2E4UA

Crystal structure of the extracellular region of the group ii metabotropic glutamate receptor complexed with l-glutamate
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
538
structure length
512
Chain Sequence
RREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDNYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNICIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAANRVNASFTWVASDGWGAQESIVKGSEHVAYGAITLELASHPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQCSLQQVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPQTTKLCDAMKILDGKKLYKEYLLKIQFTAPFNPNKGADSIVKFDTFGDGMGRYNVFNLQQTGGKYSYLKVGHWAETLSLDVDSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYLVDEFTCMDCGPGQWPTADLSGCYNLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of the extracellular regions of the group II/III metabotropic glutamate receptors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords Metabotropic glutamate receptor 3
total genus 160
structure length 512
sequence length 538
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
A PF07562 NCD3G Nine Cysteines Domain of family 3 GPCR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.50.30 Mainly Beta Ribbon Tumor Necrosis Factor Receptor, subunit A; domain 2 Tumor Necrosis Factor Receptor, subunit A; domain 2 2e4uA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2e4uA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2e4uA01
3RH0A 3C3MA 3CNBA 3O1JC 3IP7A 4QYWA 5KC9A 2E4VA 3GWGA 2L19A 5BR1A 2WB4A 3LUHA 4O5AA 4NV3A 2L18A 2FEKA 3O75A 3O2QB 3I45A 2IYNA 4JOQA 4YLEA 4IMIB 4FE7A 4QICA 1E2BA 4YCSA 3H6GA 1CEYA 2GWRA 3T95A 3N8IA 2PJUA 2RGYA 1B00A 2JCGA 2PAFA 1VPWA 3BILA 5FBKA 1A0OA 2TMYA 4ZPJA 3GV0A 4ZMRA 4NCBA 3IP5A 4RXMA 2HQRA 2ID9A 1DBQA 2NZUG 2QV0A 4Z4GA 3JVDA 3LUGA 1D4ZA 2NUBA 1KGSA 2IOYA 3NBMA 1ZESA 1EHCA 4RK4A 1RZRD 3N75A 1JF8A 4KZKA 1DZ3A 1EWKA 4MYRA 4MS4B 3QX8A 3MQ4A 5DLEA 1FFGA 3EODA 4RU1A 4WXMA 3IPAA 4G86A 2LPMA 4LX8A 2ID7A 5BRJA 1Z18A 1M2FA 1ABFA 3Q7TA 1SD5A 1EAYA 2L17A 2JK1A 5KQPA 1L5ZA 5PNTA 2PL1A 3H1GA 1JH9A 5F64A 2FEPA 3A3KA 4EGSA 2HJ9A 3GA5A 4RK5A 1A2OA 3UK0A 1GUBA 3OLWA 3FFWA 1UDRA 3QLUA 2FQWA 4KQCA 5HKOA 2DRIA 4LDAA 5D2CA 4QPJC 3NNNA 4MS1B 1LBHA 1JBEA 4HNRA 3HXMA 3K4HA 3KS9A 1D5WA 1YVUA 2IKSA 4G0YA 4XARA 5JNTA 4MS1A 2IPMA 1FSPA 4YWHA 1Z15A 4TN5A 1XHFA 1QPZA 4PZ0A 2QVGA 3SQNA 3TMYA 4G0OA 4YRZA 5BQ3A 1XHEA 1PEYA 4RK6A 2ZAYA 3O2SB 4Z0NA 5KQLA 1GUDA 1QO0D 2QSJA 3KTOA 3C97A 3HM9A 3IP9A 3CU5A 3N0XA 4M88A 4OG2A 1F51E 4MPTA 4DADA 1U2QA 3VNAA 4MR7A 1KRXA 3CTPA 4JASB 2V0NA 4MR9B 4H3KB 5TPZD 2R48A 1HEYA 3HUUA 5KWSA 3JPWA 1F4VA 2PUEA 2VYCA 6ABPA 1M2EA 3O1IC 2A9QA 1NXPA 2PUDA 2CHEA 3RVJA 3RVKA 1QP0A 3RVNA 2AYZA 3EULA 4MLDA 4O1HA 1JYEA 1OXKB 1SRRA 1BAPA 4JB2A 4RXUA 1BA2A 3LUJA 1SXGA 4UHKA 2LP4Y 4PICA 5CNMA 4G0MA 3G85A 5JS2A 4B09A 2MYTA 3MYYA 4RY0A 5FWYB 3H5OA 3LUFA 1TM2A 3EQZA 5IUKC 2E4YA 1JFSA 3HDVA 2GI4A 1Z2DA 4Z99A 3SG0A 5IUNC 3QEMA 3LUAA 4F11A 1LJLA 1MB3A 3LTEA 4W5TA 3CZ5A 1VKRA 1ZDMA 1W25A 3I5AA 5FWXA 5C5CA 1JHZA 2ZWMA 3H5LA 1TVMA 1URPA 4MQFA 3N6VA 1I3CA 1Z16A 3O21A 3A0RB 2BGGA 2E4ZA 4KQ9A 3I09A 1RZRA 4G97A 4E7OA 2LUOA 5GOTA 4H3HB 4MLCA 4Z9AA 4NICA 1ZH2A 3H5IA 1M5UA 4Y9TA 1TJYA 2J48A 4PEVA 5JNVA 3QLUC 3TX6A 5HM6A 1MB0A 1NXOA 3ROTA 5CHYA 2AYXA 5EWMA 1OXBB 3NHMA 3E61A 2E4WA 4YR7A 4L85A 3GYBA 1JWLA 3CKMA 5JNRA 3DBIA 1NY5A 3KYIB 4XXHA 1VLZA 2PKXA 4KNYA 4N41A 4Z4HA 3SAJA 3HJFA 1YS7A 2PUCA 3E3MA 1QQAA 1YMVA 2GKGA 4UHJA 3N0RA 3HO1A 1PEAA 1USIA 3G1WA 3QEMB 2CHFA 2FMIA 1IIBA 5IX8A 5KQMA 1JFTA 4KK3A 4JA2A 2VK2A 3MF4A 5FWXB 3OO1A 4KV7A 1JDNA 1C4WA 1WETA 3HSYA 3FFXA 4N03A 5EWJB 3JTEA 2FLKA 3EGCA 1YIOA 4W5NA 3F7NA 1P6QA 1Z2EA 5IULC 5BRAA 2QW1A 1NXVA 1DBWA 1ZN2A 1L5YA 2P4UA 3DZDA 2MYUA 4MR8B 3LUKA 1NXXA 1RXIA 3D02A 4KPYA 1ZGZA 3C3KA 2JVJA 4N76A 3FFTA 2FTKE 3CZCA 3HDGA 2JRLA 1PNRA 3MMNA 3LUCA 3GT7A 4XAQA 3L6UA 3EJWA 3CS3A 4RV5A 1QMPA 3RVMA 5KI6A 3OM0A 1CHNA 1ZGGA 1JLKA 4RXTA 4E7PA 4ETIA 2FSPA 1U2PA 1YS6A 1DRJA 4MQEB 4DQDA 5FBHA 2HSGA 2R4QA 3OMWA 2A9RA 1ISRA 2LBPA 4P1ZA 3LFTA 2O20A 1J56A 3F6PA 2GBPA 4EVRA 5C5EA 4MRMB 2PLNA 3HS3A 2IPLA 2XDYA 4F8JA 4MQEA 3MA0A 3CFYA 3RVLA 2OENG 2QR3A 2A9OA 1AB5A 3O2JA 1PUXA 3GL9A 2MSWA 4ZYLA 3KJXA 5B3JC 2HQBA 3M9XA 4ZMSA 1EWVA 1LK0A 2WJWA 3QLTA 4G0PA 1TLFA 3SY8A 1XWWA 2NT4A 1MVOA 3BRQA 3OMXA 3OLZA 1ZAYA 3OLYA 5KC8A 2F8SA 1MAVA 5IEBA 4JB0A 4YGXB 4MS4A 4WT7A 4EYKA 5DKFA 5IBQA 4ETNA 2PE5A 3ILYA 4MR8A 4GPAA 4WZZA 2FQYA 1ABEA 3HZHA 2MYPA 1USGA 3P9YA 8ABPA 2QU7A 1BDIA 2VUIB 3KYJB 5EWLB 4DN6A 2MSKA 4FB4A 5JNUA 3LKBA 1APBA 3OQMA 4OATA 5EWMB 4YV7A 1LJUA 4EYGA 4TMYA 2WMYA 2R25B 4LE2A 4Z4CA 4ZJPA 2JVIA 5TPWB 4OBBA 3H1EA 4YP9A 4G0QA 5TQJA 4F06A 4GNRA 1BDHA 3HEBA 3QELA 1P2FA 2WY2D 3TB6A 1KRWA 2E4XA 3QEKA 4O1IA 3S99A 2WWVD 4IILA 4ML3A 4TLMB 3JPYA 2JVKA 2LIVA 4RWEA 1D1PA 5EWJA 3H5WA 4Q6BA 2PUBA 4MGEA 2PUFA 4KRFA 3I42A 2HQOA 3TO5A 2IPNA 3RVOA 3HCWA 3QLVA 1DCFA 2WJAA 4OTZA 5JNSA 2PMCA 2FN9A 4HNQA 2YHAA 2PUAA 1DC8A 3CLKA 2M98A 4RK0A 1QQBA 3BBLA 3RQIA 4N47A 4RY8A 2FLWA 1YMUA 3F6CA 4MR9A 5DCLA 4XASA 3JVIA 3EQ2A 3ILHA 3T38A 4L4UA 1USKA 3KLNA 4N0PA 2PUGA 9ABPA 3KCNA 3OLVA 1GCAA 