2E4UA

Crystal structure of the extracellular region of the group ii metabotropic glutamate receptor complexed with l-glutamate
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
538
structure length
512
Chain Sequence
RREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDNYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNICIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAANRVNASFTWVASDGWGAQESIVKGSEHVAYGAITLELASHPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQCSLQQVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPQTTKLCDAMKILDGKKLYKEYLLKIQFTAPFNPNKGADSIVKFDTFGDGMGRYNVFNLQQTGGKYSYLKVGHWAETLSLDVDSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYLVDEFTCMDCGPGQWPTADLSGCYNLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of the extracellular regions of the group II/III metabotropic glutamate receptors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords Metabotropic glutamate receptor 3
total genus 160
structure length 512
sequence length 538
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
A PF07562 NCD3G Nine Cysteines Domain of family 3 GPCR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.50.30 Mainly Beta Ribbon Tumor Necrosis Factor Receptor, subunit A; domain 2 Tumor Necrosis Factor Receptor, subunit A; domain 2 2e4uA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2e4uA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2e4uA01
5JNUA 4KRFA 2LP4Y 4RK4A 1LJLA 5JS2A 1EWTA 2L19A 5CHYA 2QVGA 4KMRA 9ABPA 1JFVA 1A04A 2E4ZA 1RPJA 2JB9A 2GI4A 4Z4CA 3GRCA 1KRXA 1SXHA 2IPMA 5JNRA 4CBVA 1F4VA 4RY0A 5FWYA 4LE0A 1DBPA 4MRMB 3CHYA 4YP9A 4H60A 5C5EA 3T95A 4IGAA 1PEAA 2FSPA 5JNSA 5DTEA 5HQJA 3IP9A 2H3HA 3BREA 3CZCA 3SAJA 1L5YA 4ZYLA 4WUTA 4Z4IA 4LDAA 1C4WA 2DRIA 3HS3A 3TMYA 3EULA 1M5TA 4ZMRA 2GBPA 4Z9BA 4YLEA 4RK5A 2QR3A 4RWEA 4XLTA 3IPCA 4ETIA 4ETNA 3JPYA 3FFXA 4W5QA 3N75A 1NXWA 3GV0A 1Z18A 2MSWA 3QLTA 5HKOA 3OQMA 1DBQA 4TLLB 4HYEA 2PE5A 4JB2A 1GCGA 4DADA 1BVHA 1Z15A 2ZAYA 1AB5A 1DRJA 3C6QA 1QNLA 2QU7A 4XXHA 3NHZA 4IMIB 4YS6A 5T3YA 4ML3A 5KQPA 1Z26A 4KFCA 4LE2A 1YIOA 5JNVA 3OLYA 3N0RA 4MR9B 3CTPA 3I5AA 1NATA 1ZY2A 4F8JA 4RK0A 2IPLA 3OMWA 3QX9A 3RVNA 4RSMA 3LUHA 5EWMA 1LBIA 4MR9A 1DZ3A 2PUGA 3A0UA 4W5RA 2NT4A 1U0SY 3FDFA 3QELB 4QICA 8ABPA 2LPMA 4MS3B 4LRQA 3W9SA 1R8JA 5B3JA 3FGZA 4QYMA 2OENG 4MR7A 3D8UA 1P2FA 5PNTA 4OBBA 2XDYA 4S05A 1SXGA 1TLFA 3QELA 3MA0A 4OLBA 4W5NA 4RKRA 2ID9A 2IKSA 3KLNA 4Q7EA 3TD9A 2HJ9A 2MSKA 2QW1A 3RVQA 3KYJB 4P98A 2QVCA 1E2BA 1TJYA 3G85A 2VK2A 5BRAA 3O1JC 4F12A 1C0EA 2FKAA 1QMPA 3GBPA 4UHKA 3H5LA 5IULC 3M6MD 3NBMA 3O2SB 2WWVD 3I45A 3KYIB 5TPZD 1YK1A 1Y1LA 2FQWA 2JBAB 4B09A 1JH9A 4YO7A 4RU1A 4WXMA 2HPHA 2GKGA 2JCGA 1EWKA 3HCWA 3JVDA 3IPAA 1LK0A 4JP1A 4EVRA 1FSPA 2A9PA 4P1ZA 1D1QA 3FFWA 2WMYA 1KGSA 5F64A 3O2JA 4F3TA 1KRWA 3KCNA 5DLEA 1Z2EA 1QQBA 4KPYA 3SG0A 2PUBA 2PUAA 1USGA 3CZ5A 3OM0A 4RY8A 3KJXA 1ZITA 2X7XA 2NT3A 3ROFA 3RVRA 2MSLA 5ABPA 1TM2A 5GQSA 5KQMA 5BQ3A 4TN5A 5DKFA 4D74A 1CYEA 4EYQA 4KK4A 2FW0A 3O1HB 3HUTA 1L5ZA 3ILHA 2FMFA 2IPNA 3RVSA 5T7BA 2BGGA 4WXEA 4NCAA 4EVQA 2WJAA 3KKEA 1D2AA 1QPZA 2YHBA 2L18A 1PHRA 3LFTA 1TMYA 4OLAA 2H0AA 3I09A 1HEYA 4UHJA 5TPWA 1F51E 4G0PA 4MQFA 3HK2A 1Z16A 4G0OA 4MPTA 4RY9A 1M5UA 4GNRA 3H5OA 1I3CA 3MF4A 3OM1A 1ABEA 4MS4A 1VLZA 3KG2A 3RVKA 4RXTA 2QV0A 3QLVC 4WZZA 4MQFB 1YMUA 4NCBA 2CHFA 1XHEA 1B00A 4DN6A 3JVIA 5TE9A 5JNTA 4NV3A 4Z0NA 5HSGA 5HM6A 4N41A 5GOTA 1E6KA 3OO0A 4JOQA 1ZH4A 1YS6A 4MYRA 4ETMA 1NXSA 4MRMA 1JL3A 5FWYB 3QLVA 2WY2D 1U04A 1J56A 3QLUC 4E7PA 4YGXB 3H6HA 3H1FA 5TQ2A 3T38A 1Z17A 2NZVG 3SNKA 4LE1A 5C5CA 1QP7A 2QZJA 3CKMA 3IDOA 3H5WA 2A9OA 2FMHA 2MYNA 3UKJA 2FLWA 3K9CA 4RK7A 5KQGA 3L6UA 2JVKA 3N53A 4OTZA 4Z4GA 4HNQA 1PNTA 3GT7A 3OLWA 4JASB 3EODA 4LX8A 3B2NA 3G1WA 3LOPA 4YCSA 1RZRD 3GL9A 3A0RB 4RS3A 2R47A 3HV2A 4YV7A 1SRRA 1E6MA 1RXEA 4RXUA 4Z4HA 4RZSA 3O75A 4RK6A 4PEVA 1JFSA 5CNKA 3IP7A 4Z99A 4G0XA 4MS1A 3K4HA 1PUXA 4FE7A 3LUCA 5EWMB 3LUKA 3IP5A 2E4UA 3MQ4A 3JS5A 4EY3A 4YRZA 2J48A 5BR1A 1USKA 1ZHHA 4Z4FA 3OLVA 5KC9A 3DBIA 4YR7A 3F6PA 2PUEA 2VUIB 2FQYA 2CWDA 3RVMA 3MYYA 1ZGZA 1APBA 1AB6A 1QP0A 4N76A 2NUBA 4KQCA 1DC8A 2FMIA 2FEKA 2IDMA 3GBVA 4N0PA 2PL1A 1GLGA 1Z12A 4ZPJA 1A0OA 2TMYA 1P6QA 1DP4A 5EWJA 5IC5A 2B1JA 3EJWA 5I4CA 1DRKA 3C3MA 4PYRA 3HZHA 3SM9A 1VPWA 1DC7A 4RK1A 2GWRA 3C3KA 3GYBA 3M9WA 1VRVA 2HQOA 2IOYA 2A9RA 3Q7TA 3GA5A 3QEMA 2ID7A 3Q7SA 1RZRA 4KV7A 4FE4A 3CFYA 4MR7B 3TO5A 3UUGA 1ZN2A 2JRLA 2L2QA 4NQRA 3ROTA 1W25A 1DJMA 4QPJC 3KLOA 1D5WA 2PKXA 3MIZA 3VNBA 2HQRA 2AYZA 3E61A 3LTEA 2FTKE 4OG2A 5E3JA 5BRJA 3ILYA 3LKVA 3N8IA 2VUHB 2PUCA 1FFSA 4HNRA 2IPAB 2RJOA 4MR8B 5FWXA 1JDNA 1NTRA 2PAFA 1JLKA 4M88A 4MQEA 3MM4A 3TB6A 3BRQA 3CG4A 3QEKA 3P9YA 2FQXA 3FMVA 4MQEB 1CHNA 4MR8A 4QYWA 1YMVA 3A3KA 1LJUA 2FXIA 5TQ0A 5EWLB 4EGSA 3HM9A 1ZESA 3HXMA 4DQDA 5CNIA 1RNLA 3EGCA 3CU5A 2WJWA 3CLKA 3H5IA 1ZVVA 3T8YA 4YWHA 2FEWB 5TQJA 3CNBA 4EUKA 4Q6WA 1OXBB 5D2CA 2A9QA 3H5VA 2R48A 3Q15C 5CNMA 5CNJA 2E4WA 1Z25A 3OLZA 1XHFA 5IUNC 5FBHA 4EYOA 4ZJPA 1PNRA 1U2PA 4MS3A 2PLNA 4Z4EA 3Q7RA 3JY6A 2P9HA 1EAYA 3LMKA 5EWJB 5FBKA 1NXPA 3Q41A 3DGFC 5KI6A 