1BH6A 8LDHA 1SBCA 1XXHE 3KJIA 1C0KA 1M5UA 2BBTA 1RHUA 3BILA 5KYXA 3O1HB 1JJ7A 3K9GA 1VPWA 2JLYA 5BSGA 3JQ9A 4EFDA 5F51A 1QQ5A 2PKWA 1E8MA 3LPLA 2QJRA 1BDHA 2ZSAA 3U3PA 5F3DA 3VI4B 1BDMA 1IC6A 1KOFA 1QHFA 2W4MA 3JQ9C 4HBZA 4EPTA 4F12A 4DQ0A 2WKSA 3U4HA 5J58A 2OXRA 3FHCB 3PQ8A 4RCVA 5AUOB 3VHRA 2DFLA 3KYIB 1IZ7A 5CLIA 1OH8A 3CNOA 2WP0A 3G1TA 5K4GA 3JQ7A 2UZAA 3O8LA 1ZD2P 2ZIVB 3DWIA 4FFOA 3GUYA 4HWKA 4LECA 1Z6AA 4M88A 3TBFA 3I2HA 3CKYA 4R41A 1YS6A 2AEMA 1EP2B 3KBBA 5A62A 1Q20A 3BK1A 4QEKA 2ILVA 1OAKA 3L7CA 3K70B 4QEZA 4JA0A 3SN6A 4MI3A 1NKTA 3GRPA 4DWOA 4MUHA 4EP1A 2B2CA 2HJ9A 4KXLA 5DM70 2FSFA 2NV6A 3AVYA 4GQAA 3STYA 3UT5A 1PT5A 1BU8A 5EQJB 3RC9A 4II3A 3VU3A 4CG2A 1BC5A 2GYVA 2WOJA 1SKAA 5IK2D 4DR7B 5EJ7A 3NHFA 4PYMA 3BULA 3K8YA 4WKCA 3KG2A 1JAIA 1WPQA 3HADA 3DAPA 5AHWA 2Y0DA 4AWAA 1ZU5A 3BD7A 1NRIA 2NUPB 4KRYA 4R16A 1BQ3A 1IY9A 4YPOA 3R8CA 1A9RA 4UTZA 1XRJA 3QNWA 3EF3A 3I9V6 5C34B 1P4JA 1OGJA 3D3WA 3VHQA 3PEUA 3U0BA 4AFNA 3UB4A 5L3SA 2KYRA 4M4PA 3ROGA 2VJMA 2CLEB 1NVXQ 1ZIOA 3AI7A 1YBMA 1GDTA 2W6ID 4ID9A 3IDFA 3VYRB 2PZFA 3O2NA 4Y6LA 4F4JA 4MQ5A 3UMCA 4HJXA 3ZIDA 1SM4A 4N3NA 2I22A 2R96A 5FTJA 4IZIA 3LE8A 1M0WA 2LDXA 5H5JA 3C1OA 1V37A 2FPUA 3H97A 3KWMA 4L5IA 4WI1A 4HZUB 1LPBB 2PSDA 4LCJA 1GRVA 3OO1A 5AXCA 1SC9A 2D5BA 4U39A 2WLSA 5F78A 1JFRA 2OBMA 4ROTA 2OZPA 1N2IA 3D4BA 1W52X 3GA5A 3L0DA 1P2FA 3R3ZA 5HF8A 3RJZA 4CM5A 4U8HA 2QLBA 4ZCSA 4FI3C 4ROSA 1OKKA 2IFTA 1WCIA 3JQEA 3E8SA 4BFSA 5LD2C 3EEFA 1TC1A 1XBTA 4MLDA 1SG1X 2WVAA 3IP6A 5ARCA 4JS0A 3V00A 3F7TA 3GUZA 3LO8A 4P2BA 4YRCA 2X19A 2Q3CA 1ZMOA 1SKYE 3QYPA 2P1DA 4W4TA 1PZHA 1WPGA 3T9EA 4ENRA 2IU3A 2QIOA 2QW0X 2C2XA 2Y9PB 2YZ2A 5LDDC 4EWLA 4TMXA 2FMUA 1BWQA 1BAPA 4IFEA 3QE2A 4S0XA 4EOGA 2CD7A 1QRAA 5H9VA 1DC3A 4JB8A 3J7TA 1QP8A 3PP8A 3PUKA 4F2GA 4PX2A 4DCUA 3FWZA 2XDWA 1JZQA 1RM4A 5B4VA 2ET6A 1KYXA 2QIPA 1IYZA 3IUBA 3OJFA 1SELA 4IIYA 2EQAA 3GVHA 4OLJA 2CZQA 2E7ZA 3I3OA 1TUGA 1JXQA 4QNRA 4ER0A 3ZVNA 2Q6OA 4D44A 4EPRA 2O14A 3DAYA 4EA9A 4QVIA 1EQAA 1Y1RA 4L76A 1T2AA 1WSBA 1XA0A 2YL2A 1OYYA 4GHWA 1RXVA 1GUZA 2B6NA 2FR8C 5HCUA 5B1DA 5EUMA 1RLIA 2R25B 2WJGA 1NBWB 4QDUA 2YQ5A 2ZRKA 4R3UC 1KEEA 1Z8FA 2PUBA 2AKEA 1VL5A 2INGX 3L4JA 3O1JC 4IKEA 1GWNA 3CPSA 3LQYA 2ID9A 4P33A 1IJFA 4D81A 1LF0A 1FYDA 1TQ4A 3EDOA 2WZCA 5KNBD 1H2HA 1EJ6A 4M0MA 2EZ4A 1WF6A 4ZHQF 3Q3CA 3E1GA 1GN8A 1CQXA 2J48A 3QEKA 3WFZA 4EEXA 3PJRA 2CFIA 3JD0A 2Q9CA 2ZI9A 3L7OA 5AXAA 4E51A 4Q48A 5AMXA 4C30A 3TJEF 1JIUA 2O2ZA 3FYSA 1GPDG 1G8PA 4JOSA 4EJSC 5BR4A 1EESA 1FLAA 3LUBA 1R6VA 3TUZC 1SHTX 2JLVA 1COWA 3OWHA 3I83A 4HVAA 4RV4A 2R0QC 1U8AA 2DYKA 3BSYA 1Z63A 4IV8A 3HKDA 4IUYA 1D1PA 3TZCA 1GQRA 1LPPA 4I4TB 1V39A 1WKVA 4RKRA 5AM5A 3TSOA 3SP1A 3VTAA 2XMCA 4N7MA 5BNWA 2UVDA 2XNCA 5E0KB 5HTOA 4EZIA 3MS4A 3RI3A 1H2XA 1TIPA 2ACKA 2B99A 3M6MD 3NANA 4DLPA 1CUWA 3PENA 2Q1YA 5JSZA 5BQ3A 1JW9B 1AQJA 1ISMA 4C04A 1X7XB 2XVYA 3SM3A 1Q95A 3GLIA 1U6KA 4C6HA 3P2MA 1T3GA 4OXXA 3R7AA 4RIIA 1NDUA 2ZRGA 3NW9A 3DZHA 5TPZA 1MG5A 5F1YA 3SE0A 5CFNA 3JAMA 1VA4A 2O7SA 2ZTVA 2QRQA 3B52X 3HDVA 4NV0A 3EIFA 1HDRA 1WXXA 3QRWA 2BBOA 1L5NA 3T1OA 3AFMA 5A6SA 1CP2A 5IAAA 1DJQA 4ZAXA 4YJDA 2WT8A 3MMNA 3VDRA 2ZCUA 1S8NA 1J8QA 1RP7A 2IJGX 2RI0A 4MGYR 4MQFB 1ODLA 4PNHA 4RFLA 5DBEX 4ZQFA 1Q1QA 1SXJD 1TCUA 2AMJA 3MB5A 5DHUA 