2E4UA

Crystal structure of the extracellular region of the group ii metabotropic glutamate receptor complexed with l-glutamate
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
538
structure length
512
Chain Sequence
RREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDNYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNICIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAANRVNASFTWVASDGWGAQESIVKGSEHVAYGAITLELASHPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQCSLQQVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPQTTKLCDAMKILDGKKLYKEYLLKIQFTAPFNPNKGADSIVKFDTFGDGMGRYNVFNLQQTGGKYSYLKVGHWAETLSLDVDSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYLVDEFTCMDCGPGQWPTADLSGCYNLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Metabotropic glutamate receptor 3
publication title Structures of the extracellular regions of the group II/III metabotropic glutamate receptors
pubmed doi rcsb
source organism Rattus norvegicus
total genus 160
structure length 512
sequence length 538
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
A PF07562 NCD3G Nine Cysteines Domain of family 3 GPCR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.50.30 Mainly Beta Ribbon Tumor Necrosis Factor Receptor, subunit A; domain 2 Tumor Necrosis Factor Receptor, subunit A; domain 2 2e4uA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2e4uA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2e4uA01
1ZHHA 4XXHA 3OLVA 1QPZA 3A0RB 3Q15C 2CD7A 5B3JC 3UK0A 4EVRA 3MQ4A 1MVOA 1GCAA 5IX8A 3DZDA 2PLNA 2R48A 1XHFA 3A0UA 3LFTA 5KQMA 1DP4A 4MQFB 2LIVA 3UKJA 2XDYA 3D02A 2JBAA 1QP7A 1ZH4A 3N0XA 1K68A 1EHCA 1L5ZA 1ZGGA 5T3YA 2PKXA 1ZGZA 3RVMA 5BR1A 3LKVA 1QO0D 3R0JA 4RZSA 5FWYB 1D4ZA 2OENG 3SG0A 3TO5A 4MR8A 4RXUA 4XAQA 1BAPA 5C5CA 4W5TA 2BGGA 2ID9A 3MF4A 2CHFA 5FWXA 5IUKC 3E3MA 3OLXA 1KRWA 4TN5A 5EWLB 4LZLA 4MYRA 1E6LA 4RK5A 3HO1A 3EQ2A 3OMWA 2E4YA 3Q41A 4Z4GA 4Z4EA 1SXIA 1DCMA 1M5UA 2NZVG 1FQWA 2PUCA 1IIBA 1TLFA 4Z0NA 1U0SY 3IP9A 1TM2A 5F64A 3IP7A 4LE2A 2N9UA 3O74A 3F6PA 3HDVA 5CNMA 3M9WA 2HQOA 4MS1A 2MYPA 2B4AA 3LUKA 4JB0A 3QEKA 1NXWA 2WWVD 2IKSA 4Z9AA 3MMNA 4ETMA 1E2BA 4WXEA 2PMCA 4RK4A 3QEMB 4MQEB 4RY8A 2FEWB 4WXMA 1PUXA 3OM0A 3QX8A 3GBVA 4MR9A 2AYXA 1JFSA 1QP0A 2LUOA 4IMIB 4TLMB 2JVIA 4PE5B 4YCSA 5KQGA 3LMKA 5KQLA 2GI4A 5EWJB 2MSWA 4PICA 4KZKA 3M6MD 4HNQA 2PL9A 5JNSA 2PE5A 3CU5A 3IP5A 2YHAA 3O21A 3RVJA 3F6CA 1DCFA 5CNIA 1RZRD 4TMYA 1E6KA 4MR7B 2NT3A 4F06A 2PJUA 1DZ3A 3S99A 5BQ3A 3MIZA 1ABEA 3RH0A 1DRKA 2QV0A 4DQDA 5TE9A 4YWHA 2V0NA 2ID7A 3HZHA 5HSGA 2MYUA 4G0OA 2PUGA 2PUDA 2O20A 3A10A 1GLGA 2RDMA 2MSKA 1CHNA 1YS7A 2H0AA 4MS3A 3KS9A 2LP4Y 3OQOA 1CEYA 1SD5A 3RVSA 1EWTA 3FMVA 2CHEA 3M9XA 4O1HA 4RK6A 4XLTA 1LK0A 4ZJPA 2A9PA 4YLEA 3CG0A 5BRJA 4YR7A 2W42A 4MGEA 4WZZA 2FW0A 2RGYA 2NZUG 3CS3A 9ABPA 3H5OA 3HVRA 1ZESA 3EODA 3I09A 3QELA 2FSPA 4UHKA 1M5TA 3KLNA 3RVRA 3GA5A 3H1FA 3TX6A 4ZYLA 1KMIY 4F3TA 2LPMA 4RV5A 4H60A 3H6GA 4S05A 1F51E 3SAJA 1RZRA 3NNSA 4ZPJA 4NV3A 3QK7A 3MA0A 2FQWA 4JP1A 1PEAA 1ZITA 4GNRA 2HQBA 1DBWA 1Z2DA 3OLYA 5IUJC 4NCAA 5GOTA 2QZJA 4YS6A 4LE1A 1UDRA 4OTZA 4MS4B 2M98A 4ETNA 3EGCA 3EAFA 4ETIA 4Y9TA 4RS3A 4KFCA 2FLWA 4CBVA 5E3JA 1W9HA 1VKRA 4RXMA 1QQAA 1DG9A 4O5AA 3LTEA 2HQRA 4P1ZA 1WETA 1AB6A 2LBPA 2P9HA 1VPWA 4D6YA 1RPJA 4IILA 1ZAYA 5JNRA 4WT7A 1RNLA 3DLHA 2IPLA 4GPAA 1QP4A 3QLVC 5TQ0B 2FMIA 4P98A 2WY2D 1JX6A 5TQ2A 1QQBA 1ABFA 5KWSA 3K4HA 5CNJA 1EFAA 4L85A 5TPZA 3C3WA 2JB9A 4Q6WA 4QICA 3RVOA 2QU7A 3BILA 4KK3A 2VUHB 4ZMRA 5IULC 2Q5CA 4MAAA 5CHYA 4G0XA 1B00A 2GX6A 3CG4A 2FTKE 4DN6A 1A2OA 1MIHA 4LDAA 4WUTA 4KPYA 2IOYA 3GWGA 1PHRA 3KHTA 4UHJA 5B3JA 4MQFA 1YMVA 3L49A 1FFSA 3H5TA 1D5WA 2ZWMA 3H1GA 3JPYA 1JH9A 4MRMB 1W25A 2HPHA 3RQIA 3TD9A 2VK2A 5FWYA 3RVKA 4RK1A 5FWXB 3QLUC 2MYNA 2ZAYA 2WB4A 5JNWA 3EDCA 8ABPA 1E6MA 2FVYA 3BRQA 3DGFC 4YV7A 3GL9A 4IF4A 1VLZA 2FKAA 2X7XA 4RKQA 2CWDA 5EWLA 1MAVA 3W9SA 1SXHA 3GYBA 5BRAA 1MB0A 4XARA 5TQJA 3HDGA 3H1EA 1DBQA 3H5WA 4L4UA 4RK0A 2QXYA 4EVQA 4DADA 4LRQA 2NT4A 3I5AA 4FE7A 3CZCA 3KCNA 1QKKA 4MPTA 3HM9A 3T95A 4D74A 3IPAA 1NY5A 1EWVA 1FFGA 3DBIA 3LUDA 3KLOA 3O1JC 5GQSA 3ROTA 1VRVA 4M88A 3QEMA 1MB3A 4OATA 4LX8A 3Q9SA 4RXTA 3HUUA 3HJFA 3LUCA 4EY3A 1YVUA 2L19A 2QVGA 3IDOA 1K66A 3NNDA 3KTOA 3FFTA 2E4XA 3H5LA 5KC9A 2MYTA 1OXKB 3GRCA 5DTEA 5EWJA 5HKOA 2DRIA 3C3MA 1NXOA 4KQCA 4NICA 4MLDA 3HEBA 4QYWA 3L6UA 1JWLA 2I6FA 3ILHA 1D2AA 4G0MA 1NXTA 2IPAB 2WJWA 3H5VA 1PNTA 2FEPA 3O75A 4JA2A 3TMYA 3NNNA 3N53A 3SM9A 3HSYA 2FMKA 1NXVA 4Z4CA 4MS3B 5JS2A 3DGEC 1BA2A 1L5YA 2M1ZA 3BREA 1NTRA 2YHBA 2QR3A 4Z9BA 1BDHA 5KI6A 3JVDA 2FEKA 4EUKA 3LUHA 2JVJA 4NQRA 4PYRA 3E61A 4IGAA 3KJXA 3Q7SA 5KQPA 3URMA 1JFTA 4KQ9A 3EJWA 4EGSA 5TPZD 3O2JA 1Y1LA 4YRZA 2VUIB 1APBA 1YMUA 2GBPA 1M2FA 5KC8A 2WRZA 4IRXA 1GUDA 2R25B 2VYCA 2R47A 1Z15A 1C4WA 3SY8A 5JS1A 3N8IA 4MLCA 3BBLA 3OM1A 4JB2A 1JBEA 3KG2A 1TVMA 4KNYA 1NXXA 1A0OA 4E7OA 1HEYA 2PL1A 4HNSA 1JFVA 1TJYA 4W5RA 1BVHA 3OQNA 4RU1A 6ABPA 2FXIA 3KKEA 4G86A 1PNRA 1SXGA 3D8UA 3G85A 2E4VA 3CZ5A 4HYEA 4N0QA 4PEVA 2H3HA 3JPWA 5CNKA 2IDMA 3B2NA 3HS3A 3I42A 3LOPA 3RVPA 2KYRA 4NCBA 1USGA 3CKMA 5EWMB 