4G0YA 3BILA 5TQ0B 1BDIA 3T6KA 1BA2A 1DCKA 1Z13A 3DLBA 4KREA 3M9XA 1MB3A 1ABFA 1A2OA 5KWSA 5IBQA 2M98A 1KMIY 3JTEA 4F11A 3QX8A 2R4QA 3O2QB 3Q9SA 5IUJC 4JB0A 1MIHA 1DCMA 2FMKA 4D6YA 1K68A 1NXXA 1RXIA 3RVLA 5ED4A 3OMXA 4IF4A 1EHCA 1WETA 3O21A 4G0MA 3TX6A 3D02A 3RVJA 4MAAA 4IRXA 4G0QA 4Z9AA 1JWLA 3QLUA 2GX6A 2PJUA 3LUDA 4PZ0A 4E7OA 3E3MA 1H9CA 4G0ZA 3EDCA 4H3HB 6CHYA 4N03A 4RDCA 3RVOA 4XASA 3UK0A 3L49A 2CHEA 2JVIA 4XARA 2YHAA 1SD5A 3NNSA 2HSGA 4LZLA 1MAVA 1JFTA 4MLDA 2JK1A 3RQIA 3OLXA 3NNNA 3CS3A 5DGCA 3SQNA 5TPWB 4RXMA 4WWHA 1YS7A 4RV5A 1P6UA 3CG0A 2FEPA 3S99A 1XWWA 2HQBA 2Q5CA 2AYXA 1ZGGA 3I42A 4ZMSA 2RJNA 3C97A 2E4XA 4IILA 1YK0A 3OO1A 1UDRA 5TQ2B 4KVFA 2KYRA 1E6LA 1DCFA 3HVRA 2W42A 3LUFA 6ABPA 1URPA 3KHTA 3URMA 5IEBA 1EWVA 1W9HA 1QP4A 4FB4A 1GCAA 1M2FA 3HEBA 5FWXB 3SY8A 3HO1A 1FFWA 2NZUG 4MS4B 4Q6BA 1JF8A 4KQ9A 2B4AA 4W5OA 1YTUA 3H1EA 3N0WA 4EYGA 2FN8A 1GUBA 1FQWA 4IMJB 1JX6A 1BDHA 4L85A 1ZAYA 1JYFA 2PUDA 2LUOA 3HDGA 3N0XA 1NY5A 2V0NA 4W5TA 5DCLA 5EWLA 1JBEA 1JDPA 3EQ2A 1TVMA 3N6VA 3F7NA 2I6FA 3KS9A 3F6CA 4PE5B 1QO0A 3NNDA 5TPZA 1VKRA 2M1ZA 3EQZA 3H75A 3EAFA 1U2QA 3O1IC 4KK3A 4EYKA 2FVYA 3CRNA 1PEYA 1Z2DA 2F8TA 2QXYA 5IUKC 2PL9A 1OXKB 3GWGA 3KSMA 3LUJA 4N47A 1YVUA 2ZWMA 4O5AA 2E4YA 5JNWA 4O1HA 3OQNA 1MB0A 3HDVA 4KZKA 4G86A 4TLMB 4JA2A 4MS1B 1MVOA 1DG9A 4XFKA 3HJFA 1JYEA 3VNAA 1ZH2A 1LBHA 3R0JA 5IX8A 1D1PA 2R25B 3H1GA 1SXIA 4G97A 2PUFA 4LDZA 3LUAA 3JPWA 5KC8A 1GUDA 2PMCA 1QQAA 1ZDMA 3A10A 3LUGA 2JVJA 2P4UA 2JBAA 1D4ZA 2MYUA 3LKBA 1QKKA 1CEYA 1JHZA 1ISSA 4N0QA 1FFGA 2VYCA 5KQLA 4D6XA 5IEJA 3QK7A 2FN9A 3IP6A 3DLHA 4MLCA 3F73A 3RVPA 1USIA 2FLKA 3NHMA 3HSYA 1T34A 4GPAA 1QO0D 4S04A 1K66A 3BRSA 1IIBA 2RDMA 3OQOA 5JS1A 2L17A 2RGYA 2IYNA 4TMYA 2LIVA 4HNSA 2MYPA 4O1IA 4L4UA 3DGEC 2WRZA 4PICA 2F8SA 2WB4A 3C3WA 1NXVA 1P8AA 4H3KB 4JAVC 1NXTA 3MMNA 4EVSA 1EFAA 3O74A 4Y9TA 4XAQA 3KTOA 4NICA 4MGEA 1NXOA 2OQRA 2E4VA 4RKQA 1M2EA 1ISRA 3DZDA 5B3JC 4F06A 2LBPA 3H6GA 3BBLA 3H5TA 2QSJA 2O20A 4OATA 4WT7A 3RH0A 1DBWA 1BAPA 3QEMB 3FFTA 2CD7A 1BDJA 1S8NA 7ABPA 4KNYA 1U8TA 2MYTA 2N9UA 3HUUA
chains in the Genus database with same CATH superfamily
2X6RA 3ER8A 1CR2A 3JWPA 5T8KA 2OGSA 3WIEA 2NXNA 3IB3A 3IR7A 3B2QA 3OQHA 4RA9B 4HDKA 4ZAGA 3UK1A 1WXGA 1E96A 1XJ5A 2PLFA 2VDJA 3LT1A 4UVEA 4F56A 4CQLA 4QFDA 4EPRA 3QU7A 2C9DA 2PR7A 5T67A 3T1YB 1RPJA 1UBLS 1G1MA 1P0IA 1X38A 3B70A 1ZR2A 4FFNA 2L0XA 3PDCA 4LDRA 5HFNA 3TQSA 3UOAB 4CM8A 2WMNB 1KJNA 3HB7A 1JEQA 1UDBA 3GARA 3PTLA 4IXNA 4W7SA 4EG7A 2ZXUA 2BFCB 2JCVA 4M76B 1NVBA 1T91A 3N05A 2DQKA 1GYPA 1QSGA 3BSFA 3DAFA 1OFHA 3EDQA 4M1EA 4RE6A 2CHVA 5FAXA 5A7FA 4DV5B 1FW6A 1XRRA 1XRMA 1RABA 5IJ0B 3BREA 4LDNA 4R98A 4WZAA 4IDQA 4D3XA 5JAHA 1JEQB 4K9KA 1C1XA 5C8XA 3FHOA 2GAAA 3LVFO 1BS1A 3RTEA 2PZJA 1IXZA 1VRWA 1IN1A 2OO5A 2A14A 2GESA 2QTZA 4MI1A 4CTMA 2QP9X 1EZZA 4M0CA 2D5LA 1KC3A 4ETIA 4MP3A 2AFIB 1AQLA 1P45A 5IFLA 5ENDA 1AF7A 1FRQA 4IJMA 4KXMA 3ADOA 3DLTA 3AP3A 1TL7C 2A1TR 3A1FA 3BE4A 1N1MA 1U3FA 1YOBA 3AY0A 2O8BB 4DJ5X 1A71A 1G18A 4C6TA 2XVMA 4WCFC 5AW3A 1OJ7A 1WEHA 4JB2A 2BTOA 2X4DA 4TKMA 1BVHA 4LF4B 2Z56A 5HMMA 1F20A 1KZ7B 1MTZA 1KSFX 1ZUNA 2QX6A 3C6QA 4BNHA 1F48A 3SR3A 3VHRA 1PJ4A 3SLRA 5DVZA 2XLBA 1NSYA 3AEKA 1MW9X 3NATA 5EPEA 4KSCA 4IG9A 3A6EA 2YVKA 3TZQA 3WL6A 1E9DA 3HR7A 5GZ6A 5DZSA 4ZV9A 4PYQA 3O7MA 1Y5MA 4HZUA 4L7VA 1NUAA 3BCHA 2P1ZA 1SXQA 2YQ4A 3W6UA 3QELB 1D09A 3SSMA 2VHCA 3WHPA 3WWDA 1CNMA 1UCFA 3GJTA 4F5YA 3SHFA 3BGVA 1XCPA 3ALQR 1VGVA 2C07A 4MR7A 4NOKA 3HJNA 1FFAA 1AZTA 1RQNA 3LY8A 2NU9A 4DBVO 2R1TB 3QELA 3S5UA 4NAVA 1RYYA 1E1YA 1VG0B 1XLTC 1RMYA 1NOJA 5ECWA 2Q4RA 4Q7EA 1KE2A 2ZUUA 2PLAA 3TRIA 4UU7A 1YQEA 3HDQA 3KYJB 4P98A 4PZDA 3JQEA 5JLAA 2JIZA 1XD8A 1HI9A 2BFCA 4G01B 3E4DA 1PI3A 2W0SA 4TL7A 2JI9A 3L4SO 3QBTA 4Y1RA 5AI0A 4KI7A 4D9MA 4KN6A 3G8YA 4UUNA 5HZKA 2ZYIA 1QK4A 4UNQA 1CUFA 1CP2A 2BDEA 2JFNA 3DFIA 3EVCA 3LLCA 4J4BA 4DQUA 1DQRA 2YKGA 2R44A 1IAQA 3GC6A 1RQ7A 5FPYA 2AH5A 3AZQA 2PLRA 4ITUA 2J9RA 2FUKA 4NFLA 2PPVA 4IRMA 4QYIB 3WV4A 3N3AC 1NBAA 2BZGA 3W4KA 3VNQA 1NG9A 1EZ1A 1SBTA 4DAEA 3MCAA 1T6BY 2B4TO 5AI4A 2YV1A 2OLKA 1E2KA 2YBEA 3QQ5A 2YXBA 1PV2A 3WB0A 1ENZA 2ZJZA 1KU6A 4DY6A 1U8FO 3RABA 4EVRA 3SQMA 2ZE6A 3RS0A 1WM1A 5AK5A 1DSSG 1NVMB 1RSZA 1SZCA 2PRYA 4L9WA 1XPOA 4DIFA 4FOOA 4LSZA 1GZSA 1E6UA 1MEJA 5FBZA 1EE2A 3TLCA 4HNAB 4DABA 3FBTA 4HB2A 3R7NA 3WMGA 4O1MA 5GINE 3MHPA 4MVJA 2G1PA 4RY8A 4BXOB 2BMVA 3IEKA 2ID4A 4IHKA 1NLZA 2NT3A 3D9QX 4K3UA 4PHFA 3RVRA 4L9RA 5DSZA 1R4NB 4H6VA 2X8LA 5DCYA 1ZRHA 3BJEA 4G8CA 4H7EA 1KP9A 3ZHXA 1EXDA 5I7UA 1CU1A 1F0YA 3KJIA 2CVQA 2PZGA 2VRCD 1E1CB 5A4KA 4B5KA 2JFPA 2PA3A 1WW3A 3GQBA 3UAGA 2EKDA 4XWYA 1PFYA 2OFOA 1A98A 3KT6A 3VR1A 1LVUA 1XB2A 2OKCA 3R3WA 4EKEA 5IFKA 3RUEA 3E84A 3N9IA 4CETA 2R751 5ALVA 1H3EA 2XKAA 2OBXA 3S2GA 2C7OA 1OCEA 3MWEA 4KKVA 5L3ZA 3GU3A 3OM1A 3ZHTA 1Z0SA 1FVXA 2C8VA 2ORED 2Z9DA 3FFBA 3U4QA 1J09A 2ODBA 4X1KB 2QAGB 3ABQB 1GL3A 3B89A 3QLVC 4MPDA 1KXJA 3L93A 3LDAA 1GTMA 3OH8A 2WJYA 3BCUA 1NW5A 3H2BA 1JG4A 3A27A 1TUGA 5CFMA 1CEQA 3A7EA 2HN9A 4GKBA 1HT0A 1JV2B 5ALYA 4Z0NA 3Q8WA 4FNGA 1XPRA 3LQ1A 4AY2A 1EK5A 5IM4A 5KNBH 4OHCA 4HWPA 4C0SA 4OHWA 4QOGA 1OX4A 1TEXA 5LYJB 