4KOEC 1XDUA 2OR3A 3LVRE 4PLVA 2V0CA 2QL5A 3BUSA 3Q12A 3ZE6A 2IVZA 4JSTA 3AL2A 3MAJA 4OY3A 10MHA 3Q7RA 5LZ9A 4MWEA 1TO1E 3AP1A 4KPGA 5JNLA 5AJTA 4QGSA 1G3QA 3OCCA 3FE2A 5TMBA 4YR7A 1IK4A 4ZZIA 2BGKA 1C50A 3LBYA 4LHXA 3ZV7A 1E9FA 5IBPA 1L2TA 4XB6B 2B1RA 3N7AA 3V6LA 2Z9CA 2X77A 3C97A 4ZVVA 5K0JA 1MO4A 2G1KA 3RIGA 1SUAA 3ZGZA 1TJ3A 3M4YA 1O94A 4M0KA 3MILA 2RGEA 4RYLA 1KNXA 4ND8A 3F78A 5TQ0B 3UMSA 5KQSA 4ZAVA 1HFKA 3OM9A 4GGMX 5BN4A 4MQEB 3BUKC 1HT0A 5AKEA 3TOVA 1T8RA 3ICEA 1O94C 4HN4B 4G5RA 4M1OA 5HZKA 2JBHA 4WOPA 3WLAA 4TOIA 4H31A 2NSHA 4TRNA 2RGYA 5K5EA 2PSEA 2NPOA 3SOZA 4BLOA 1K7XB 3I76A 3IAXA 3B6JA 3KB6A 3SI7A 4OBWA 1GUYA 2E1RA 5ALXA 2P6RA 2C5EA 1V11A 3QFCA 4IW3B 3EGOA 4IIJA 3N87A 2H31A 2ZULA 4HCJA 5JYBA 2X9NA 1EWTA 1SKUA 5IULC 5BUZA 3RYCB 5CW1A 1NZFA 1O96B 3BBPA 5K1ZA 1OI4A 3GLHA 1NPTO 2OP1A 2GCOB 4NOJA 3A26A 3S2ZA 5JTTA 2H1IA 4B7ZA 2H1LA 3BE6A 1MENA 5KB3A 4E5VA 1ZDMA 3MCAA 4MXWR 2DPGA 1SVUA 3B1FA 3NEJA 4C14A 2GBGA 4F9GA 5JFTA 2DF8A 5EOVA 4PEVA 3EGWA 1TJNA 4HQNA 4HJRA 1VYUA 1XCBA 4YMVA 4ZWNA 3OPNA 2CXOA 2W2NA 1UKZA 2XXAA 5B7PA 2SNIE 4J3FA 5BQFA 1ADCA 1O7JA 2E5WA 1QGYA 2FB9A 1EVYA 2GSDA 4LDNA 5TPWB 4PN7A 1GPAA 1TM3E 4EPYA 4WTOA 4QFDA 1O4VA 1J20A 3TCKA 1GTSA 3JR3A 1DBSA 5WRFA 3WAKA 4ZV7A 5EPOA 4AZTA 4YCBA 1SY7A 2F3TA 4FN5A 4NBTA 1Q7RA 3DC2A 1N1EA 3L8GA 4Q1VA 2XB2A 3VR4A 3GDHA 4WASA 1S1MA 1IWOA 2YQ4A 3NWJA 5D01A 3DUFA 3ZJTA 4HZGA 1KXZA 1YBVA 1Z0IA 2PDAA 1MC8A 5JCOA 5C8VA 3F4LA 4INOA 1SB8A 4BAUA 1U5BA 5ARBA 5EP4A 3TO5A 1QCCA 1YACA 3D4PA 4PG5A 5K01A 4AMVA 3O21A 3PDWA 4RPCA 1Z4LA 2G63A 4X1YA 5DBIA 4CG3A 5JCOC 3KQYA 3T5AA 3CEAA 3CXUA 4LXYA 1YDGA 5HILA 1PWHA 4J0GA 4BQRA 5IDWA 2YIDA 2IK8A 4NENA 2A0KA 3CZAA 4KAAA 1GV0A 4RX1A 3P2EA 3CLTC 1C3VA 2BTEA 2XHZA 4UU0A 4EHIA 2KLBA 1JI3A 1S2NA 4A73A 2DY0A 3R7BA 1EUCA 1YZFA 3FCEA 2P2DA 4WN9B 2JATA 1XMIA 2HLDA 1BVUA 1N2XA 1YVPA 1SIWA 2GCIA 3P0RA 3UAVA 4FMDB 1N2GA 4FR0A 4P2GA 1JJBA 3WYDA 3DYIA 5JNSA 2AOUA 1YJ8A 4O5OA 1MO6A 2JEZA 2DHCA 1H8HA 5JNUA 2QUJA 3IT3A 2OL4A 4BOYA 2JKYA 1KH1A 4AXBA 1FNSA 1FYWA 3M9WA 3B9PA 1XK6A 2Y2VA 4MHOA 3K4QA 4G5YA 3TSAA 1DLIA 1AXGA 3JV7A 4R2XA 4DCGA 3FZQA 2ODNA 1AE1A 1Q57A 2P2NA 3PXEA 4XTRA 4YMSA 3DTVA 4AMBA 1UP6A 3RRNA 3AKDA 2ONKA 4G0YA 2I7VA 2VDKB 4J03A 1QKKA 1YKFA 4CL8A 1GA4A 4FCWA 5DEIA 4M86A 1ECPA 4CEHA 1G5FA 3D2CA 5JSFA 3HJAA 2GYUA 4LRQA 4ZCPA 5EJ8A 2Q1XA 1T6NA 3B6IA 5KHOC 1N2JA 1I3NA 1JB9A 1U2TA 3ODGA 5CVEA 3B7GA 3DXXA 3L7IA 3ZG6A 4AB1A 2JBAA 3RVOA 4EUNA 1XWWA 4MWBA 2I4OA 1ZUNA 4ZK2A 3OD5A 3QI7A 2J33A 3X1ZA 4CL3A 2ADOA 2WC1A 3QFTA 4X9XA 1D4VA 3BWBA 1X9HA 3ADDA 1QKIA 3I6ZA 5CAEB 1Z0SA 3ZJVA 5LA6B 2Q21A 3FCOA 5EHNA 2VH2A 1RM3A 2W37A 2R4QA 1L4GA 1XRMA 1U0TA 1VE1A 2PQ2A 4MRSA 4PZYA 4RKEA 2Q5FA 3HABA 4U3JB 4L78A 3MBWA 2NACA 1ZX1A 1MA3A 1A69A 1W85B 1SG9A 3DV2A 3IBGA 3MM4A 1AXRA 4H27A 4IEIA 3VC2A 1BXGB 5ALOA 1PYGA 4Q03A 5E38A 1TEZA 1P74A 5H81A 1YSCA 1XDWA 4BVBA 1YL5A 5LYJF 1QHGA 4IO0A 1CE8B 3ETNA 4G01B 2I33A 1P4HA 2UYGA 1GNLA 2PJZA 3AF4A 4JSYA 5E2BA 3C6KA 2VZ9A 5E9QA 4ABYA 4DV0B 3H9GA 3LPNA 3NFYA 1F17A 1WUHS 2JI7A 3C1TA 3NBAA 1WUTA 3D0OA 1TQ2A 1JEQA 3IPCA 2IP4A 3Q2OA 4ZOQI 3CR7A 5AVRA 1QQTA 2OZLA 2BSXA 4TXHA 4JQOA 2YASA 1WD7A 3DJFA 2D13A 1PSDA 4MIKA 1AH2A 2P5YA 4BFVA 4BU1A 1A5TA 2WHEA 3V4ZA 1I01A 3HCFA 3KKOA 4KAXA 3RQSA 