4HYEA 4QYMA 2FW0A 3B2NA 1QKKA 4G0ZA 4S04A 4IMJB 1NATA 1RPJA 1U8TA 1GCGA 1VRVA 3Q15C 3N53A 3RVQA 1H9CA 4NQRA 1JFVA 4RY9A 1FFSA 1W9HA 2FXIA 1BDJA 4IRXA 4H60A 5IEJA 1PNTA 2NZVG 4LE1A 3UUGA 4W5RA 2Q5CA 3KLOA 6CHYA 3RVSA 1K66A 2MSLA 3CG0A 1AB6A 2CWDA 3JY6A 4N0QA 5ABPA 4W5OA 1ZH4A 3IDOA 3IPCA 2FMHA 4NCAA 1U0SY 2N9UA 2IPAB 1Z25A 1NTRA 1DCMA 3DGEC 2JB9A 3EDCA 3OLXA 4MS3B 1QP4A 5ED4A 4FE4A 1Y1LA 3H1FA 3H6HA 4LDZA 1RNLA 2CD7A 4RZSA 5TQ2A 4EVSA 4LE0A 3FGZA 3N0WA 4LRQA 2GX6A 2FQXA 3HK2A 2E4UA 3C6QA 4OLBA 4EVQA 3KHTA 4MAAA 2OQRA 1CYEA 1P6UA 4EUKA 4KMRA 2R47A 1Z17A 4RSMA 3GBVA 2P9HA 3Q7SA 3JS5A 2X7XA 4ETMA 4WXEA 1NXSA 3LUDA 5E3JA 1E6KA 1P8AA 3O1HB 3TD9A 3FMVA 2FMFA 4RKQA 4Z4EA 5CNIA 3URMA 2F8TA 1BVHA 3A0UA 3DLHA 1SXHA 2FEWB 4W5QA 3MM4A 2MYNA 5HSGA 2W42A 1EWTA 1NXTA 3GRCA 3F73A 3M9WA 5GQSA 1Z13A 1EFAA 3KKEA 3Q7RA 1DCKA 1E6LA 3NNSA 2WRZA 5EWLA 4KREA 1DG9A 1T34A 4EYOA 1ZVVA 1DC7A 1D1QA 3C3WA 3Q41A 3QX9A 4MS3A 4XLTA 1YK1A 3L49A 4MRMA 3HV2A 2B4AA 4JAVC 2H3HA 4KK4A 1JX6A 1DBPA 4RDCA 4EYQA 3QLVC 5IUJC 3EAFA 2H0AA 4D6YA 5TPWA 1ISSA 5FWYA 2IDMA 4HNSA 2JBAB 3QELB 5TE9A 4YS6A 2QVCA 3Q9SA 1FFWA 4Q7EA 2A9PA 1PHRA 1JDPA 1ZHHA 5B3JA 2RDMA 3LKVA 2HPHA 3O74A 4Z4FA 1M5TA 3RVPA 4RK7A 4PE5B 1SXIA 3BREA 2FVYA 4MR7B 2RJNA 1C0EA 2B1JA 2I6FA 1KMIY 2VUHB 3R0JA 3T6KA 3RVRA 5CNJA 1NXWA 5T3YA 4Q6WA 3H5TA 3T8YA 5JNWA 1D2AA 2FN8A 3HUTA 5TQ0B 1Z26A 3MIZA 4RKRA 3FDFA 1QNLA 1DP4A 5CNKA 1U04A 2NT3A 4D6XA 1MIHA 3H5VA 4EY3A 3DGFC 3CG4A 4G0XA 5DTEA 3OO0A 5TQ0A 5TQ2B 7ABPA 2L2QA 3OM1A 3IP6A 4IGAA 3HVRA 4F3TA 3H75A 3SM9A 4LZLA 1Z12A 4KFCA 4D74A 1K68A 4S05A 3BRSA 2YHBA 3M6MD 4WWHA 4Z9BA 2QZJA 4KVFA 3LOPA 4RK1A 3LMKA 3A10A 1LBIA 4YO7A 3QK7A 4OLAA 5KQGA 3NHZA 1DJMA 2M1ZA 3UKJA 1FQWA 2KYRA 1TMYA 1YK0A 4IF4A 2FKAA 3D8UA 4WUTA 5I4CA 1RXEA 4F12A 4Z4IA 1S8NA 5DGCA 1ZY2A 1QP7A 1ZITA 4PYRA 3KG2A 4P98A 4RS3A 3OQNA 5T7BA 3VNBA 3CHYA 2FMKA 1JYFA 2QXYA 2PL9A 1YTUA 1JL3A 3DLBA 3NNDA 3CRNA 1GLGA 4CBVA 3K9CA 4XFKA 1R8JA 1E6MA 3ROFA 2RJOA 3W9SA 5HQJA 4JP1A 4MQFB 5TPZA 1DRKA 3OQOA 3SNKA 3GBPA 1A04A 5IC5A 3KSMA 4TLLB 2JBAA 5JS1A 1QO0A
chains in the Genus database with same CATH superfamily
2B0CA 3QVJA 1DPFA 5L36B 5DBIA 5JZMA 1M0SA 1JFFB 2IHZA 1ID8A 3H4TA 1KKLA 3TF5A 1V9SA 4EI2A 1VZ3A 2J8ZA 4ZRDA 1OE0A 4INAA 1E2IA 2CNBA 1KVUA 2GCOA 4TZ0A 3BXGA 2JJYA 1A5TA 2RGEA 2AMLA 4JOQA 3ONVA 4NDNE 3N86A 3OZGA 1YHYA 3HCCA 3QXJA 4DZRA 4ESOA 2YWCA 3GARA 1R4MA 1ENYA 3PC7A 3P2YA 2EEPA 1W36D 5H81A 4UQOA 5FUMA 5FBKA 2OY0A 3AQ4A 5TGTA 2FCAA 5F5XA 1VI6A 3K0FA 5FPPA 2G82A 3DV0B 1RWQA 1VC2A 1GHTA 4FTWA 2QIOA 1P6XA 2ODBA 4Z4GA 3S28A 1ZONA 1DC4A 1E9BA 3F7MA 3NBMA 4MQ5A 4Y1EA 4EB8A 1ZESA 1PWHA 1RZRD 4FIDA 4KPGA 4KXWA 1G66A 1USVA 5MN5A 1I6LA 3VZRA 2P75A 3BEOA 1BVRA 4FYWA 3SM3A 4LXQA 3UXHA 2AH5A 2R62A 2WFMA 3OTWA 3DM9B 4P53A 2H65A 4M1EA 5FQNA 4BJHB 3T34A 3KM0A 2FUNB 1JHOA 1O95A 2WJGA 3FLBA 2NXCA 1VCNA 3RIXA 2X19A 5HFAA 3U7JA 3HI4A 4V1CB 3ANMA 2PL1A 1L7XA 1VL2A 4HXEB 2FJPA 2FEPA 1XVLA 1R0LA 4OQQA 4MB2A 4TROA 5JJBA 1OFIA 2VDWB 1K2VN 4ATNA 1RHUA 5HS4A 4NZ9A 3LKZA 4N0DA 4D4HA 2AUMA 4IFIA 1K0UA 4QOFA 4CWAA 1O9GA 3EVEA 2TMKA 4Z9YA 1PV4A 1P4GA 3C3BA 2X2PA 3ETGA 4QPJC 2RK3A 1B6GA 2A0WA 2A78A 2GHTA 3AJ9A 4OQMA 2IEBA 2ZUSA 3HA2A 4AO8A 4E6PA 1N0IA 3IBCA 5TMBA 3RYHB 3RJTA 5BO5A 1LZKA 2JGLA 4PZAA 1A69A 3O0DA 3CO0S 1V8PA 3L7AA 1RVV1 2ZRCA 2UU9B 4MVYA 5DE3A 3VDMA 1FTSA 1SMKA 3EF3A 3NH6A 1L9XA 4JKYA 1YD7A 2HV9A 2QVGA 4L07A 5DMXA 4CKCA 1TEZA 3ZW8A 4G0OA 4C0XA 3USCS 3OA0A 4L95C 5EVJA 2XGGA 4H9GA 5ILGA 1A9TA 5J23A 2RD2A 3O2SB 2QVZX 1TW3A 1QO0D 1Y9JA 2C9CA 3AJAA 3E22B 4I08A 5G0UA 2MR5A 1FNDA 2CXTA 3VNAA 1ZK0A 1RRMA 4LQLA 3SYKA 2Z6AA 4UVIA 1XMOB 1VIMA 3VHRA 4EGCB 4HAZA 2IHBA 1QIEA 1Y3AA 3KAQA 1I4DD 4GOJA 4CF4A 3JPWA 1NJ8A 5KTNA 5L53A 3D4BA 4CLDA 1OWMA 3CLUC 1MPTA 3VBEA 1KZGB 1EFVA 1T2FA 1CQXA 1Q12A 3ODGA 3OD1A 4LMAA 2EKQA 1IY2A 1Z4QA 4AMVA 1PJCA 3O9VA 4O1HA 2CJFA 5DGHA 2GEJA 3ILXA 2HA3A 1FDSA 1XRJA 1VBFA 3ISVA 3KOMA 1EGQA 4TRNA 2FRDA 4CM3A 4PNPA 4DREA 2YMPA 3WIDA 1XB2A 2CFOA 1XWIA 2KQUA 3Q0EA 4WZBB 5DX8A 2I22A 1PQ4A 4G5XA 1O7JA 4RH3A 1MEEA 1EWQA 3A31A 4GQIA 1VLMA 2F3TA 2HMTA 1EK5A 3LUAA 4XR9A 1DB3A 2BJWA 2GJSA 3HH8A 4PSKA 4XCQA 2RHHA 3VH2A 1FFYA 3CZ5A 2AR7A 3EUWA 4FGWA 4PR3A 4K2AA 3NTVA 3NTOA 5AUNB 3ESAA 3H1AA 4XLZA 1DIBA 3B52X 5KMGA 3CEMA 3N6VA 2XEXA 2PXHA 4QPNA 1X7DA 3QVWA 2EZ8A 2IZ6A 8ABPA 3KE9A 5JRZA 3HCDA 5ALTA 2BI7A 4NECA 3KKNA 4LKOA 3L05A 1P8JA 4NYIQ 1M5UA 3CLVA 4GPEA 1PV1A 3HCPA 4Q21A 4WKGA 1E1KA 2HQ1A 1NC3A 5FLXA 1M8JA 2YIDA 5DW0A 2H2HA 3ROTA 1RQPA 1XK7A 3T7KA 2H4HA 1YWGO 3I23A 2RH5A 3DYBA 3HUFA 4UU8A 1EJ2A 2FFQA 1OH7A 4L73A 4UBKA 2AV6A 1GL9B 4KNYA 2QUHA 5GMOA 1YS7A 1RQRA 2YQ5A 1VIAA 2NUTA 1Y1QA 2G6TA 1ZC3A 4TXNA 1PEAA 2YW2A 3HC7A 4YPVA 3DKPA 4KEAA 1KEPA 2FMIA 3GGDA 1QYWA 2WLTA 4KN9S 2Q8PA 4QTZA 3N2GA 4NBNA 3H1TA 1ZA3R 2R7KA 5HILA 5FWXB 5HYVA 1T2UA 5DJ5A 2CL0X 2AJDA 1GPYA 2DHEA 2M6RA 4HAIA 1I4TD 3V8PA 1K6JA 2Z08A 3A7EA 4GEKA 4JI7B 2NO1A 4LF9B 4UE3S 2DERA 1PTJA 4D8VA 3OHPA 6REQA 4D43A 2RGUA 2CT8A 1NI4B 4PS1A 5IF3A 3RB8A 1QTQA 1VCHA 1ZD3A 4O2BB 2XQVA 4YXWD 1J2RA 2NW6A 5B1DA 2ZAMA 2I4NA 4ALJA 5JT1A 3F3YA 2OZKA 5J4HA 1P91A 4OQFA 2JVJA 3WK5A 3ZUGA 4Y6QA 