1TA0A 1JL3A 2EQBA 4AS3A 4ENUA 1I6KA 1GA4A 1UKCA 2H63A 1IBRA 3BMNB 1KS2A 1ZICA 2AK3A 3Q87B 2B36A 2XUDA 4I50F 4HUQB 1I1NA 3AERA 1INLA 1FRNA 1OROA 4HTFB 4JOSA 3H16A 2FMHA 1M9NA 4MWOA 5CITA 1HUQA 1GNRA 2XCRB 3LNTA 2Z4SA 5KUTA 3GRZA 3Q5DA 2FWPA 4HNQA 5GZ3A 1WO8A 3EODA 1AUPA 3B2NA 4ZZIA 1F8XA 2J4DA 2Y1KA 3REQA 3JZFA 5K01A 4OXXA 3VU1A 2PX4A 3CN7A 4BL5A 1ACJA 2F48A 1Q0QA 3O75A 2UUAB 4YAOA 1TNRR 4AS2A 1R8XA 3AL2A 3IP7A 2VVTA 3CVJA 3CCFA 4FLFA 1GM5A 4FZRA 3I4CA 1VXOA 2H9AA 1LW6E 2VXBA 1NI5A 5G40A 4DR4B 2Q07A 3FETA 1ZHHA 3TTUA 1XU7A 3NT5A 4FNMA 1M2VA 3DBIA 4H7JA 4QYTA 3TKAA 4YR7A 1I30A 3KETA 2AFRA 4AJEA 4PC1A 5FTWA 4OHYA 3UAXA 4CI9A 3PIRA 4PINA 3T06B 4YRQA 4F96A 3U31A 5G0WA 4BKOA 2GPTA 3VKUA 1USUA 4OM8A 4Q4DA 3A05A 4ZOEA 1LTQA 3TJMA 4XB1A 3AX6A 4QODA 1PDWA 2VHUA 1DKUA 1Z9BA 3FTDA 1D8TA 2JAUA 2X6TA 2DWCA 3G49A 1UM8A 3GDOA 1DTWB 1DP4A 1P6QA 3QBVA 4L07A 2BAGA 4FBLA 1J07A 1M54A 2YYYA 4CQMB 2RH8A 1GPDG 1ISPA 1DBRA 2ORVA 2VBFA 2GTIA 3E5RA 1OZHA 4PZZA 5HKLA 1NU6A 4A2CA 3K1ZA 3UV3A 3F8WA 1IHYA 1VKJA 5KJCA 1BXRB 3DTVA 3IT2A 3ITNA 1P17A 4W1RA 5H83A 5JLJA 1V8FA 1WD7A 2POCA 2X0EA 3PYMA 1HDRA 2CL7X 2IVFA 4DV2B 1YRYE 3NHRA 4UKDA 1XTVA 4Q48A 4X8HA 3QKUA 4URZR 2R00C 1G4UR 3D8HA 1DXYA 1P4GA 4J4HA 3A11A 4OG2A 1VP9A 1PBTA 2BF4A 2PGAA 5E3JA 1OX4B 5BRJA 1JB9A 1HDOA 2P11A 3I0NA 2WJHA 3AJ8A 4QLOA 3UFXB 1T2VA 5IAKA 4BNNA 4X90A 3PQ4A 2GVZC 1JUDA 1P4SA 2I6SA 3KB2A 4FZ5A 4V0OA 2IPAB 1KYIA 4MR8B 4UHFA 4K0KB 2AUNA 1PW5A 3B3FA 2DHEA 1SHUX 3G2HA 2Y1LA 4RSHA 3HGQA 3ZV6A 4CKZA 2QMZA 2D6FA 1SC3A 3LBNA 3TM5A 3QEKA 4C6RA 4FTWA 2PU5A 1BMFD 3ELDA 4TN1A 3OBIA 4OKNA 2Z2KA 3BXXA 2EGGA 1W93A 3IPRA 1VHQA 3ILVA 2WM8A 3Q88A 4FWIB 3G13A 2ZXEA 5AKIA 1Q0ZA 5DI3B 3VR2D 2G5PA 5C35A 2F17A 3LPAA 3CRMA 1ADCA 4IS3A 5BNWA 1WBBA 3LF2A 3W7AA 3TKLA 2HRBA 3PJEA 2FPGA 2R1UA 3ZWMA 4LF5B 1YR7A 4Q6WA 2A9QA 1X6VA 2V6GA 4D79A 4QSMA 1K8QA 5FL7A 2C1EA 1HYBA 5EMLA 4P36A 3GLKA 4ZIRA 5IUNC 4QZVA 4AX8A 3AUKA 3R76A 5BMVA 1IWPB 1E99A 1IDN1 3MIIA 4RDXA 3GLIB 1E3MA 4PR0A 2GCEA 1N9GA 1EAYA 4HLNA 5H5JA 1HYQA 1MHPA 4INOA 2QY9A 3AJDA 3SC4A 3GGSA 1UWCA 2VJNA 1S2NA 5JW6A 2IOQA 1GSIA 1NHGA 3BWXA 4BRZA 1XRPA 2V6MA 4FW8A 5EZ5A 3H9QA 5C9ZA 2AQ8A 3PKIA 3M9XA 4IFEA 5LQAA 1ZSNA 3OCXA 3B20A 4PTYA 3SEQA 1HMPA 4J2OA 1UC8A 4F2DA 2UZ4A 3JTEA 4F11A 4ZT4A 3R7LA 1E1LA 2ZRDA 4F60A 4D6YA 1MNQA 3O83A 2JD1A 2HBRA 1WMEA 3P20A 3KELA 1O2DA 2C5HA 2PKCA 4CG0A 4KQGA 4BO7A 3I62A 4TRNA 3RVJA 1QH8B 3C16C 2ADMA 1OH5A 1Q19A 1RQ2A 4ZEWA 1Q1NA 3QUTA 4DNFA 7GPBA 1UINA 4Z7JA 4DT1B 5ICCA 3PDJA 2OVBA 4A1OA 4P84A 4MUMA 1YL6A 2X8JA 2HADA 4BBPA 2JD0A 3MN1A 4HGNA 5BW6B 4XWAA 2P8SA 2JHGA 2PUHA 2VSYA 2HLNA 2H7VA 1WQ4A 3ROMA 3UWSA 1IONA 1GPH1 1S3IA 2QLJA 5D3QA 5FULA 3T5PA 4CM5A 1L5HA 1PSZA 4N90R 4RTRA 3MHDD 3QVJA 5EZSA 4I9XC 4E11A 2GFHA 2Q5CA 1J7KA 1A7UA 1CY7A 4FSXA 4TV8B 1IWOA 5JQGF 3KKLA 5KNCA 3UMJA 1HETA 3JQBC 1FNMA 4DIOA 1CY6A 3WLAA 1E0DA 1VYHA 1UDRA 3NDIA 1OLSB 3DPUA 2VYVD 1OC4A 5JBIA 1JMVA 2OQIA 3R40A 5JARA 1M2OB 3H4IA 4RYLA 5EJ8A 2Q5FA 2GPJA 2AE1A 2QW8A 1XQYA 2PH7A 1B0ZA 1Y5LA 3BJMA 4PBSA 2YWCA 2XXJA 3R3HA 2C5SA 1XNJA 4JA0A 2VP6A 2XRFA 4TXMA 4B8WA 1QUEA 1HBJA 1Q83A 2ZJAA 3IV7A 5EY5B 2VQDA 3RYIB 3ZZMA 2BM0A 4QTZA 2XB6A 1EVKA 3CNLA 5ALUA 1BDHA 1JSLA 2AEMA 3U4GA 5BV1A 2YNMC 2C5EA 4OH1A 4KDEA 2W2QA 3U37A 3C98A 3HI4A 4RQAA 4EO4A 1ZMOA 1OZ0A 2IE8A 2Z5LA 1Q95A 3W2IA 4W63A 4RTPA 3U3XA 1FRZA 1Z2OX 2HIGA 1A96A 1W87A 4J90A 1T8RA 3D6FA 3P4XA 5AT1A 3O1IC 5KTKA 3BA1A 1FUKA 4UXHA 4CQMA 3KJGA 4F5ZA 1PG0A 4IXWA 3K4PA 3BE8A 2VUTA 1V4NA 4YN3A 3ST7A 2GN9A 2DCMA 3TECE 3ZBTA 4FBMA 5E6RA 4F9GA 4ZEOA 1JKJA 221PA 3QVWA 4MW4A 1QYXA 1YVUA 3JARA 4YUVA 3V1LA 3W8RA 4G89A 4AG3A 3ZU2A 3ZHUA 5L40A 4UU0A 4TLMB 4KQKA 4HV4A 3H3XA 4R2IA 3M49A 1YBMA 2AFHA 2AMLA 4P80A 4Y2VA 4KAAA 1VLHA 3UQZA 4W5JA 4ARBA 1X42A 3R0JA 1N7HA 5JSFA 3LUAA 3R9XA 5H4HA 5HILA 1LRLA 1V6SA 2PMCA 4ZI3A 4MW0A 2A67A 3F2IA 4GNKA 1QQAA 2IH2A 4CUZA 4QXQA 4HY3A 1U3VA 1YD7A 1AGNA 1CF2O 1YB5A 4H31A 4QFCA 1ZXLA 2I1WA 1YUNA 2R1ZA 3FVQA 4N0QA 5LDDC 1TC1A 5EPUA 2XMQA 2W43A 3JVEA 4BPRA 1Y8ZA 3E27A 3M4NA 3IUYA 3MPUA 4LGCA 4G4IA 3R5KA 4M9SA 3L4BA 4YCDA 2XOKD 4REOA 3T9AA 4D41A 4YUZA 5JI2E 3JW8A 3KR1A 2P2DA 3EG5A 2HXYA 1WB4A 5IW8A 2GAJA 3AUUA 4ZVRA 5IHXA 1QHGA 3K51B 2CNWD 2KMLA 4NC9A 2FX5A 2Y2VA 4B6JA 1OWNA 1P0MA 5EIEA 1PR2A 1PJQA 5BQFA 4R6WA 2F8SA 1H2YA 1IN8A 2WB4A 3C3WA 4LRTB 1DEKA 3H99A 4EVSA 4JAVC 4OB7A 4IZOA 4ER7A 1P31A 1PJBA 1EBUA 1TW3A 3QITA 4XAQA 3TJZA 4MGEA 2WG2A 2IYQA 3GLIA 1ISRA 1CNEA 4COOA 2IIPA 3UUEA 4IP0A 5C7YA 1S2LA 3H5TA 3RRJA 1V96A 2BDTA 4RA9A 1M8KA 3T1OA 3SQXA 4AKGA 3EEBA 3PWKA 4ZYVA 4HS4A 3KL4A 2A9VA 2O5CA 4X97A 2QY6A 1EVLA 2HB6A 2ZIXB 3BAZA 1QRUA 1X7WA 1LJLA 4ZC1A 5KTTA 3TAUA 4NEQA 2UYOA 5B6IA 2JJYA 4FYJA 4N7BA 1US8A 821PA 5KHLB 3VKGA 1TQ6A 2E1RA 3OZDA 2FX2A 5LXTF 3RC3A 5K0JA 2QUZA 3R24A 2UYYA 3ZCVA 1E98A 4OCZA 4XOUA 3GLHA 4H0CA 1LRJA 2X1HA 4B76A 4JYPA 1DBPA 3KWLA 1KVSA 3JARB 5DWDA 3QJGA 5KTRA 3BWVA 2G76A 2G71A 4ZU3A 1SPXA 1KJQA 1WQ3A 1AMUA 1XIVA 3U7JA 3KQKA 4HWOA 3IP9A 5CLFA 2XHZA 1W36B 1GXSA 3ZI4A 4CM1A 2QQGA 1CUXA 3MWGA 4UPEA 2ZCJA 1FVOA 1ECPA 3EFBA 4JU8A 4QT4A 5L95A 2AFIA 1SCUB 3VZDA 4UM8B 4ZMRA 3QTBA 1T0JB 3R9XB 2GBLA 5JXIA 