3ZYCA 5IEJA 2AG8A 4EGAA 2G9RA 1I1HA 3HYTA 4TMTA 1DDGA 4WBNB 2CB0A 3O3CA 4M87A 5AJUA 2IX3A 2C3OA 3BHIA 4BWFB 2ORYA 3WYAA 2O23A 2YNMC 3HL4A 3S3TA 1UJ2A 3RIYA 2V6JA 2VUTA 1EG7A 4UNQA 1YR8A 4B6JA 3OICA 5KSPA 4FW9A 2W8ZA 2R6HA 3DDWA 4FOSA 3BTOA 1JSCA 2OAGA 3JZIA 4KDFA 1KHHA 5ALLA 2H1CA 4XLTA 1MAAA 5HOEA 5BWCA 1AUQA 2HTFA 4JP3A 3EOBI 3M49A 3DZIA 4KMMA 4KMSA 3NUGA 3FB1A 4UD2A 4H77A 2CFSA 2GZMA 5KTKA 3FIUA 3TIIA 2VT6A 3WBKA 2FJUA 2VJLA 3IAS6 2WWRA 1KR2A 4TTQA 4YAGA 5L9AA 2RDMA 1DCKA 3H5AA 4PQEA 1MQSA 2J3KA 3LP5A 3TM5A 3M9LA 3SM9A 3SR3A 3R9IA 4UNRA 4LZAA 3RTCA 3PCXA 4ENTA 2CXUA 3CEHA 3OEHA 5BVGB 3ZK9A 2BEVB 4JAVC 3HZRA 1ZWLA 5BN3B 2JDID 4R7GA 1QHSA 4P8RA 2XI4A 2O8DB 3OM1A 3L6OO 2PVCA 2NUPA 3PQ3A 5JYCA 4CTNA 4RHTA 4ZU1X 4CL2A 2ZUFA 4QUKA 2XSZD 2QTVB 1Y89A 3LBNA 3EQ6A 4JLAA 1N25A 1RPNA 5TT1A 3WL6A 1BYIA 3AV3A 7MHTA 1L7BA 3T1NA 3KUKA 3OCYA 3A1FA 1QKJA 5AJYA 2VF5X 3BXGA 4TTIA 1RC1A 1QIIA 3PXBA 3LM8A 4BLVA 1HEYA 4BB0A 3L8YA 1IBLB 4LQ4A 2ZTMA 1APBA 4IG9A 2XCOA 5LBUA 3OU7A 1MAVA 2ATIA 4LMPA 4M7WA 3BE5A 4D0NA 4HZUA 1ZJ4A 3SYNA 4JKOA 5TQ2B 2MMCA 3BTSA 4MP3A 4TSKA 4BY9E 2RI1A 1AK1A 1TZ2A 4HH0A 3AHGA 3BDVA 1YK0A 5F3RA 4RF3A 4BCBA 1T1IA 3OQPA 1Z75A 4DR6B 3FB4A 4J7CA 5EPEA 5AW7A 3AIOA 3ANTA 5H9WA 4IAOA 4Q9KA 5LSAA 3GFSA 4JI4B 2G9NA 1P1IA 4Y2YA 3WXBA 4RTRA 2XYGA 3GPIA 3E2MA 4ISBA 2R84A 3CURA 3GW8A 3UJ6A 1R88A 2VHZA 5COQA 3T4PA 4BYMA 4DDMA 4Q3KA 1KY2A 1SKQA 1C9JA 5FI3A 3VYWA 1B6GA 4B3BA 4BNMA 3AF6A 2QVXX 5T4HA 4LF4B 3Q5DA 3FOWA 1USWA 5DO9A 1ZAKA 2CNNA 4PYQA 4XYBA 4OB7A 4CPDA 4FHQA 1YZHA 3D6FA 1VRWA 1ZGZA 1YFKA 2ZT6A 3KR1A 3LF2A 2YVKA 4G2TA 2A9FA 4IS2A 2NV2B 5KJCA 4ERXA 4U2CA 5IWAB 2CDNA 3OX3A 2FPSA 1JHMA 3ZWKA 2QENA 4NU5A 3BD9A 3L0CA 1N0IA 3QY9A 4UPEA 2YZGA 3VNVA 2JIMA 3TRIA 3IEKA 5C46F 2IBTA 1YR2A 4H7KA 1WXDA 1N5RA 1XFDA 1ZNZA 3GUUA 4ECEA 2J09A 3NBFA 1EWYA 2YW9A 5DEOA 2FZVA 4WN3A 2Z2ZA 4O33A 4MYRA 5ILOA 1IZ9A 1M7BA 4M1ZA 1VG9B 4HFJA 4MA5A 1XZMA 3KKZA 3DHWC 1VECA 3OFVA 3DQQA 4Q93A 1CX9B 3D2AA 3OT1B 3ZBPA 5CG2A 2DJIA 3M81A 3C16C 3DMGA 2PWAA 3AR4A 2VUSA 3AKCA 3IULA 3URFZ 3A25A 3NOXA 3SDZA 2QB5A 3ROZA 5A06A 1AA9A 2XGJA 5A0TA 3GFPA 1KI7A 2I65A 2W2LA 4X95A 2J67A 2HBQA 4QG7A 1TTQB 2WPNA 5E6RB 3EIEA 4AK9A 2DH6A 2O2JA 1DX9A 3D6UA 3QWAA 3FJ1A 2IY7A 1G8JA 4QPJC 3HCOA 3GRYA 2P0YA 4RCZA 4UNSA 5I7AA 2B4AA 3DG9A 4X7RA 2R8RA 2BDTA 4ILEA 4WKBA 3WLFA 1DAFA 1SHUX 3L02A 1VL0A 1SQ0A 2CK3A 4BMNA 1SUCA 1X7XA 4Z51A 2GM5A 2JIDA 4HLQB 5MHTA 1UFRA 4FOLA 3OG9A 2DPYA 3Q3HA 1PR1A 5DNYB 1UPUA 4KIJA 4OP1A 1RBZA 5LMZA 2E4YA 4H0FA 4ARZB 2BC9A 1XVIA 3OQIB 3T35A 3ZDCA 5L8VA 2B5WA 1PG0A 4UDXX 4XWWA 1Q17A 1DEHA 2JJ8A 2NYUA 5AWFC 4DB4A 1F8UA 1PWZA 1TM4E 3Q41A 1KF0A 1EGMB 1ONPA 2HWYA 4EZEA 3U7GA 3D7RA 3NHAA 4MVJD 4I1UA 3B82A 5KDDA 3MJVA 1WVGA 4MQFA 5L3RA 1OC2A 3RASA 3PQ7A 2FZGA 3RFVA 1A5BB 5CB8A 4B5KA 2JIZA 5IDYA 1D2AA 3S7ZA 3ZY6A 3C7AA 1BKDR 1G3MA 1UOPA 4IBOA 1G5TA 3OP1A 3IAM6 1JNXX 3P9XA 1KK2A 1PK9A 4O25A 4AUKA 2WJWA 3EEYA 4IFTA 4EJ6A 3P9YA 3V1UA 1EK5A 3WQSB 4MZDA 1D2RA 2C0CA 3CH5A 1FK8A 2PLRA 4DLVA 4JBIA 1WZEA 4N40A 5TQ0A 1F8FA 1RACA 3O3OB 4MQEA 3RHFA 3ZHZA 4ZICA 3OUTA 4JC0A 5HQJA 3KAKA 4ZJUA 3E22B 3KSZO 4XVRA 2OEPA 1R9GA 5L7WA 1Y1LA 1JR4A 3IKLA 4W6ZA 5LQNA 3ZE9A 1F5SA 2H18A 3DFZA 2ZRIA 1MIOB 3PWTA 4N0QA 4OLHA 4TN1A 3VAAA 5DM4A 3SNKA 3F5MA 