2F8TA 1JYFA 2QW1A 1RXIA 3FFWA 3OLWA 5C5EA 3DLBA 3O1HB 4RY0A 2PUEA 3GT7A 5TPWB 4KMRA 4KRFA 1A04A 3C3KA 4RWEA 3FDFA 4EYOA 3NBMA 4G0PA 2FQXA 1RXEA 3CNBA 2OQRA 4OLBA 3EULA 4WWHA 5TQ0A 1C0EA 3N0WA 4QYMA 1ZVVA 4F11A 4W5QA 1XHEA 1F4VA 1ZH2A 3O2QB 4EYGA 3LUFA 2MSLA 2JBAB 3NHMA 1P2FA 4N47A 2WMYA 3A3KA 4S04A 1CYEA 3P9YA 4IMJB 3T38A 1D1PA 1LJUA 4JOQA 1BDIA 3C6QA 3FFXA 5IC5A 4Z99A 3CTPA 3CHYA 1URPA 3H75A 1Z26A 5IUNC 4MR8B 2IPNA 1DC7A 1LJLA 3IPCA 1GUBA 1R8JA 2A9RA 4KREA 2E4WA 2E4ZA 3O1IC 2IYNA 4Q7EA 1USIA 1JYEA 3G1WA 3CRNA 4MRMA 1QNLA 1LBHA 3LUAA 1J56A 3H6HA 3OO1A 4F12A 2B1JA 4OG2A 1EAYA 2E4UA 1Z25A 2JRLA 3IP6A 3KYJB 1YS6A 1T34A 3CLKA 4KV7A 4MS1B 4EVSA 1JDPA 3Q7RA 5DGCA 1Z12A 4YGXB 5JNVA 3QLUA 4FB4A 1DCKA 1U2PA 3H5IA 5IEBA 5FBKA 2L17A 3JS5A 4YP9A 7ABPA 1XWWA 3OLZA 3BRSA 3F7NA 4MR9B 4LE0A 1U04A 4MQEA 5PNTA 3VNAA 5DKFA 4ZMSA 4KK4A 1NXPA 2FMHA 2PUAA 1U2QA 1FSPA 3UUGA 4Z4HA 3N6VA 4N03A 2QSJA 4Z4FA 2GWRA 4RSMA 5ABPA 4H3HB 1ISRA 4XASA 2RJNA 2NUBA 4N41A 3HV2A 1M2EA 3LKBA 1KRXA 1DBPA 3QX9A 1QO0A 3FGZA 3HUTA 3LUGA 4PZ0A 2P4UA 1NATA 3VNBA 2L18A 2FLKA 2JK1A 3C97A 4MR7A 1JDNA 3OMXA 5JNUA 3GV0A 5IEJA 5ED4A 3HCWA 1P6QA 1ISSA 3K9CA 1S8NA 1SRRA 1Z16A 1DC8A 2HSGA 3LUJA 4G0YA 4EYQA 2A9QA 4ML3A 1AB5A 1YTUA 1ZDMA 2FN9A 5T7BA 4E7PA 2TMYA 3CFYA 3RVLA 3EQZA 3Q7TA 1D1QA 4RDCA 3SNKA 4F8JA 5HM6A 2JCGA 1GCGA 1P8AA 1ZY2A 5D2CA 3T8YA 4Q6BA 3QELB 1Z17A 4G0ZA 2HJ9A 5I4CA 4W5NA 3JVIA 4EYKA 1H9CA 4G97A 3HXMA 6CHYA 1JLKA 1EWKA 1PEYA 2RJOA 1BDJA 4RK7A 2IPMA 1Z18A 3GBPA 1YIOA 1NXSA 3N75A 3RVQA 1OXBB 2WJAA 1DRJA 2PUBA 4O1IA 4D6XA 3OO0A 3ILYA 4JAVC 1TMYA 3JY6A 1JL3A 1P6UA 3JTEA 1KGSA 4YO7A 5JNTA 3NHZA 2J48A 4B09A 3MYYA 3KSMA 4FE4A 4JASB 4H3KB 2AYZA 3O2SB 4HNRA 1JHZA 1I3CA 3MM4A 4XFKA 1YK0A 1Z2EA 4MS4A 1DJMA 2PUFA 4OLAA 4RY9A 1QMPA 4LDZA 3HK2A 5HQJA 2FN8A 4TLLB 5DCLA 4N0PA 3F73A 2F8SA 3KYIB 4KVFA 3RVNA 2JVKA 1YK1A 3I45A 1U8TA 3OQMA 1ZN2A 4OBBA 3SQNA 1USKA 4RKRA 2L2QA 1JF8A 2R4QA 3TB6A 1LBIA 5TQ2B 2QVCA 5EWMA 5IBQA 4N76A 5DLEA 4QPJC 2PAFA 2GKGA 1Z13A 2FQYA 5FBHA 3N0RA 3ROFA 1FFWA 3QLTA 4G0QA 5TPWA 4Z4IA 4W5OA 2A9OA 2FMFA 3QLVA 3T6KA
chains in the Genus database with same CATH superfamily
1GTZA 3AUUA 3PDUA 2OWEA 3R6LA 5CXXA 4HJRA 3RYIA 1YOVA 1IJBA 4BB9A 1L0BA 1X80B 2O6HA 3A8TA 4KZPA 4MKHA 1DWUA 3D9QX 2OPHA 4EPTA 1RYEA 1H2AS 1C8LA 3FD8A 1G7CA 3HABA 4AZ3A 2WP8J 3PE4A 3ZY5A 1QB8A 4AUMA 1TAHA 2I1VB 3ELWA 1XRPA 4XX0B 5F4BA 3WK5A 5F33A 2XDYA 3AF3A 2ZWVA 3D02A 1AE1A 3ZQ6A 2BM9A 2YDYA 4IICA 2WAYA 3A9VA 4ME6A 5LB4A 5T3YA 1PD1A 2ADMA 4FLEA 2EERA 4IVPA 1NJGA 1D4ZA 3GGOA 4KIUA 5CUQA 3LSYA 1FYXA 2Q45A 4F3NA 5K3OA 3CT6A 3FLMA 4UAJA 5C31A 2FWBA 1S89A 1NG1A 3FSJX 3M2PA 2VJCA 4LZLA 3AKEA 4JEIA 3VSDA 1FLVA 3RUCA 4FFVA 2B94A 3EEFA 3Q8KA 1YZ3A 2A0YA 4OA8A 1EINA 3F4KA 1UIRA 2CHUA 2EZTA 1HDCA 1O6CA 2Y1CA 2Q6LA 3MJRA 2J5QA 2HRZA 5F64A 1JLMA 1A27A 3ORHA 5FUWA 2ZR7A 3S1AA 3PT5A 3T7RA 4CYMA 3O74A 3U1BA 1KI6A 1EESA 1E1QA 3GLUA 3L7DA 3SCZA 3WGNA 3EEBA 3TTVA 4NEGA 4ZTUB 3OF2A 2ACWA 3TLAA 1BHO1 3FKSA 4JXJA 2P90A 3ZJ5A 1OA1A 4IGIA 2GTIA 3A1VA 5AK4A 3CLRD 3IT1A 5DNAA 3L1UA 3LIPA 3PFNA 3RS5A 3IEIA 3EX7C 1QIDA 1DHRA 2IUTA 2XWSA 4RTNA 2DPLA 2QJTA 3MJCA 3N0VA 5I9LA 4F9FA 2D13A 1PV2A 3RC8A 4I6EA 4DLKA 3AFNA 3A04A 4IVRA 2PL9A 4NC9A 3H83A 3HGTA 4IJ6A 4XIJA 3TD2A 4LK2A 3F9CA 4UE6A 3K0FA 1M1YB 3QE3A 3S0JA 1UFRA 1C7JA 2IY7A 5YASA 5IXJA 3ZLJA 4KN8A 2D2XA 4R9RA 4EO9A 5K8JB 5KQRA 4B3RB 4GT1A 1EWRA 2V0NA 2Y1DA 2YXBA 2M6KA 1QLWA 3UMSA 4ZYTA 3HZHA 2NMVA 2MYUA 5JMPA 1PL7A 1TYCA 4S0ZA 1IEVA 1OWMA 1Z33A 1CV2A 4MS3A 2MSKA 1CHNA 2X1MA 4G5RA 3T35A 2YWFA 4RGBA 1U0HC 2VDLB 4BFUA 4E5SA 4REQB 4B3IA 4RK6A 4L5YA 2YH2A 1GQ2A 2UZ1A 4KQHA 3CG0A 4OYHA 1E3JA 1LI5A 1R64A 3R5SA 4QDXA 3RRZA 2FW0A 2VJDA 4EHLA 3R3ZA 1EQAA 4LBVA 1M10A 1N2JA 1XRLA 2EW2A 3SSAA 1T5OA 2DFDA 1NF9A 2YYZA 4I55B 4J0EA 3EZ2A 4R3UC 4C22A 1B4DA 1DPFA 3I76A 4DGSA 4ERNA 3O9VA 1EX9A 4PYJA 4QXRA 3H6GA 4GPIB 2R97A 3KJNA 2HDOA 4ZPJA 2OL4A 4K9SA 4UHCA 3WYCA 1RI4A 3GMIA 3B7GA 4EHNA 4F4FA 2HKIA 3GH3A 1MD9A 2HQBA 3OP1A 4FFMA 5KHAA 5EE3A 5B6JA 1JSXA 5FR2A 5I7WA 2POQX 1RW4A 1IQPA 4LHYA 2W2LA 4EF5A 3LCCA 4ZCTA 1EG2A 2XUOA 4WZBA 4O3MA 3UWOA 4CT5A 3EN0A 4X8MA 4ZQHA 3FRIA 4DV0B 3OJOA 2QM0A 3EUWA 2PX4A 1YGYA 2W93A 4KU4A 1OH8A 2FLWA 1C3VA 4PXYA 4B4KA 4RETA 1K6IA 1V95A 4IGEA 3CVVA 2QX8A 5FWAA 1MGPA 3WS7A 5F7JA 2AC7A 2HCBA 5LOVA 2I6GA 1WXQA 1O8CA 2HX1A 2P9HA 2CVQA 2ZBUA 3A1CA 1NPYA 1FDRA 4YRIA 3L1VA 4CKBB 5BSEA 2ZG6A 1ZAYA 3DH0A 2IHUA 2I2AA 2NXEA 1AZTA 2EV9A 4K3VA 5C4GB 2DPXA 3THXA 1EJ2A 3L0PA 1UFOA 1VCHA 2OEPA 4ZRMA 1Z7GA 2AA3A 5I4BA 5HILA 4EFLA 1N6HA 2HYDA 4C21A 5LXTB 2ATVA 2VAWA 3PC7A 1VZ2A 5KOYA 5E6UB 1L4FA 3D4LA 4Q02A 1H6CA 3S70A 3ZWNA 2KMLA 1JHPA 1XF1A 3DVRX 1TA9A 4I4IA 1M83A 1QGOA 3LK6A 5DEOA 3WMEA 1G20B 3CG4A 3LQ1A 1N92A 3FUUA 4UCQA 1QAQA 3K5WA 4CIAA 3ZD6A 4BAUA 2RGAA 4JUAA 4RJJA 5T67A 1C81A 1R4MB 3I2HA 4RA9A 5ILOA 1P17A 2PMFA 5EIFA 1G63A 3C6MA 2CT8A 1U3GA 1IBLB 3Q7PA 2QLBA 4IPTA 4QGAA 4DJ5X 1Z4QA 1NPDA 4MQFA 1U80A 3ADOA 5BV8A 4K2HA 4Y2SA 1TO6A 1DCTA 4M1SA 1XU7A 1HE8B 1F2TA 2W71A 4JBLA 1ZA3R 2X0JA 1UJ4A 1X7YB 3L02A 3QM1A 2VATA 4HXEB 4WGFA 2VK2A 3WNVA 2PWYA 1MC1A 1D2RA 2OXEA 4IZ6A 1O6BA 4NZOA 5ALIA 4HCJA 