2Q2OA 3GFOA 1YFZA 3C39A 1FJGB 5H16A 1N9KA 1L5FA 4TVOA 5FEMA 2WDPA 3WKDA 1LQUA 3FCOA 4MUBA 3QYJA 4U6SA 4IUCS 4JUIA 4QQ8A 1D4OA 3IA2A 2ZVDA 2FW9A 1S01A 3GB9A 4OJKA 4QGHA 3FKJA 1Z2NX 4TVKA 3RC2A 5A04A 2N0SA 2C1ZA 2Q0QA 4G0UA 3I01A 1TW2A 1XTRA 2DR0A 4XE5A 5HZGA 5IYZA 4I5EA 3U6KA 3WTBA 1MT3A 2QTVA 3M3DA 1W9MA 4HAUA 4X6XA 1EX1A 1Q17A 1QIDA 1Y9DA 2KWIA 3LBHA 3AOEA 4JDPA 1Y7TA 4U2CA 2Z08A 1H4QA 2IZ0A 1S7CA 2IW3A 2D62A 1KO4A 1E2FA 4B1FA 2VEDA 4BVLA 4KWCA 1JMAB 1RKVA 4QLBA 1W0KA 4P83A 3OT1A 1YR2A 3TTYA 4D3YA 1D5CA 3A0UA 3DZKA 3O8RA 1OYVA 3FXAA 4QICA 3CLTD 4RH0A 3N39C 5A2GA 1B93A 2UUBB 2OBNA 3BPSA 4HH1A 1W29A 5EP3A 1UPCA 1NQOA 4JT9A 5FV7A 5K7SA 3QJ5A 4S05A 3PGXA 1C7FA 3K73O 3TDMA 4MQUA 4O0MA 4W5NA 3PHLA 2YV5A 1TADA 2Q2QA 2BI4A 3B6IA 1TAGA 4WN9B 2MSKA 1T0UA 3GLRA 2FQQA 2IEDA 2NO7A 4D44A 2Q3LA 1XD2A 3QOYA 2GAIA 1J39A 1YB1A 2BHRA 3C5CA 4V3BA 3L1UA 4BN4A 5KJ1A 2IH5A 1U9IA 4AY5A 5DNAA 1ZQ9A 1EFRA 1OR8A 2YV4A 1X9HA 3GFQA 3NU1A 5BSTA 2FKAA 4FFPA 4FXOA 4M8LA 4ATNA 1F2TB 1P39A 5DHAA 4O4HA 2X4IA 5DIFA 2AMJA 4MWBA 2PZAA 4C7OB 5TPZD 4R8LA 3EUWA 4P3NA 3TNLA 1E7QA 4EFDA 5JYDA 1WCXA 2LZ0A 4AROA 3PNBA 2OV6A 4KBYA 3L01A 2JCGA 1KMNA 1DG3A 2TMKA 3PEEA 1BVYF 3ETNA 3VPCA 2QVLA 3AIKA 5JRDS 3FSEA 5K4HA 4B0OA 2D2FA 2BP7B 4JGBA 4RPLA 2I3DA 3WK4A 3RKSA 3ZWYA 2OYSA 2D7JA 4IY1A 3K9WA 1KO1A 5HF9A 3FG9A 5CXUA 1Q1EA 2HWWA 4KXLA 2BFPA 4YCCA 2QENA 1W6RA 3GUVA 1UP4A 2H16A 5EJMA 1HT2E 2J87A 2BJHA 2RGNC 5H3LA 4N65A 2DOKA 2VTBB 1TM2A 3VKWA 1CEXA 3NG1A 5DXFA 5J1TB 4BFSA 2J3JA 5C3MA 4IBOA 4HEJA 3D7LA 1JLMA 2FW0A 2GPYA 5G0TA 3RFVA 2REQB 4S1NA 2NSLA 1AVTA 2XEXA 4LWZA 4O4LA 4GUDA 4JL8A 1YS2X 1Q91A 1JQBA 4C2TA 2VYFA 1FRFS 1X8LA 2VK4A 4MV7A 4UCXA 4I7EA 1PTJA 1TMYA 3IDSA 2H0AA 4LMRA 3USCS 3ZYZA 5LP1A 4OLAA 3AUSA 4G0PA 3HPRA 4L0QA 2D5IA 3FZGA 4G0OA 2Z6AA 1Y8CA 1ZYUA 4K0RA 1VI6A 3N28A 5DHSA 2E4AA 1UBFA 1ONSA 4ZFNA 5KMGB 1XZIA 1JFRA 5BO5A 4Y7CA 4DXAA 5FTNA 3EMBA 4IPTA 2ZJ3A 2XB4A 3T9BA 4EDHA 1A9OA 5AVJA 1E66A 5GAJA 2VSNA 1N75A 3ZE7A 1GRCA 2WKRA 3A7DA 1GXSB 3ZDCA 2BR5A 2CK3D 2XUHA 3JQ7B 5KYXA 1KJJA 1UXOA 4H6XA 5EEGA 5BNZA 2L82A 2BKLA 2Y1DA 1E6KA 4MYRA 2GK4A 1XA4A 3AERB 1KFJB 2VT6A 4MRMA 2V7BA 4TQGA 2WPDA 3T7KA 4QJ3A 3BTVA 3HFGA 3K32A 5CRIA 2ZRPA 1MUUA 1IHDA 2HBYA 3IURA 3RUPA 4G0NA 2O8DA 1JZQA 1FEZA 3RD5A 2DBRA 1EVYA 4DLZA 3X3FA 3QHQA 2QZJA 2QRPA 3FZEA 4QGSA 2A9OA 1VSVA 1YS4A 4MIYA 4D96A 2FZWA 2YIJA 3UKJA 1XEXA 1XDDA 4JR2A 3QKTA 3WNCA 1JLLA 4ACBA 2A30A 3Q9LA 1BE0A 4RV9A 3ICWA 1JR3D 2I78A 4R4JA 1A1SA 4WESB 4J0QA 2DPYA 1H3FA 2BUBA 4B83A 1WF3A 5I7SA 1XELA 1VG9B 2R47A 1R5JA 3GT4A 2FOXA 3HZOA 2GK6A 4KRYA 3VNRA 4YV7A 3O3MB 1MMFB 2OHOA 3DZJA 1AQNA 1GILA 5FAKA 2QN1A 3C4QA 4HH0A 4MB6A 3SVLA 1ISFA 4Z99A 3TSYA 1QDEA 4BMSA 3UHOA 4KWEA 3UB4A 2IELA 5JSQA 1UKBA 1MEEA 2BCJQ 1P7PA 3FUVA 3U7QB 5BSHA 1NN3A 1BKSB 3N0TA 3DDNA 3FH0A 4J6FA 1LDYA 2ROQA 2YZKA 5EMKA 4R2JA 4JNCA 4FPXA 4IAOA 4US2R 4FDAA 2VJOA 2CXSA 2QTLA 3DZ8A 3KEGA 1G3MA 3VTKA 5CB4B 5GIPE 5HOEA 1K6JA 2HC9A 3SZGA 4DCSA 1M5RA 4ZPXA 3T1HB 2A9JA 2QQEA 4JBLA 2VPQA 3D6NB 1UC9A 2PCJA 2QM0A 4B2YA 1ZH0A 5AK3A 4CMCA 4EJSC 4RLSA 1GEGA 5ALDA 1K7XB 4ZJYA 4C30A 4CR6A 1A5ZA 3U3MA 2BR3A 2IBMA 1JB1A 4NHEA 2ZU6A 1A88A 2CZCA 4PYRA 4JU9A 3NYRA 2IIQA 2O0MA 5FWDA 2C9MA 4E88A 4P4LA 2FPKA 3PC3A 3WAKA 2JDID 2ZIAA 4U1RA 1D0IA 2FNAA 4BFYA 5AVXA 5AK6A 5IAAA 3W5SA 1MO5A 4IEEA 4Y6QA 3TQHA 1JU4A 3JRNA 4B4OA 3BMQB 3ROTA 5CDTA 5KYYA 5SZJA 1KYWA 3TOXA 1D5WA 3MIZA 3WLNA 4GWGA 1CIJA 1LCIA 4NNOA 1UBHS 3W5VA 5AM4A 3VR5D 2I65A 1GZ6A 2AD5A 5I7AA 4GFDA 2B1RA 2H2FA 2NV2B 4RIGA 3DC7A 5AI5A 1EGHA 3HY4A 2R11A 3ZU4A 2F1JA 1EP9A 1NTRA 1J2RA 4L5BA 3UT5B 4AXBA 3GD7A 1ORTA 3GFVA 4DDVA 1CRLA 1ISHA 1S8OA 2A57A 1VSQA 4TT3D 5HK8A 3MAGA 1LSUA 2P2SA 2WIJA 4HL6A 5A9SB 2CFRA 4MRAA 2YVUA 1MAUA 2QTCA 3IODA 5BSMA 1EA5A 2JLZA 1G3IA 2JFHA 3JYLA 2BRUA 2NV0A 4NMLA 5TQ0A 5EWLB 3F4LA 1KK0A 1QH1A 5JALA 3CVXA 1ND6A 1TYDE 3W5AA 1RNLA 1QCYA 5EQDA 1CUCA 3G5MA 4HK4A 4JBIA 3AIMA 2XQJA 4FIDA 4BU0A 4CLXA 3VSEA 3WISA 2G9QA 2CB9A 1BA3A 3K8ZA 3O26A 5TQJA 4INJA 2X10A 3VSDA 1KEUA 4DGSA 4XIGS 4I1UA 3N2ZB 4MCHA 1V11B 1J1UA 3N1UA 2HXGA 1ZRSA 5FYDA 4BV3A 1ZM4A 5JXWA 4U7TB 1PR3A 2C2XA 2RGBA 3CLRC 3L40A 5EXTA 2V6JA 1IMJA 4MVJE 1Z68A 2EEZA 2EKQA 5L51A 1ZGHA 4L9SA 2WHQA 3MWYW 5I8PA 3JD2A 3ZD7A 1KP3A 3WXMA 1KJZA 4DARA 4IIJB 1SVKA 2XD9A 3DZFA 1L5QA 1I4EB 1O5TA 2AN4A 3QFHA 2C4HA 4GZ3A 1A2OA 4OA8A 1ZBDA 3BDVA 3TCXB 5ADWA 5IVPA 2VP4A 4AQYB 1J9GA 3OG9A 5DHUA 4CIVA 2NMVA 4Y1RB 3TK1A 2WTMA 2ZWIA 3L8CA 3AIIA 3O4IA 3F3KA 3QIAA 4ZOCA 3GO4A 5L6LB 3AHDA 2BEWB 3M1LA 2J3DA 3QPWA 4ARIA 4P58A 5FUVA 4CV2A 2GZSA 2JBWA 2VTDA 3NJ8A 3W5DA 3AUAA 1RZUA 2P6PA 2XE6A 3COVA 3VSAA 4FWTA 4XWWA 4IEFB 3QX3A 2Q1SA 4EG3A 3W1WA 2LW7A 4G5YA 3FCEA 4MYHA 5D1HA 3ZS8A 6AT1A 1SBHA 3JXEA 4GE0A 4ZTBA 1PV4A 4U2BA 2A33A 2HRCA 2Z8YM 3CX7A 1GG5A 2V7PA 4J1NA 3VR3A 3E05A 2A5DA 2R84A 2RMKA 3NW9A 4NMWA 4BO4A 1V6AA 3HXPA 1YB2A 4HUQA 1UMKA 2XXAA 1T13A 1VIYA 3OPYI 3W2FA 1UXIA 5TPWB 2R4TA 4IICA 5KTMA 1H2ZA 3AVOA 3QEOA 3X1YA 1SEPA 4FXPA 3OMLA 4RV5A 5C34B 2O07A 2ZVPX 3UV7A 5LQJA 4Y6SA 1EUQA 4PAMA 1TF2A 4YIHA 2W11A 1RYMA 1VPLA 3BN3A 3K1AB 5JASA 2ZRHA 3UKDA 3U7EB 4KQFA 3WHLA 1OXVA 1XZKA 1AX9A 2WYVA 