1DC5A 3R0XA 3MJFA 1YOVB 2CYAA 3WDLA 1K9SA 2OG2A 5HK8A 4BJ1A 1E2PA 2R79A 4LK3A 4OJMX 3GCXA 1G20B 3RVJA 2O7RA 1ATZA 3B20A 3MEQA 4MS3B 5DBOA 3K0SA 2HNAA 4R0MA 1AMOA 3RYCA 3UJDA 4HUQB 3HA3A 1O96A 4DR3B 3MLEA 3FOAA 2D5CA 3HJRA 2ZJ4A 2MINB 1C9KA 1U90A 2GCOA 3ME4A 5LWQA 4D4LA 1N8TA 1NVBA 4LMBA 3A10A 1J0XO 1ZNWA 2OFFA 4G3XA 1CUHA 4EI7A 3LDHA 1WU8A 3JYLA 1H3NA 4G9BA 5SYNA 1Z8NA 2FZCA 4XYLA 4IEFB 2ZXUA 3C5WP 2GCNA 2WDZA 2OV2A 3BXZA 3G3EA 5B7QA 5JHGB 3H2YA 3WLRA 4ZMSA 5KWSA 5AW1A 4JI2B 3ASVA 4K1LA 5TPWA 4PGHA 4PC6A 2FFJA 2NXWA 2RHJA 2IYYA 2QD1A 3SSOA 1U6JA 3ANXA 4C22A 4RTJA 4RE5A 1OH7A 1OH6A 1ENZA 5GONF 3T5MA 3TQQA 1JDJA 2I6TA 1OBFO 1KMCA 1GZSA 1DO0A 4TGLA 1GEGA 1U2QA 3D5QA 3NWPA 3SC2B 5J23A 3OEEA 3WVNA 1V1JA 3T34A 1IPHA 1EVZA 1T3LA 1U9IC 3ZZ1A 1Z2OX 2JL1A 2UZ1B 2ZI5A 1A95A 2HCRA 4L6AA 4W63A 1LNSA 1Q6ZA 5J43A 3RGWS 3W6PA 5A05A 5BR8B 3KJXA 4C08A 2H57A 5IUNC 2OCXA 3U16A 4C7OA 1U7HA 2GD2A 3QPCA 4G5GA 4IDOA 5LJIA 1UZLA 4AX4A 4LRTB 4MPTA 1ANKA 4R84A 5HS4A 4MVJF 4G5XA 3F3YA 4EYOA 4RMIA 4D4KA 3AF5A 3N8HA 1OR8A 3LU1A 2G5GX 5DMJA 1MLDA 4WN9A 4TYNA 3QE0A 3NYQA 2GRUA 2JFWA 1YHZA 2BGMA 3WL8A 4JB2A 3W9UA 2GJSA 3OQBA 2JGDB 3EEBA 5ESWA 3C3YA 3A9WA 4IXNA 5GJBA 5FLYA 2PHZA 3ER6A 4GX5A 3H1EA 3UA4A 1T91A 4PZLA 4XJVA 2DLNA 4NVRA 2QGNA 1NF3A 4DXHA 1K9VF 3LXMA 4ZMRA 1D03A 1QK4A 2BMAA 1C9DB 2FK8A 2QXYA 1Y6JA 1FYXA 2Y1EA 1X1SA 1VJ5A 3C3XA 4NLLA 1J5XA 1CUYA 4WK6A 5AI9A 3CZQA 1LTHR 2C4WA 3EXIB 1XRRA 3FCUB 4WY2A 1B7GO 3C3BA 4O02B 2L82A 4D79A 2HLHA 1IJBA 5KU1A 2PX4A 1N2BA 1L5MA 1ZVJA 4IOLA 3ZDQA 1ISSA 3ZE8A 4RAOA 3NQ41 1KJWA 3QVMA 3TXXA 4ZI7F 2HMVA 3KPVA 4ND5A 2HYDA 3AI2A 3LWDA 3VHLB 1LLFA 6GPBA 1SU4A 5CDTA 5F33A 4G0PA 3LYHA 4M37A 1NVEA 3PLNA 4H7JA 4J07A 1JIXA 4DS3A 3GHHA 3WTCA 4MW2A 4PM4A 4UM7A 4BZQA 3KKLA 4KE6A 1FIUA 3GFVA 4XCQA 1CNFA 1RPAA 4A0SA 1NQTA 1DWUA 3DDUA 1Y42X 1CUXA 4AG5A 2BUCA 1H0HA 5CCBA 1CRZA 7GPBA 4RTNA 1LX7A 4BO2A 4D74A 4FGJA 1RJGA 2XE7A 4LZZA 1MJGA 5CAEA 3GZNA 3JASB 3MAAC 1NF2A 2OLKA 5LA6A 1TE2A 1WDMA 1A97A 2AWOA 4PZAA 5EIAA 3I32A 1E7YA 1UMBB 2X8BA 3OQJA 2C2BA 4OQQA 4U3JA 4HQ0A 4Z0NA 2G0TA 3PEYA 1W85A 3MWYW 3WZ2A 1GIAA 3M1LA 1BXGA 9ABPA 2V7GA 2W6NA 3ZWYA 2Y2UA 5DLQC 2OV8A 4IDPA 1CE8A 1T2DA 2JS7A 2YMPA 3LL4A 2YZ7A 5I9NA 3U6BA 1E0AA 2H4WA 2WD8A 4JVMA 3EISA 4GE0A 1KI8A 1PW7A 2PGJA 4MS1B 2E4XA 1E7WA 2V98A 4BLPA 3O84A 1VKJA 3W3AD 3B6ZA 3DOIA 4D6XA 1X8JA 2JK1A 2PX0A 4Z53A 2V7TA 3MCVA 1ZS9A 4AM8A 4PGAA 4Y2JA 3TFQA 2PAAA 1I2CA 5KEIA 5IWCA 3WRVA 2OC9A 4IJMA 2EBWA 2J9FB 1G66A 5AD1A 4YUZA 4OU4A 4PZ9A 3HCCA 4MTCA 2R6ZA 3PDJA 1QVRA 3MGGA 4GBGA 4AJJA 2HEYR 2IUEA 4Q3NA 4WBNA 4YQFA 5AVXA 4KMRA 1TRKA 1SCNE 1ABBA 4RTMA 4JHXA 4BO1A 1NBMA 3IB6A 3NBMA 3IAEA 4DV3B 5BR1A 3C8MA 1DRVA 4QYMA 2PZEA 2OCIA 4MQ6A 4KXMA 3VDMA 1OT5A 1RXIA 2JFHA 5FUYA 3ZDRA 1NT2A 4YRBA 4B34A 3L5KA 2WYUA 4MVJM 5HIIA 5HM6A 1F7UA 5B1EA 2CLDX 1RS0A 3KAJA 3IEMA 4NTZA 2R2GA 3ISJA 2PU5A 3IDQA 2Q49A 3P26A 2JRCA 3R8XA 2OD7A 4B32A 3PF8A 5EVCA 1G21B 4E1VA 2AXQA 3ETDA 4ND7A 4FYPA 4R8SA 5GV8A 4G85A 3U9LA 1KDPA 1KR5A 1P5RA 3PFCA 2GVDC 2JAXA 4D8UA 2V3CC 3KYJB 4LJAA 1SKYB 3QJYA 2Q5HA 5DFAA 4DJJA 3DZ8A 2B37A 2JLZA 3ASZA 4W1SA 1RAIA 5HKKD 4IF4A 4L15A 4D9HA 4A03A 1Y8QB 5DYGA 3UHAA 4XDYA 3RVPA 4AQYB 2K7ZA 3P4YA 1SWVA 4FS3A 4DV5B 2CCGA 4IX9A 3ZBTA 5BVGA 4BQIA 4NESA 