2V0CA 2CV2A 3R0ZA 2DHCA 2C88A 2W70A 3FAZA 2W42A 1Y42X 1S02A 1WTAA 2FCRA 3HDJA 3JQCA 3KSDO 4GLOA 5IBCA 3GT7A 1IM5A 3OF3A 5C8VA 2QUBA 4DXAA 3DH0A 1IAQA 3HP1A 4IWYA 1XLUA 4GWGA 3HN2A 2R1UA 2HO5A 4XA8A 4MH0R 3K0HA 1BHO1 1HDGO 2RH9B 4FZ3A 4I4LA 4TTSA 3Q8XB 1FQJA 1E5LA 2RHOA 1TVCA 4EWLA 3VGPA 3JQ9C 4N12A 2ZBFA 2WD7A 2FGJA 3LFTA 4U02A 1J00A 1Y3CE 3FTFA 1IN1A 4OQ4A 1AKNA 1PT5A 1YR2A 2IPLA 2XDYA 1Q3HA 3CLSC 4MVJP 4EFDA 3S4YA 2QR3A 4BNMA 2A9OA 2QL5A 1AB5A 2Q5LA 1DTWB 3BMQB 3H9CA 1Y8RA 4OYHA 4WACA 3FYSA 1FUIA 3U2QA 1V48A 1KEEA 3AEXA 2A1TR 4MKFA 1U65A 2EWWA 2W0MA 4YP7A 1CG6A 3U3SA 2Q5IA 1RI5A 4CQMD 1F8YA 1ESDA 1Y9EA 1G21A 2JHPA 4LTDA 4J0DA 2WJHA 3BCSA 3MMSA 3GMIA 2MSNA 5BQ5A 4ZVUA 2W6OA 1Q6YA 3QUQA 1SO8A 1PDVA 4L08A 1V11A 2RJ3A 1PR3A 2NX2A 4L9AA 3C6ZA 4NOKA 3ZHRA 2OCKA 4FPXA 5T6MA 2E9SA 3RU3A 4B7UA 4M22A 2O1EA 4DLKA 2JLRA 3FNHA 2MDTA 1JT9A 5JPIA 5AKZA 4QFCA 3ALQR 5EJEA 1PEDA 3PNPA 1NLFA 3U7QB 4Z4CA 1GG5A 4H7IA 4QYSA 4RM2A 3KEOA 4ZCTA 2QN8A 4DC1A 5DHTA 4NBKA 1Z33A 4TLCA 2EF0A 1EJBA 3PI6A 5HIIA 3V8BA 5BQFA 3RS7A 5DYWA 3QVTA 5GVRA 1NV8A 3DCYA 1WM1A 2C3OA 2JVKA 2OCXA 2LIVA 3PSAA 4NK4A 4RLQA 4IG9A 2J4FA 3L0DA 1JDSA 1KY3A 4GRAA 4Q5IA 3WLFA 4C0WA 2IHJA 1ZK4A 2EWMA 1FQKA 2ZQYA 3QV2A 1WMAA 1ZMOA 4TLBA 3NBKA 3AR6A 3QW4B 1H6DA 1JKMA 2JFWA 4QQKA 1N33B 4YUZA 3L07A 2ZRGA 4NCNA 3TL6A 5LU9A 1ZD4A 2XMZA 4FN4A 1HX7A 2HFKA 4C2TA 1LKZA 1BCSB 2P2DA 4XD2A 4E2ZA 1M34E 4B3JA 1N57A 2PUWA 1QHEA 1AQIA 1FE8A 1Z3CA 3NBUA 3PFCA 3Q1LA 4PC1A 3WSTA 2NPOA 2Q9UA 5CM8B 4DV5B 4JJFA 2LCIA 4P22A 1PFYA 1USKA 3E9RA 4HDSA 4C4AA 4D9IA 1E20A 2H6EA 3UB3A 2Z6QA 4OM8A 3HRKA 1TUBB 1M1NA 3K8ZA 4DMMA 9ABPA 2FG7C 2PUGA 3HI6A 3D6AA 3STXA 1KP3A 1ZIPA 3EUFA 4RNDB 3SSNA 3TRKA 3VU9B 1RMYA 5DNUA 4S04A 1UANA 3A6ZA 1W76A 2EQ5A 2R751 3MS2A 4PINA 1IK4A 4JBIA 5BT8A 4IIDA 2HXSA 5A5EA 3LQ4A 5EE1A 2HWYA 3NLLA 2FW9A 3R3VA 4B3IA 1NLYA 3FPHA 1S0UA 1E3QA 3BKWA 3E58A 2RKWA 2OVBA 3TAXA 3R5TA 4DVJA 2BMAA 4R7TA 3NHBA 2O4CA 1YL6A 5K3DA 3I39X 3ZV3A 4E1VA 4ALNA 5BWOA 1V45E 2ONCA 4I7EA 3M33A 4GX5A 4L78A 3R3SA 2PO7A 4JL5A 4OMDA 3RIYA 4TYQA 4DCTA 3M5WA 2ZIUB 4V03A 2HBQA 2YZ2A 1L4EA 1WPXA 4KVGA 4PO1A 1NJGA 3ZX5A 6LDHA 5ARCA 1EMDA 4PZEA 4H7EA 4JWTA 5IRCD 1ARZA 3ELDA 3L7BA 1E2UA 1IBLB 3U5TA 2WTXA 2MR6A 1G7CA 4HSGA 4FKMA 1GXSA 4QFBA 5IG2A 3W5IA 1QO9A 1UCFA 2CBZA 2JLSA 3BHJA 4FT2A 1IRXA 3H6HA 3PIDA 3VUFA 4BUCA 3W8DA 3U4MA 3UWKA 1P80A 2WPDD 4WERA 5BT9A 3OZ7A 3OFND 3NXKA 3W77A 3BAZA 2BM1A 3HCFA 1O5OA 4QDKA 5LLSA 5CGQB 2IUTA 4OX9Y 2I6UA 2WSSD 2B4TO 2VDQB 3BCRA 3KHTA 4IUBS 2IIPA 3E7WA 3AI1A 5ALXA 3UWSA 4FILA 1ATZA 3S7TA 3WKAA 1ODIA 5CLHA 3U17A 3BGDA 1R5BA 1GL6A 1O9BA 2SKCA 5CT6A 4HKTA 3UG6A 3SYRA 2Z8YA 5REQA 3FHOA 4P82A 1DDIA 3E70C 1DAGA 3Q12A 5B1EA 3EPLA 4RHXA 1P31A 1Q0UA 3SDSA 2Z2IA 3CUVA 4F9GA 3L02A 5KNBH 1KYTA 1U9CA 5LP6F 1VLJA 3HL4A 3TRFA 1GOTA 5IDXA 1NTOA 2HDWA 1ZUHA 1AK2A 3M6WA 2FA9A 4GX2A 4DHEA 5BUQA 3CZ4A 3NALA 4J3JA 4WK2B 3AIKA 4JDPA 5CU7A 3VOSA 4NEQA 4BFWA 5B6IA 2GZ3A 3CNOA 3RRYA 4KHPB 2FGKA 3BE8A 1KJJA 4LSZA 4JI5B 4CKBB 5DN9A 4ZDIA 2PFGA 5EWLA 1LWNA 1WV0A 3QX9A 1FYWA 3EA0A 2Q2VA 2ZYTX 1YQUA 2P90A 4EG8A 4FQ5A 5ALFA 4ZYUA 5DLPA 2B61A 3NASA 2BE7A 3OLCX 4RDCA 3U3MA 1QIFA 3P0FA 2XTNA 3IV7A 4D6YA 1G19A 2XRYA 2IDMA 1L5SA 2FMUA 1U8AA 3ABOB 3PHHA 4I50F 2JBAB 1RR6A 3A6GA 3K2IA 5TE9A 2R2AA 3TLGA 3C5HA 1EGHA 1B15A 2IUUA 3TLBA 4EAQA 1JQBA 1RM3A 2HHHB 4B73A 4HDCA 2IUFA 3CVXA 1PTKA 4CHGA 3MMZA 3L7CA 4ZXFA 5JH7A 3ACDA 3O74A 4OMFG 2XYRA 3GRFA 4CQLB 2GA8A 3UAXA 5L3VA 3WJ7A 1BXKA 4TM8A 2GZRA 2IZZA 3IV9A 3OCZA 1DOHA 4Q9IA 2FVYA 2IH5A 5IT0A 1V3UA 4LJ7A 5F21A 4OLJA 4DEYA 2C5FA 5GAJA 3DLPX 5ESWA 5EXSA 2UAGA 3HVIA 4Q6WA 4L2IB 3RSSA 1ODTC 1U0BB 4JLUA 1DGQA 4IKOA 5DULA 2A9FA 1UBRS 2W6QA 1MT3A 2CCJA 3IMGA 3ZS8A 4G9GA 4TMZA 4YUWA 3VSEA 1BIFA 3I61A 2IE8A 5ALHA 3LLVA 4GXNA 3WQBA 4GICA 1WXEA 5IJ9B 2EGHA 3QF4B 2H11A 1ECPA 2L2QA 3GJ8A 2HU2A 3EOZA 1EVKA 1IG3A 4O2BF 4WCDA 4S0XA 3LY7A 4D74A 4JR2A 1FU4A 5G4KB 1Z6TA 1XPOA 3H86A 1I6MA 5EG5A 2QZJA 4B80A 3V2UA 1MV5A 1UXKA 4Y18A 5KWEA 4R71A 2PMBA 1E7YA 1U7TA 2FPIB 2ECFA 4BDTA 3BD7A 3GVPA 4M1SA 4UNIA 3H8WA 1JLLA 2VNHA 1E5VA 1E69A 1K7FB 4ND7A 3W7AA 2NTVA 1RXEA 3GFTA 4O2AA 4Z4IA 3QF7A 4K7JA 2PD6A 1MF7A 3UOGA 2ZDHA 3WISA 4PGGA 1CF2O 1EK1A 1WHSA 3HFGA 4GPTA 3M0EA 1NUPA 1VG1A 2JKVA 5FLEX 3K94A 5DP1A 3V80A 5C9ZA 2CGEA 1P75A 2BZ0A 3D5QA 1R1DA 1Y7TA 2P8JA 1Z47A 3QHAA 3WGHA 5DASA 1NDUA 1EGVB 2R86A 5GJBA 5A5GA 1J9GA 4I4CA 4UNRA 5BSGA 5IHPA 3GA7A 3RRFA 3OU2A 4MI1A 3AONB 2P65A 1RC1A 2C04A 2NO0A 4G4JA 2EAUA 1I1HA 4J1TA 4M0MA 4JQYA 4KXXA 3TS1A 4E2FA 5JW6A 1BQ3A 2C3PA 3AK4A 2EG5A 1RAHA 3KETA 3PEVA 3W6PA 3COYA 3DZHA 3JYOA 3RH0A 2XUKA 1J2UA 3CNBA 3ETJA 3ZG6A 1PRYA 1ZP6A 3PQ6A 3IVAA 3MG9A 3STVA 3A70A 5C1PA 2D62A 2R8RA 4YCDA 5CBPB 2NADA 4P7BA 1XRRA 6ADHA 4D8UA 2DEUA 2E5LB 2NACA 1P1JA 3KKMA 1QLHA 3O2QB 1O1YA 3I45A 5HEKA 4HH4A 3SJCA 4IMIB 2EBHX 1NM5C 3C8ZA 3IMEA 4UEOA 2IWRA 3UMRA 4U63A 1E2BA 1L1FA 4LBWA 1XTQA 1B0AA 3ONWA 3WVNA 4DIEA 3PZBA 2BM8A 3KJQA 3EEQA 5KHAA 3B6EA 3TKLA 5D5HA 2G7MC 1A0OA 5LZ9A 5DBEX 3IILA 1KO7A 3AC0A 3O83A 4MA4A 4Q24A 4N5DA 4AUEA 5CB4A 3LUGA 3LT4A 1T2EA 1IUOA 1JGTA 3SQOA 1BKDR 4A26A 2XYPA 3O0TA 2H5EA 4BJ6A 3B8EA 5JZOA 