4XSVA 1RC8A 2CZQA 4G0VA 3LNCA 4C2UA 6REQB 4I3GA 3CO5A 2IPXA 1PJ2A 4Q9NA 4WVLA 3P45A 3UN1A 2JHCA 1KAMA 3HLTA 3E7XA 3LCVB 2PSEA 2GM5A 5FWXB 3HEBA 4YP5A 1GLNA 1K6IA 5GGXA 1C30A 4HBGA 3KTFA 1MABA 2ZFUA 4LECA 1EESA 4E2FA 2YY7A 4A6XA 5C4IA 3SC2B 2C1XA 3L7CA 4IGFA 1Q3HA 2XAUA 4D7AA 2I2WA 1E5XA 2H4FA 2LUOA 1B0AA 3D54D 2W48A 4AWXA 4QOFA 1RRCA 1DIAA 3D7KA 2J85A 5DWQA 4Y30A 1G2OA 3GGDA 4DMFA 4XCVA 1J9EA 2DY0A 3RHSA 3IOMA 2JJMA 3EBPA 3MD0A 4HCJA 2YZGA 3EPRA 3ENKA 4FC6A 4E4RA 2AF3C 2PVSA 4FI3F 4G25A 4U2FA 5K0FA 3TWOA 1PS0A 3CRVA 3DR5A 2VWHA 2DY1A 2K2WA 2ZIEA 1NQUA 1X8XA 2ST1A 3OQ1A 3GLFE 4KXFB 2A0KA 3OD5A 2HSDA 1BE8A 2X13A 4O5AA 1TK2A 3SBEA 1G60A 3HDVA 4EX6A 2LV8A 3EXIB 1GHTA 2XGGA 5THKA 1MVOA 4TWAA 4UMVA 2BFBA 4J0JA 4QGAA 1PR6A 4R2KA 1OXXK 4M55A 2ZSJA 3QFTA 3QKSB 2CMHA 4QDUA 4U7PB 2CXOA 4WV3A 2WFLA 4E2YA 2GJ4A 3MWDA 3C3CA 5KC8A 1Y3IA 3CLUD 5B7QA 1YQXA 3DMYA 4TM7A 4BC1A 4IWYA 3IKMB 3RRMA 3G2PA 2SCUB 5E6UB 1CCWA 1KJ9A 2O1WA 1GZVA 4TSFD 3AR4A 5SZIA 2HWYA 2ZE7A 4GRIA 4JVMA 1QKKA 3DCYA 5IU6A 5JHHB 3KKPA 1JHZA 5CYOA 5AOCA 4RD6A 1A9TA 3WYFA 5SY9A 2OGWA 4W5WA 5KQLA 1SRQA 2FN9A 4ARCA 1K2WA 2PUWA 2VPIA 3JSXA 2VBGA 4HVAA 4MLCA 4LWOA 1G8GA 3AH8A 4UUBA 5F51A 3VVCA 2C95A 4P31A 1RLIA 4UFPA 1DX6A 4I3FA 4KXVA 1GO2A 2CB0A 2Q5OA 3OZWA 5TEWA 1G17A 4X94A 1RU3A 4BIIA 4NVRA 2L17A 1N8SA 1E1KA 2D59A 2IYNA 3CKLA 4FDVA 4FFOA 1FZQA 4MI6A 3OBBA 4YT2A 1XYVA 3QFRA 5HFJA 3QY0A 3PK0A 3SXJA 1NXVA 521PA 4GI3A 3NRCA 2V4MA 1XAGA 2DBYA 1G20B 1L4KA 1W4LA 1XMIA 4M9XA 1NXOA 1VECA 4NS1A 6LDHA 4D45A 1P4AA 2AOWA 5IKEA 2FN3A 1RYDA 4ARSA 1V7ZA 1YGPA 4CEJB 1AZWA 1XZBA 3IQFA 3KAQA 4NKRA 2XZTA 3GDHA 2F43B 1LKZA 1RCUA 2QJOA 4J1TC 3FRHA 4MSVB 1FTNA 1JAHA 1F8FA 2VSQA 2Q6VA 2V5AA 3EFOB 3I05A 4B79A 3U3PA 4C0JA 3AVTA 4P81A 2AOXA 1RQGA 4MRNA 2GM4A 4NTZA 1ZSVA 2B98A 4RK4A 2W58A 1X87A 3G2JA 5DMHA 3MB8A 3BFXA 3H8VA 4WPGA 4MVXA 1CQJB 2KLBA 1NF3A 1R10A 3SYKA 2QRMA 3V8QA 5E7JA 3UYLA 2J3KA 4P82A 5F5LA 3GJXC 2O3UA 3CYFA 3OC0A 2I4IA 4OY3A 3U3OA 3AMVA 5LQCA 2ERYA 3DV0B 2RAFA 3ETDA 3ESDA 5BV7A 2CL0X 2ERCA 3JQ8A 4WJLA 2IPMA 4XOIA 2B8WA 1Y5IA 3RC9A 1JEDA 4E3WA 3P0RA 1Q7GA 2Q99A 5K6RA 1ZJ6A 2IUYA 3Q7IA 2XIJA 3EXEB 3R0IA 3ME5A 3HGTA 3UFXA 3ZU6A 5KYWB 3KB1A 1N5DA 4ZYLA 2GSDA 2VHZA 3H4MA 1D4AA 1BWRA 1IY8A 1J42A 3FNHA 4WUTA 3WAJA 2GQ0A 2GJAA 2WIGA 3U9TA 4MV1A 4AECA 2VHTA 2XMRA 2F1KA 3KOMA 4HXGA 4TMWA 1L1RA 5AHKA 5JROA 4R9SA 5H82A 4FR0A 1HXHA 2CE7A 3AQIA 2QRJA 3ANLA 5I8ZA 4DCCA 4JLKA 3RWOA 3CNNA 4AYXA 3KXLA 2V7QA 3KKMA 4J3JA 4KUEA 1NW7A 3GA0A 3GV0A 1NBMD 1R3DA 1Z18A 2PRSA 2VHXA 3KRTA 5B58C 1BVUA 3QLTA 5HKOA 3IKTA 1R0KA 3B1XA 4HGOA 4WFKA 5JAPA 1T5TA 1GTG1 3PNVA 2VJLA 4EB8A 1U2SA 1L8LA 2GWHA 1L7EA 1EE1A 1GZDA 2WYIA 1CJKC 1E1QA 3IERA 3ITKA 4QHTA 3W78A 3NFYA 4BDSA 4DMCA 3F90A 5KKCA 2ODEA 1OYYA 1SC4A 1JDSA 1Z6PA 2BFNA 3I5UA 3IEPA 4IMIB 2Q8NA 4G63A 5EJGA 1Z26A 3G2KA 1W34A 3M1IA 2CJWA 4KFCA 2IEZA 3GFPA 4HZUB 4RORA 1LS1A 1EI9A 1MH9A 2P5SA 3AR5A 4GBED 5CK5A 3VVBA 1ADYA 1CP3A 2NUTA 5SYAA 2XNHA 4G4JA 5DJ5A 3WIOA 2P3OA 3TNJA 5B3KA 4W4TA 5ED0A 3AP1A 5ALIA 3R3VA 1UEXC 3GRYA 4N5HX 1CJSA 2VA9A 1KDRA 1RLUA 3THOA 3TUJC 4PYMA 4Q7QA 3LPCA 4DLKA 1EB8A 2QYSA 1DAGA 3IVCA 4JLPA 3WB2A 3W8DA 3DAGA 5CCDA 3WE7A 4Z4QA 4AI6A 1IJFA 1N77A 3MSCA 4ZT5A 5LM3A 5D3ZA 4MDEA 4MARA 3UJ7A 4PO1A 1IDOA 3LLSA 4F3RA 5ICEA 2XRMA 1J8MF 2ZSUA 4X20B 3DT8A 1PYGA 4XB2A 2H31A 2KJQA 2YFHA 4BCCA 2PX5A 1G21A 4TXJA 3ZDDA 2PRIA 3Q9NA 4OQDA 4XWKA 2VT3A 3AINA 2WLSA 1Z8DA 2YRFA 4P53A 1B6SA 1XJCA 1YC2A 1QORA 3A2LA 2HA0A 1OAOC 4Q00A 3C24A 1VMDA 5CH5A 5DK6A 3TLKA 3ZTTA 1YL7A 1VG1A 2J3MA 4JITA 4KE6A 4QARA 3VMFA 5KYWA 4FR2A 3B9RA 2QX9A 1GU7A 3DKRA 4LHVA 3THYA 3RUIA 5C8DA 1GVHA 5U9CA 2OAQ1 1UOOA 1Y98A 3CVUA 2IKQA 5ERYA 4XEHA 1VE7A 3EGIA 1E58A 3IJEB 4MWDA 3OM8A 3TTXA 2PSJA 2FPMA 4M4PA 1QU3A 1ZXBA 1S1CA 4YJ3A 3WTCA 4MHOA 4N48A 4MIEA 4JP1A 1LK0A 4HYQA 5C5DA 1KY4A 2QRUA 3DE1X 2ZGVA 4OHVA 4MV8A 3RIGA 1PE0A 3O2JA 1TRKA 1O9HA 1IQUA 2BEJA 1SBCA 4REMA 4FCCA 2QMQA 1ML3A 2UVDA 3V4RA 1VL2A 2O2ZA 5GJVC 3ELBA 5DBFA 3OEEA 2PUAA 4JJFA 3PCRB 3AVPA 1HLFA 3MQFA 2IU6A 3GMTA 2EWMA 3P2JA 2NXEA 5TV2A 3K94A 1K08A 2P4QA 5DYNA 4ZOQI 3F8SA 3BWDD 2CLSA 2IYRA 4AN0A 1QE0A 1O6FA 2ESRA 2PQMA 2PHZA 2XCOA 3HUTA 4BDTA 4OK5A 4I50B 4WRRA 1W88B 4EOGA 2QD2A 3RYFB 3G9UA 4B75A 4TS9A 3K0CA 3TSAA 4ILKA 2FV8A 4LOKA 5DYWA 1YR9A 2BFWA 1GGNA 1QHSA 3E1SA 4BX3A 3VJLA 4FS8A 2Q5IA 3F47A 1V8BA 4MQFA 1Z16A 1C3XA 3M6AA 3B1KA 4GNRA 4KIFA 1XTZA 3PZBA 3V42A 3K9LA 4V24A 2XY4A 4UEQA 3T52A 5DWVA 3L7DA 1PJ3A 4MMYB 2GOYA 2Q9UA 4OXKA 5BOVA 3COJA 5K9ZA 1QVAA 2EQ5A 2VNAA 4MQFB 4PQRA 3WFJA 4PIVA 4DDUA 4MQBA 5DM70 5H3HA 2HW8A 3SJBA 4JSRA 2V8OA 3C6MA 5DGDA 2GBLC 3BHMA 3SF0A 2QAJA 1W2HA 1GJRA 2V9PA 3GUUA 3UB2A 2A7XA 1HL7A 3C3BA 2AKAB 4YCMA 2ORWA 2XVAA 3WKEA 5FWYB 2MMGA 1TFUA 5FOVA 4IDBA 4O2RA 1W5EA 3PXXA 4WY2A 4EFLA 4LXGA 4ZTZB 1N0HA 3VR5H 2IYFA 1G7RA 3P0EA 3NAZA 4IDFA 3WDSA 4WJKB 4BVKA 1TMGE 4EPVA 5LU9A 1T1GA 2MYNA 1N1GA 2PSDA 4G84A 3CT4A 3QBEA 3TPZA 2FLWA 4UDYX 2VPPA 1CQPA 3AGQA 3OX2A 4AAYA 4IJVA 2XD4A 3M33A 4WAUA 5G4KB 1KRWA 4PGFA 1IK6A 1QH1B 2FZ4A 3D5QA 2NZYA 4I1PA 2AMFA 2OK8A 3FB4A 4C5CA 4FDTA 3PT9A 5HTKA 2UVPB 4B6OA 4MLPA 4TMFA 4XVCA 2WF9A 1HTTA 