1LV7A 2BEVA 2ENWA 4WNCA 1AVTA 5BN3A 2Q7DA 3CF0A 3ZHBA 1C0PA 1GNTA 2ZT5A 4JC5A 3FNQA 3PI6A 4LE2A 2O8DA 4O2AB 2GEBA 3AU9A 4D02A 3BD6A 3L7LA 3SQLA 1V5FA 3CU5A 4NDZA 3UC9A 5KYGA 4O0MA 1QORA 3ZLTA 3TH5A 1ZW1A 5LQKA 5IP5A 2BOVA 3H4VA 1FXSA 5FAXA 5EFOA 2GHIA 3E81A 4J2HA 3GXOA 5ILQA 1M6NA 3ILVA 4D56A 3GR6A 4XQ9A 9LDBA 5EJ4A 2QR5A 3NJRA 3PWSA 3W4KA 3CB2A 1B76A 1PLKA 4RM2A 2KJQA 1EAMA 2YDXA 1BGVA 3OFKA 4JCOA 4MSUA 1LS6A 1EMDA 2OXEA 3F6CA 4F7WA 2Y6UA 3KVVA 1OE0A 2WYOA 5TQ2A 2EVWX 3I1FA 2DERA 3E61A 5MGBA 4IJVA 2FMTA 3DD1A 1KAMA 3E0XA 3HBAA 1CJMA 4H9GA 2F00A 4TV8F 1ZJWA 3G2IA 1F06A 4OXNA 5BQXA 4OI0A 1Y4UA 4KIWA 2CFOA 1MJHA 5JU6A 5I9SA 1B43A 4WNAB 1G18A 1MOPA 5DN9A 2W6MA 4HEQA 3VOAA 3MT0A 5LIPA 1AKRA 2ZE5A 2I7XA 4OHKA 1W19A 2ZR7A 3WKBA 4NYIQ 2FWJA 1ULTA 3TGWA 1E1QA 4QDJA 1S1CA 4IILA 5M04A 5LL6P 1ZHOA 2OD2A 1VE7A 2CHVA 3LDUA 3LQ1A 5AK4A 5KJFA 4YCCA 3KTFA 1P31A 2NO7A 3BMQB 4DCVA 5HQ3B 3S2YA 1MO3A 2FUEA 2FSUA 1YRWA 2JFVA 2A8YA 2X22A 2C3YA 3PJGA 1X8XA 2IYPA 3UATA 3UOWA 4KREA 4WUTA 2XJ9A 5AOVA 3NTXA 3PITA 1B93A 3L8DA 1AMNA 3RRFA 3JALB 3FNFA 3NH6A 4X20B 4LOJA 3L6DA 4R8MA 4BNTA 2ZUEA 1SVLA 2OBYA 1DINA 3ABQB 3PWZA 5TEWA 1XHEA 4BVAA 1M8PA 4XCXA 1LBHA 2H4JA 4DSUA 3LP8A 3HCDA 3QITA 4UCFA 5AUPB 3ZS8A 1VBMA 2VG8A 4AS2A 4NOMA 3OJWA 5I7WA 2B5VA 5K6RA 1V8BA 3PFGA 4QGHA 1SCJA 1A8IA 3G7NA 4AX8A 3L84A 4RABA 3SXPA 2QN9A 4RS4A 2I2XB 4QM7A 3OT1A 1NVUQ 4NQRA 1YE5A 3O6VA 1AGPA 4L7QA 3U80A 2WIAA 4GH5A 2B4YA 3GAZA 2BISA 2V5VA 4PHHA 4QAQA 4HRXA 4PZ0A 2LIVA 1X2BA 1LI4A 4OREX 3D6VA 5E6RA 2EWMA 3WOHA 1G8SA 4QUJA 5T3YA 4C0AC 1KOLA 5C53B 4UXJA 4Q05A 4F2HA 1Y81A 1NXOA 4M1SA 2O3SA 2I1VB 2HFJA 13PKA 1G42A 4IVQA 4A8HA 2F1HA 4OIMA 4DCSA 1E62A 1SR8A 3Q0EA 1CY8A 2RMKA 2JLWA 2BFFB 4GI1A 1N8KA 2VA9A 2YFQA 3PDCA 1JFVA 1DKQA 4BMOB 5BMVB 3BGWA 2Q3EA 2ZWVA 4KQKA 3IBSA 5J9FA 5FOQA 4QE3A 1GRRA 5FUVA 4ARZA 3GFBA 3FUCA 2VP9A 3L49A 1VGQA 2QAGB 2A30A 3G0BA 3OQIA 4BK5A 3QKWA 5DTRA 4EHBA 1ORVA 3I6BA 4IDFA 4NPHA 3GEMA 4ZHSA 2NTJA 5DX0A 4B87A 4UHFA 2MDTA 2HA0A 1KFBB 1JALA 1JHYA 4YIKA 5GOZA 4MW4A 3W5HA 1EFKA 2D59A 2IU0A 4CQLB 2FMIA 1DKNA 4DYVA 5CLFA 2WHYA 2IOYA 3HR4A 4PSCA 4XASA 4BQNA 1MPTA 5FHQA 4EB3A 4CIBA 2HIAA 4L0CA 4MHSA 4KN9S 1USVA 5LQSA 5GVSA 3ZV6A 4Q7MB 3BVPA 3IH5A 4P4SB 1YVEI 2GA8A 1DFIA 4RCYA 1SMKA 3DONA 3TTTA 3DZFA 2PX3A 3IO5A 3L06A 4RLFA 2FSVA 4I46A 1P9OA 2PM8A 4NCKA 2VHEA 2R7MA 1GGJA 2XB6A 2XD9A 3QWHA 1XZQA 4P3NA 4P4TA 5AM4A 1H5UA 3RT1A 3S28A 1UKVY 3EWNA 3MMXA 2FQQA 3O4GA 4XARA 2QVYX 3X1XA 4ENQA 4AY2A 5DOZA 8AT1A 1GPMA 3P2JA 5CM8B 1F60A 2P30A 4CLDA 3V1TC 2IV3A 2J0UB 3FCSB 3VU1A 3BB4A 2Z2JA 2AX4A 1C80A 1I6KA 2FWMX 2QTMA 3FRIA 3P0IA 4Q4AB 1I2BA 4WXPA 1Q0UA 3LKZA 3UYLA 4WGGA 1P0PA 4FCTA 2BZ0A 1W93A 4G23A 2HOQA 4FCVA 3E22A 3DL0A 2J5BA 3WGVA 3IGFA 2WKQA 2I9KA 1UR5A 4CTOA 1RLMA 1ORWA 5CPBA 1YQEA 4ZZ1A 1Y9DA 3LG2A 3FSGD 1OWPA 1T6BY 2H11A 3LRTA 4L8LA 1AKTA 1MIOA 3IDAA 4XSHA 4PGMA 1Q1NA 2GZSA 2ZUDA 1W49A 1UBTS 3LQRA 4U5QA 5AVJA 3NVMB 3STUA 4BN0A 4D0RA 4E2XA 1YOVA 4C0BA 2UUPA 2R6FA 3AYZB 3KEMA 4C4SA 5TS3A 4UVHA 4CFSA 2B61A 3NWOA 4AQDA 1Y9AA 3E5HA 3SZOA 3L1IA 1EXVA 1Q21A 1G20A 4DLWA 4FWTA 2P78A 1Z3CA 4MS3A 2G7MC 4P3KA 3R76A 3K2QA 4HUQA 4US1R 3UVEA 4WFKA 3Q1LA 3M6FA 3RVLA 2AI2A 3U3DA 2MINA 4AJOA 4ETMA 3HVJA 4GYWA 1GGVA 3FPHA 1TAQA 4NZYA 3LECA 1SBHA 