4EA7A 5AESA 4BQFA 4GSYA 3OEEA 1XTRA 2YC4C 3PPIA 4YCNA 4UU7A 3U3VA 3IV6A 3QLEA 1CUVA 1I94B 3C6KA 2C8JA 3JQFA 2OCGA 2QMQA 4X41A 2YBDA 5KQPA 4J4BA 3I5UA 4C4ZA 5KDDA 4R5MA 3LWDA 2CFTA 2B0JA 2PA3A 4OAQA 4WD3A 1C2YA 2Z3WA 3A3KA 4G09A 1ZWLA 4YRIA 3KSAC 4D9CA 5K20A 3OT4A 5AK4A 5KSOA 1O6ZA 4ODIA 4R6XA 4UUPA 1GUBA 4M7WA 3WQRA 3CEHA 2R5NA 3ED5A 2HA4A 4N3CA 3TLYA 1B26A 4CIXA 2AHRA 4J1NA 1BDMA 5EMNA 4MS1B 1IZ8A 3P94A 2Q6OA 4YUXA 2EFDB 2IODA 3I9NA 5EIOA 2EDCA 4UM9D 4IOJA 4JL8A 5IKEA 1THMA 3EMBA 2EZTA 3USZA 3VI4B 4QM6A 1DKNA 3G9TA 4KWHA 1JMYA 2HXGA 1NVBA 2PGJA 3ADOA 4UATA 5TX7A 2UYYA 2F1OA 2J5QA 2VP9A 3LF2A 4CUZA 4HSEA 1O08A 1FY2A 4QARA 3TMYA 4KOAA 1WPQA 4Y9RA 2C7VA 2JAHA 3I4CA 5T8KC 4KUGA 4HGRA 3W5BA 4PF1A 2DXIA 1HO3A 3C7TA 3DV2A 4RWZA 2YOFA 3KTOA 4X20B 2FWBA 3ZTYA 5IXYA 3HM9A 4XZ3A 3AFHA 4DR1B 3PQ2A 4KH1A 4EELA 4J6EA 3AI7A 2DT5A 4MR9B 1X1SA 2YV1A 4K6HA 5KWSA 2XTAA 4TYYA 2PVSA 4N3AA 5I8PA 1M2EA 1T9DA 1Z2CA 2FJUA 1VECA 5KYYB 1NOIA 3MRVA 1UBMS 4XJSA 4Y7DA 3U48A 1GPKA 3SN6A 3EULA 4HYTA 2R4UA 1UQRA 4OHFA 4PIPA 2XKKA 2REBA 3DPUA 4PFJA 3W06A 4A2PA 4C0KA 3TLGB 3IAHA 2I78A 1QE3A 2FWNA 2BPOA 4QOSA 3LL7A 3JVVA 4WH0A 3UPTA 3OT1A 5LBUA 4LECA 1JB9A 1ONBA 1E3MA 1A9ZA 5KJ6A 5AJUA 4LDRA 1TM2A 3KWJA 1U80A 1JFSA 1QLJA 2C4HA 2MSCB 2YS6A 2IDJA 2MWMA 3SG0A 3ZTWA 1P1BA 1N6OA 2X7HA 4CQLA 1WZNA 1ZJZA 4LF5B 2QUIA 4JI0B 1H69A 3GJTA 5DCUA 3I4LA 2VP0A 1UKYA 3GJSA 1Z0KA 4QU0A 3MW8A 4Y2UA 5IVDA 4F92B 4CGZA 2XUJA 3LX5A 5UKDA 5ISMA 2C9DA 2WYWA 3HL0A 3W3AA 1SU8A 4JGGA 2J5KA 4G0WA 2W2KA 2BGGA 2R2GA 4DM4A 1ZGAA 4A6PA 5SICE 4YIKA 3IQHX 1ULZA 3TZQA 3CSSA 5FHRA 3UAGA 3FSEA 4GKAA 4I1RA 1JXQA 4ZAGA 3CIOA 5TXGA 4WL0A 3V1MA 5JNVA 2VP3A 3QLUC 3JWEA 4M6WB 2YDYA 3EUAA 3CVJA 3GXBA 3P97A 2H2IA 3HSKA 3NTRA 4OIFA 3NHMA 3L0CA 4NL4H 4UU0A 3KV3O 2CN1A 2ZIVB 4X44A 3V32A 1A1SA 5AIAA 1E2FA 4PPYA 4EKGA 3AVWA 5JNRA 5ALWA 2BMDA 4QRIA 3HJFA 2IQ5A 1QHYA 4AN1A 1G8SA 2O0KA 3LVBA 5FV4A 1R9JA 5ITSA 3TLAA 3OIFA 4HNGA 4L5JA 1KARA 1VFPA 2FOXA 4B6OA 1AKVA 4P86A 1BDBA 1C0PA 2Q3DA 3PX7A 3ZD7A 1U8EA 3IIKA 3UJ8A 3V55A 1HORA 1JSLA 3A3OA 2LXNA 4CKEA 1GR1A 5JXWA 4FMCF 4LYYA 3CMMA 2HLHA 1W30A 2RI1A 3F4BA 3GG2A 4FI3C 4QJ5A 4Y6RA 5E4FA 2J5BA 1TQDA 1NAHA 3IBFA 3AESB 5BNFA 3WKCA 5ILOA 1WETA 4E70A 2FR8A 1UJ5A 4W5NA 2DETA 2OZPA 4GOMD 1BNCA 4IM7A 1NR7A 2OSBA 1ZN2A 1TQHA 1OZHA 4OP2A 4XYBA 4EJSC 5A5DA 1IRIA 2W2KB 4AMUA 5FFNA 3Q0TA 1H2AS 1N9KA 2YBEA 3KELA 1E5QA 5F35A 4QNMA 3L8MA 1JPJA 2YCLA 2YJ3A 1FDVA 5M7EA 3HXQA 3H17A 2YWFA 2VO1A 3HHEA 5IT4A 3SXUB 4IHJF 3ICEA 1LUAA 4Q4HB 2F1JA 1COWD 4C7VA 1I51A 1G8PA 3O5AA 2XSZA 3FGNA 2O8BA 1NMQA 2FSPA 2FSIA 3P9ZA 3K9LA 5K3FB 5JSUA 4R1NA 3SZGA 2C1ZA 3E84A 3I9V1 5HMLA 2HSJA 2X42A 1AQUA 1G7SA 2CHQA 4M9CA 2HJHA 4MWCA 4D4KA 2DE0X 1ILEA 4ND3A 2OQ2A 1AUPA 4XOUA 4YLYA 1AHNA 3PHBE 3IUSA 1YJQA 4Z2YA 3PDHA 3LDUA 5AW0A 1PBNA 1FXWF 3RYFA 2XXAA 3WAGA 3K0AB 1ZMBA 2WG1A 3LRXA 2OWDA 4ND8B 3LWNA 4UC0A 4X95A 3UH0A 2WJWA 3ZQKA 2ZZMA 2EQAA 5JAOA 1JZQA 2XTMA 1SCDA 2OGTA 1IOVA 1LQTA 1OAAA 1KMCA 2PAAA 1GYRA 3BRQA 3KEQA 1EE2A 4RY2A 4UFOA 1TFRA 2PGDA 2P77A 4R2JA 1EP1B 3AU9A 3T54A 1PL7A 4QATA 3DXYA 1CUCA 3RDPA 4S12A 1DOAA 1E63A 4EW3A 4F4FA 1Z6GA 4WZZA 4A10A 3AGPA 1DMRA 1CJKC 3S27A 4G6ZA 1RD4A 2H4WA 4KLAA 3C70A 6Q21A 1D03A 5CDYA 3OWOA 1APBA 4C30A 2OCIA 4ZZ0A 4CQMA 4NXNB 3WLAA 2Y0PA 4URUR 3VBCA 5F2OA 3REGA 4HFJA 3O1LA 4GSLA 2R0QC 4Y6OA 2JFZA 4OBBA 3EDYA 4PG7A 5TQJA 2HMVA 5EJMA 4RGQA 2VP5A 3O8BA 1S2GA 5AVOA 4YYZA 5IPFA 1ZL2A 2IE0A 3NEAA 1KY4A 4HX2A 4Q19A 1KJYA 3ZDEA 1XDBA 5DGDA 3R3YA 4KH0A 3VJLA 4UPVA 1TZ2A 4F6RA 4HN9A 3SMVA 3U9TA 4N48A 3ICWA 4AC9A 4RWEA 4YGYA 1D1PA 4O4IA 5BVGB 1GTMA 2VDMB 5DBFA 1DEOA 3WFZA 1XRSB 1SIOA 4GBJA 1QS0B 4L1KA 1TO2E 4FFNA 1PSWA 1ZUIA 2XZPA 3L8FA 4MHSA 5ALPA 4WFKA 1QV7A 3PCRB 3HCWA 1KERA 1DCFA 4XIFA 4BFCA 3DB1A 4OTZA 3NW9A 3PE4A 3DCNA 4JELA 2FR8C 1Z6XA 5HF8A 3D8TA 3FYUC 1E9AA 3WAKA 2PM8A 2PLWA 4KSBA 2YNMA 3WHPA 4BX2A 2M98A 4BFLA 5JJ5A 3WC4A 3TTWA 2FLWA 3RG2A 3NT4A 4MR9A 4QTTB 4GR9A 3I0ZA 4UBLA 1JLRA 3IVMA 2C4KA 3UYKA 3EGIA 3LHSA 3WBJA 3EQ2A 5IU6A 4E5KA 1TJPB 3HYRA 4G41A 4E5SA 1F38A 1PWEA 3GAZA 3K0SA 2IYLD 2RHCA 1BMFD 2BKVA 4HTFB 1FXUA 1JSXA 3CRVA 3GN2A 4B46A 2IYOA 1OTYA 3Q6NA 4EY7A 1T8TA 4FD2A 4FR0A 5C52B 3D43A 2NTJA 4QU8A 2PRIA 1IFXA 1KC1A 1XEFA 3DP9A 3KPWA 3AM1A 1CVRA 2JFOA 1W1IA 2HWXA 1Z38A 2B3DA 2WP0A 4GC5A 2XGSA 4A0SA 3U62A 4FS3A 2AJ8A 3FA2A 1KMHA 4P36A 5A71A 1YE5A 2C8LA 4MEAA 4CIDA 5D86A 3HA7A 1O96A 1PR9A 2XWPA 4IYRA 4FHQA 5H83A 4LC0A 1T5TA 2VZ0A 4R3WA 5ALIA 2NZJA 3VPGA 3RRNA 2H1FA 1CV2A 1GUZA 4X54A 1FFXA 1L4GA 1Q5PA 1UC9A 4L8WB 2V65A 5J4KA 4YRPA 3X43A 4DZTA 3G0GA 3DTTA 2VHTA 2HWKA 3C16C 1N9ZA 2FMHA 1I32A 1KI1A 1MB2A 1IXSB 4D9NA 2VPPA 4FGZA 4CLXA 4YMTA 3DOCA 1G3MA 1CEXA 1TJ3A 2NO9A 5DI9A 4ZU3A 1QP4A 1I4LD 1GVHA 2VG8A 3ND7A 4UD2A 3ASZA 4OI4A 1C9KA 3H0KA 2HMSA 1Q57A 2C7PA 4OEHA 4LDZA 1P5HA 1RNLA 4RJJA 5JBNA 4TYWA 3JSAA 3W78A 2R6CA 3FPSA 4OJMX 1J7KA 1RYNA 2VYFA 4D25A 2H9IA 3A3PA 5E2IA 2XDWA 2BGTA 3IO3A 4INPA 3AEKB 1DKPA 1EX1A 3HACA 1J42A 4M55A 4EUFA 5HZMA 1QF6A 5A6VA 2W71A 2QRZA 4N3NA 1XAGA 2D7CA 1YZUA 1UAGA 4IIJB 1VIDA 2KW5A 1ADJA 4ZC8A 1Q95A 1VPEA 5CT9A 5F5NA 3RABA 1TVKA 3GLUA 3K4QA 3ZJ4A 1E1DA 