3DSRA 4K3VA 4N54A 3SX2A 2UUOA 2HDNB 3BB1A 2EFJA 3WOVA 5B3LA 1DJOA 3LUCA 4D3ZA 2GN4A 3HU3A 1JQJC 4GOLD 1M2VB 3IP5A 3GA7A 3R8CA 4R1OA 3VOAA 1YZVA 3IPYA 4EY3A 4YRMA 4JI7B 3OJWA 2O8FA 3QF7A 4PRKA 1CY0A 4UTXA 3OLVA 2WW8A 3MTQA 1H65A 3S55A 5LFAA 2HF9A 4A2PA 4EKGA 5A6VA 3PNLA 2GEDA 5EERA 5D51S 3UAVA 2EJCA 4BNFA 2IDMA 1VBNA 2PTHA 5DX0A 1SU6A 2V7GA 3HN6A 1UBEA 4HLQB 1KK1A 2XYQA 2Y2UA 3CSDA 3IUJA 2AJCA 2CMKA 2I62A 4O3MA 3FNBA 4ZXPA 3KQWA 3N2KB 4YHBA 3CZRA 2VP3A 3DO8A 4RAQA 4EHNA 3BIFA 2ID7A 5DOVA 4D0RA 4H0FA 1SUIA 2O6HA 5D8DA 4DSNA 1SUCA 4BZWA 1T4GA 1N6RA 3WB1A 2FPOA 3A32A 5KOHA 3ND8A 2YMMA 2FPIA 1RLOA 3DZCA 3G0OA 3LPMA 4EUEA 2W6ZA 4KO4S 5JZSA 3ZVNA 5JVDB 3VJRA 3L0CA 4YAKA 1ZMRA 3MS4A 4HXEB 1XZ8A 4EP1A 3UYKA 4H1WA 1JTFA 5K51A 5KX5B 3VYTB 1E9FA 2H51A 1P3JA 1U4SA 1KEKA 1NUPA 3WL7A 1G8AA 1M7GA 2AWNA 3NP7A 1ZK4A 2NQ8A 3TVYA 3O95A 5AFSA 1CHNA 2Y9PB 3R09A 5IDWA 5L3SA 5HJ5A 1PFKA 1U5CA 4HNGA 4OSPA 5CIWA 5A6SA 4D0GA 1G6HA 1Q84A 1QOQB 1TM4E 2VJCA 2HMWA 3AB8A 3PC2A 3DP7A 3IVMA 3EXG2 1N6HA 2GLUA 3B60A 3USZA 4ALMA 1K7EB 1E9CA 1NY6A 4L5IA 4YWHA 4JWTA 2W6IA 1JJFA 4CN8A 3MT0A 5CNMA 4HGPA 4B6PA 1O57A 1H93A 2Z30A 2FUCA 3KBBA 4GIQR 1Z25A 2CWWA 3WLEA 5FBHA 2DWPA 4EYOA 4RJTA 5LLSA 4ZI7F 4MS3A 4I99A 2FW7A 2JHAA 4JJZA 1HNXB 5DU2A 4PAOA 2Y99A 3H2HA 1T9KA 3F6SA 4M6WA 4J9UE 4MGZR 3WX0A 5EUBA 2P9EA 3L46A 3LIIA 2YZNA 5FJIA 1XZJA 2WNIA 2J31A 3U0VA 5AKHA 1NUQA 3VR4A 1H2RS 1KVTA 4JXKA 3EC7A 4ED9A 2IGTA 3QXCA 1LW7A 2CKDA 1FX1A 4XTRA 4DC9A 1JHAA 1TECE 5F1PA 3PEUA 5LQMA 1V25A 4DKJA 3MFQA 2F1RA 3IXLA 4X1KA 3W2GA 4XD7D 1V3TA 1MJHA 2A92A 2R7AA 3P32A 1V8DA 1Y82A 2O3SA 5JJIA 5I9IA 3H17A 4N12A 3WICA 4ALLA 3TX6A 3IHLA 3G5UA 3WLKX 2JAOA 4CIXA 3ZUPA 1JDBB 3ZIAA 1RQPA 5JSZA 2MR6A 3TPCA 4JLVA 4KQJA 1IBKB 4P0QB 1JR6A 1QQ5A 2BR4A 1OWMA 2IVZA 3U3TA 1N1EA 3VTAA 1TVCA 1T26A 4POOA 4YUWA 4PLCA 4QULA 1T9DA 3BTSA 5CXQA 1T2CA 3L49A 4IKPA 4D0NA 4CMAA 1WVGA 4BUZA 3HY3A 2HSGA 3OESA 4IH4A 1EXMA 2VR1A 4UCFA 3PC6A 4YAEA 2ECFA 2UDPA 1H1TA 2IXAA 1DL5A 3B6ZA 4WWHA 5LOVF 4JI4B 2PGXA 4NATA 6REQA 1F38A 2VI5A 3HMKA 3KQQA 4TWBA 1U3WA 3VDQA 1FDUA 1T15A 3WGOA 2H59A 1IQ0A 3U4DA 4RVCA 1SCBA 2P2CA 2PKWA 1UIMA 2ABWA 2GHRA 4HN9A 1T2DA 1ZNWA 3PA8A 4GKVA 3TI9A 5GVSA 3EUFA 3EPJA 1ENYA 1O5OA 1I80A 1T36B 2Z8YA 1QG4A 2PM8A 3NS7A 3CX4A 4TZTA 2OCKA 4LJRA 1Q12A 5FOWA 3PC8C 2WVAA 3RG2A 2RCYA 3KL2A 1O94D 1YE8A 3VZQA 2FHPA 3MINA 3H1EA 3G0CA 4LQ4A 1MV5A 4XIFA 3IA7A 1NN5A 2NGRA 4M54A 1J25A 1X7GA 1Y7PA 4MYCA 4OQYA 1K8RA 2YJ5A 1JT9A 4QRHA 4MVYA 1E0JA 4W5TA 3RNOA 1SUWA 3ZWAA 3PXUA 5BY2A 1FQJA 3HFSA 1JQDA 3VDXA 2B21A 1IIRA 2X23A 4DWOA 3V2IA 7MHTA 3MWEB 3S27A 4ZAYA 4BTVA 2J5XA 1W2GA 4YAUA 1D2GA 2B78A 2XCQA 4OXYA 3TQIA 1P9WA 2ZS7A 1QPBA 1OGYA 3H75A 4KQXA 3DFKA 3AHGA 5KDOA 1DKQA 2QU8A 4OYRA 3AI2A 4I6EA 3RVBA 5GM1A 2IODA 3NYIA 2OT3B 5FI1B 2A0WA 2IP2A 4WA8A 4ARUA 4H77A 4HSEA 3GP3A 3UA4A 1YA6A 4KFTA 5JMWA 1RPAA 3GVPA 2QIPA 1ZMTA 3OQNA 2FPPA 1KZ1A 1G0OA 4BQSA 2WJ4A 3PLAE 3F0TA 4IS2A 5CFPA 1ZU5A 5DXJA 2H4HA 1JYEA 1C8KA 1FYDA 3GVXA 5KYKA 4QJ5A 3DT9A 4BWVA 1VBKA 5AICA 3TL6A 1D1PA 1S2DA 3SBOA 2WAXA 1SJ9A 3OTQA 3VMMA 5KSYA 1SUEA 2NYRA 3VUFA 1ZNZA 5LZ9A 3K0FB 1GGVA 3EIXA 2A2ZA 2PS3A 1UPXA 1SM4A 2QJFA 3A1VA 3E7WA 4L6IA 2W22A 1WX1A 1KH3A 2CYBA 3SGLA 3T99A 1U2EA 2DHDA 4O4IB 2G9NA 2WVGA 5EGSA 4E0BA 4RGQA 3PU6A 2YVLA 3QK7A 3K9QO 3NHMA 4GLOA 1R8YA 2R87A 5I9SA 4S04A 1QO0D 1T8TA 4YRKA 1FU4A 2HLDA 3UMCA 4MVJM 4A2WA 1JKIA 3AKEA 1YV9A 4FFMA 1LZLA 1A8HA 5D85A 4LOLA 4F9EA 7MDHA 5F77A 2CUZA 1DV2A 1YR8A 5IAGA 1HE1C 4QAQA 3KLMX 4RPCA 2H54A 1G3RA 4I5DA 3L4KA 2WJGA 1JT2A 2H1FA 1SCAA 3DOEA 1A4XA 3KPWA 4BY9E 4KGQC 2D8AA 4DL9A 4A0HA 2Q1WA 3FVVA 1L5GB 4EWLA 1XQ6A 5WRFA 4JC8A 4B3HA 2JLBA 5EYPB 3KZCA 1XLVA 2LBPA 5ITWA 1MJ5A 3AZPA 5KTYA 3CVOA 3OI7A 2P78A 3CR3C 3UHJA 4N49A 3K4QA 4N1AA 2HU5A 3F5MA 1X7WB 2PS9A 1QG6A 3BOSA 2JLYA 1XVIA 1GSAA 1FQOA 4YY3B 3LT0A 1OBCA 2ZJ6A 1R1DA 3V2UA 2FY8A 4PFJA 1V48A 4IIXA 2VHWA 2TYSB 3EVBA 3BGWA 1R0RE 4EA7A 2NO9A 3BZBA 3L7AA 2NVUA 2QJTA 4G81A 2Z5VA 3CUVA 2KB0A 3OIGA 1XTTA 2Y76A 1KH2A 3I2HA 4LHSA 4LZJA 3UOWA 3UJ3X 2V4UA 1GZ4A 4ARZB 2ARKA 5CXSA 1XNHA 4DCVA 3DOFA 3V7FA 5KSOA 1DAFA 2HJRA 3GRCA 4LNHA 4RL4A 5EE5B 1T9AA 4EFNA 4JC4A 4ZZ0A 2KI5A 2QAGC 5BR7A 1V9SA 2OFPA 4NDNE 1Z56C 3HWX1 1Y80A 4LQLA 1H0RA 3I8OA 1SXJE 5FFMA 3T95A 1QCCA 3C3YA 4L57A 1DJNA 3EG9A 4W9NA 4BMCA 4U8GA 2AFVA 4M60A 3SAJA 2RHWA 1N6KA 4WFQA 1BHJA 1UF9A 2K87A 2O0KA 2DRIA 3OCUA 4C4XA 3CPHA 5HIMA 4HP8A 2E85A 4I0WB 1EFCA 4Y9UA 3EE6A 4TYQA 2O3QA 1JEYA 4ZAWA 4OREX 4QBHA 2WFLB 1N5JA 1YVDA 3V8NA 2PY6A 3DEZA 1N3BA 3N74A 3PHHA 3HBLA 4Y2HA 3ANTA 3UG6A 3BUKC 5CA1A 5C7IO 3DBHA 1UT6A 3K72B 3N76A 4J1QA 4BNMA 4EHJA 1C50A 3ISJA 1YONA 4LXXA 4KQ6A 1QUFA 2BE7A 1G20A 2CNBA 3N75A 1KI2A 5BWMA 3DDZX 1AE1A 3V8PA 1SUPA 1E5LA 1S02A 2D2IA 2GN6A 2P68A 4RESA 3V80A 1H05A 1KE1A 3O2NA 3NWJA 2BHTA 2PMEA 3SZ3A 4UZFA 4QXAA 3U61B 1OB2A 3K70D 4IIGA 4UBKA 3WWZA 1Z15A 3D8SA 4RTMA 2VQFB 1AGRA 1CS0B 4R1PA 1BW9A 1GPUA 4GYYA 3ZD8A 1PJLA 5AM1A 1U2GC 1VMEA 4HVCA 2B2NA 1RD4A 1AKNA 3REGA 3MERA 3G7UA 2CCJA 1CQJA 1XCOA 1Z5VA 2GR9A 4B3BA 3S8YA 121PA 1MFPA 3GUHA 2QP4A 5JV5A 2ZUEA 3LP8A 1U0OC 4RACA 3W79A 4ITRC 4YA6A 1XG5A 3OE7D 3JQFA 4ZV7A 