5KVCA 4R6XA 1EFTA 1EVLA 1MO5A 1PSWA 4FC7A 1DIOB 3P8ZA 3OAAA 1CCWA 3UJBA 1MC5A 5A03A 4AJLA 1X0VA 1JEOA 2O2SA 4JVSB 3BYZA 4BMPB 2E48A 3M6AA 2OHGA 4QDTA 5F9MA 4LE0A 4QD3A 3W5VA 1YMUA 1K97A 2DWOA 3BWYA 5CDFE 4DJFC 3QPUA 2BH2A 3HS3A 3JD1A 2JLUA 1DAEA 2XQVA 4KYUA 3UMFA 3SU8A 1KJYA 4BO9A 5AK5A 1V6AA 3CRW1 2C07A 4YI3A 4WOKA 3FHJA 1YZGA 1YJCA 4YONB 2UYQA 1YZ3A 3D7KA 1SHLA 4TLEA 3C3PA 2PG3A 2QTTA 2CVZA 4QHTA 3U7HB 3FG9A 3O9VA 1GSAA 3SC2A 3ZHCA 1AK2A 1QR2A 2EFYA 3GDWA 2QXTA 2O3UA 5AHXA 4JI1B 2UZ1A 2BHRA 2IDMA 3DL2A 5AQEA 1I1OA 2JAWA 4RNDB 1D1QA 4CKEB 3KT8A 1H9CA 3BTVA 1ZGBA 3K5WA 3RU9A 1E79A 3ZCUA 2JJ1D 3WQQA 5KKCA 3BD8A 4HLDA 1DNPA 3DL4A 3O4HA 3HKBB 2W6CX 3WDSA 1KJJA 1FTYA 3ZXIA 5GADl 2YV2A 2QZPA 4Z3DA 1ND6A 3PEEA 1FPQA 3B1YA 3O8NA 2NV0A 4MW9A 1Z13A 2YMLA 3FKJA 2COEA 3G2OA 2NMVA 3ST7A 4CKXA 1NRXA 4EABA 1R7RA 4UUBA 3A4IA 3T9BA 1E5VA 1JECA 1RJWA 2X2EA 4YXWD 4P0TA 1DQZA 1L7OA 2XYRA 2IY9A 3KUUA 4BQQA 4TZ0A 4UVEA 4MEAA 1R5BA 1IXKA 4MDHA 1TVKB 3RYTC 5GP1A 1H65A 5JXHA 2JGDA 4X3PA 5IXYA 1PNVA 2I6FA 1MC4A 1ZNYA 1YCDA 2QRKA 1JR3D 3R3YA 5L51A 4G63A 3LHIA 4MLZA 3VSDA 1PKEA 1IMOA 1U8FO 4C0SA 1JPVA 3N2LA 1LDGA 1FU4A 4FHGA 2FW1A 4OFWA 4P4NA 5B2FA 1I1NA 4J0EA 3WNBA 1DJLA 1GRCA 1CW2B 1QO0A 2DP4E 2QLTA 1DRUA 1G19A 3EXIA 4ALKA 4ZFNA 3ZYZA 1M34E 2B3DA 1ZN8A 1XMSA 5F2KA 1EXDA 3B60A 1E1MA 3ZUPA 1IQUA 3DO8A 3T3NA 2HWWA 2X0RA 1GVHA 2B1IA 4NG5A 1MORA 2PVPA 2HZBA 2B94A 3OJ0A 5HFNA 1QCYA 1K5HA 2OHXA 3MTDA 4RHCA 5ITVA 3COJA 2V0GA 3H7AA 2QUHA 4TVKA 4GQBA 3AETA 2GZRA 5EIBD 5CJJA 4XEUA 1R8XA 4PX5A 5BRJA 4EVIA 3UG6A 3FJYA 4HPXB 1JE0A 1F51E 3U4QA 3HXMA 4JX9A 1AHPA 4QASA 4PCLA 1E2MA 1H42A 4CI0B 1NVWQ 4PHCA 2ZRCA 3G68A 2AN9A 4J1TA 3JASA 3T3MB 3ZIAA 1BXRB 1H0SA 5G0SA 1Z88A 4EYEA 2PUJA 3Q7IA 3HC7A 2DFVA 1UMBA 2EHDA 2QP9X 2P69A 1OXKB 4YV1A 5L3VA 1KQFA 2BGTA 2XKJE 4J1TC 4UHJA 3NG1A 5BNZA 5KREA 1CJUC 4KNWA 4BUCA 5EMJA 1RSZA 1N5KA 3FI9A 3KRTA 5K3OA 5EG5A 2LW7A 1S5PA 2WK1A 4ESOA 3DZDA 4BBJA 3GELA 5IAOA 5ESRA 5DK6A 2QLNA 2WU0A 4M1TA 3FGOA 4MS1A 4BVHA 4KHPB 4YCMA 1AQLA 3OU6A 4E4YA 2YHUA 4YJGB 2VYQA 2C1XA 4RV5A 4Z8XA 4RPIA 4LOHA 1QYRA 3LUHA 1QUEA 1PV4A 4G2NA 4KVZA 4KVFA 2IPXA 3LH5A 3OX2A 2J9XB 2AJLI 2J9FA 4NYIR 3KZ1E 4WK2B 4II2A 4MVXA 2ZBGA 2YHSA 5BPHA 1XZBA 4FE3A 2DWUA 1TTHA 3QFRA 3KKKA 3AK4A 4BNNA 2DVMA 4R40A 5F98A 5GQSA 1D3AA 1JSXA 2CBXA 4GSLA 1RQLA 1XZIA 2C3PA 4OTZA 4R0NA 1F8GA 1XZKA 1XCJA 1Q14A 4KKXB 1JKIA 1P3JA 4V0RA 1V45E 1JMAB 1GCOA 2VJAA 2NZVG 1ZINA 2JARA 2UV8A 3KBOA 4WEQA 3SC6A 1IOWA 4WKPA 2G25A 4RVOA 4A82A 4COKA 3U9SA 1XNRB 3HN2A 1G21A 2IYVA 3KDPA 1LNZA 3QBVA 4JJEA 5AKIA 4Q4LA 3RS3A 3ZBUA 4B80A 2GAOA 3D7SA 3OIVA 5KCZA 4NE2A 1LW6E 1QQBA 5E1DA 1LKZA 1ESEA 3NTLA 4Z4CA 2B78A 3VUFA 3SHTA 4QGAA 3MCTA 4BNGA 2CSXA 4MR9B 3AUKA 2AR0A 1BS9A 4FPXA 4YAEA 3AHDA 3C4JA 3NETA 1Y8QA 2I91A 3T7SA 4RD3A 3LNTA 4OYYA 4LGCA 4ZC1A 5BNIA 3T9CA 5CFMA 4RVDA 5JLJA 2Y1XA 2C4NA 2NUAB 3UB3A 3VSEA 1I2ZA 3CNBA 4DV1B 2EWVA 3QWBA 1PFYA 1PF7E 1Y4AE 4O2AA 4TUYF 3R6GA 1E0KA 3UV6A 5JE8A 1YKGA 4Q24A 4N8SA 1Y1TA 4F04A 4LSWA 1CV2A 3VZQA 2HM7A 3AHJA 1RC8A 2FOLA 3WADA 5IH3A 1KFEB 1D4ZA 4JP5A 4MO9A 4KFCA 4RKFA 4LS3A 2VHVA 3CGWA 1PL8A 2OKCA 4IJQA 1PBNA 4MW5A 4X85A 1YJ5A 3TTYA 4ZVPA 3CW2A 5ENVA 4B3FX 4JBXA 1EDBA 2OLEA 3D81A 3WSVA 3JZAA 2Y3IA 4NMHA 2CXHA 5BT9A 2BM9A 2NAFA 