3PHLA 4LOIA 2OCPA 1SM4A 1LDNA 3FE2A 1E32A 2AQKA 4FMDB 5JSYA 2QZPA 2IA5A 1OIWA 2EW2A 1ACMA 4BN4A 1BGXT 2F6RA 4DIBA 2FEWB 2UZ1B 3DSRA 2Y05A 3J7TA 4RQBA 1J1UA 2Z2KA 4OA5A 2IU3A 3BA1A 4EHAA 4ZAVA 1Z13A 3UJDA 2C77A 3MQFA 3KDPA 1OD6A 3IXQA 3V8VA 5GTDA 5E9AA 5LBTA 2UVPA 1NI4A 4OQNA 1JG6A 4S1NA 4U2GA 1N6LA 3NNSA 2WRZA 3Q72A 4EX7A 3GEIA 2Z8XA 3H04A 5KSYA 2Q3BA 3T3GA 2R11A 3VKHA 4I2VA 4IJQA 1JHAA 1POWA 2CZQA 4HGPA 4KK4A 1X7YB 3CZPA 2WNHA 3NV7A 1E59A 3R5HA 2QTZA 3OJLA 3EH1A 4FCTA 4QDJA 4TV9B 1TF2A 4YAFA 5EXDA 5IAEA 2GJKA 1V16A 2HMYB 3I04A 3SBOA 3AUXA 1S2DA 2IYYA 3KQWA 3LSYA 3QKSB 4JGIA 5F9HA 4ZI2A 2WAAA 5IS2A 5TV2A 2GEDA 4ME6A 1HOXA 1XEWY 4K6KA 3GI1A 1W85A 1M0EA 4G23A 1U3DA 2A5GA 4N9WA 3R9WA 1YL7A 5CEFA 3GIDA 4DIKA 2Q3MA 3U1TA 4CODB 4NSNA 4IDCA 3VR4H 1HMPA 4AU1A 2QX9A 4Z4FA 1GNTA 1ZOOA 2QTNA 2XY4A 1JECA 2B34A 1JPUA 2O0MA 4LUCA 1C7IA 1WY5A 2GHIA 4QEDA 1H8HD 1VDZA 4GOLD 1BSVA 2ZRDA 4BUZA 4HMPA 1M6WA 1RMTA 2BLLA 3OUUA 3R0JA 4BL5A 5AHOA 1Z56C 2FXVA 3T8YA 5BWCA 4E32A 4URHA 3II6X 4CT0A 1DP4A 5DGIA 5ALRA 1NJ5A 2V6IA 2VR1A 4J43A 3B12A 4TGLA 3GLHE 2VQSA 1ZM9A 2YOHA 1YZKA 5AVWA 5K01A 4QNNA 5B58T 2Q28A 1QGZA 3OECA 4KXYA 5DO9A 2R8ZA 1RTTA 4U6QA 3T1HB 2G1AA 3NH9A 2C2WA 3DLAA 4WWHA 2B37A 1S3SA 3HB7A 5GGXA 1I24A 1BFKA 2W8BA 4O4LA 5KYGA 1DJLA 5IBPA 5B64A 3M6AA 1IJKA 3OY2A 2RAPA 3C3AA 2WAXA 1FA9A 1Y3DE 1IJEA 3KL4A 3PRYA 4XGKA 3CA8A 5DM4A 5KQGA 3PL5A 2KYRA 2QUKA 3IMKA 4X8LA 1X7HA 2QX8A 5JO9A 1QE0A 3DCJA 4RPIA 2AOXA 2QTBA 4IZHA 4ICIA 1QQTA 5JSQA 1G8MA 1P81A 2FP3A 1WABA 2HIMA 3WKEA 4UTRA 4YMGA 2A5DA 3U6KA 5CLIA 4L76A 1MIOB 3OCJA 3PA6A 3R7SA 4LYHA 5BW5A 1LDMA 1ZM3A 2C9MA 4GOXA 1IN6A 3KAKA 1Q1BA 4G1BA 4MHOA 5JFOA 1CWUA 1QH9A 4IDPA 3JQQA 2G83A 3OIDA 4MW7A 3J81k 1CS4C 1KOJA 1JKIA 3CRNA 1JTFA 4AJJA 3MOGA 4XFKA 4CBVA 2QTHA 2E49A 4TUYB 3PUYA 1AS0A 3B6IA 4JP1A 2AG0A 3F9RA 3ITDA 4UCWA 5CVCA 4CL8A 1SVNA 2WIFA 4ZTBA 4OUDA 5BYBA 1N6RA 1T1SA 4RKEA 1Q3KA 4FGUA 4KSYA 2R6HA 2JBAA 1G9SA 2QG6A 3A14A 3NGXA 3L8CA 3IAXA 6AT1A 1AN9A 2QX7A 2ISQA 2P6UA 1WBJB 2PGAA 3W5CA 1BWSA 1QFJA 1ZBDA 3NYRA 3NTQA 3SE0A 2KJQA 2RK4A 4JUCA 4RW0A 2OR3A 3W5JA 2X15A 4DLNA 4M37A 3O75A 5JH7B 4OLFA 3I30X 4YIHA 5FRDA 1QIJA 5B53A 1W73A 1RAFA 2PYZA 4YAUA 6REQB 5LOVF 1U63A 3H2KA 4PG5A 4NMMA 1PD1A 3ZHUA 5ADVA 5EY5B 4O4JF 1B1CA 4NS4A 5DNWA 1Q0TA 2XUDA 4BB6A 3DTYA 2VJBA 5HOQA 5F9MA 1UJNA 5KO2A 4LWZA 2ID9A 4UARA 3E9EA 2XDQB 3RS8A 3OZRA 1QBKC 1E2QA 3M7IA 4G0NA 2NUBA 1ZNYA 3KQOA 2K6GA 3JVEA 4R3UC 4UTVA 4B4OA 1QR6A 3V2GA 1G2IA 4BO2A 3L0IB 1UC4B 1E2KA 1XD2A 3MQ4A 1MA0A 5DLEA 1ZEJA 2L82A 1ZQ9A 5E1MA 3VXKA 5KNCD 4MV4A 1X8XA 1Z83A 4G86A 1VXOA 4R9UC 4XPIB 5E2AA 1JR6A 3E2PA 3DDZX 4P32A 5C1OA 4RPKA 5AW7A 1N32B 3W9YA 3HLTA 4JJ8A 3V1LA 2QSZA 4AY3A 2NU8B 1X38A 1YAJA 1VPTA 1Q77A 1R50A 2JZCA 3WMGA 1ISMA 4IFTA 1PLLA 4J9VA 4OAPA 4BDSA 1I2BA 3W6OA 4UTNA 4K1LA 4WBXC 1U5BA 1K4KA 2VZEA 1JTVA 4WBNF 2FQWA 3B6JA 4AD8A 3B51X 1OVGA 1LB1B 1WB4A 4MXWR 2DFKB 4Y0VA 3LUPA 4HNRA 2VQDA 4UZFA 2G7ZA 1I01A 1CB7A 4RMGA 3H3JA 3VZBA 4R3NA 2AN9A 2D2IA 5IN4A 5F4ZA 1SK9A 5JLJA 1G17A 4PNHA 4YUAA 4DNQA 4W9RA 4R1OA 5ALEA 2I99A 3RBAA 3W1VA 4YWHA 1GUAA 5AVTA 2JI4A 1RQ2A 4C0SA 5HG0A 4P0TA 3JV7A 2BIFA 1XSEA 4J03A 3CF4G 4JCCA 1FBTA 2ADOA 2X5JO 2GBCA 3KTAA 4L4YA 1RI3A 1Y1PA 1WA5A 1P9OA 1KAEA 1XHEA 1KRHA 1YV9A 2ESRA 2ERYA 2IUEA 4U7JA 3SFVA 1ANKA 1U7XA 2QNIA 1SUDA 1XJWA 5ENDA 3TSYA 1N5MA 1M0TA 2G04A 5CIQA 1QS0A 3B5EA 2CMHA 3FI9A 2ZRHA 4YN3A 3GZTB 4DMUB 5BUSA 1P2VA 4RHYA 3PUJA 3ZDQA 4RD1A 1K4MA 2QRPA 4K5QA 3UGKA 3GK3A 2R48A 2ZJ5A 4QUGA 4QQRA 3BAFA 1FRZA 3PPYA 4JXZA 4KR2A 1R37A 2VYCA 3K15A 1NVFA 2QR6A 2VH1A 3EASA 3EZ9A 2GJAA 3HKDB 3UMMA 3BWBA 4IDAA 2BW0A 2Q1TA 1POXA 1JU9A 1H1LA 2P9ZA 2WTNA 2XGJA 5KYWA 1JEQA 4BN0A 1LV7A 3QNUA 2CBXA 4QDUA 4B09A 2QAJA 1RZUA 3KX2A 4L72A 2Y1EA 1W0CA 1V41E 1X1TA 2HUNA 3ON5A 2GJ9A 4X1OA 2SNIE 3B5IA 2EFJA 3WLKX 2GI4A 2JEZA 1RI1A 1SUCA 2F1HA 1M54A 3QOYA 3OX4A 1PK9A 3R6LA 2P2GA 4Z0TA 1MB3A 3S8MA 5AI9A 5KNDH 2HU8A 4W5TA 5D7BA 4MVJM 3VRHA 1XL0A 2QE7A 5F1PA 4ZKEA 2BDUA 5L45A 5CYGA 1FK8A 1J06A 2I2CA 4X8MA 2MU1A 2VAVA 3E8XA 1I1QB 4YUYA 4EF4A 3LZCA 4O6VA 1OT3A 4DJJA 1PR4A 3HCRA 4DLXA 3GFPA 4IH9A 4M49A 1ULHA 2CNLA 1OYOA 3EG9A 4DOMA 3ZWDA 1MAAA 4YDQA 3AINA 1JHMA 3ILSA 3KHSA 4RENA 4BXOA 4DBLE 1G5PA 1SG6A 4QU5A 4CMJA 2C07A 3QOFA 4E21A 3HFJA 2BEWA 4ZN6A 4A2WA 4GMHA 1T2NA 5JFGA 3ZVKA 3E1GA 3S1LA 2VF2A 3N8DA 5JYEA 4L4XA 1QGOA 2HN9A 3RC1A 2I65A 4QYTA 4ZO9A 3C1TA 3PFNA 3RSZA 4NBVA 4PGHA 5FOTA 2F8LA 1J2JA 1UFKA 2BWJA 2YXNA 4Y8VA 3P5SA 1N6NA 5EINA 3ZNNA 4QJIA 3ZWQA 1KI4A 2WBLC 1XCJA 3EIFA 1PYOA 4WN9A 4KVAA 1EDZA 3UVEA 4X7BA 1IN8A 4KBFA 2G9NA 2RE8A 3HO1A 1USIA 5HUHA 2XNJA 2XXAB 1IH8A 1G8FA 4LJAA 2W2LA 5CURA 3TG2A 2JA1A 1IIBA 4LC9A 2WJVA 5J2TA 2YWHA 1IIRA 2XPCA 1QIDA 4O59O 3IESA 4JFRA 1HFJA 1B6SA 4LBZA 2V1UA 1FYEA 4KYVA 4J1TC 3RU9A 1DS6A 4UZSA 2A3NA 2AMYA 1Q84A 4CU2A 4CEJB 3THXA 3SLRA 1EAMA 3QHQA 1XZCA 3TW4A 2XA9A 3BXFA 1XMVA 4PQFA 2QLTA 3ESYA 1U9ZA 2I7DA 3IUQA 1QQ6A 4N3GA 4B5KA 4OSOA 3U1VA 3LX4A 1QYRA 4AZSA 3D1VA 4QXRA 1DIOB 4MITA 3H8JA 5DWQA 4DV0B 2GZ2A 5ALZA 3MZ0A 3QVGA 1DBIA 3ZVLA 2XOKA 1SKYB 1J0AA 3K2QA 3EJWA 4Y6PA 2YVUA 4HP8A 2CV0A 1ZGGA 5BWLA 4RE6A 3LAWA 1QJ4A 