2PUGA 5FP0A 4HAWA 1MJGA 2EXXA 3PHJA 1YDGA 1ZFNA 2WTBA 4I4NA 5EFOA 3BH0A 3KLBA 4DGQA 5BR4A 1N9ZA 2BM9A 4B3GA 2PFGA 4TWJA 4DG9A 2ZAGA 4O2BB 5DW0A 4TRJA 5JT1A 1T2UA 2GH1A 1Z06A 2WJVA 2MDTA 5E1DA 3HN2A 5IAJA 3PLNA 1KMHB 2V45A 2FSVA 3WGYA 1IHPA 1X2BA 1JRLA 4OXNA 5KYNA 2B5OA 3AKDA 1VYTA 3JZMA 2H08A 3TG2A 2FE4A 2QNRA 2GUGA 2C2MA 3AR2A 4G67A 1C7ZA 1M6VB 1G55A 1YRLA 3FYCA 3QW4B 4IIBA 4L4SA 3BTUA 1Z33A 3V3KA 2VXCA 4KXWA 3R7BA 1C3LA 1G5RA 1OQAA 5LBTA 1F2TA 2RGUA 4TTQA 3FTPA 3P9XA 3K0HA 2BE9A 3QFCA 4JKOA 1YU9A 3GCDA 4E5PA 2EQAA 1RBMA 1SO8A 4LY3A 1QCZA 3FLAA 4QXMA 3NCTA 3AHFA 3RS7A 2YNMD 3O2SB 4F91B 2CVPA 2YUTA 4ZP1A 3LXXA 3GFSA 2B37A 4MA0A 3EXAA 3S3TA 3RC8A 1DWQA 3IQEA 3DAHA 2RHGB 2WT8A 3NVKI 3HHPA 3Q2OA 4PZAA 3KD2A 4YREA 3W8NA 1P2BA 3IR5A 4J0GA 1X14A 5FTKA 1N4AA 4WBSA 3AYXB 3VFDA 4YONB 3CZ9A 4D0SA 2UZAA 4KX3A 1XN1A 3ENZA 3GJZA 3LA6A 1B1AA 1G16A 3P0HA 3FGOA 3WGNA 3NAMA 3JWIA 1T9BA 4WFJA 5J59A 4F9FA 1U6JA 2F3SA 4GGPA 1QQBA 1P81A 2Q2NA 4BZQA 2UYGA 1NSFA 2PKRA 1KEWA 4P93A 4RZXA 3OZVA 1NI4A 4F3KA 1WB5A 3QA3E 3U7HB 1UJNA 1OH8A 3V2GA 4HDRA 4I46A 1PGPA 4OHXA 1W88A 2MSLA 3DKVA 5TMEA 4IJWA 4UREA 2QI9F 2REQA 4TN5A 5DKFA 5LDGA 2JIZD 2YXNA 3CUYA 4MUHA 3FTFA 2HSZA 4AKHA 4GE3A 4LXIA 3DUWA 1NN0A 2FMFA 3N2NA 1K7FB 4KO8A 4TUYF 1M0SA 1UIRA 4PG6A 4UEWA 4EMSA 1IPHA 5E4FA 3VYVA 2C59A 2R4UA 2GCOB 2L18A 3D8BA 2V7XA 1MR3F 3GHYA 4GT1A 4JLMA 1JLRA 4CG3A 3ME4A 3EXFB 1RXSA 2Y66A 1S2OA 2ZWVA 1I7QB 3E3LA 4KR3A 2XGMA 3ROPA 3HK2A 5AKZA 4RY9A 2VYNA 1WLSA 3FYTA 4PAWA 3U48A 3MF4A 3QYAA 4D1YA 2I7DA 4J0DA 2OO5C 1AQUA 1Z0JA 4U4AA 3VISA 2M2IA 3M4JA 4BIMA 4R1TA 5GADl 3FUUA 3HFJA 4WZZA 5KWVA 2HIAA 3A3PA 1YMUA 2EX0A 1R6UA 4NCHA 1V0JA 2XF2A 4RSRA 4RKYA 4A4DA 4DN6A 2DUWA 5C31A 3OUUA 4RJIA 3C4JA 2J9GA 3OUZA 2RK6A 3U56A 4RZQA 4KBGA 2CYCA 5DSXA 3EIOA 3L8ZA 4NBWA 4YP6A 1X1BA 4LJ5A 4PZLA 5BN5A 3AB3A 6ADHA 2OFXA 2FX3A 5ITZA 1BHSA 1Z5NA 2QR5A 3K30A 1DIBA 3GIWA 4URUR 1U1IA 3ELUA 3WYBA 1MX9A 2RHCA 1THTA 1SUFA 1ADJA 2W71A 1N2CE 3KEOA 4JUFA 3RK0A 5I7OA 4GKAA 1RJEA 2ZBVA 1OX6A 1ORDA 1ZD4A 2FR1A 2ZTVA 4UARA 4LPKA 4ZVPA 4AKSA 2ZM5A 3PEYA 4UXIA 3RRZA 3EF1A 2YBDA 3HUDA 2NP6A 3OM9A 3L84A 3OQBA 4RHFA 3IR6A 2J4CA 2OM2A 4F1KA 5AUNB 3GL9A 1BFDA 1VJTA 5FYQA 1RXEA 3IDQA 4GVXA 4RZSA 3F3SA 5ALLA 2PXHA 1CUEA 1RCFA 3I92A 3KLPX 4QVGA 3DPSA 3SU8A 1IRXA 2H4XA 2H2HA 3NXSA 3UJAA 3HVKA 3T9EA 1KAGA 3GROA 5CP8A 1RLJA 1UUFA 2REBA 3L7MA 4FE7A 5JCJA 3T1QA 2GD0A 4A91A 4BE4A 2UXCB 3LUKA 4CR7A 1BSVA 2WAOA 3JS5A 1EZ4A 5JBQA 1J99A 1Z75A 1ZI8A 2J0UB 4KJXA 4XXHA 1N3LA 1NMYA 3QBJA 4M1KA 1UZUA 2R60A 5JD5A 4MW1A 4M6WB 2ATIA 4YJGA 2COKA 2WC1A 3U49A 1LPMA 3MYYA 3D2BA 4M1QA 3B1ZA 5BVHB 2OECA 3I39X 1Z07A 1W76A 1ZXXA 5DGHA 4U39A 2EBUA 3C7TA 2OMEA 1SVNA 3LH5A 3NIFB 4IDGA 4XKJA 4FB5A 4V39A 2PZFA 1MU0A 1FFXB 1J8DA 1UMCB 2OEPA 3FMFA 4MUYA 2W90A 3SIPA 5KHOC 1F8UA 1SK9A 1NVEA 2FUNB 2MR5A 2TMYA 2Y1WA 5DASA 1M1YB 3C3MA 1C3VA 5H81A 2WIAA 3HMQA 4M87A 4O4JA 4K6MA 5E95A 4ESOA 4Z5XA 2ZUSA 1GR1A 1HORA 1MQSA 3S29A 4EA8A 3K5IA 3TX2A 5KOHB 2A9RA 2O2GA 1BHQ1 2IX3A 4TS3A 3K31A 1UMCA 2XUIA 4P4SB 3TO5A 3SKVA 3QVUA 2L2QA 4NQRA 2Q4OA 1JE0A 3OIWA 2O2XA 1P2TA 3BXOA 3KC2A 3OJXA 4M37A 2I2BA 1IPEA 2I6XA 2FZLA 4RCVA 5DDIP 4R2HA 5FD8A 1YVPA 3L05A 3R2JA 1GT91 1A3CA 1LGYA 2WR8A 2VKTA 1DQZA 4DA0A 1KI7A 4L27A 1AGXA 3R6DA 5DLQC 2PUCA 5I6DA 3IELA 3EEYA 4L15A 3UXYA 3H3FA 4AZVA 5L3SB 1RYNA 3GWZA 4JJGA 3VO9A 4O4LF 4A26A 3EF0A 4CM9D 2AMVA 2Z4TA 3FMOB 3Q2KA 4Q3LA 5AW6A 3A4TA 4P38A 5L7WA 1BO6A 3VGJA 1BDMA 5K5EA 1W5BA 3NBFA 2DZDA 4MQEB 4AWAA 4RTSA 4MV3A 3A2MA 2NUAA 3DWGA 1YMVA 2OZEA 3X1ZA 1Q1GA 5NULA 3ROGA 3L06A 4EGSA 3HM9A 1Y9ZA 4GRAA 4DQDA 2GZRA 3MXOA 5HKAA 3I5YA 3W6OA 4GXRA 5G4KA 4TKLA 1TUBB 4RJLA 5AKGA 1HT1E 4FC7A 4ALJA 4ZVKA 2AF4C 3QHPA 4K6OA 4XWOA 3AY6A 1OTXA 3IBFA 5G0VA 2I2FA 1UPFA 3CQ9A 1KZYC 2HGZA 3F5DA 1I3OA 4C21A 3IXQA 4BKMA 1XFDA 3KVVA 3DFZA 1PNRA 4OFWA 1YE5A 3HDHA 2PLNA 4GMHA 3D5TA 5JQGB 3NDPA 2B99A 2P2ZA 2VUUA 3HA2A 5ALGA 4WOKA 3ZLUA 2OCBA 4O0LA 3I2FA 4C4AA 4B3DA 1IXRC 1DTWA 5GGYA 3TIVA 5M3BA 1FRVA 1GL9B 2ZCUA 5MDHA 4ZHQA 2B4KA 1DC5A 1SG1X 5LKAA 3O4RA 3LDHA 2A0XA 2R5FA 3PHGA 3CEPB 3ESQA 2GA9A 3DMFA 1CEEA 4IUDS 1LXCA 4FHCA 2WTXA 4XWGA 4X62B 4AJKA 2G17A 2R6GA 1ATZA 1VJGA 4GAEA 4RKEA 4X24A 2OAGA 4PXYA 3IS3A 4ZICA 5KNDD 5C80A 1PD1A 3K6KA 3PKJA 1R4ZA 4R8VA 3K71B 2C8JA 2IYYA 2Z8ZA 1ORRA 3UJPA 2CXRA 3IOBA 3RBAA 4X65B 4RVGA 1TM1E 1RYZA 1OT5A 3OIFA 4HBZA 2P2YA 3RANA 1I5EA 1SU4A 1QZTA 4F38A 4ZDJA 2UKDA 2PRZA 2PL5A 2FAXA 3DDHA 1N8TA 1SXJA 5HCUA 1E77A 3SHOA 4PPYA 1D07A 2ZUWA 4UM9D 2JVIA 2Y93A 4WK4B 5EL0A 1BU5A 1U1DA 1MAVA 2JL1A 5A4JA 5K8CA 1SD2A 4UMFA 3LQ4A 3NM4A 2ZRKA 3MTJA 4X93A 3DBOB 3LFUA 2RH4A 2D0IA 4PPFA 2ZAOA 3F67A 4FFLA 1EUDB 1HLGA 5E6SB 2B0JA 1AURA 1S3FA 1YHZA 4JI5B 4DEYA 1LPPA 3B38A 4PNPA 2CHQA 1UQRA 4LTMA 4XDYA 2VNJA 2WNSA 3LDFA 2ORIA 5C37A 4B85A 3MJEA 3URMA 3I28A 4TTIA 1ZS9A 1CY4A 3BK7A 4FEAA 2I2AA 1DEXA 4JHLA 1C41A 4PCVA 1E6EA 2OG2A 2GFIA 1R50A 3N2GA 3NANA 4MS4B 3EDOA 4NPHA 4HN4B 4R8MA 4WXYB 3VPHA 4X64B 4D9HA 5AJZA 5DT9A 1AK1A 1PJ8A 5JTTA 3GJSA 2XUQA 5A5EA 5CFLA 1B3BA 1N2HA 2YJZA 3HLYA 4K2HA 3HWSA 4LZZA 2OYCA 1U7UA 4P3KA 1ODKA 2Q3FA 4PVCA 1WXIA 5DB4A 2NU9B 2C5GA 4ON9A 