2E4WA

Crystal structure of the extracellular region of the group ii metabotropic glutamate receptor complexed with 1s,3s-acpd
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
538
structure length
518
Chain Sequence
RREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDNYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNICIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAANRVNASFTWVASDGWGAQESIVKGSEHVAYGAITLELASHPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQCSLQNKRNHRQVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPQTTKLCDAMKILDGKKLYKEYLLKIQFTAPFNPNKGADSIVKFDTFGDGMGRYNVFNLQQTGGKYSYLKVGHWAETLSLDVDSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYLVDEFTCMDCGPGQWPTADLSGCYNLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Metabotropic glutamate receptor 3
publication title Structures of the extracellular regions of the group II/III metabotropic glutamate receptors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 162
structure length 518
sequence length 538
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
A PF07562 NCD3G Nine Cysteines Domain of family 3 GPCR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.50.30 Mainly Beta Ribbon Tumor Necrosis Factor Receptor, subunit A; domain 2 Tumor Necrosis Factor Receptor, subunit A; domain 2 2e4wA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2e4wA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2e4wA01
4WZZA 3JVIA 3NHZA 2MSKA 3O1JC 3OO0A 4H3KB 4MS4B 4RK7A 2B4AA 4F06A 3H5IA 4YGXB 3KJXA 1JYEA 4D6XA 3RVOA 4RZSA 1SXIA 1BDHA 2PMCA 1KMIY 3NNDA 1F51E 1D2AA 5C5CA 2WJWA 2YHBA 5JNWA 1Z17A 1P2FA 1CHNA 4JASB 3OM1A 3SG0A 3T8YA 3KLOA 1KRWA 1LBHA 1BVHA 2E4WA 3H1GA 4KVFA 4EYQA 4QICA 2QU7A 3K4HA 1XHFA 4MR7B 1PUXA 4XASA 5DTEA 2MSWA 1PNTA 4YCSA 4MLDA 3EDCA 1DCMA 3Q15C 3I5AA 3LOPA 4MQFA 3DGFC 4IRXA 4MQFB 4RKRA 1ZAYA 2IPAB 3H5OA 4JAVC 3O74A 1VPWA 4Z4FA 4Z9AA 1E6LA 1ZGGA 2IDMA 3LUJA 3D8UA 2FEPA 3Q9SA 6ABPA 4O1HA 2MYUA 4RXTA 4W5QA 2W42A 3QELA 4LE1A 5DCLA 1AB6A 3QELB 1USIA 2WB4A 3HUUA 4MS3A 5ABPA 4IGAA 1NXXA 1JDNA 1W25A 4MS3B 4EVQA 1GUDA 2JB9A 1NXSA 1PHRA 3KLNA 3MIZA 4MQEA 3H5VA 1FFGA 3EGCA 1T34A 3A0RB 4MQEB 3RVKA 1Z2EA 3N8IA 3CZCA 3GWGA 3RVJA 1P6UA 2A9OA 3SQNA 5BRAA 5KQLA 