1N5OX 3A4VA 4G5RA 2BHTA 3PNLA 1Q92A 4ER7A 3GMDA 2VKTA 3LPNA 4I5DA 4WECA 1T8WA 1E99A 1GP2A 1O6BA 1OA1A 3JQ7B 1AQYA 4FMCB 4OFXA 4P3XA 4PC6A 1E2LA 2I91A 5AUPB 2LZ0A 2F7SA 2QJWA 1H23A 3ORSA 2YR0A 1ZQ1A 1CQWA 4FC6A 3HWRA 4C6HA 1B43A 4WKBA 4HT3B 3GL9A 3PNSA 4AO7A 4RL4A 5KYTA 2GZ1A 3D81A 4FN5A 2NU9B 1T5IA 2OK7A 4QSMA 2AOUB 3ENWA 5T4HA 1TLFA 5A3JA 4ZOLF 1UDBA 1MVOA 3FPCA 1RLUA 3OMXA 1EX6A 3ANYB 1PJ2A 3L2OB 5IEBA 2IS1A 3NC1C 4HQ0A 1O87A 1J97A 3DFFA 4PPFA 4ADSG 1MAUA 4C3VA 1P2DA 3GEGA 2GD6A 5DI3B 2HYDA 3ST7A 2FQYA 4G0UA 2CE7A 2C1EA 2Y8EA 3CCBA 1TW2A 4ZIRA 3UF0A 3R1IA 3T35A 3B70A 3COZA 2FN3A 1TAGA 1AKRA 3RK4A 2Q6TA 4AAYA 4DW8A 4B6GA 4EPVA 3BA6A 1M1UA 4QELA 5AOVA 2WB2A 1DPGA 4RULA 1T8SA 4L57A 2I6QA 2B5OA 3TMKA 4EHNA 4U2CA 4Z86A 4CEIA 5EJFA 1GGKA 3AKDA 3RD5A 5A4KA 4O4HA 2BHSA 2GEKA 1Z7EA 3RBZA 1SUIA 4X85A 3E8MA 4MB0A 1UFQA 4GNRA 4ENVA 3GP8A 5TDHA 1LPBB 4DR3B 2PWBA 2BGNA 2FWAA 1HDCA 1CYDA 1FP1D 1TRKA 3FUVA 1N2OA 3PK0A 4IILA 4YJ2B 1ZA2A 5C1DA 1XKXA 5IC6A 1G2OA 1WD7A 3PLRA 2VP4A 5WRFA 2GEBA 2K4MA 2QP4A 1D6MA 3OPMA 4DGSA 4E12A 5L3ZA 1MPXA 2AIRA 2R1ZA 2CLDX 3VU8A 3VPDA 1WUYA 3PL1A 1XT6A 2Y67A 3I42A 1A5ZA 3WP1B 2E3JA 3U44B 2Y1GA 3QYAA 3UWMA 1MOZA 3GLIB 4ND1A 1MJHA 1DG3A 2RHRA 2ORVA 2HU5A 1W35A 2CNKA 3V7FA 1QIHA 2V45A 4PM4A 2DP4E 3VTZA 5BSKA 1JH8A 1ODLA 2R65A 4HNQA 5HJ7A 3WL7A 1FJXA 1JVSA 2X5OA 1WCIB 1XZAA 1TJNA 4V2IA 2C7RA 2P9QA 2Q29A 3A36A 3EFBA 4QOJA 3RIGA 4EFNA 3P2OA 2IBTA 2Y71A 5ALGA 2J6IA 1UBTS 3GAMA 4N0PA 2Z9DA 3K1AA 5U9CA 5TF0A 1NY6A 2Y4OA 2CKDA 3B7GA 3EEOA 2IBSA 2FZCA 1I5RA 2G07A 4AECA 4BNDA 2JLQA 1A7UA 5JHGB 3EZ6A 4QRHA 4B2YA 2AJCA 4MI6A 2ID4A 2W4QA 1YS4A 2PX3A 3TPZA 1W88B 4R7GA 4Y0NA 3U3XA 2ZSKA 2JARA 4OUDB 4UAUA 3VPFA 1RRKA 3SS7X 4QAJA 2YWJA 3BERA 1AA9A 4PHTA 2RHGB 3HA5A 1TC2A 3NOOA 3QHPA 5CITA 5EJ9A 1BD3A 2H4FA 2FDCA 4P4GA 3NJ4A 3RRZA 1JDUA 1T9HA 3LDGA 4HVCA 4RKYA 2X8WA 3IMFA 4MNTA 4RO0A 3CQ9A 2I4OA 1VRCA 2VWQA 3HABA 4GLFA 3ESZA 3B2EA 4H35A 4PS0A 4PONA 4OXYA 2OILA 4TWIA 1KDPA 1BE0A 2BN4A 2E48A 1UKBA 2BSAA 2YRXA 1M8KA 2H4YA 1IE3A 3CO5A 3SBXA 4FM9A 4FNAA 2GJ4A 2EGGA 4BKUA 4JLKA 3PFIA 4MQMA 3V8EA 3V4VB 2Z4TA 3AFNA 3WLMA 5TF4A 2H1LA 2ZSJA 4MS3B 1HNWB 4GW3A 4WNAA 5DWVA 3VAYA 1DSSG 4FDLA 3B6ZA 1F8UA 5L51A 2UYHA 2CVHA 3MHPA 4QECA 4C4OA 2G6BA 2BF7A 3ZJTA 1MEOA 2HPZA 2IV2X 2ZWAA 5KQSA 3VR5A 1M75A 3N28A 2E2WA 1DINA 4E5PA 3AZQA 3OKAA 3M4XA 4J2HA 1CQJA 4HQLA 1NW7A 2Q4DA 1V6CA 2YJ4A 4R2IA 4LRQA 4X7MA 4FFWA 5DXAA 2EP8A 4HEA1 2YMQA 5LWHA 1XO1A 2DPHA 4Z8XA 2PEZA 1NMSA 4YP5A 5ITZB 3V34A 1KSFX 5FFMA 1G6HA 2BYTA 3SR3A 2VYNA 1ICEA 2ACKA 4Y1RA 1ODCA 2C0QA 2D7JA 3KC2A 4NVRA 3UK2A 3VR6A 4UNSA 1SVUA 3L6RA 3UGJA 4OOFA 4YROA 5F52A 3NIDB 4AZ0A 3PHJA 4XR4A 2F67A 2CFCA 3OFSA 1BEEA 3FMVA 3VZSA 2ZI9A 1OH8A 1NHGA 1NNUA 4YFVA 3MLAA 4WX2B 4IO0A 2QRQA 1XA4A 1E6UA 1F60A 1GQQA 1NA5A 1Q7GA 1GQRA 4C6TB 2QD5A 4QUJA 1A71A 4Z51A 3F73A 2JF0A 2G72A 1LVGA 2ZQ5A 5I9TA 4KGZA 1E6LA 2EXXA 3VR4D 2C96A 5EP4A 3MTQA 3AB3A 1T34A 3K9QO 4AXBA 4G56A 4YQEA 3L43A 4YHBA 4P80A 4LF6B 2CKMA 3NETA 4E15A 1I6KA 2J6HA 3AERA 4V38A 5DIZA 2CZCA 1WMEA 5HCUA 3VR2A 3ZXXA 3WGVA 4E88A 5ESRA 3TBHA 3V46A 1THTA 1FTYA 3CJRA 5TPWA 4QG3A 2RHLA 5FWYA 2HRBA 3VO1A 3ZBUA 1II8A 1MQ9A 1RYYA 4HNSA 4A6XA 2LE0A 4AMZA 1OW3B 1SHZA 2D5CA 2YFQA 3PR1A 1R9MA 5KUTA 5KTOA 8MHTA 1SZPA 2EW8A 2ZJ0A 4FCVA 1PI3A 2VSNA 4HBGA 4DSOA 4C7OB 2YWBA 1WE2A 3D4LA 1GRCA 4PC2A 2CNDA 3MWEB 1C5KA 4NC9A 1K92A 4NZZA 1L4HA 5B3JA 1Z4MA 4IIGA 1OBVA 2GNAA 5JI2E 4RK7A 4RANA 1MR3F 5B3AA 2DCMA 4ES6A 5K4GA 2X1MA 1RJDA 2BC9A 3Q40A 2XE8A 3MJ4A 4GNKA 4TVKA 4F2DA 3GLFB 3ZHVA 2WKRA 4CLRA 1NVVR 4J75A 4UUBA 1NKSA 5JSZA 1Z07A 3U6BA 3RYIA 3FD8A 1HT0A 1HE1C 1OT5A 1TX4B 2Y6UA 3WWPA 1A9RA 3Q3HA 2PY6A 2VWGA 3BUKC 1ZNWA 3FPLA 3MIZA 4HRAA 4OMUA 4ZCPA 1Y4ZA 1S01A 1TU3A 4BNFA 4OB6A 3E7PA 1VM6A 4Q3NA 4CFSA 1WQ4A 3PBKA 5TQ0A 1KAGA 2QLJA 3ESCA 4RH0A 3C3XA 4GYWA 2YKGA 1XELA 2D0IA 3CINA 3A11A 5J2UA 1P7ZA 2VAWA 4Q18A 4N5LA 2XMQA 5FL7D 4I14A 4O02B 3RG8A 2UXCB 5JCOA 2Q6KA 1G21E 1QTIA 2W2XA 1S8FA 3MTAA 3BTOA 4FLMA 3DOIA 1QYCA 3BWEA 3D0KA 1L7AA 4JI8B 1XN4A 4OLAA 2C83A 4HDRA 3AHCA 4XDYA 4YV0A 5I8ZA 3KQHA 2QPAA 1CY4A 1TTQB 1NUUA 2CJXA 2P11A 1UKAA 5ECWA 3Q7QA 3AH8A 3GAFA 2PZ8A 3GLKA 2XE6A 4QXAA 1TNDA 3EH2A 4BV3A 4EL5A 5IM4F 4I5GA 4Y6LA 2YJZA 4Y98A 4PNZA 4WLOA 3IURA 3NMUF 3AY6A 4S1TA 5ECDA 5F7XA 4O5OA 2IPOA 5ED0A 5T7BA 5CEEA 2JFBA 1DV1A 2ZVQX 3OIGA 4Z3DA 3A4IA 4MJ7A 2F48A 3ZHZA 4Z4QA 1R00A 3NNDA 1ISPA 1HLGA 4Q3AA 3MELA 5BMVF 1E6MA 1K8YB 3EIEA 5AM5A 5AVRA 4KIUA 1SC9A 2EFCB 3ETCA 3GLSA 2G4VA 3SQLA 1Y8CA 1DRKA 4BLQA 4EENA 4F86A 3S6JA 4OP1A 4KLNA 4M46A 3T5CA 5B6JA 4TQ9A 1C4OA 1VE1A 1YJAA 2IXGA 2QIPA 3KOUA 3KSMA 3VSCA 3OKPA 2I80A 3CEJA 4GVLA 4GU5A 4BO5A 2EJVA 5CYOA 4D5EA 5KDOA 5KVVA 3O8CA 3COJA 4IX9A 3LBYA 1PN3A 3W8NA 1QXSA 2VF8A 3A3YA 3QE3A 4YRJA 3VYTB 5E8JA 3WSWA 4BRSA 5C7YA 3FYTA 2L18A 4PZCA 4QPDA 1KTIA 3VSDA 2ZEJA 1TUGA 1KQOA 4YLEA 4S0ZA 4LSGA 4U7WA 2DWQA 3WQQA 5CB8A 1C7ZA 4WXRA 4RV4A 4YRNA 5HUQA 1UOEA 4G63A 5L6LB 4V0KA 1JEJA 1MRZA 2Q4BA 2R00C 2QWXA 3BILA 3GPCA 4HL6A 1K8ZB 4II2A 2NZUG 1E98A 1RLMA 4IFBA 5JATA 1FC0A 3COSA 4YALA 5JS8A 4K6FA 2WJ4A 5L4SA 1R6VA 4B43A 5KVAA 1JG3A 4Z53A 5CA0B 2UZ4A 1NVVQ 3N75A 