2O5RA 3V9AA 1MC4A 3PE3A 2O2EA 3IIJA 1B23P 3ZEAA 2I5PO 2AN1A 3DL2A 3TTVA 2VF5X 2V55B 2BEWA 1E7RA 3HEMA 2DFVA 1ZVQA 1Z0UA 4X7RA 3N8GA 1FT4A 5AVUA 4I55F 3UATA 3X1XA 5CA0F 4WLUA 1M1YA 1RHRA 1RVV1 2Q27A 2WTNA 1NDUA 2QSZA 3FYDA 4JROA 3JQ9C 4DLYA 3PEWA 4ASUA 4EQ6A 3COZA 4KGVA 3QXHA 3R7WB 5BVGB 1YF3A 3DA8A 2PVPA 4YUAA 4RPJA 2Z04A 2F62A 5B2FA 5CAEA 4XVHA 2FMXA 4HS9A 1IM5A 1HFJA 3CZAA 3TL2A 4FR5A 4ECEA 3L04A 3IE0A 1LBHA 3MPOA 4RS4A 4BO8A 5J4YA 5JS8A 2ATXA 4N6GA 4X1YB 3QMPA 2ZS8A 4NBUA 1I4OA 5BPHA 1R2QA 3SVZA 2D4HA 3Q6IA 2I1LA 3L7JA 5SZKB 2RHJA 1NUHA 3C8ZA 2DTEA 2O3RA 3DULA 3OU7A 5FI3A 3JRXA 1AM4D 1F3OA 2B30A 1FBTA 4RFVA 4RV4A 3VHLB 3UXHA 4PAGA 2VSXA 4UCQA 5DXAA 4PTLA 3STYA 1EFDN 4E31A 1USIA 2KQUA 3ENWA 4WOJA 4A6DA 3Q3VA 3VH1A 3HSYA 1D7OA 3STHA 3GX1A 4Z0TA 1W73A 2I1QA 3ZNQA 2E3JA 2QTGA 1OA1A 2J41A 3CNQS 2JFWA 1XK6A 2HRQA 1H8EA 5H9VA 3ZIDA 1E1CA 4C3ZA 1BEZA 4FM9A 1I36A 2JGAA 1EK2A 3ZY3A 2D1YA 4EAQA 3A1CA 2AYYA 4LVOA 1C3OA 5E1BA 3WDLA 4B4VA 4GP6A 3OFNA 3GMDA 1SU8A 2IEAA 2ZBPA 3Q7QA 1H8HA 4MW7A 5JQGA 1BYIA 1T4CB 3OZBA 5LB4A 1HKUA 2EKPA 1U1CA 4UU8A 4Y9DA 1KOJA 4RMHA 2BMJA 4GXQA 3IKLA 2FWNA 1D1SA 3KJEA 1BDJA 3HZRA 2WM9B 4AMYA 1L8QA 1SKYB 3TFOA 4QVIA 4PGHA 3UCXA 1M6NA 4EITA 1BC5A 2WHEA 3I53A 4XJVA 3RYCA 2G1JA 3BWBA 4YMLA 2AJLI 3EWAA 4P4GA 4KI0A 2ZUFA 4BFLA 1X7XA 1AOXA 2ZI4A 1SVMA 2V8BA 3E7PA 5C3UA 5LD2B 2VDUE 3QMWA 1O8BA 4IDAA 5KYGA 3EZNA 4OFXA 4AJNA 1OH6A 2C83A 3P2EA 4H18A 2JFVA 2QE7A 3I34X 1F4VA 2DEUA 4UAUA 3KE9A 1DEAA 1NF8A 2D74A 1W4CA 2JGDA 3T12A 1JEJA 5K4AA 4KBFA 4CEHA 1JI0A 1OFGA 1YS1X 2O2DA 3K9GA 3OCYA 4TV8A 1PSWA 1F6BA 3M3PA 2VDQB 3IQXA 1EVJA 2OXCA 4V0QA 2YYAA 1A76A 2IBSA 1ESDA 3KYDB 1E64A 4OMDA 2ZTLA 5CPFA 5F33A 3EULA 2R62A 2V3VA 3G6KA 4HGZA 1U2GA 3ENVA 3SD7A 2FH5B 2IYVA 1TQ8A 1VLJA 2R8XA 3ZVMA 1QQ7A 3N6RA 3AETA 1C9EA 1CZKA 1CXZA 4MUFA 5F76A 4RWEA 3SDZA 1BWSA 3TLZA 4D4KA 2QTTA 2V3WA 1DAHA 3KAKA 3QWAA 2QZPA 1JHDA 4DR2B 3NC4A 5AW8A 3OPQA 3C8MA 4MNTA 1SNYA 1DKRA 2FCRA 5J58A 3BIJA 3ODPA 3IMEA 3DH0A 1CUBA 3KUUA 3FLBA 4MDYA 1W4AA 2ZULA 4FYMA 4PZUA 4BUCA 5BV8A 5A4MS 4ARVA 5A71A 4I1SA 1NT4A 3I32A 1YDEA 2X1VA 1VLMA 1ZMBA 5ILGA 4OQMA 5HUJA 1TTQB 1QOZA 4M2LA 5LP6A 2D1TA 1A5BB 2P4SA 3E1KA 4OQFA 3F46A 2ZP1A 4HRYA 4YRTA 5FIUA 3RO7A 2CXUA 4AK9A 4BFCA 5F7OA 5FOSA 3KJQA 2ZJ7A 5LYYA 2OWDA 1WBJB 4DG8A 4YYZA 3CBGA 2DVMA 3ORYA 2F55A 1L1EA 3VC3A 3RRYA 4UOZA 3JR7A 1RVDA 2Z43A 3CX6A 1KSHA 1WXHA 2OHVA 3TR6A 2OVFA 1PL6A 1Q0TA 2H57A 3RU2A 1FP7A 3WSWA 1V3QE 2P67A 5H59A 1GG8A 1TIPA 1Z4PX 4EL5A 5A5VA 3WWPA 4QTTB 4K6CA 4QYMA 5BN4A 4HC4A 4ZVQA 2A5JA 1L5VA 3X1MA 2ZB8A 4R83A 5A4IS 3SEFA 3K0BA 5L53A 3KLNA 4ND4A 5AKEA 2XX3A 5JCZA 1Y8AA 1OZFA 2P77A 4JEIA 4ER0A 1GYRA 3IALA 4TOIA 4C22A 4YAGA 1RHJA 2GKOA 3ICVA 2O2SA 4ZYUA 2CHUA 5D00A 4PSUA 5BRAA 3SXPA 4YBRA 2PL3A 3I6QA 3QY9A 1NVVR 1MX5A 4M9CA 4OGFA 4F1WA 4OFZA 3HYTA 5ECGC 2AOTA 4C3VA 3DV9A 5AVZA 3WKCA 3PFIA 1QAMA 4OBEA 4HQOA 5JY1A 4KIWA 4KDCA 2W8BA 4FSDA 4UUPA 3T4EA 1GADO 5GV8A 3EF3A 3KSBC 2RBKA 1IL0A 1Y1LA 2P6NA 3LT2A 4IIEA 3U4HA 2ZYGA 1ZMXA 4XFDA 1YHNA 3DMTA 3OP4A 4MEBA 3JYNA 3ETGA 4L1KA 5CA0B 1ZRNA 4MUAA 1L9KA 3MG9A 4LOHA 3WI7A 1FSPA 3E9DA 1K63A 1S4MA 1M6HA 2ACVA 3AJAA 1RKXA 5K03A 4FCVA 3KZKA 3IE1A 3P9ZA 5AVSA 1XCBA 1DJQA 1WL8A 1QNFA 1G9SA 4TTSA 4DDWA 2G5GX 1KDPA 1YRWA 5IM4F 1DAEA 4YI3A 5A0TA 4LUCA 1SHJA 3HP7A 4WX2B 3ZWDA 4HUJA 5FUWA 1Z4NA 4S2UA 1UL1X 1BOFA 1XDUA 4H08A 5IKOA 3DOHA 3BERA 3RM3A 2YS7A 3O4GA 2NUPA 1Z36A 3WADA 2HHAA 3NGXA 3U7GA 1HYEA 4HRAA 3NBXX 1TGYA 4KK4A 1K92A 1MAAA 3ASUA 1IQRA 1TMKA 5EP1A 2XADA 1NVFA 3PGA1 1CS4C 5C52B 4NYIQ 3C5WP 4QUGA 1NBWB 4RTJA 1HL3A 3BK1A 1FMTA 4AS1A 1X7XB 1QPZA 4B80A 1T6ZA 3LHDA 2P9TA 5DP2A 5KX5F 2ZUDA 4CMIA 3I09A 1QGZA 2FPWA 3M0EA 1WP9A 4DC0A 3JRWA 2WTEA 3QXXA 1W7AA 1K6EA 3MT8A 3ABZA 2ALJA 5FORA 3NBZC 4M4SA 2HX1A 1JU9A 3DQZA 5F2EA 1TMOA 4YK7A 1ABEA 3VX4A 4ZKDA 2GRAA 4LF8B 4KO2S 4YBZA 1DAMA 2FUG1 1JQAA 2X8JB 4PV7A 4TSRA 1A9RA 1CE8A 2ANBA 3HL0A 2X6QA 1T2EA 4KH0A 4OVKA 1KA9H 4BNVA 3VYRB 7YASA 3FF4A 2J3IA 4ZAVA 2XSZD 1S96A 2X77A 4IIFA 5K3CA 1G66A 3QUSA 2HA5A 3QFFA 3JQ6A 4I55B 3MOGA 5LZ4A 2OPBA 1W1UA 1P0PA 2HMSA 3K09C 1I7DA 1WMSA 2ZB4A 4PVDA 4RVFA 1F9EA 1FP1D 3IIIA 2ZBEA 2ATVA 3T1NA 1QHYA 3KFLA 4TLCA 4IOJA 3FYUC 1F8GA 5I48A 1KOGA 2F4VB 2E82A 4LI3X 1Q0PA 3ILSA 3QLVA 5JYBA 2DBVO 3MHTA 3EQ8A 3QLUC 4EPTA 1OXUA 2GUWA 4YAJA 1WB6A 3H1FA 2GYUA 1BMTA 2CMFA 3SKXA 3BXFA 3T38A 4F72A 2EIHA 3QOXA 4WXPA 4YAIA 3GZTB 5CJ2A 5LP6F 2VXYA 5C5CA 1Z6YA 3I04M 4QNNA 2WYWA 1H22A 3D4PA 1XLUA 5HUQA 3ZCXA 2V97A 1NJ6A 2XMGA 1LA2A 3GPDG 4AX4A 2HM7A 5AESA 4D5EA 5KTOA 3PXCX 2B2XA 3RR2A 3LOPA 2WILA 5IK2D 3KQTA 2CSXA 2YCBA 3BULA 4WNAA 4EL0A 4QDXA 1SRRA 4GS5A 4P8RA 5EJ6A 2DUMA 1ORVA 3JQDA 3U26A 4AG6A 1T9HA 1IY9A 1J7JA 2B3TA 5T6MA 3WWEA 4BO6A 2Q46A 4QQNA 5T4HA 2BKEA 3I8XA 3CW2A 1QXSA 3D4LA 2GEUA 4PFKA 1JBQA 4BLSA 1UT5A 1U9JA 1WDTA 2FMTA 3HRKA 5T5QA 1NMZA 1FX0A 1MRSA 1WUJS 3PE6A 1R4MA 4J43A 4FLEA 1WCIA 4WECA 1DWOA 1ULTA 1AB6A 1G9XA 3EVEA 3GFTA 1BH6A 1ZH6A 4ENQA 3M83A 3FWKA 4QU0A 1N32B 3Q0TA 2EL9A 1RIIA 3WP1B 4EHKA 4MUEA 1OZGA 2N3ZA 1CY1A 2HNKA 2Q7DA 3W2HA 3SHVA 4GX0A 1XC7A 2JZCA 2G25A 2Z0MA 1T5BA 3Q40A 3B6JA 5A9RA 1PL8A 1DC7A 4IINA <