5E8JA 1E9EA 1XELA 2XYVA 1XE3A 2NXEA 4C05A 1ZC4A 4NU0A 3O8BA 3OC6A 2P77A 3MT7A 4RVNA 1IEVA 1Z47A 4MP6A 3KLNA 4E3WA 1W35A 1LJLA 1NT4A 3KT0A 2PY6A 3QF4B 3G5UA 4D41A 4WNAA 3H1PA 3TLKA 1QTIA 2Z04A 2GCEA 1EZ1A 3T1QA 1E99A 1YASA 1OX6A 4MV7A 3C8DA 2IXFA 2HA5A 4AWXA 3OA0A 4DDTA 3LLSA 3UTCA 5JZBA 5DTIA 5BW6B 1QE5A 5KQMA 4OCZA 2AJ8A 4E5YA 1FFYA 2VFAA 4F38A 1E18A 5JXJA 1KS2A 1KYVA 5HQ3A 3BMQA 1N0WA 5AVWA 1D07A 5AW4A 2LP4Y 4FHZA 1WUIS 4FTWA 1Z0AA 3L7AA 1WZCA 1W4ZA 4HL6A 3AG5A 2GPTA 4QPCA 5BORA 3RSZA 3CEJA 4AJ1A 3WZMA 1Q92A 2DUNA 3CISA 3EOZA 4NK4A 4TYPA 5F21A 5EIEA 1EFPB 5CBPB 3JALA 4X20A 2NSYA 5EUBA 2QD4A 4MIEA 1IFXA 2BT4A 4TYWA 3A9CA 4FC6A 4I8IA 1BSVA 3MHDD 1GPJA 5C9ZA 4Z4FA 1A9OA 1Q1BA 1NN1A 3LK7A 3T9AA 1IOLA 2HJSA 3ILYA 2G1JA 2YOGA 1MAUA 4NOLA 1PFVA 2Z8YM 4CLHA 2FWAA 2FZKA 1NMEA 2X4GA 4YYEA 1UEIA 3NAZA 2D2XA 3LXRA 4P81A 5IKOA 3B3GA 2CNKA 1KO8A 2H5LA 1ESZA 1WAMA 2JCVA 2BRUC 3X2FA 1I6LA 2Q07A 3MWLA 1KE1A 3DBRB 1XALA 2J5XA 5ALHA 1WB9A 1W4LA 1BS2A 1OYWA 2ZYGA 4LV6A 2DKOA 3RF7A 1UZUA 4MVCA 4KN5A 5JJLA 4KVGA 3ED5A 5AKKA 5JD3A 3IKTA 3CLSD 4GQIA 4P34A 4F1KA 1V7QA 1Z74A 1G98A 3DP9A 4KIUA 2HA6A 1MFPA 1KVSA 3SF8B 3SQXA 2YKGA 2XY4A 2WUEA 4XUCA 4BC1A 1XFAA 3LBHA 4F91B 1QYDA 4X94A 1RPTA 5H4GA 4JIGA 5TLSA 2BFFA 1FTNA 3G59A 2CCKA 1QYCA 2RHMA 5TJ9A 4KXNA 5BMVA 2A94A 3A58B 4QUGA 3W90A 4CIVA 1C0LA 4UCWA 5LXTB 4D9KA 3C39A 5FBRB 5B4TA 5CLJA 2QAGA 1F1BA 3RSSA 4UOEA 1TTTA 5HWSA 2SICE 1JEYB 1Q0ZA 3K5IA 1DEKA 3I2FA 1IBSA 3L8CA 3A1CA 3HB4X 4EMBA 4F2PA 4KNYA 2BBSA 2BMVA 4BJHB 3NBUA 4CQLA 4DMCA 1W36B 3VJLA 1JV2B 3VFDA 3Q8XB 5FXMA 3N0RA 1UFQA 3B6KA 1H2AS 1UT8A 2PKQP 4Z9YA 2B1GA 2BI4A 2F48A 5KKNB 1JI0A 1MGPA 3EDRA 1M2HA 4P4SA 1ZZGA 2HGSA 3AEUB 1UKCA 2ERYA 4HYQA 1N5JA 3ZNNA 2V7QD 1N2ZA 4D9CA 1GXSB 4FDMA 2A1TR 1E3SA 1C8BA 2JD0A 3RLFA 4CT4B 4GS5A 4UHCA 4Y2HA 3QU5A 4MINA 5EJAA 1JG4A 2GMWA 3ZWDA 4F93B 5I7SA 1OI3A 2QRNA 2VZLA 4W82A 4J1QA 4JOCA 1CIJA 1Q6YA 1E4YA 2FEOA 3MTEA 3QMPA 5J5VA 1Y9EA 1D04A 2Q3FA 4QO7A 1Z6YA 2X13A 1KA9H 3PUJA 1PQPA 2J0UA 4P4LA 4DQDA 3R5KA 4ZVRA 4C0LA 5B57C 3SSNA 2DR2A 1V41E 1IHYA 1FF9A 1R0LA 2JI4A 3HJHA 4QM6A 1YR1A 2VZ0A 3LUAA 4L73A 5KI6A 4U2EA 4CLRB 2BM0A 2BH9A 5H80A 5TS2A 1MB2A 1E0SA 2HA3A 1U4OA 1YTLA 1HDCA 2PR7A 3G88A 3ICQB 2EGUA 3NATA 1P3DA 1THMA 4JP1A 1ZY2A 4PLYA 4XX0B 4B6RA 4P7GA 1TIKA 2AI1A 1YE8A 4Q4JB 3LS2A 2TSYB 4IDDA 4GC9A 1NATA 4CKBB 3R7WB 3G1WA 3NHUA 4XDZA 1YRHA 1RMQA 3OZWA 1NJFA 1T35A 4O2LA 2RIPA 3BOSA 3EGCA 2DQKA 3N8DA 3ZDXB 1IQRA 2HHCA 2Q6KA 1CEQA 2G9VA 2R6CA 2FFAA 4P93A 1Y4ZA 4CF6A 1HORA 2HU2A 1TVCA 2OCAA 2XX3A 3IE0A 3ESQA 3TRJA 4OOFA 4C1NA 2XCRB 1FP2A 3OECA 1Z22A 4Z3KA 3SD7A 4A0FA 1CR6A 2XCSB 1UK8A 3QVLA 3AB7A 1VQ1A 1TMOA 3C3WA 4DLZA 1RRGA 1J90A 5IHPA 1YHNA 3I4LA 4NZ9A 1ZI6A 1WBBA 2F1RA 1E61A 5HG0A 3EWIA 3TJRA 1M66A 1R8YA 1XEXB 1VIDA 3DZKA 4GKAA 4RPJA 1FFGA 5BYBA 1RADA 3N9IA 4Z2AA 3ROEA 4KBYA 2AFHE 2V5UA 3T4EA 5CT5A 3O3MB 1B8OA 2BEJA 4YJ2B 4ZYZA 3KOUA 2VPZA 4DCCA 1VLMA 2IS4A 1JYEA 2DTDA 3SICE 1F0PA 2QE7A 3AXTA 1GQSA 4H4CA 4JSRA 4C5AA 1RKVA 1KL7A 3HCPA 3M6UA 2BKUA 1LK7A 5IH7A 3K6SB 3I9JA 2V9CA 5AXBA 3FH0A 1BFUA 2L17A 4YGYA 4L27A 4DNQA 4LF9B 4WH0A 4FGKA 4WY8A 1PHRA 3C3MA 3Q88A 1T8SA 3D2BA 3U7IA 4P3YA 4DYDA 4FONA 4TVBA 4J43A 1N5MA 1CUBA 3K1YA 4X3CA 1JS1X 2P7HA 5L95A 5IM4A 1DXQA 1WUYA 