4FWBA 2QMYA 4YACA 1FFDA 5ELLA 2JG3A 1UKZA 1TM4E 2J4DA 3IUBA 4MYUA 4U6SA 1ZR2A 4PPGA 2A9VA 1STOA 1XZEA 3W4IA 3P9RA 3O91A 3STTA 1IL0A 4ERNA 4HWSA 3TOVA 521PA 1RRGA 1IOZA 4F4UA 2BCJQ 4DDUA 1W5FA 3ADKA 4QASA 3ZWYA 5BORA 2A4KA 2V7XA 2XUHA 3BH6A 4RE5A 1JN0A 3FRIA 3ZZTA 2H5IA 2OD7A 5EE9A 3KJEA 3SLGA 3FFAA 1U7DA 1GT6A 2DQKA 1WBBA 3E9QA 3NCTA 4OGWA 4BYMA 3ZHQA 5K8UA 4KB5A 3S8EA 5IJ0B 1T2VA 1Z5NA 1W6UA 2BFAA 3F71A 4JROA 1CRQA 2PKWA 3K4HA 3F97A 1J0XO 4H7HA 4Y9UA 4ZVNA 4G1VA 3G2IA 4MP3A 4F4DA 3A6EA 3HY3A 5CH8A 2G4LA 2BP7B 1PEKE 3AOEC 4I9NA 1IUPA 2IJGX 1M9NA 5KAPA 1FUUA 1SVIA 1QYDA 4M0CA 2PQ0A 4MUFA 4TN5A 5CW2A 2MTBA 2IV7A 3RYFB 5CDFE 4XDGA 5HQ3B 3TOXA 1JPVA 3HVUA 3IUMA 2XLBA 4EKNB 3CN7A 4TUYA 2WAYA 1HE2A 3MCWA 3V2IA 1MW8X 1FLVA 5E95A 3CZMA 1K5HA 4IMRA 4LXYA 4WIAA 5CCBA 3H2HA 3N0XA 4RAQA 1NU8A 3SHVA 2GXQA 4JASB 4XRGA 3Q8KA 3KZCA 1CDOA 3TW8B 1YCFA 1OHHD 1GTZA 2YYZA 3KYCA 1WBDA 3ZOZA 1AKYA 4CM9D 4C87A 2ZCJA 3N05A 5KU7A 1J70A 4I4TA 3D7KA 1OXKB 2PR2A 2WTAA 3Q9NA 3KYDB 1SXGA 1T1GA 5E6UA 4IHJA 3UHJA 4M8LA 4HADA 2BSQA 3ZDDA 3N7UA 2R9VA 5E3IA 3AHDA 1U8XX 1XAJA 3ACBA 2Q3HA 2YV4A 4RJ2A 2J0UA 3LHFA 1ULSA 1O5TA 1XROA 3KO8A 1UK8A 2W5UA 4IEFB 3U31A 3UKOA 1LI5A 2ZOSA 3GZNA 5E0OA 5EPUA 5K09A 2OFOA 1MO5A 4MEBA 3JYPA 5CW1A 1WEKA 1OKKD 1UOPA 2ONZA 4D9JA 4I81A 5K2MA 4D45A 5GM1A 3DZFA 5E1OA 2Z6UA 1VSTA 2CHGA 5A9SA 3IT3A 5JVDF 1TVMA 4AN0A 4S3MA 3K0BA 3CUSA 1DUSA 3L7LA 5E4TA 2OPBA 4KXMA 4BZXA 2NYVA 3A4MA 5B57C 3JYNA 1US8A 1AKQA 3KXKA 5F78A 3WGNA 3X2FA 5JXGA 3P9XA 3C41J 5JALA 1YR3A 5B4UA 2VQ3A 2UZIR 4K9NA 3ZCRA 1AHPA 2HHAA 1YZ3A 4AUMA 1HQDA 4DA4A 3BJRA 2IT1A 3Q10A 4I9GA 4OHZA 2JCSA 3GNTA 2XNDD 3PHCA 2GKOA 1C9NA 3WIUA 4YV2A 1Y6RA 1XTUA 3EDQA 3F4LA 2H7CA 3ZU4A 3CT6A 3EIHA 1YOVB 1EE9A 4D3SA 2QQGA 2HTEA 1ESNA 1TU4A 5KYKA 4B6EA 3WWDA 3SAJA 4O4JA 4UHJA 1NF3A 5LYJF 2BGWA 3C6YA 2DPXA 3BYZA 3UCEA 1LA2A 1DAIA 2IF2A 1Y81A 3GAAA 1L4BA 1H93A 3ZQ4A 3A1CA 3WNZA 3VKGA 4I1SA 3MF4A 4NNJA 4QWMA 3G0DA 3K20A 3SX2A 1PJ8A 3TLJA 4HGYA 2JCVA 3MAGA 3NI2A 3OPNA 5AKYA 4XIIA 4LRYA 1F9EA 1K06A 2PBLA 2FRVA 3BL8A 1GQFA 3EGCA 3JQ8A 3FZNA 4U7HA 4EHBA 1P6QA 1GZ4A 3D3NA 1J39A 2ATXA 2HCJB 2NUPA 2QW1A 1U1EA 3M6FA 3QBJA 2EX4A 4P38A 5EQJB 5BN4B 3VKWA 4GUAA 2NMVA 3DNMA 4NFYA 1XR3A 2HLPA 2W7TA 2BI8A 3GGSA 4KGXA 2BGRA 1RXIA 4OL0A 1BXRA 1IHXA 4N76A 1TUEA 3EW7A 1K2WA 4NQZA 1UBEA 3WMFA 4BNIA 3MCVA 1FMFA 4PCVA 3SVTA 3DVLA 3GLHB 2ZPUA 2HF7A 4G4SO 4ALIA 3KU1A 4QSHA 2HRCA 1A97A 1U9JA 4HLUC 4QDXA 1V2GA 3PRKE 5B3LA 3TVDA 4QT0A 4EHLA 3CF4A 3K7EA 3I5YA 2JAWA 2DFLA 4JLWA 1VGVA 2V7PA 3PUVA 5AKKA 3WAJA 1KQNA 1SURA 3L4EA 3WADA 2O20A 2CHUA 4I8IA 3WICA 1IM8A 1CY2A 1KYQA 1NR5A 3AERB 3RYCB 1HQYE 2IV3A 3WFJA 4LY6A 2VNKA 1N3BA 2QEQA 1UWVA 3A1NA 2O2YA 2ODQA 3JQAD 3O31A 5KWJA 3LQKA 4PZ9A 1DO8A 1V9CA 2LD4A 4TS9A 3ZJVA 1PZHA 2FZGA 1XPUA 1OLXB 3STUA 4Q4AB 4Q9AA 3ZGXA 1P74A 1N7HA 2HPAA 3MT9A 3PEEA 1RCUA 1YE8A 5KINB 4CTOA 4GAEA 3BQMB 4AMGA 4JB0A 2KBEA 5M04A 3DEIA 3HRIA 1B74A 4WT7A 4HNAA 3ZV5A 5CLQA 1IBCA 3IL2A 1NT4A 3RRXA 4DF3A 2G1PA 5IKXA 2EARA 2D00A 4KDEA 4UMFA 1Z0AA 3ISTA 4PSDA 2QI9F 4FOTA 5EWLB 4X8HA 4BRZA 3E81A 2ODEA 2UVPB 5IAJA 1HOTA 5BXYA 4TMTA 3GLHA 1KC3A 4IFEA 2O2ZA 4PPQA 1CJVC 3WB2A 2EKBA 5DTMA 1QG6A 4FWIB 4Q34A 3VJMA 2OG1A 3QVOA 4QJBA 2QRMA 7MDHA 4KUHA 1HFKA 1I3MA 1E79A 1XDWA 3QELA 4K0RA 3SZMA 5HZHA 2VSXA 4O1IA 3OCUA 2PZJA 1C8VB 5E1BA 4CM1A 4XWKA 3DVSX 5C46F 5HX7A 1UP6A 2JFVA 1XE3A 4NONA 1A72A 1XTPA 2H29A 2VRNA 3VDQA 2G0AA 2QU8A 4C06A 1E9SA 1Q44A 4QBFA 4BATA 5F2NA 5HPYB 2HQOA 2I29A 4X7RA 4UFPA 1SPXA 2EIXA 1CUBA 3PE6A 2WJAA 2WHXA 3OSZA 4YR9A 4D4IA 5LFAA 4C07A 1XMIA 2RGGA 4CT5A 1ADBA 4NE2A 5G1PA 3NYWA 4Z9XA 3A32A 4N47A 1XFAA 2WA2A 2ZUBA 3RC3A 3B3GA 4KXUA 1TZKA 2AEMA 3ER9A 4PHCA 3PNQA 1DUVG 3JVIA 5ALQA 3R8XA 3HGMA 2RHJA 4J2TA 4LJSA 4IUDS 5JVDA 2ZUFA 2PRZA 3FNEA 4C05A 2SCUB 1RDFA 4L51A 3KCNA 3OLVA 1TCAA 4QNRA 2C4UA 3IHWA 5H16A 2VSFA 1E1MA 4QM7A 2CVQA 1YRAA 1QU3A 2Z3ZA 4Q7LA 1RPJA 2JFGA 4INJA 2WZBA 3HCAA 1UKEA 2OLEA 3JSXA 4XVHA 2XQIA 4ZT3A 2WFAA 3OWHA 4MZDA 2NU6A 2FX2A 2B35A 2FSVC 1JFVA 3SEZA 4KG7A 4URWR 4ZXPA 1CQZA 2ZBRA 5ALLA 2AUTA 4V3BA 1DEKA 4JP2A 3UJ7A 3VOBA 3KLOA 4YMHA 1SFRA 4DPLA 5AJXA 3H11A 4CMIA 4W5OA 2ZIFA 4WSOA 3FWKA 5B7QA 1E6CA 3JAMA 4MMXB 3GPDG 1ZD1A 2FWPA 2JKZA 5AXDA 1P17A 4DA7A 3EHEA 1TYBE 1IEWA 1NTRA 1OLUB 4HV4A 3HLKA 1GSHA 1L5MA 1REQA 3SU8A 3H2GA 5TSDA 4D8XA 1RCFA 5PGMA 3WKDA 4INOA 4D4LA 2YH2A 4Y3UA 2VDNB 2V96A 3NEPX 4L74A 2CD7A 5AHWA 4RQAA 1NURA 4E5MA 4OO3A 4N54A 4V02A 4PAMA 2GYYA 1KGDA 2H1VA 4YAJA 3N07A 1EZ1A 2VPTA 3LZ6A 2POCA 3LYUA 3LGXA 1DAPA 3RAJA 2EZUA 3R7WB 3HK2A 3O93A 2B21A 2EATA 2HX1A 5COQA 5AFSA 2ZUWA 3DHEA 3U9SA 2QY6A 1I2ZA 2PRSA 4I8XA 1WDTA 4KE9A 1DQYA 4XIYA 1NJ2A 4KO2S 3OG9A 3H7AA 4R7ZA 2J0QA 2WR8A 3E3NA 2WIJA 2OECA 2QF7A 1DT5A 2ZE7A 4MINA 3TQFA 2MT9A 2P9HA 4D42A 2CW5A 3JS5A 4ETMA 2B98A 5E3JA 2X2OA 1A27A 1X1BA 3WRVA 3W5HA 1OLSA 3IPYA 2HK9A 4JI3B 3TD9A 2AFRA 3H9UA 4F3YA 4Z4EA 1U2DA 1NX6A 5CNIA 3JATA 2YTZA 3DLHA 1W2HA 4A0QA 4ACBA 1ZZGA 4DILA 4XQ9A 2Y0EA 4NULA 5KJ1A 1O03A 1O0CA 1E2HA 3BWXA 2VNJA 3EBLA 3GT4A 3QJGA 1P62B 1T9GS 3TUIC 1VRWA 2QVXX 2QD1A 2R7NA 4ILEA 3AJDA 4Z3KA 2Q6LA 3QI2A 4R83A 4KGVA 3ROKA 1F8GA 