4IF4A 3E5HA 3V4PB 3L18A 1GUFA 2PH5A 2QRQA 2NSHA 5E7IA 4LY0A 5DB4A 2R3SA 1XCLA 4W9NA 4DS3A 4HNVA 5IXSA 2ZBRA 3HJBA 3W9SA 5JS7A 3FCUB 1JHQA 1QIEA 2QY6A 2Z8YA 3F49S 3G5UA 4GKBA 4TM8A 4TV9B 5CDHA 3SQOA 4NPHA 4GO1A 3CSDA 2IITA 4U3JA 4ZA2A 1RTTA 1KI4A 4I1IA 3WQHA 3OIFA 5AK0A 2EXXA 5EQTA 5SYNA 4MPTA 3LVBA 1GEGA 4EUSA 5KDDA 3PD7A 4E22A 5EJ4A 2ZYDA 4G2TA 4F5EA 3PTAA 1A5TA 3F5FA 3NASA 3I30X 5ALRA 3V8RA 2UU9B 4C0WA 2GPYA 3H4TA 1HFKA 3HLYA 3CVOA 1MLDA 5E0KB 1RYHA 1U5CA 2ZCVA 4HZGA 1MB9A 4Z7JA 3CRRA 4IZIA 1ZLXA 4NCIA 2VK4A 3OQIB 2Q5IA 4OHXA 2DSNA 2E5LB 1SU6A 3D7LA 1A98A 3OUTA 3OHPA 5DTEA 5HKOA 4PZEA 2X5OA 4RVNA 1D2EA 1CR4A 5A4IS 4MVJH 1G5FA 3C3MA 1JAZA 4JCOA 5A5EA 2XB4A 2YVUA 1YWGO 3DYIA 4YT8A 3HEBA 4EW2A 2PEYA 2GRJA 1I7PA 3HJTA 2BFDB 4HGRA 3C48A 3H42B 2NZYA 2CCKA 3ILHA 4FKMA 4RAQA 2ZQ5A 3OOHA 5AXAA 1Q19A 1W49A 4M89A 3P97A 4KDFA 4IG4A 4RUKA 3T9DA 3TH5A 5KSPA 2OPBA 1JJAA 3UB4A 4BE9A 5IP5A 2R8ZA 3ZE2B 4IWNA 3D2AA 1RIIA 3B6ZA 3S3TA 3D0OA 1TUEA 2FEKA 3RS7A 4I2NA 4LYGA 4HUQA 3ZOKA 5PGMA 3TRIA 4H6VA 4IY1A 4UEQA 4A91A 4WD3A 4UM7A 4ALKA 4GGOA 3DEKA 4MDFA 2OZKA 2ZIWB 4BV3A 3ROKA 1ZKDA 4F72A 1BSVA 3ENNA 2R85A 5JSKA 2FUNB 4CMHA 1EXTA 2ZVJA 4M0KA 1APBA 3W1WA 3F7MA 3UGKA 1QF6A 1P0PA 1JLSA 2VIIA 2D5BA 5BOSA 5L9AA 2P11A 3QOYA 1WKVA 4QIHA 5J9FA 3BBLA 4PBRA 2ZIZA 1DKUA 5K2MA 1N6PA 2IYVA 2IYLD 1TVMA 4FYYA 5FUYA 5L7WA 3BH0A 1HDRA 4KNYA 1RYBA 1NI4B 2HMWA 1TJ4A 4HRXA 4HS9A 4QLBA 1I94B 2HSWA 2UAGA 2WZDA 3HA2A 4D3ZA 1P4GA 2FSIA 6ABPA 2YBEA 2Z58A 1AHNA 4H7IA 3ZVLA 5LYJF 3EZ6A 3IHTA 3G85A 1PVVA 4HYEA 3CZ5A 4NZZA 3WSVA 4KE8A 2QTRA 4TV8F 4E12A 3VPCA 3GVIA 4UZSA 1AK2A 2AT1A 2FEXA 2N3ZA 3KT0A 1B6RA 3S7TA 2QE7A 4W82A 2HJVA 3NZEA 2I7TA 4CF5A 4JYBA 4EY4A 2PFKA 3OTHA 2IZ6A 1YZTA 4LF6B 1GAXA 4OI0A 1PDVA 2F67A 2H5IA 4U02A 3U7QA 2A3RA 1KY5A 3USCS 3I01M 1RAEA 1IMJA 3NUQA 1EFKA 4WWHA 4OLBA 1QCDA 4DIKA 4F92B 1XG5A 4CMEC 5KTPA 1HDEA 4F2WA 2J6BA 4R9VA 5L7YA 2V6FA 1QH8A 1TUBB 2MSLA 2ST1A 4D4JA 4ZDKA 3AR4A 3BHNA 4G0NA 4JWTA 4W99A 4DLUA 1ECFA 4H1UA 4IMJB 3WLKX 4D92A 2CVPA 4GDMA 1DUIA 2B92A 5ES3A 1URPA 3TTUA 5CXUA 3IP3A 3UMFA 1VCNA 1PJ8A 4B9EA 3DC7A 1W30A 1UMDB 2AJCA 4I1VA 5F12A 1E18A 1HLFA 5LMNB 2VPPA 4O2AA 3QHQA 4JUFA 4DIDA 3T1YB 5CIWA 4P7GA 4DSZA 5CB8A 5J2TA 1VIVA 2VOJA 1VGVA 1ZCAA 2C3OA 2IYNA 4G41A 2Y68A 1QWOA 2I8CA 5BQPA 4CRWB 3I01A 2Z2JA 2W6JD 3IAFA 1ZGAA 3GLSA 2ZYHA 4Q05A 1JKMA 1ISJA 4LXUA 1EUCB 2O59A 4HK4A 1GKLA 1M3SA 4D4HA 1YS6A 3NWEA 2W4QA 1X7GA 3F1KA 1Y8RA 4CLXA 1Z12A 2QLNA 5JNVA 1Z3CA 3FGPA 1GZ7A 5ENDA 1NZJA 3H19A 2VDQB 2L42A 3KEQA 5FBKA 1U3UA 4TLAA 4JQSA 3J80A 1LF0A 4CEHA 1JSZA 2ETXA 3JQBC 4UUQA 4LN1A 1U2ZA 4JELA 1TCVA 1HRKA 4BNVA 5K9ZA 1F6BA 1QC5A 4N5HX 1FF9A 1JN0A 1CZLA 1Z68A 4ZEWA 3HVJA 3DCNA 5TS2A 1D0GR 2D5IA 5LJLA 5ABPA 4PZLA 3PXBA 2GZDA 2A0FA 1KFBB 3PRHA 1RMTA 4PCUA 3CURA 1V5EA 1M2EA 3C8HA 3OA2A 4YYZA 4N48A 4HS4A 5CJJA 3FGZA 3FYUC 3KQNA 1TVCA 2DWUA 3N8GA 4EZIA 2YIDA 3CVYA 3AEKB 3ISJA 1ZSYA 5HJ7A 4EAQA 4DABA 2V65A 4DCJA 3FYUB 2D4HA 4LQLA 1YKFA 3LVQE 2FOLA 4KGVA 3WZ2A 1T3TA 1TNDA 2XMSA 4ILEA 3JYHA 1M2OA 4LTMA 1BU8A 2XAUA 5TSDA 5K03A 1DC8A 2MINA 2IEIA 1YULA 2PVSA 4QXQA 2XD9A 5DI3A 4DCSA 5I4IA 2ZVQX 3LBFA 3SDBA 3RJ9A 1WTAA 2FN9A 2I4IA 2QG4A 2CXRA 3ECAA 5HUQA 3QBVA 2NQ2C 4P5DA 2RHBA 3TSOA 4WXHA 1MG0A 4DV2B 1TU4A 1XHLA 1M2VB 1CJUC 2RGXA 5KS2A 1Z17A 2A1UB 2GXUA 1VQ1A 2WF9A 4H16A 4KYUA 2ZYWX 1G5HA 5EHGA 2G8NA 2HADA 1A76A 5KNDD 1JLKA 4BLWA 3CVUA 3U5ZB 1BDJA 5BVGA 3PXCX 1WVMA 2QM8A 3HZOA 2I66A 2WMNB 3L7NA 1NLMA 4Q47A 4UU1A 3SOZA 3JAKA 2IZ1A 2VOEA 3BCSA 5CT8A 1FMTA 3NIFB 4AIRA 3ANXA 2XIJA 1TMYA 2GZHA 1RM5A 1MEJA 3Q1LA 5JMTA 1F2UB 5EMNA 1O97D 3RT1A 4MUGA 1LJ8A 2AYZA 2ON6A 4J1TC 5DO9A 4ZU6X 1GJRA 4BKUA 4FZJA 4IRUB 3ZZTA 1IAQA 4N65A 1QRSA 1J07A 4MS4A 5DW3A 2ZU6A 2Y92A 4MUXA 4CODB 1UIMA 2JGIA 1U02A 2ZJ8A 1YR7A 3VNRA 2VP5A 4BNLA 3WV5A 4YLYA 5B55A 5AW3A 2VTBB 4JYAB 2NO5A 5AVUA 4Q4HB 3DUFB 5LZ8A 1U6KA 4FJ2A 5TJHA 2QM7A 4FHCA 3W5IA 5LLDA 2WZBA 1IHXA 4PRKA 5BSVA 1M6VA 3ECSA 3KE9A 2D0IA 1TT5B 5AW0A 1W47A 5JO9A 1IZ7A 3JQGA 4FSHA 1QIMA 4OHMA 5E7JA 2WVJA 4R54A 4HAWA 1X3LA 3SM3A 4K9OA 4QFDA 2F62A 3KKMA 4XIGS 4XVUA 1MOQA 3ESBA 4DYDA 1WB6A 1J49A 3TLGB 2HLNA 4EPWA 1JHMA 2FOIA 1Z34A 2IYZA 3AM3A 2EFGA 2Q0HA 3Q15C 1KOJA 3Q0EA 3DZDA 4A6DA 1ONBA 2ZJ3A 5KTMA 3PLAE 3HLTA 3UHPA 1CJCA 3LYAA 2A30A 1DIHA 1DP4A 3DZBA 4NH4A 2VEOA 3NTLA 2R8EA 4E1VA 2GJSA 3AJ8A 3NC0C 3HJUA 3GFRA 2F3UA 5HFAA 3UGQA 1K68A 1QV6A 1W85A 2QGZA 4BP1A 1BVRA 1ZGZA 3EGXB 5K0GA 3GFGA 4YJFB 1S4MA 3DM9B 3G2OA 4GRIA 4WNAB 3WB0A 4NQZA 4WPGA 2H4WA 1FYFA 4IDDA 2FDXA 4ZCIA 2RH4A 4XJXA 5GZ6A 4MR8A 4NDNE 5FHQA 3ZC3A 1OZ0A 2BGGA 2RH9B 5HOQA 3L8HA 1XRJA 2F3TA 1I2DA 1PZFA 5F1YA 1QPGA 3SZMA 2OHXA 3IAM1 4EGFA 3BBPA 1KRWA 1WXFA 3QXHA 4OFBA 2A84A 3WDSA 4AS1A 1MCZA 1RWVA 3PHLA 4K40A 5FORA 2E4YA 1T3LA 1QGUB 1NBMD 1EP1B 5DNYB 1ESNA 4A8HA 1Q0LA 3VNSA 4RACA 4QQNA 4AO6A 2KI5A 2F9MA 4CKXA 1Y63A 2Z4SA 4WIAA 3P0IA 4PAQA 4KQ6A 4EFNA 4AS3A 3COVA 1L5LA 1A7UA 1VL0A 1XJWA 3V9AA 3GGJA 1P1RA 2JRCA 3C7CB 1ZIYA 3RWMB 3WVNA 4ESVA 4RPJA 2IKSA 4WNIA 3VHXA 3P4UA 3F3MA 4PV7A 4MV7A 2PSJA 2CXOA 4QQKA 1JHOA 3C0KA 5K3FA 3SOPA 1PUXA 4DB2A 2EBFX 5HJEA 3EBPA 4RVUA 4BMVA 1GN8A 3LHFA 1FT4A 