3MPOA 5F5NA 2IOQA 4IGIA 3B9BA 2VBFA 1PS9A 3DBHB 2JA2A 1SUIA 4BWVA 4Z9AA 1NLZA 4B4OA 1K63A 5B4UA 3IUJA 3M4ZA 1A8UA 2ZIFA 3HN7A 2X5KO 4E94A 2VHQA 3IR6A 2GS9A 4WGFA 3HKBA 4ZTBA 2I4RA 5IAEA 1S2DA 4MW7A 1XRQA 2HK9A 3LQFA 3ZY4A 3K71B 5CK5A 1JEEA 3GAMA 3U0VA 4PLGA 1UXKA 3OF2A 4AZVA 3BJIC 4YHBA 1J0AA 3KZMA 4BB9A 1YTUA 5LP1A 5AM3A 1AZLA 3W5IA 1BROA 3BZWA 2B4QA 2IL1A 2I8CA 3GA7A 4LDAA 1IG0A 3JARB 1QTNA 1NHWA 3QU9A 4LZLA 3E70C 1SOUA 3IELA 2Q0SA 4I5FA 3UGQA 1OWMA 3HCNA 4BPRA 3OZXA 4P38A 4XPZA 5EE3A 4YPVA 4L3VA 2C03A 1GNQA 1KMQA 1T0JB 4LN1A 2QJOA 1RZRA 3A4MA 5BY2A 1YQXA 1TVKA 3B78A 3FMIA 3KVNA 4JLVA 2X7HA 4N90R 1KQPA 4PE5B 3HM2A 5J4HA 4H6WA 1JBEA 3DTYA 1R0YA 3I05A 4IIBA 1G8KA 3RK0A 2ZYIA 3AB8A 3G9ZA 2Y99A 4LDZA 2IHTA 3AINA 4C88A 4M0LA 3ZVRA 3QTBA 4G0ZA 1UANA 4HLUC 1G6KA 4MGHA 5LDHA 2ZWOA 2NYAA 3DAOA 3IJPA 2BZ1A 1JGTA 2X0EA 2O6LA 4MQBA 5LCXA 3W34A 4XVCA 1G60A 1ZMTA 3EY9A 1NLFA 1MT3A 1VJTA 5AK0A 4DNPA 2OV6A 3ME2R 3D1LA 3RU2A 4D4GA 4J3JA 5L3QB 1HE4A 4GPZA 1Y5MA 2VHYA 3PJFA 5ICFA 2OXCA 2HK8A 4GICA 5FH9A 4LY9A 1B23P 2NU6B 1BHQ1 4G84A 5ALMA 2ESRA 2R9VA 4X71A 1B8VA 2BM8A 2DPHA 4JUDX 5EN4A 3V4PB 2D0PB 2W5UA 4UQOA 3K2IA 4BTLA 2KE5A 4FLFA 4O4LB 3ZC3A 1UBLS 2VK1A 4Z99A 3VR6H 2J9GA 1NOIA 1ZVKA 3M4NA 1E3EA 1ULZA 1NLUA 3EZYA 1BXRA 3VO8A 1PNOA 5E6SB 2H1SA 4N9QA 2P40A 4WMLA 3S1LA 1F48A 3N6VA 4KMOA 3OT5A 2F8SA 3HO8A 2VTBB 1QOZA 1U63A 1PR3A 5LKAA 5KUTA 3EJ6A 2FZ5A 3BIXA 3TZQA 1M0TA 3O92A 2BCEA 1XMQB 3S8MA 5HF5A 2P4QA 5D00A 2YBEA 4N0EA 1FLDA 2W6ZA 3PVZA 1UXOA 4JT2A 3BEOA 3ZV3A 4LPKA 3UW1A 1WSDA 3CZMA 2PKQO 2UAGA 1J06A 1O6FA 3AI3A 4YJGA 1C9NA 3ICCA 1GPKA 2WWHA 3PIDA 4DREA 2VJBA 4KODA 1F3LA 4UDNA 3NHMA 3O74A 1Y7TA 4E5MA 3ZV4A 2Z2YA 2WJPA 4ARSA 2WFLB 2JI6A 4XR9A 4BNDB 4TZ6A 1VSUA 1JDNA 3UW3A 4J76A 3O0DA 4X62B 3K2EA 1NSFA 2QORA 2HSGA 4NF2A 1GPUA 2I7TA 3GJ5A 5EP2A 4ALIA 1B0UA 4PYOA 3JXEA 4YN3A 2ZDHA 3MQ2A 5I9TA 1SCDA 3PU6A 4RDHA 2IYFA 1U28C 3EVCA 3H8JA 5ALQA 4RTLA 1J23A 4GX2A 3PQ2A 5IJAA 2P35A 2HF7A 5H8WA 3ZU2A 3KHTA 7YASA 2EEPA 1GKKA 3COVA 2HSZA 1L7DA 2WWVD 3RYIB 5MDHA 5REQB 3AGQA 1P6XA 5B3LA 1DBIA 1T24A 2O1EA 4F3RA 2UVQA 2XVMA 2YWDA 3EZ6A 5FUXA 1PCXA 4M0UA 1EGVB 1NWCA 1L6RA 4HX5A 3WTBA 3W2HA 2OUKA 4YX9A 4QREA 3ZQ6A 3L8EA 1EDDA 2BEWB 1TM2A 3DQPA 4LCEA 1YHYA 2H8KA 2QD5A 1JJIA 1FMCA 1ULSA 3LY8A 3PCRB 4MR9A 1ZH6A 3V4OA 3DBLB 4CF7A 1U8UA 3HO6A 5I6DA 4YRTA 1GGHA 3C7KA 1L1RA 3MRVA 3CLKA 4BX3A 2E55A 1NF8A 2J46A 2V55B 3L92A 1I80A 4CU5A 4P0QB 1NN0A 5DE3A 1NU6A 3JQBA 1UP4A 4QJ5A 2NUAA 2AN4A 1ZOOA 1U0HC 2YJTD 1XTSA 2FEPA 5H02A 4BNZA 5CA0F 3X2SA 3GFGA 4UAJA 2LDBA 1SNYA 1A9YA 3JQBC 1P2SA 3PPIA 1YDWA 4GM4A 1E1NA 3CE6A 4RESA 1ST3A 1Z6PA 2XT6A 3PR3A 5C8DA 2XAUA 2GX6A 4FHFA 4IDAA 3IPLA 4LHSA 4UUAA 2OK8A 4R51A 5IW8A 3RR2A 3L18A 3URMA 4BWGA 3IPXA 2DULA 1UC8A 2NIPA 5DU2A 4QQKA 4Q21A 3N7TA 1CG6A 2H6EA 4B85A 4EI8A 5FPSA 2VXCA 3PEFA 2J7PD 3VH2A 1BMTA 4JT4A 5BPFA 2Y71A 3QWFA 3KTAB 1ZSVA 1NNLA 1VHJA 2H7VA 4RIFA 4NBRA 1EXNA 1JSRA 5I9MA 1VPTA 1LY1A 4F1JA 2P8JA 1S9HA 3D6NB 1YS2X 4W5JA 3WMGA 5IMSA 2PE5A 3CR3C 4KO4S 2OCKA 3QSYA 4KPFC 1XZJA 4OUDB 3VZSA 4BO0A 3A6FA 1XA3A 5KVSA 1AS3A 4MAFA 1JHOA 2ONYA 2GBLA 3HRKA 3QF4A 1B3BA 5F73A 2WPDD 5ADHA 5A7GA 3RANA 4E46A 1OY1A 2WICA 2VHXA 4EF4A 4I66A 5IC4A 2GBLC 2GDJA 2SKEA 2XNDD 1H8ED 2CLSA 3RT7A 3VR1A 4BX2A