5H0IA 4D26A 4EITA 2JKYA 3TNFA 4FSXA 2QV7A 4IIXA 2ZE6A 4Z0PA 4XLTA 4MUXA 1DCTA 4UBOA 3FVRA 1IPEA 4UOQA 1OI2A 1XDGA 3OPQA 1QGYA 3KPYA 1ESZA 1DBPA 2VCHA 3NKFA 3FDIA 3A1DA 4RVGA 4EYQA 4OI0A 2VWPA 2WJJA 4XJVA 1CUIA 1LS6A 1JWBB 1MUUA 2VRCA 4GGMX 2Q0SA 1KYVA 1IXYA 3KVNA 4JOBA 2WVGA 1UH5A 2Y2VA 5DMHA 3VR6D 4YO8A 1NT2A 2G09A 3DTVB 2J07A 2C4VA 1D4OA 2JCBA 3EXG2 2H85A 3QTLA 2Q8QA 3KTAB 3TVTA 4BP9A 1V96A 4CDNA 3FW1A 4B82A 1F2VA 2XB8A 3OC6A 2ZIEA 2B78A 3PTLA 4JP5A 2YIMA 4LXUA 4NKRA 5ANRB 1YR7A 2UUOA 4NZPA 1E1QD 3KZMA 1I5EA 1B93A 1KY2A 1PL6A 1ZM2A 2RJNA 3TQSA 5DM60 4H77A 4WNAB 1IEVA 4K46A 1KMIY 2P5SA 2HUPA 2QRJA 3Q6IA 3UMVA 2QN1A 2Q3JA 3CCCA 1P3JA 2SBTA 4PYJA 3GZNB 4NEHB 2K7ZA 5BYAA 5KNBD 1QRRA 4RMNA 2V6GA 4D6XA 3DB2A 4UTPA 5LR6A 2JIZA 1D1SA 1NRWA 4HOYA 1Q16A 2C31A 1X7GA 1WPGA 1WTCA 3H3XA 1W9MA 4IV5A 1NQAO 2ICAA 3WLSA 1UBSB 1HG0A 5BW6B 1X9HA 4I55B 2FUG6 1N7IA 2ZYHA 2JJ2D 3MXOA 4W7SA 4ZHSA 2V6BA 1AMOA 1QR2A 3L84A 4JVMA 2Z5FA 5JAPA 4BP3A 1Y9ZA 2FDRA 4G5GA 5BN5A 3QVUA 3NBYC 4KFCA 3KFLA 1P1FA 3A05A 4Q37A 3T7DA 3H2JA 2R5WA 5CT5A 3V42A 5I45A 1YC5A 1XQWA 3V7YA 2PV7A 4EJ6A 3LX6A 3DMTC 1RYEA 2HMUA 3LQ1A 5FPYA 5LNK6 1QPGA 3NHZA 1DTWA 4GYKA 4BFTA 1DJMA 3FIJA 1ZGHA 5LA6B 1LPOA 1BEZA 1U0LA 3UBTA 2Y1KA 3D8UA 2PA0A 1A8UA 4RTKA 5FI5A 3CUTA 1CIJA 4FFOA 1COWA 3PWZA 3EIUA 4HH1A 4YJ2A 5IF9A 5EYPA 2V97A 4G67A 5DEOA 3CWZA 3TLZA 1HLFA 4C7KA 4ZKDA 3FTCA 1O5IA 4FYPA 4AF6A 2DJ5A 4EPTA 2BGMA 4R68A 2GCEA 1ZRHA 3NFYA 3ICCA 5CUQA 2IYTA 1VSBA 1JXOA 3U4CA 3EW9A 1JKJB 4YRMA 3NBAA 5IH7A 4LW8A 2NZ8A 1O89A 1Q2UA 4DMFA 4LJ8A 2R8OA 5B6PA 1CY7A 1W96A 4BMPB 5HWSA 5I7HA 2ZSFA 4UHFA 2VHXA 5JBQA 3OQOA 2D1RA 1ZRSA 1U7OA 1TIBA 1G6KA 4G1EB 4JX8A 4M6WA 1JFLA 3UW1A 3ZYCA 5K0FA 2A0UA 3B1FA 4JLNA 2CV1A 3DKRA 1JDZA 3HNOA 1ZOIA 1GCGA 4I1VA 5FH9A 2ZLBA 1B2LA 3ZI7A 4ARSA 2QR5A 1G98A 3BXZA 4HDQB 4EY5A 5C81A 3L6DA 4CQJA 4HC4A 4ZYYA 1F7UA 1ZAKA 5BR1A 4U5QA 1RPAA 2IHNA 3DEHA 1RZVA 1DTSA 3SDZA 3FNGA 3QVMA 4FNOA 4B6QA 4HPJB 1NVGA 1FNBA 2AB0A 1QBGA 1N5JA 3VVBA 2OL4A 2ZM6B 1KDRA 3IT2A 4JJ7A 5FKJA 2BGKA 3MGCA 3N8IA 1P0PA 3L0ZA 2WUDA 1B00A 3AL0C 2ZKLA 1XX6A 1Z5ZA 2NUTB 3KKZA 4HWKA 1WQ3A 3PQEA 3PXUA 5LQMA 2R1TA 2GPJA 1E61A 2FPPA 5GWXA 3CW2A 1ML3A 2ONJA 1RYHA 1QKIA 1QK3A 4MQUA 5KTTA 4PBTA 4MYHA 2PD4A 1DKLA 2ORWA 2B99A 4II7A 1JF8A 1FPMA 4R84A 5ALJA 5JOQA 3B8HA 5BNWA 5C8YF 1SCJA 4J7UA 4LRUA 3ZNQA 4FFBA 5K0LA 1H05A 5D3KA 2EZ9A 2LPMA 2OV6A 1N5LA 3I72A 4HR7A 5K0CA 1TU0A 2Q0QA 4TTJA 1CZNA 2VBCA 4OQPA 4RPGA 1VE5A 1U4NA 1L5ZA 2HOQA 3BT7A 3PNVA 3FFBA 1SCQA 3C7KA 3K71B 3LP8A 2BFBA 3MYRA 5F64A 3H99A 4M87A 1W0KA 1ZCJA 1CE8B 2EHJA 1BOOA 4NH0A 1Y1SA 1P4HA 5K3FA 1U2GA 3JAKB 5FBQB 5LMNB 1QC5A 1HV8A 2FG5A 3ESBA 1WHTA 4QQNA 3NNNA 3HYSA 2E5WA 1GZHB 1D2HA 3WL4A 5AI5A 3OCCA 1XZPA 2OGSA 4DMHA 3ABRB 2YRWA 3R09A 1E8DA 4XVCA 4I9FA 3IQWA 1V95A 4U2EA 3VVLA 4WAUA 3TCXB 3ZY3A 4BU1A 1MQAA 5B1YA 3DTVD 2NUAB 1KPGA 1IC6A 5L9AA 2ECKA 1EEXB 4Y1RB 4JXXA 4HH3C 5JD5A 1KYXA 2XMPA 3NO4A 2V9PA 3BJZA 5CIWA 5IWCA 2C2KA 3WRWA 3K70C 1OA0A 3CUEF 2I7TA 5BUZA 3Q5DA 4F04A 1M2NA 3T7JA 1KH1A 4LZAA 4S1VA 3GCZA 3S44A 3AM5A 2UXDB 3IT0A 3F1KA 3NDPA 3OOWA 1ZKMA 1VIVA 3MTBA 1U3FA 1KQPA 3M3DA 5DGXA 4LCBA 4WKPA 2MSEB 1OASA 2WMDA 3TK1A 3K1YA 1KVTA 1PW7A 5DN6D 2QL9A 3E22A 2AEEA 3PYXA 1E9RA 3ET4A 3PDIA 1KDOA 4GMKA 4HAUA 3VPCA 3MLEA 3FWNA 2A9QA 4JUAA 3DAOA 2A92A 2QUJA 2AS0A 1C81A 1JLHA 4H0CA 3TE6A 2P6MA 4DLVA 2P3OA 4ILKA 1LXCA 1RM4A 1G5FA 1ZJ5A 3GLVA 4B8ZA 2QVLA 2YRFA 3ENVA 3GELA 2H59A 2XB4A 3S1AA 1L8QA 5AHRA 2XODA 5FP0A 2C42A 3FSGD 4YRRA 2CXOA 1BQEA 4HVAA 5AOAA 5SZHB 3S2UA 4RY0A 2H4XA 3KVRA 4URVR 2F59A 5LXTA 2EBWA 1OF1A 4RPLA 3JVUA 3UV6A 1YFZA 3H5OA 1FTQA 5SY9A 2CCKA 1E64A 4IH1A 5IUNC 7YASA 2BR5A 3IT1A 1ZN9A 2HFJA 2O6LA 2ANCA 2WHPA 5TMDA 1W25A 1MABA 1X1AA 1KZ1A 2C5GA 1WVIA 2PG3A 4FDTA 3PPVA 4FK8A 1Q7CA 1KDTA 2P62A 3LDFA 2O7QA 3CZQA 1H2FA 3T0GA 2CYAA 2J9YB 3H5LA 1F2UB 1MG5A 1EFLA 2J4CA 3LK7A 4TZKA 3JQBA 1KSGA 4U00A 1X39A 3ANSA 3A0RB 3I2JA 1SC6A 5NULA 4RIIA 1Y9DA 1MLDA 2G1JA 3M5CA 1JAYA 4CG3A 3PCXA 3P0HA 3UPDA 3GVCA 1EDDA 5JZBA 1PQWA 1GCUA 1O2DA 2DH5A 2PMDA 1PJZA 2WSIA 3FWHA 4LJ4A 4Z9AA 4NICA 3SHOA 4CMBA 5KOHA 4B47A 1FIUA 1QORA 3R0VA 4R31A 5B4VA 4XPZA 4Y9TA 3WWEA 2XZLA 3LO8A 3EB9A 4RACA 2DR3A 1ZA1A 2NSLA 5KZMB 1AKEA 3GPBA 1JR3E 3DUWA 3HXKA 4KYIB 1OXBB 2JIZD 3DFMA 1E9DA 1DOZA 3AF1A 2XRMA 3AJEA 4I0WB 4TMWA 2LR0A 3LCJA 4J3NA 2P9GA 4GG1A 2Q9BA 1VLZA 4X1YB 3IKJA 4AYWA 3TJRA 4ZVLA 4CMEA 1XZDA 1Q1ZA 5C37A 3EYWA 1UBOS 5DN6A 2JJQA 3DE5X 4DQLA 5FYDA 1QHNA 3SK0A 4LMBA 2PL3A 3DE7X 4LFAB 3FPEA 5DX0A 3JQFC 4JLSA 4WASA 4E2YA 1PW5A 2VK2A 4Q4AA 2H63A 3EF1A 2AA3A 5LIRA 1ORRA 3CR7A 4X84A 3PGKA 4JX9A 5ARDA 2ANBA 1EP3B 5JCJD 5IT9A 3M6XA 4PCAA 4I50B 4LFBB 4K6GA 2QK4A 4PZZA 4HJXA 3QXCA 3ZW7A 3QRWA 4OQZA 1EFPB 1YBAA 3A06A 3SQMA 2H17A 3E9CA 3K31A 4LK3A 4OBWA 4HEHA 4NJMA 1MNQA 3MJHA 1G41A 4BMCA 3ABZA 3CUWA 4O2BA 2QRGA 3CZCA 4B3RB 2ZETA 4OHCA 3VR3D 4I4TB 5I9BA 2XMGA 3IEVA 2HWWA 1GUYA 4NPHA 4BHTA 3MMNA 1FDUA 1Y3BE 1C3EA 3SF0A 4DQXA 1DKQA 1DAEA 2BFFB 4PO3X 4JVSB 4IHJB 2VNAA 4ZAWA 3OSUA 4TV8B 2EGUA 4BNGA 4H1UA 1ORIA 3O90A 3QVLA 2R00A 5KTPA 2OHOA 4XH9B 2H54A 3WIOA 1U3UA 2W6NA 4TSFA 1XGKA 2B7CA 4ZQHA 2HSGA <