5EQFA 3KZ1E 4L8LA 4Y1RA 2F8LA 1DQZA 4PSVA 5HKLA 4D9HA 1N5JA 2JASA 5KQLA 2GI4A 5EWJB 1CE8B 4X6UA 1OYVA 1WF6A 2B7CA 2PE5A 5C8DA 1ESMA 3DVAB 1GSAA 5HBRA 3E9MA 3O21A 4Q0MA 1O4VA 4EL5A 1RLOA 1UJ5A 3EF0A 4MR7B 2E4AA 1UPAA 2HGSA 4Y6RA 1J8YF 1O4WA 5AFSA 1SIOA 1GG8A 4KNWA 1JIXA 1JA9A 1CY7A 1L5HB 4UEJA 4WOKA 2OBFA 2PUGA 4WUVA 2JG3A 3OM9A 4FOPA 4I9UA 2BMFA 3SIPA 3MWEA 2PUVA 4YDSA 2YJZA 3G2QA 4X1YB 2BM0A 4LYEA 3STWA 2ALJA 2WFLB 1G59A 3ACDA 5DH9A 1ZUIA 3MMPA 5HGJA 3G0IA 4I1SA 2JI7A 2HMVA 1T9CA 3S29A 2HUNA 2AQHA 5F2OA 1TJPB 5JROA 4JLBA 3D5TA 221PA 3VMFA 5J2UB 4AN0A 2YWGA 1F38A 3O3OB 3OH8A 2UUBB 4PC1A 4AJ4A 4AU1A 1F5NA 1XEFA 5BUQA 5I48A 2VNSA 3SR3A 2BRUC 1E2DA 2ZS8A 3I09A 3GLHA 4YJ3B 3TX6A 4BX8A 3GUZA 1MT3A 3OZSA 1NVWQ 4JL8A 3WDMA 1P91A 1UJMA 2D00A 1BN7A 1N0WA 2Q4TA 2AKAB 4Y0VA 3THYB 3NAZA 1EDDA 3ET4A 3CO0S 4HDCA 1JR2A 1N3BA 4WZAA 3PHCA 3HV0A 1VLLA 5HUJA 4C88A 5HKKD 3LDUA 2EZ4A 3CX3A 1AY0A 1V48A 1XO1A 2FPIA 2DSTA 2GN0A 3B70A 3G2IA 3WGYA 4O4LB 3AI3A 1BJRE 3E84A 2AFHB 1QNFA 2P30A 4F46A 3HVKA 1H4TA 1N0VC 2X8JB 1NT4A 1T8RA 5JFOA 4YMVA 3KQLA 3K32A 3PXAA 2I78A 2OFWA 3F74A 3F46A 3S2YA 1ECGA 1TZMA 5GVRA 2CWWA 5AW5A 5IFLA 1WY7A 1JG6A 4KFSA 4RS3A 3P9IA 4INPA 4TMXA 1XD2B 3ZE1B 1XSEA 4LXHA 1OVGA 2Z1NA 3O91A 4MJ3A 4EKGA 2DT8A 3AL3A 4V02A 1GAQA 1LTKA 1VRCA 2BEVB 4YMSA 2W6PA 1V1MB 3FOBA 2VWQA 1QHYA 4J6EA 4OHFA 2OY0A 1E4EB 1SBTA 5I51A 1CB7A 1H85A 3R5TA 5J4YA 4CL0A 2J6CA 3EWSA 4KE7A 4GI7A 1RQ7A 1W581 5KVQA 1RPAA 3FZNA 4MULA 4Q1FA 1M2KA 4B3JA 3WLLA 2W48A 1JPNA 1P2VA 3JD1A 3DAYA 4QFBA 1XRNA 4W4TA 3E23A 4DUGA 2WF8A 2Z2ZA 1N57A 2R8OA 3EIEA 3LPAA 4HDNA 4OKIA 5JANA 3TG8A 4S1TA 3CT4A 2PQ0A 1CTQA 3IULA 1E9BA 3KKQA 3LLSA 3C70A 4WZ6A 4TZ0A 4TWIA 3RV4A 4X66B 2AGVA 1OH7A 2ODAA 1NKTA 1A9TA 1K75A 4QUJA 4BV2A 4Y1FA 3RSFA 5FOVA 4URWR 1UAGA 3QMMA 1ZK4A 3Q6MA 2N42A 4P80A 1T4DA 1BCSB 2PS3A 3EASA 4YTEA 5CEEA 3GGCA 4DSTA 3G13A 3THWA 1YJCA 4DCUA 2HLHA 2BZGA 4ZCRA 3NBZC 1DEXA 1VKHA 3DHNA 4X8LA 5CCDA 3I5XA 1ZJ5A 2FSSA 4JLAA 3EC1A 4NCJA 4QWWA 3FNBA 2RBKA 2FE4A 4PNZA 3RQIA 3F7TA 2AW3A 3I23A 3I6ZA 4JBNA 4BASA 5DYTA 5JASA 3QLUC 1KMMA 1GXSA 2HHLA 4I55F 4IIFA 3TRDA 3KKNA 1YB6A 3KELA 2LGJA 3NQ41 3NUZA 2HMSA 1XP8A 1YE5A 2G5CA 3ER6A 2IEYA 4NOJA 4WFQA 2CVHA 2VSNA 2Y93A 1YZNA 5CA0A 5P21A 1PX0A 1SUBA 2PS9A 1DUSA 3ZXYA 2AQ8A 4EG8A 2AB0A 1YQXA 2IQ5A 3H1EA 4FIZA 5AESA 3JZDA 3REQB 5IZ4A 2V97A 3BVPA 2WHQA 3QX3A 1R0KA 4G3XA 4F21A 2DH6A 2K2QB 2OO3A 5LQUA 4I3FA 3NDJA 5EZ6B 2Y76A 1NC1A 3V4ZA 3IPAA 1KEEA 4EHAA 1E2LA 1M34E 3ICCA 3M3DA 5DIFA 5BW5A 3RS3A 2GZ1A 3B2EA 3ROTA 1XAJA 2BGIA 5A05A 3RK4A 4MKRA 3QEMA 3MTIA 5FLEX 1JB9A 2PD6A 3PE6A 1ESDA 1L3BA 4YRDA 1CUIA 3MN1A 2NTVA 1S2LA 4MI9A 1E5DA 2XUKA 1OXMA 3IDOA 1Y4ZA 3OJ0A 1IC6A 3KQHA 2BF4A 3TZBA 3QUBA 1KFJB 3ONNA 2QLJA 2XE7A 4JUBA 2GXAA 1S7GA 1AKYA 4L57A 4NMLA 3N07A 5LXTF 2YVLA 2JLXA 2QDKA 1JR3D 1IDN1 4MWOA 4CMAA 1J2TA 3HY6A 4GKKB 1HDYA 9ATCA 4DBZA 5GONB 4DNOA 1HFEL 1AQNA 1JWLA 1D2AA 1CULC 1X0VA 3O4VA 3QNMA 4MK4A 4EATA 4Q3KA 1C9YA 1UMBA 5KREA 2VTVA 4CLEA 3UKDA 4TXMA 4UFPA 4JR0A 2FHSA 3DE2X 1ZSNA 2BI8A 5EKDA 5H4GA 2GN9A 3KU1A 3PDJA 4IDPA 4RHCA 4E46A 1G0NA 5IJ0B 5HM8A 3KJXA 1R6TA 3OJLA 3R3UA 4H27A 4EK9A 1TPYA 3BFXA 4LGMA 2BMWA 1WD7A 3FNGA 3JQ7B 4G5SA 1NV9A 5JBIA 2ZSKA 2GEUA 3OBIA 3NP9A 1ICIA 4XDGA 4KO2S 3DD5A 3K0KA 5LQNA 1I7SB 2WJZB 3Q4GA 4FE3A 3SP1A 3WAGA 1X8XA 4MWSA 2R7AA 4UFOA 2NSDA 3V1LA 1VI6A 3H2GA 4IIBA 3VYVA 3BHMA 3T1HB 4B1FA 1Q15A 2G80A 3BJIC 4J16A 5JC8A 1TQ2A 2GEDA 3IQWA 4WOJA 1JBEA 2BCJQ 4Q3NA 3FTDA 2XE4A 3KPVA 5L53A 4PLHA 1CP3A 1ADCA 2PL1A 3GROA 2JKVA 2PGXA 4KOAA 4TV9F 4IDFA 3OQNA 1TIPA 5LN1A 1E2HA 3GP8A 3E9QA 1JMKC 1II8B 2G76A 1M1ZA 2IKQA 3X1KA 4HG2A 4TL8A 1Q1QA 2XB2A 5JAOA 5KKCA 4FDTA 1MOSA 3R20A 3WKCA 5AM3A 3ZNQA 3NDPA 3IA7A 4WDRA 3VSCA 1H6BA 2VUTA 2A4KA 3E3LA 3TX2A 3I42A 3GAAA 1F0PA 4JLDA 4PGFA 1KS9A 1WCWA 4IJKA 1ZK3A 1JWBB 3KB2A 2DFKB 3OLWA 5EJ9A 5AKKA 1ZW1A 4MV3A 4RM2A 5KVAA 1PV4A 1M5RA 1PUJA 4WSOA 3AM1A 1Q3KA 1UOOA 1D2GA 1L8XA 4L5AA 3V48A 1R6VA 3VPDA 5IPFA 4G0PA 1RD4A 2GPSA 2R7MA 3EULA 3INGA 3SSOA 4IIUA 3YASA 5JYCA 1CVRA 3H1PA 1G8HA 3A31A 1A8QA 4P53A 4UASA 4JLPA 4TMFA 1EK1A 4FBMA 3LUFA 2ZT6A 3CF2A 1L8OA 2PD3A 4LOHA 4B3DA 3HYNA 2PZGA 1QLJA 1LQUA 1UZAA 4KC0A 2IIBA 3A3KA 4X54A 1U7HA 4ZVRA 3TLXA 5KTKA 2GZSA 4AO7A 3D2BA 3VPHA 4X1KB 2ASVA 4X6YA 5HIJA 4MVWA 2BFEA 3FUXA 4X63A 5L3VA 1TTHA 4R1NA 1M8JA 1YB4A 1I32A 4EG7A 3SF0A 4LBYA 5CB0A 4ABTA 1CC1S 1ORDA 1SOUA 2CLOB 5IKPA 4V3BA 4XFJA 1SBQA 3TCKA 2QD3A 1J4AA 2VF5X 3VR0A 1ZD3A 3C8ZA 1T10A 2AFIE 4JBIA 1G18A 4FDAA 4CMIA 2ZYGA 2QMQA 1B14A 3CNNA 5FUXA 4ZZ0A 8GPBA 1ZHOA 1ACJA 2DT5A 4MRMA 2OZLA 1U8FO 3PNOA 4U6QA 1GEEA 4EARA 1DC3A 3LXXA 1R4ZA 2BUAA 1S5PA 1XCPA 3GJ5A 3ETEA 3L1KA 3R5JA 1ZISA 4I5IA 3HKDA 2J3DA 2GF0A 1MZPA 2V54A 2XY4A 5EE9A 2XXBA 2G7MC 5IMSA 3T54A 3PUJA 3OCZA 1QHXA 5K0ZA 2GJAA 4E5KA 2ODNA 3DMTA 2WT9A 1SZCA 1AO0A 1FDIA 3FL7A 5CURA 1VZ3A 3ZLBA 1JPJA 1JJBA 3DBHA 4RADA 3TLZA 4BHTA 2R79A 2VBCA 3HBMA 4GM4A 4BLTA 2CJPA 5A0TA 5DX0A 1TK3A 2VNIA 2XQFA 3TQFA 3DFKA 3ZD8A 3DAHA 4CCSA 1KDTA 5B1SA 4QKQA 3NHWA 2B98A 3FPBA 5GMOA 1GL3A 2J30A 1NN0A 2F00A 3WYDA 3DXZA 4LTNA 5DNDA 2DPMA 5AVWA 2DQSA 3DEAA 1P5ZB 3AX6A 2UZIR 3I58A 3V8NA 3HEMA 1T8UA 3A36A 1JS1X 3DEJA 3QX9A 4BQRA 2C7OA 2GPWA 5LKRA 1PG0A 3PX2A 3TW8B 1QVVA 1G4HA 3COJA 1E0DA 2L18A 1QH1B 1RWQA 1YUMA 3DE5X 3C3BA 3M6UA 4BP3A 4EG0A 5AVTA 1BHJA 5KCMA 1WMSA 3UK6A 4JC4A 4YA6A 5CIQA 3ESZA 3PXEA 4KG7A 4M0UA 4C0QC 3ZWYA 1G6Q1 1QH9A 3HWWA 4XLLA 4UTOA 3W5AA 1E9VA 1NONA 3LHSA 1HKUA 2O5EA 3R5KA 1B42A 2RONA 4NABA 3BTUA 2H9IA 1CZOA 5KYWB 4GMXA 1EGAA 4ZAXA 1VDMA 4RZIA 5JCJD 2IX3A 3BWCA 3KALA 1YFJA 4CDGA 3TEMA 4PU0A 2WICA 5DMXA 2F59A 3CRVA 3U6BA 2BLLA 1L8AA 2X5XA 3KJEA 1YTLA 4L95C 4TVBA 4X6XA 5EKSA 4F7DA 2YNMC 1OGJA 4JV5B 3MRTA 4HFNA 1FPMA 4DYHA 2QLTA 1JHRA 4K1LA 2G0NA 2O0KA 3SVTA 5SICE 1L3CA 3ONEA 3Q6NA 1M75A 2QZ4A 2XE8A 3H9CA 3M89A 5ENVA 5I7VA 3LCMA 1FNMA 3JYLA 3G9XA 4FWIB 1O08A 2R7NA 1IN4A 2CFRA 1YIOA 1MQ8B 3A1SA 4R8LA 1XT6A 2HQ1A 3A70A 3MWJA 4H08A 3TINA 3UQZA 1RP7A 3CZ4A 2X22A 3BMQA 3OO0A 4ZI7B 1DDOA 2WB2A 5DULA 1RVV1 3TG2A 1PTJA 2A78A 3NHZA 3KOXA 4ZJYA 1MMFB 2CDBA 2XTJA 1DX4A 2CLLB 2UV8A 3QV2A 4K46A 4LNHA 1SUDA 2C5FA 2AHOA 3VI3B 4G5QA 2XB9A 1GNQA 5FLKA 1M0EA 3MM4A 2QD2A 3KIPA 4H4CA 5EP3A 1QTNA 4A2WA 1QGZA 3EQ6A 3FPGA 1LDNA 2X3YA 2P68A 2NO1A 3QPVA 4TS9A 5JE8A 3RUDA 3SI7A 4AJ1A 2WSMA 5FWNA 3L4JA 1MC8A 1Y48E 3FUCA 4LPKA 1BQ4A 4RPCA 4RY2A 2OFOA 4URYR 4B3TB 3PX7A 1QDEA 5ELLA 2JVKA 1K8QA 1YK1A 2G5TA 1NVTA 4B74A 4COKA 4RHFA 4WLVA 4Q19A 4XIYA 5DDIP 4DLLA 1U5BA 1A2KC 4PINA 4A0SA 2LVBA 2YOFA 3K2EA 1AA6A 2QVCA 3AOEA 5IBQA 1DV2A 2QNIA 4YCBA 5IAKA 1EVZA 3AKYA 2BGRA 3TNJA 3D3WA 3WWOA 5ICMA 5BYBA 3K8YA 2RKOA 3K15A 1T2CA 1U2GC 4S1PA 4D9JA 1RT9A 1C50A 1FZTA 1TYDE 3GEIA 2XZTA 1E1CB 2QD5A 4J07A 5DN6D 3LFHA 5JAPA 3K0CC 4E33A 4FVTA 3HN7A 3A3YA 3MQ4A 1U1CA 1YNSA 3QY0A 3IAHA 4BB0A 5F7XA 3GT3A 4LZJA 3VUEA 3ZYZA 2GO7A 4A1FA 3TEFA 2HJHA 5FOXA 5F9HA 2GM3A 3RRNA 4QOJA 1FX0B 3F5MA 3OM8A 4M37A 4MV8A 2A5JA 4MVJA 1IZYA 1ZGGA 1EHYA 1YDFA 3O7WA 3U31A 3ZQUA 8LDHA 1YQQA 5DTIA 3QMPA 1TM1E 4RZSA 4RNCA 1WSAA 4BMZA 2I3GA 3DMGA 2JJ2D 4JLSA 3H2YA 4LGYA 3OWHA 3RC3A 4BQSA 1U3FA 2GEKA 4NONA 5IG2A 3DE4X 4Q4AB 1Z36A 1AQJA 1Y5NA 4RIHA 1N8TA 4DR7B 2IS6A 1AM4D 2UXBB 4LYYA 3N59A 4Z49A 2MCFA 1PF7E 3UWDA 3E22A 1HNXB 3FZQA 1AQ6A 1KI7A 1W94A 3FNEA 3JYQA 2FRDC 4ZVMA 5K3AA 3X43A 2I2DA 2VCYA 2FPSA 3I73A 3NAGA 4LE2A 1X1AA 1QP8A 1VKJA 3KJZA 1O77A 4LRYA 3LA6A 4UMDA 3EFOA 4K3UA 2MYPA 4BVJA 2JFFA 2XOKD 4FSXA 7MHTA 3R0VA 1NXWA 1MAWA 1E98A 1BROA 1STOA 1IPFA 1ZOSA 4ZU3A 3UB2A 4BO6A 3UJ6A 4DL9A 1OF1A 5E2BA 3HY4A 4MQEB 1OLOA 3ZY6A 4D80A 1CT9A 4FLMA 1KL7A 3RUPA 9LDTA 3CCCA 4GXRA 4N6OA 2Q5QA 4FGZA 1VG9B 7ADHA 3PQDA 3EG9A 5HCIA 2YRFA 1RHJA 2YJGA 2C5BA 3QYJA 1TQ4A 1OIWA 4MW2A 3LSTA 2I7DA 4PW0A 3MJDA 2VHZA 2ZYSA 3WRWA 2XKKA 4ZTBA 4YRRA 4I1OA 5EP1A 2NX2A 4KZKA 1B8UA 2X4DA 2GBGA 3R7SA 2WM3A 3N70A 1HDGO 5C1DA 1XQYA 1IB6A 3C1TA 4UUBA 2C7VA 2PR7A 4RHXA 3W7AA 5AW1A 1WB9A 4TL7A 5DU2A 5AW6A 5FEUA 2WKSA 1FSZA 2E6KA 3UA3A 2WUFA 4RZUA 3HP4A 5LIPA 4G1VA 1SCNE 3CMCO 3SHWA 4DIFA 3WGTA 2EZ9A 3LF1A 4QUAA 2FFQA 4EJ0A 4D56A 3CW9A 4EHBA 1MA3A 3S1LA 1QJCA 2FPGA 1R0ZA 3SIXA 2ZWOA 3TIIA 121PA 2BKXA 2C5GA 3A10A 3OEHA 4UBLA 3B6KA 4XPIB 1XU9A 4N3AA 3WLQA 5CLHA 2LP4Y 2HM7A 3GLTA 3MPOA 4HL6A 4UAVA 4WXRA 1IN6A 5ER6A 3R8CA 1GKYA 2CNLA 3KB1A 5KINB 2NU7A 2CHEA 3IXMA 1DMSA 4TQAA 1GA4A 4B34A 4BNKA 4K9RA 2BF7A 1WDMA 2RGUA 3RTEA 1E59A 3RUEA 4WZZA 1NQOA 3BDAA 3IB6A 5LQAA 4FYIA 2Y1LA 1S0UA 2CW5A 3BJMA 1R9NA 1EVYA 3KOOA 3WLFA 4BE4A 3GRVA 2YBDA 5ARDA 2QYOA 4NJEB 3AGPA 5KOJA 1XFAA 4ZEMA 5COAA 2A1TR 1DIRA 2JD2A 4F3TA 2B8JA 2QYSA 4PG6A 2FSVA 3DO6A 3U3PA 4H60A 4XD7D 2RD2A 4O8ZA 4S05A 3VZCA 4CNBA 2BGUA 1V8ZA 4NV3A 3VR1A 3EFHA 3BB4A 4BP9A 5FD8A 5HA5A 1YR3A 1U98A 3E5NA 3OPYI 1G38A 1ST2A 2PGLA 1ADFA 2BSXA 1CU1A 3PNLA 1U4NA 2GN8A 2H3EA 4NCHA 5BSHA 1EFTA 3NHFA 3VKGA 4GLBA 2BR4A 2XUPA 1N7IA 2PSEA 1U94A 3PR2B 4QJBA 1T1RA 5EKXA 4DCMA 2D2EA 5L8VA 1YFKA 3H2HA 5C52B 1BGWA 3KZXA 4FXPA 2GH1A 3ZLVA 4HAVA 3HHEA 3S7ZA 1C80A 3UUFA 1O6FA 2QMUA 1CUWA 3I4LA 4TXNA 5CDFA 3TUIC 1K88A 1TF5A 3B3AA 4YPFA 3VA7A 1CVLA 1W4CA 4CV2A 3GUVA 3P0RA 4P1ZA 1AB6A 5E2IA 5KKNB 1TXGA 2PKYX 3H18A 2ZT5A 2OCPA 1H1TA 4ARVA 3P2OA 3IBFA 5LL6P 1IWBB 2IHYA 1KSHA 1G8FA 2FMIA 2P40A 3SQMA 3AEUB 3L8MA 2VHTA 4G56A 5TQ2A 1POXA 1AGNA 5INTA 1VJ1A 4K9MA 1U63A 2OAGA 2G0TA 3TAXA 1O0CA 4AG3A 4IIHA 4P54A 4K87A 1BXRA 4KQFA 1K5HA 2NTEA 2ZRNA 1OBVA 2C3PA 1GLNA 3BD6A 3CLSD 1Y3CE 1CUEA 3HXKA 4U2GA 4XOIA 3TNYA 3JZFA 3LFUA 1OYOA 1Q91A 3NVAA 4ZVQA 5HF5A 4YMHA 3WMXA 2GX6A 2WTMA 1NXQA 1X92A 1YACA 2YRXA 4GSKA 4ER7A 2EKLA 3GJ0A 5IF9A 1WZ2A 4H1HA 1AG9A 4KPYA 4MUNA 1J1IA 2PBLA 2PRIA 1GZ5A 4IJWA 2H63A 2Y1KA 3NC1C 4UHHA 4RA6A 4N40A 4E15A 1GY8A 2OO5C 2D5AA 4IDQA 4FOOA 1EFVB 4YT5A 2YFQA 1LBEA 4HGQA 3OETA 1PN3A 3ETDA 4KP7A 2KBEA 2C5LA 3PICA 1Y4DE 4QM7A 3TZEA 5CYPA 3ZNOA 4KI0A 3R74A 2A0KA 5EVCA 5AOCA 5IXYA 2F43A 5J2UF 1KFKB 2QBYA 3AB3A 1KK2A 1H2BA 5CLQA 3I9JA 3MTAA 3MT9A 3K0EA 3TD9A 4BFVA 1TI7A 3H2KA 3ISVA 3B1YA 4YJ3F 5AOBA 2IXGA 2P2GA 1BOOA 5C8YA 3OPYA 2Q3LA 4ZVPA 5JNWA 1KJ8A 1JU3A 4M6WA 1L4UA 2J9FB 4R5HA 1QYXA 1COWA 4RKQA 4EBFA 4YUAA 1QQ5A 3BGDA 4BBAA 5IANA 3V4OA 4O2BB 5EWLA 3QVSA 3TFWA 1W4RA 4YXWA 1U7WA 1UJ2A 3IQFA 1PWHA 3MSCA 3O83A 4TZKA 3PGVA 2HO4A 3LK7A 4JBXA 3ZNNA 4UPEA 1OZHA 4O4LF 1UOQA 1GLVA 1OLXA 1VXRA 1XDSA 4P22A 4KE6A 4RK0A 1DC6A 1GTVA 4CQLB 4GI2A 5LQCA 2BH2A 3AVXA 1XTIA 2BHLA 3I1IA 3T1OA 2ZPTX 4Q1BA 3NXKA 1T5HX 2B36A 4BZWA 2CBXA 3OAAD 3GT4A 2IBTA 3FWZA 4IUBS 1QKIA 1XRQA 1WLSA 3VC2A 1YAJA 1Z7YA 2H65A 4K6HA 4ZEXA 5IWAB 3ND6A 4U7FA 1IMOA 1CNFA 1OAOA 4QTTB 5B1IA 4ER0A 1ESCA 2F1OA 3PC2A 3NM4A 4P7BA 3QVTA 3AVUA 4KXQA 5JADA 4F6RA 3SPXA 1EUZA 3NORA 4I6GA 1IZZA 3GUCA 3UYLA 3ZU3A 2W2KA 3IQHX 4GMFA 3H5LA 3T3GA 2R6CA 4FFWA 2ZIUB 3O4RA 1LK5A 2ORIA 4KQCA 1UKYA 3PJRA 5B7NA 3PB3A 4PYQA 1KYZA 4XGKA 3X3HA 5AVZA 2O1WA 3SFTA 3NT4A 4KLRA 4ZOAA 5C53B 3OX1A 1KXZA 1E62A 2XWJI 3V00A 1E64A 2BKAA 2Z98A 4URVR 1KWGA 2A9KA 1OIVA 1QHFA 1ZU4A 5CT5A 2V7QD 3SZRA 4MS3B 3VRHA 1UBFA 3BREA 1NTRA 1Y1PA 2QR3A 3M81A 4C9BA 1I1HA 3VNQA 2XOXA 3PNSA 4DC9A 3G2KA 4QXOA 1GQOA 5FKJA 2C92A 5A4FS 1E1YA 3QUAA 4PC6A 5K0LA 4PCAA 5KAPA 3BSWA 3CIOA 1I4EB 3K71B 2R6DA 4AP6A 5JI2E 4PWZA 3PJDA 4MP3A 5ADHA 3PUKA 5JLAA 2EP5A 5JY6A 3GRRA 3EXIA 1U1IA 5TPZD 2PHZA 3L4BA 1HYHA 2DPYA 2WYUA 4N1AA 1I2CA 3DAGA 5GGYA 1M54A 4ISBA 5BQXA 1DSSG 3GEHA 1ZC3A 1TYBE 3NKFA 2W6IA 4N8EA 1TKRA 4BJ3A 4CKWA 2OWDA 5ILGA 4EKEA 3G5AA 3LX4A 4HDKB 5E6RA 1P7VA 1LSUA 3WNBA 3RRXA 3EVZA 3SHFA 1OI4A 3DTVD 5LBUA 4YP1A 2GYVA 2JHAA 4YYEA 3MWYW 1VHJA 3R7AA 4AZTA 1Y6GA 1JLHA 1VJ0A 4J0QA 3QU4A 2HTEA 4NNPA 1UQRA 3TKYA 3AIKA 3X0DA 1ZRHA 2PJDA 2XNJA 4ZI5A 3QI2A 4CM8A 4EYEA 3S1SA 1WW2A 1YDWA 4GWLA 3SD7A 4Q9NA 1ST3A 2QTLA 2D8MA 1V9LA 5T64A 3UJNA 1ISIA 3U81A 1WX1A 2DTDA 3SZUA 2II6A 5H1YA 4JGBA 3UBMA 1H3EA 1IUPA 4TTQA 4KWCA 1X7ZA 4X65B 1BS2A 1UJBA 2Q5JA 2QUAA 2WC1A 1KYTA 4YP6A 2O7VA 2GRUA 1BZYA 1KDPA 2BJVA 4RQBA 1ZGHA 3T94A 2XNSA 5FPKA 3DEFA 3ET5A 2GCOA 1OREA 4EOGA 3AMVA 4HQOA 1R27A 3RVBA 4C20A 1WZEA 3HDTA 4NXNB 2BGTA 1UM8A 1VGQA 3K09A 4RGYA 5FNVB 3DAPA 4CKYA 4W5QA 5FH9A 5K3EA 1HDIA 2WIGA 3O2QB 2UVPA 1JFFB 2XF2A 5GONF 1KWKA 2JBAB 3G68A 5DYNA 4YP7A 1TJNA 5LLTA 1Y1RA 1N7JA 2H59A 4I8DA 5A2GA 3PEEA 1YHYA 2QRVA 4CM4B 2B34A 3H4MA 3VZSA 1VLQA 2GA8A 3HP1A 1J6UA 4ZYYA 1IK4A 5EZYB 3CWQA 3RYFA 3HJRA 2CCGA 3RTGA 4N4AA 3U7IA 4BNXA 5DM70 5FCDA 1L5OA 1NQXA 2QI9F 2XIQA 3VGPA 1M1NA 3OPQA 1SVKA 2UUCB 2P3QA 4RHYA 3TNDA 4ANFA 1AS3A 1SC1A 4Q7MB 1Z6XA 4C0KA 3O1IC 3BJZA 1T2FA 4B85A 4OHVA 3GZNA 1L7DA 3W34A 3QVMA 5FUMA 4NBNA 4E31A 2DEUA 3X1DA 3ZLUA 3UPUA 3ZDYB 2XUHA 2AZDA 3EXHA 2RGGA 3H6HA 4ZHSA 4CM1A 2NP7A 1CQXA 4CF6A 1AKUA 2HV9A 3WKAA 4YGYA 4B2PA 3JD3A 1HQCA 3CPSA 5DGHA 2D0DA 3DDUA 1JDPA 5K8IA 1PWEA 1SFRA 4LF7B 3DAFA 2YL2A 1ZVKA 1Y7LA 1ZXLA 3VO2A 1OIXA 2YXEA 1JG1A 3ABRB 3W5CA 4IXMA 2G9NA 2N46A 3EVGA 1BVUA 1THZA 3OJCA 2OGZA 5DN6A 2OC4A 5FI5A 4AWXA 4DSOA 4LE0A 1QK5A 3GBSA 3QITA 4NMXB 4PG4A 3W06A 3ZPXA 3ZUGA 1NXPA 2FMHA 1BDMA 3RRBA 4D3SA 4DCOA 2QVBA 3A1WA 5ALZA 1HQDA 4JJGA 1ND6A 2H4FA 2R96A 2OHIA 2Q2WA 2YHIA 5LQKA 2AOUA 4HSGA 3GWZA 4URUR 4Y2JA 2NUBA 3R7LA 5J59A 1Z0JA 5EE5B 4KH1A 3UV3A 1KRXA 1L2TA 2YR0A 3AHDA 3HUTA 1E1LA 4JIGA 1CVIA 2WNHA 4GMDA 1FQJA 1VLMA 1CQIA 2FFBA 3R75A 1IBRA 2H1VA 3UWSA 4KIWA 4ALNA 2WJHA 5B4VA 2ZE7A 3NVDA 4EJSA 1EQUA 2PXCA 2ZTVA 1SKYE 4BATA 2QZ9A 1E2MA 3ORQA 3MELA 3RSZA 3HXQA 1P6QA 1KBOA 1B0ZA 5JQGB 4LYJA 4F5YA 3GC6A 1ZINA 1HL3A 1XZFA 4L8FA 4B3XA 4YMGA 4KFRA 1FXUA 1YA8A 1Z5OA 4MPPA 4OHOA 4BKPA 5A1TA 5JD6A 3A6PC 2VI5A 3H1TA 2Z8XA 5THKA 4RH1A 3EQZA 5AVSA 5HTOA 3EUEA 3ZHYA 1RLUA 2X58A 4KWHA 4YMTA 2C54A 1GCOA 2VP6A 4Z0TA 1X7XA 4JDUA 2YOHA 1VP3A 3GPCA 4RVDA 1SEVA 2CXNA 1ZA1A 3BGOS 1E4OA 1DEKA 3ALQR 2VRNA 5D3MA 5HHTA 3EIHA 4RCZA 3Q9NA 5CFMA 1DT3A 1W88A 4G97A 3AEQB 4LS3A 1T4CB 2QUKA 5D85A 2ONJA 5E3HA 2UVDA 2ZSDA 1OD6A 1ZH6A 4YRCA 3N75A 2OYRA 1TW2A 3V3KA 5DHPA 3RBAA 1NBWB 4I81A 5KX5B 5HR5A 3EOAI 2I9KA 3KWJA 4R2KA 1ZOPA 2VH2A 4KH0A 5EUMA 4ZANA 4G23A 1G21A 4HNRA 2CXTA 1VPLA 1RTKA 4G2NA 4TWAA 4D99A 4ESOA 4C3VA 5C80A 4TMZA 5D5QA 3CRMA 3EZGA 1YC2A 3SXUA 4X7RA 3TQOA 2DBRA 2PLWA 5BMVA 3GEEA 3OCJA 2ZB2A 3PJEA 4I08A 3ETJA 3T5AA 1B73A 3IS3A 4XM0A 1H0HA 2GF9A 4PO8A 4C0HA 1CEEA 3Q11A 3LBHA 5AP9A 1WPQA 3L6OO 4IEIA 2VP3A 5DBGA 1SVNA 3ABZA 2EYUA 2H0RA 1EXDA 2QX6A 1QF9A 4NCKA 1FNNA 1PGOA 4MGKR 5LQSA 4KXWA 3RF6A 1XRMA 3LZDA 3UGTA 1RXWA 2Q9CA 4HRYA 4PF1A 4S1WA 1MHTA 1DIGA 2WKPA 4OQXA 2GKGA 4MVJG 2O7NA 4OHPA 2XCQA 4XOUA 3T0GA 2GK6A 4QODA 1OLSA 5EMJA 1AT1A 2C97A 4DKXA 4C7JA 2IS1A 2FMFA 4AM8A 2NUPA 4ND4A 3BAFA 4XQEA 2JGEA 1HGXA 1YRHA 4GQIA 4P2GA 2OYCA 4A4DA 3VKVA 3TJEF 5KDOA 5B3JC 4LMPA 1XCJA 4H7EA 4MYDA 5DM0A 4X85A 4I3HA 5IX8A 1WPRA 2ZRMA 2Q1YA 3ZDAA 2OCXA 2IDKA 5I7RA 1RRMA 2ID8A 3E4CA 3MCAA 4HVAA 1NBIA 3UZUA 2DJ5A 4W5JA 1KQFA 4QHYA 1H2FA 4R9UC 1C0LA 5TY0A 5TRTA 2DETA 4YPVA 3ORYA 5JJLA 3LW7A 3KZOA 4P4TA 3FOWA 1WUHS 1V5FA 3DZJA 4TYYA 1R5BA 4HZUA 3R3XA 3RIYA 2BFCB 2CMHA 3OQVA 1U0EA 3V1KA 3MF4A 4DJFC 2CHFA 1BXKA 1DJOA 1TM5E 3DE1X 5JYBA 1IBCA 4FN4A 3A9RA 4KAJA 4RCVA 1B6SA 3FPEA 3V1UA 6Q21A 1QOQB 2JEYA 3BTOA 1N36B 4FQ7A 3EMDA 1KC1A 2P4HX 3LECA 4H3VA 4ZI7F 2PUCA 4KIJA 4NENA 3A9TA 1TM2A 3KVOA 1VP9A 3MMXA 5BUCA 4WCFC 2EKBA 2WA2A 1FLAA 3EMBA 1FCJA 2RB4A 2YFKA 3M9WA 1I0IA 4IIVA 3F0TA 5EQDA 3WSTA 4LYDA 4ENQA 4U1RA 4LY3A 4Q93A 4Y7DA 4ETMA 3D6FA 2B6NA 2J87A 2X76A 3LCVB 1MB4A 3JWGA 4WCFB 5KHOC 2E87A 1NRJB 1QAOA 2Z43A 3TOCA 4A15A 1JTVA 5CPBA 4M0MA 4U5QA 5GZ3A 1YOBA 3SE0A 4F3KA 2NWQA 2DUUA 4O25A 1MH9A 1XXHA 2V98A 3ED5A 3FCOA 4G24A 1GPMA 4M0LA 4BXOA 4CEJB 4H17A 1JKJB 3TXAA 1MA0A 1L9KA 3GLFA 1YQ9A 4PRLA 2J41A 3NBYC 4PNEA 4FEYA 1C9EA 1NFRA 2EFJA 3K96A 3UHOA 1TTPB 3CU5A 3UK2A 4F1JA 4DRXB 2WABA 5CVTA 3SEZA 4AUKA 1NP3A 1PR1A 5DCWA 3CBGA 1HZZA 4BFWA 1Y3AA 3FIJA 3G02A 1YAHA 1PGNA 1HLDA 2PRJA 3W5UA 3DOUA 2PKQP 1FNCA 2HOQA 3RF7A 3S99A 3AERA 3PFFA 3RH0A 3BFVA 5J40A 1E9SA 3FCSB 3NCHA 1OI7A 2XUFA 3LDFA 3HBLA 4E3ZA 2YHSA 3UTCA 1J2JA 3H17A 3DHWC 2O6LA 1LLCA 4GIBA 4YPOA 3SC6A 1LU9A 3L6RA 1EUDA 4M38A 2B61A 3ME5A 4WAUA 3RJZA 3RVSA 3KQQA 4OGKA 3EVAA 3OIUA 2WM9B 1CCWA 1F8UA 2ZJ5A 3KQVA 1J0DA 1VJCA 5H59A 3L7CA 3EYWA 4FFNA 1ODCA 5EN4A 3QWIA 1C4XA 3FLBA 1CDDA 1JDUA 1HDOA 5KMGB 4MAFA 4UTZA 3I1YA 3M5WA 4FR5A 2BEUB 1M5TA 2VTDA 5IAEA 5BSMA 1RP1A 2DQKA 2JH9A 2Q49A 3L1IA 1SAYA 1XLWA 3CIFA 4KBFA 1KK1A 1PT7A 4RV5A 1OC4A 1GTL1 4OXIA 1YB2A 5B2FA 1YVPA 4JKOA 1NQWA 1JXQA 1TRKA 4F5WA 1F51E 2CJWB 3NNSA 5JSQA 3S2IA 8ADHA 4ZODA 2JLRA 3G2LA 4O8CA 1P1FA 3ZYCA 2ES4A 1RWXA 3SC4A 1E77A 4N0DA 4OQLA 1IJEA 3UJAA 4XVCA 3W5DA 1GZUA 2DR0A 1FE8A 2ZE5A 1J42A 3KYDA 4J29A 5CH3A 4MS4B 4R68A 5JOQA 5K4GA 2JC3A 4YBRA 4RYDA 4ETNA 1EUQA 4UHDA 2Y0PA 4BYMA 3AHCA 5C1BA 4DHWA 1GGHA 4CT4B 2BKLA 3BL8A 1VHTA 3COWA 1N2CA 4NMMA 3TRHA 4RC9A 1U28C 2B1RA 2JCVA 3INNA 3VU3A 3VDNB 3ETCA 4NCBA 2GB4A 3SQLA 3UJ8A 1NVKA 3A6ZA 5KIAA 2LBPA 1A5AB 1X9IA 4YRQA 3UHJA 4D4LA 5FBWB 3HKBA 3E2MA 3P9KA 4HH3C 4KXFB 1NX9A 4AKEA 1V71A 1E5QA 1H1LA 2PX5A 3SYRA 5TQ0B 4BZZA 2OLJA 3T1TA 1ZG3A 4UTVA 1JFLA 1VG0B 5DW0A 1D7AA 7REQB 4KO8A 5F51A 5C32A 4FUTA 5TPZA 2PYZA 3IKVA 4XA8A 4EL0A 3S44A 4LCBA 3BILA 5IMBA 2CVOA 3ONFA 5EJ8A 3JQAA 1Y81A 4WZBE 1SRQA 5I8ZA 3W6NA 4CM9A 3RODA 1DZIA 4B7UA 2GXQA 2AHRA 2RK6A 2FTKE 5C7IO 1NVVR 4LQCA 3U7EB 2C83A 3BJRA 4JDPA 5FXMA 3WGOA 3GWGA 2G3YA 1ISGA 1M74A 2B69A 3FJYA 3LXRA 1V7PC 2ZJ6A 1ARZA 3H2SA 3N9IA 4FKZA 1XAHA 2XHEA 1W0JD 3L49A 3L05A 3B9QA 3WK7A 5CW2A 2NOAA 3ES9A 4GGMX 2HA4A 3I52A 1X1BA 3LF2A 2GO1A 1O54A 2RGWA 2V6GA 2VNJA 3Q12A 4FS8A 4ALMA 1UKAA 3QKTA 2CHGA 2WHRA 3IT2A 4ZVVA 1FIUA 2Q4EA 3QKRB 4TTIA 1Z7BA 1RYYA 2W6ZA 2EQBA 2TS1A 4HWSA 3NOQA 4JH0A 2AG6A 2PYDA 1GVNB 3L7LA 3WLSA 2HLPA 5EP2A 4HFMA 1JPUA 3FZYA 1KBZA 3SBOA 2JH3A 4JC5A 4AN4A 2FDCA 4YV7A 2QRMA 2GPNA 4FNGA 5AK5A 1RAIA 1UBMS 1ESZA 1MAVA 2BDUA 2LV8A 3OJFA 4D9BA 2GHRA 4GL4A 2NYAA 2IXBA 3RT9A 1KHTA 4FCWA 3I04M 1NLFA 4N18A 2VA8A 3TI7A 3LV8A 1C0KA 2VAPA 1RXSA 2IH2A 1EK5A 3L1HA 2GTPA 1UP7A 1EH5A 1JW9B 5DTJA 3T95A 5BSKA 2AR9A 4QOEA 4WVLA 3W2EA 3NI2A 1Z06A 3FROA 3NU1A 2VT6A 2PNFA 3BQ9A 1BYIA 1O5OA 3KJQA 5ENZA 1KYXA 3HYRA 3OT1A 1O9HA 2H0QA 1JGTA 3UG6A 4BRUA 2H7XA 1W29A 3D8HA 3NVMB 2C2KA 4LYFA 5FB3A 3QUQA 3K0AB 3D3JA 4ZQCB 3LDAA 4N90R 3FOAA 4YQEA 4D7AA 4GOMD 3KTOA 2ZI9A 2VK8A 2EW8A 2C95A 1XE3A 4YI5A 5E1BA 3EC2A 4FYKA 1YXMA 1EFRA 3DAOA 1PL8A 3DFIA 4DIMA 2ZWIA 4LHZA 3U0VA 2I3AA 3SE7A 5AI6A 2DECA 2V3WA 3TR6A 2C4VA 2A57A 1CSEE 3ZGVA 4CTKA 1SK8A 4OY3A 1X74A 3I04A 4LDJA 2HWYA 4HVTA 1UKZA 1MJ5A 1XMSA 3KEFA 3WNZA 2R68A 3B1FA 4AY5A 2QEQA 3PGMA 5JRDS 3QI7A 1O7JA 2DQYA 3ZVNA 4GP6A 3V8BA 1ZUNA 2CL0X 1LRJA 4NBUA 3SC2A 3SZ3A 3KEMA 4TSFA 4I0WB 3VKHA 1GCIA 4NQRA 4PYRA 2Q50A 3G8AA 3U4MA 2O8BB 1YIAA 621PA 1Y4AE 3RG2A 1QGDA 1REQA 1TVEA 4PZPA 3NOXA 2UWIA 4IL5A 4K0RA 1LSOA 1MV5A 3R24A 3ZS8A 4KQ9A 3EJWA 1IVYA 2NXCA 3L01A 3OD5A 5CGZA 3BH6A 5F5NA 3D4IA 2NAFA 5CM8B 4YAJA 5JSYA 2P35A 2QPLA 3GJSA 1KTIA 3EDMA 2O9JA 1E99A 3UAXA 3D5QA 4WLOA 2DWQA 1GUDA 3N7UA 4M1OA 3W04A 4B2IA 4C7VA 2XXAB 3EIUA 4NJMB 4O4IB 1CQJA 3UHFA 3NIGB 1PKEA 4FFPA 5JS1A 2HK8A 4MICA 4QHTA 3ZCQA 4FYVA 2VH5R 4GFDA 3EE6A 2C7GA 1LZKA 4JB2A 4KGXA 5BYJA 1NZFA 4O2BF 2QOEA 5IKOA 3Q72A 3CR7A 4YRSA 3U17A 1XLTA 2IA5A 1N2XA 4QU5A 2Q2OA 4U5XA 3VU9A 1JFVA 1XTUA 1EVIA 2EVWX 1KYVA 1XI2A 3RU3A 3HVUA 2P75A 2ONKA 1XL0A 2ZRCA 3IT0A 4EKYA 1W36C 4C4PA 4GEKA 3WL5A 4B48A 2JFBA 4H2DA 5FFFA 4KDCA 2QUJA 4TWZA 5TT0A 4NYMQ 2WIFA 3MVEA 1PTKA 3PSAA 3F7OA 1EAMA 4DVGA 1ZM2A 5BWNA 5ALDA 1FTYA 5EWMB 3BICA 4EQ6A 2JGNA 1BS9A 1GNLA 3FFWA 5ALHA 1L7RA 5C5EA 3DLBA 3ZV4A 2XZPA 2Y1FA 3NYRA 3IHLA 3OZCA 4XGIA 4DQ0A 2IOQA 3AF4A 3M4YA 1MQAA 2DKNA 4IH4A 3BMCA 4DA6A 3M1LA 4K9QA 5C1PA 3CNBA 3OP4A 1QIJA 1RKQA 2J46A 2VWHA 1PLKA 1P1JA 3SS7X 4FUQA 2G36A 1NI5A 2QB5A 2GCPA 2A0UA 2OAP1 4EG1A 3WLRA 3RBZA 1A95A 1QUEA 1ZI6A 2G9UA 2KE5A 5DHSA 1KI8A 1RZVA 1XZQA 3JWHA 3K1TA 3K3PA 1C30A 4DRXA 4PC3A 4MYHA 1QX4A 1PSZA 4ZFNA 5B3KA 4S04A 2BDEA 4L51A 3BFPA 4JOQA 3OHMA 3RSGA 5LMZA 1Q44A 1KY2A 1O95D 2SCUB 5FTKA 4HH1A 4BV8A 3B3QA 3C45A 4EA9A 1KEZA 1KZ6A 3IMCA 2DX7A 1DC7A 3AXSA 1K8RA 1UDWA 4N5IX 1TGYA 5AI0A 3VZBA 5CH5A 1V3TA 2Z3VA 4UXHA 2QRNA 3DVLA 5HF6A 1KERA 3MGGA 3SDSA 2LWIA 3ZHBA 2F3PA 2OFXA 4XGRA 4PQGA 2EYQA 1VG8A 4HEHA 3SNHA 4ZI2A 2ZJOA 3GRKA 2HK7A 4HDOB 5JDIC 1DQPA 1P9WA 2NVUB 4EUHA 2WVAA 5CT6A 1V26A 2B1JA 4MV0A 1KPHA 2XUIA 1OXTA 1Z25A 2JRLA 2A86A 2NU8A 3CB4A 2VRCD 1KARA 3PDHA 1AZWA 3WL4A 3SJ7A 3NDBB 1O2DA 2PL3A 5AK3A 5DGCA 4U9HS 4RTJA 2OBXA 2RHWA 1AUVA 4WRRA 3IUYA 2FZEA 5HX7A 2X9VA 1QKJA 4YP9A 4I8IA 4DR1B 1JIIA 5BW4A 5E9JA 4EG3A 3GMTA 2P3SA 4EMSA 3IIEA 3ETGA 4TXLA 2JGAA 4J0JA 5LYJA 1KQNA 1PR9A 3CM0A 3VNAA 4OHYA 2PLFA 1U2QA 4G9EA 2IX9A 2VHYA 1AJEA 1WHSA 3WGGA 3NH6A 1Y5RA 4ZT5A 4TV8A 5SY6A 3STTA 2C0CA 2D0OB 3UMBA 4RHEA 3F3KA 3DKPA 1WXGA 4ESEA 1RJ9B 2DLCX 3UXYA 1TC2A 4YMLA 4ZHQB 5HE8A 1DMRA 1HMYA 1IOWA 1VBMA 4LJKA 4XWOA 2I1LA 5BN3B 2I99A 5LNK6 3FDXA 4B0PA 4ODIA 1BH2A 2JK1A 3PG5A 4HTFA 1W48A 4GX1A 1GNRA 1MFPA 4O4HA 3X2FA 2CV0A 4IX9A 2EFDB 2JGJA 1FUEA 4QPDA 3RS9A 3TIGA 3WGZA 3EUAA 2OE2A 2FEMA 3DZFA 3QUCA 5FNVF 1RAGA 1X1SA 3G82C 1DOAA 2KJQA 5CG1A 1A3CA 2QVZX 3R7BA 1SUFA 1U7TA 4GR5A 2HSGA 3HYCA 4A16A 4DPLA 3KL2A 1GILA 5GV7A 1DAEA 3LBNA 5H16A 2ZRQA 1KVQA 2W2NA 2C20A 2BDTA 3AUYA 3NM5A 3PUIA 5A6VA 4MOWA 4LCJA 2Z2KA 3ZGOA 1CF2O 2FSGA 1U0GA 2CK3A 5EZYF 4F8JA 2JCGA 3TLJA 2WKQA 1C9JA 3CF6R 1KP2A 1XA0A 2FN7A 3SKVA 3QELB 3RARA 3TDMA 4E94A 4YN0A 5EY5B 3HXOA 1KR2A 1KFEB 1J00A 5AKXA 5F7OA 4FSDA 3FTEA 1BXZA 4FW9A 4HLDA 5EJFA 1EWKA 5HRUA 1Z2PX 2XLBA 3ZQ4A 3EY9A 1TMKA 2CDAA 4J16C 3GRUA 3JATA 2NO7A 1FS4A 2APJA 4OU5A 1V9SA 5HWSA 2C2OA 1DU4A 4HXGA 5A9SB 1YT5A 5K8LA 2YN0A 1OWOA 1P6UA 3FE2A 2J48A 3SLKA 4TLEA 2PA3A 3MT0A 2R8YA 2R87A 3EXEA 3O4JA 4LHXA 1I24A 1GZSA 3OMLA 3TBKA 3U7FB 4GI5A 4KQEA 1XGKA 2XVZA 4P58A 1E7YA 3IX7A 1HT2E 5G0VA 1ECLA 1E5XA 1ID1A 4X1IA 3AT1A 2F1IA 1C4KA 2B0JA 3QSYA 3I9NA 3V1NA 2UUAB 1U31A 2R2AA 2ZP1A 3T4XA 4X91A 1T8WA 5EHNA 4G4GA 2ZM5A 4M4RA 3NGMA 1QYRA 1XN4A 1YB5A 1Z29A 4P38A 3SLGA 4YQFA 1PS9A 1HUQA 2A5FA 2D8AA 4MQ4A 2L2QA 5KU7A 3ROXA 3TB6A 2C29D 4HDMB 4E4DR 1QF7A 2PH3A 2XGMA 4CG0A 5CMLA 1Y6ZA 1MRSA 2GFHA 1YRLA 3CY6A 4HBGA 4IHJB 5HQTA 3C43A 4N8DA 3ULKA 3H9BA 4UE2A 1ZP6A 3N0RA 1EK0A 5KYNA 3V1MA 2W37A 4K8OA 2JHCA 2VR1A 4WCVA 3RNOA 4EY7A 1E79A 4OEHA 4TLCA 4HWKA 5AI5A 4KI7A 2WWGA 3KPWA 4JX9A 2IS4A 1H5UA 2V45A 4RPGA 4LQDA 5TC4A 2DYKA 3AY6A 4CL3A 3T3OA 1MO2A 1WOYA 2I7XA 4QE3A 5JQGF 3DV0A 1RHMA 2Q1SA 1TB4A 1YR2A 3ZCPA 2O23A 5JQWA 5H8WA 4QX6A 5EXEA 1ODKA 4GX5A 4EF6A 4PAGA 4WKPA 1PHPA 3TXYA 1PAUA 4YMUA 2PYIA 1Z5GA 2ATIA 3Q5GA 4Y2TA 3RVMA 3TAUA 2CY0A 2PKXA 3OT5A 4RMIA 3LKVA 1AKTA 2VJQA 4NARA 5DBOA 4YV1A 5JAHA 4A5OA 1VPVA 3CVWA 1H8ED 4BJHB 4UHEA 2ORED 4ZXPA 4BCBA 4EIWA 5CK5A 2ID9A 2RGEA 2KW5A 4P5EA 4DIEA 1GO2A 4L3WA 4ENRA 3K4QA 1N6IA 1BKYA 1XZHA 2O2ZA 3B60A 4IQ4A 5KNBD 3JQ6A 3HO1A 1R4NA 3E9CA 4ZVNA 5KX5F 1QONA 1YBHA 1EP9A 2IGTA 4QDUA 3L92A 4RJTA 1X7WA 1TLFA 3K0HA 1H05A 2QF7A 3EPRA 1G7RA 4EYSA 2M32A 4AFNA 3MWDB 4K6CA 4IRMA 4RD0A 1C3OA 3MJEA 1G66A 1YASA 4Q1AA 4DLZA 2JLVA 2XSZA 3DBHB 1IG0A 2K87A 1XRSB 3AZQA 3D64A 5JJCA 3SZLA 1TIBA 1NG9A 5E4JA 3EPPA 2DR3A 1JH8A 4R1LA 4UBJA 3UXEA 3FVVA 1AVTA 1I4DD 3LT4A 2YJNA 4GWKA 4MITA 2IODA 4RO0A 2BFNA 4FOLA 3AJEA 1FJXA 1DC5A 1G42A 2NTYC 3GBVA 3NWJA 2GWHA 1RE1A 4U00A 1JFSA 3AETA 1QP0A 2DAPA 1UBOS 3I2KA 4Y9UA 4C6TB 3I62A 4TMWA 2JGRA 2P6PA 2RHLA 4I66A 5FI3A 1OVMA 2PK3A 4P9NA 1UC5B 5D86A 4H6PA 4Z1OA 1YKGA 2G4VA 1HT1E 3G59A 1S8AA 3HVRA 3SQWA 1MAHA 1ZNYA 5H80A 2X0DA 3F6CA 4KGGC 3VYWA 1RZRD 5K45A 2PZFA 4JLUA 4BPBA 2ORWA 2ZYTX 2X41A 1L7QA 3G49A 3JASA 3OE1A 4XCXA 5HMMA 4MUYA 4QUEA 4HDSA 4C04A 1W34A 3L7MA 1IBMB 1IN1A 1ABEA 2B37A 2R5FA 4HHEA 3KSUA 1AS2A 4QQFA 3N2ZB 4LSGA 5EMLA 1T91A 1T9ZA 4CXMA 4PGHA 4WK6A 1GLGA 2Q5LA 1OKKA 1A96A 5JISA 4J91A 5KSOA 3O4GA 2DP4E 2JATA 4C29A 3AJRA 4P84A 1R6XA 5HBGA 1LLUA 2EF1A 2PEZA 3LLMA 2A9PA 2FZ5A 2B7BA 3RR2A 1Q83A 5D87A 3DOEA 4YR7A 5HCUA 1WXEA 1TEXA 3U44A 4HYQA 4V1CB 3WO0A 4F9EA 3HUEA 3QA9A 3RCBA 1OBCA 5C81A 4EAAA 1ZESA 1CEXA 3GQBB 1RKVA 2BMVA 2HHAA 3KT6A 4MCHA 3HCBA 4JU9A 2EWMA 3RIGA 2GDZA 4U9UA 1PTJC 2KSQA 1N1GA 4NOMA 5E4FA 5LB2A 4DY6A 4F4DA 2IH5A 4HAUA 1KU6A 5SZHB 3BRWA 3HO6A 4G5XA 4BGUA 3OI7A 4NIMA 5BWMA 1R5OA 2UXCB 1E3WA 2CNWD 2H1FA 4PZDA 3S55A 4BQNA 4JOBA 4IIXA 4MQ6A 4R1UA 5IUJC 4FQ5A 3KETA 4H7FA 2G17A 1U9ZA 3M6FA 3WOVA 4BRWA 1J39A 1NUSA 3ZGXA 4MYTA 2ZUFA 1MORA 1TOAA 2ZJ0A 5G02A 5A3SA 5B6PA 1K06A 2FW1A 1E9FA 4BO7A 3JAMA 2PN1A 4CBVA 3BHIA 3Q85A 4QD3A 1LBQA 3AOEC 4UBMA 5G2OA 5J5CA 2JFPA 5AKEA 1SVSA 3TQCA 5C46F 5AVXA 1DG9A 2Z6QA 1RPTA 4IZOA 4PYNA 1JEQB 4P86A 1V5IA 4P7FA 2DJIA 3CN9A 1GGNA 2F48A 3MGKA 1Q7BA 3QF4A 4YJ2B 5JNRA 4WZAE 2JIRA 1RCFA 4P3YA 2IP2A 2BTOA 4OVKA 1W7AA 4UUAA 4ZGGA 3EOZA 3TS1A 4MDYA 3WNDA 1X14A 2GCIA 3GOQA 5I3CA 2JZCA 2WLTA 1GZDA 1HT0A 3BD8A 4HDQB 4BEJA 1SCUB 2P5YA 5FOSA 2Q29A 4CPDA 4AKGA 1DI0A 2REOA 3KUCA 4Q12A 3TJRA 2PS1A 1QGAA 2B1IA 4LBWA 4KUEA 4G0XA 4MAAA 1ECCA 1D4VA 4AD8A 3UUWA 4PQRA 2JJ8A 2HLDD 2F9FA 2EG9A 1X80A 2R4UA 1E9EA 1BHSA 3SFVA 1EBBA 1J33A 1V1RB 2HCJB 5EIXA 2Z6AA 4TKZA 4TZ6A 1A5ZA 4GOJA 3NJRA 1JZTA 3B1KA 4IDBA 4XX0A 3J81k 2C7PA 4PYKA 3AY7A 4GAEA 4ZVOA 2XQVA 1OC2A 2G7ZA 4ATNA 5BT8A 4IMRA 4NBTA 1KZHA 4CI9A 2ZPUA 3V2IA 1MVNA 2FDRA 2D7DA 1EX7A 2OECA 4V38A 3F67A 5EVJA 1RWBA 1Z62A 4H18A 5BUSA 4RVSA 1RVDA 5AKJA 2YY7A 1PJCA 4WBNB 3DG9A 2VNKA 2H7VA 3LCUA 1R4AA 3LY9A 5LM3A 2PLAA 3A4NA 3WIBA 2AE1A 4GPTA 1C1DB 2ZAOA 3K9WA 1PL0A 4V3CA 3JX9A 2QTNA 1L7AA 1CUZA 1DS6A 1DUVG 1V1JA 2EJTA 3HDGA 1R9MA 3SF8B 3VPBA 4AS2A 2B3TA 1KDRA 4LVNA 1F5SA 3VR5H 2GAOA 4UOZA 3VSAA 1NBOA 3CE6A 4LRQA 4MTLA 1XZCA 4L5BA 4KR3A 1C3JA 2AOTB 1TAGA 2D4AA 2FZWA 3KTAB 3LPLA 3PHBE 3C3DA 1NUTA 2VXBA 2NUAB 2DLDA 2XQIA 2X23A 4AY2A 5K0TA 1NASA 2Y0DA 4K6OA 4OL0A 1H2WA 5K99A 2QTWB 3NDIA 1C4OA 5IC4A 3KJHA 1GV1A 4IS2A 4RXTA 4RKYA 3OPXA 4ALIA 2GYWA 2V7BA 1SXPA 4DIBA 1KZ7B 4GM0A 2QVGA 5ALQA