2VYCA 4YRZA 3OQNA 4KFCA 1MB0A 3LUKA 3OLXA 4FB4A 4OBBA 1RXIA 2QVGA 3A3KA 4PICA 5DKFA 3I45A 1E6MA 1EHCA 2JVIA 4OLAA 4S05A 1KGSA 3H5LA 3OMXA 3M9WA 3N75A 4LZLA 1LBIA 2CWDA 2FSPA 3O1HB 4MRMA 5CNKA 2FN9A 3RVRA 1WETA 3DBIA 1NXOA 4MRMB 3UUGA 1BDIA 1XWWA 1J56A 3FFXA 1JF8A 3IP7A 5IBQA 5T3YA 4KK4A 4MS1A 2RDMA 1JLKA 1ABEA 4MS1B 2L17A 1YS6A 2FMHA 4RK4A 2FLWA 2LUOA 1Z15A 2IPNA 4XAQA 3DLBA 3HDGA 1RNLA 1JH9A 3RVNA 4Q6BA 2E4ZA 1YTUA 1QO0D 2R47A 3B2NA 3GA5A 1H9CA 4UHKA 3RVPA 5GOTA 3F73A 5B3JC 2MSLA 4OATA 5GQSA 1YMUA 5TPZA 3SNKA 2LPMA 3EODA 4E7OA 4PZ0A 1ZGZA 3L49A 4YS6A 4G0MA 4LDAA 2X7XA 3H6HA 1MVOA 1U8TA 1UDRA 3LKBA 4JA2A 4RWEA 1M2EA 4RU1A 2TMYA 3UKJA 3OLWA 3A0UA 1Z13A 1GLGA 2NZVG 4EYGA 5HSGA 2IYNA 3A10A 2NUBA 3HK2A 3KKEA 5EWMA 3GL9A 3HV2A 1YVUA 2E4XA 4QPJC 5EWMB 5KQGA 4KPYA 2LIVA 2O20A 3F6CA 4WUTA 2MYPA 1VLZA 2NT3A 3EQ2A 1RXEA 5BRJA 2XDYA 5DGCA 3QLUC 2L18A 4DQDA 1QPZA 1BAPA 3Q7SA 1SXHA 1TVMA 2LP4Y 2Q5CA 3LUHA 4LE0A 3RVSA 2PUEA 2FVYA 5T7BA 2RGYA 4HNQA 3T38A 1QP7A 1GUBA 1I3CA 3QLTA 4KK3A 4RK1A 4YWHA 4O5AA 3FFWA 4NV3A 2JCGA 3C3MA 3G1WA 4LX8A 5BR1A 2QVCA 1BA2A 2I6FA 1GCAA 4CBVA 4Z4IA 1JFVA 2GWRA 2PL1A 4HYEA 4RKQA 1ZH4A 3GYBA 5FWXA 5TE9A 3RVLA 2BGGA 1Y1LA 1M5TA 2CHFA 4RSMA 3I42A 3KSMA 5FWXB 5HM6A 3Q41A 1MIHA 4KMRA 1D4ZA 2HSGA 4G86A 4H60A 2WWVD 4B09A 1LJLA 4KNYA 3IPAA 2PAFA 4TN5A 3VNBA 5JS2A 3CNBA 4QYMA 3GRCA 4MR8A 2HQBA 4WT7A 2KYRA 3KCNA 4MR8B 1YMVA 2PUFA 5HQJA 2DRIA 3L6UA 2ZAYA 3M6MD 3QLUA 4D6YA 3HS3A 1EAYA 4TMYA 1FFWA 2VUIB 3TB6A 4DN6A 1JBEA 1A2OA 1U2PA 3ILHA 2B1JA 3LUDA 4Y9TA 1JYFA 1JHZA 4E7PA 3QK7A 2A9PA 1NXWA 4ZJPA 2AYXA 3LFTA 2QXYA 2HQOA 3HM9A 1LK0A 1DG9A 1U04A 3GBPA 3H1FA 2FXIA 2ID9A 1JL3A 3DLHA 3EULA 2H3HA 1F4VA 2F8TA 1JFSA 1ZVVA 2MYNA 3RVQA 2GX6A 1NATA 2JBAA 3TO5A 4LE2A 2JBAB 4UHJA 4N47A 1DC7A 4KRFA 1NTRA 3R0JA 2IKSA 3EAFA 3O2JA 1EFAA 2PL9A 5IC5A 3KTOA 3QX9A 2AYZA 2FMKA 3BRQA 1QP4A 1NXTA 5EWLA 1ZESA 4ZYLA 3RQIA 2L2QA 4TLLB 5EWLB 4TLMB 4JOQA 4ML3A 2FKAA 5CHYA 2R4QA 3LTEA 4MYRA 3GV0A 3TMYA 4S04A 2WRZA 4GPAA 4YP9A 3NHMA 5FBKA 5D2CA 3N53A 3FGZA 2QV0A 4IILA 1BDJA 2N9UA 3URMA 4H3HB 3HVRA 3KYJB 4YLEA 3ROFA 2E4VA 3W9SA 2GI4A 1R8JA 3GBVA 3BREA 2E4UA 3LKVA 3CS3A 2RJNA 2PLNA 3JPWA 1ZH2A 5FBHA 1DBWA 2HPHA 1PEAA 1AB5A 1M2FA 1ZITA 5I4CA 4N41A 2OQRA 3IDOA 3Q7TA 4L4UA 1MB3A 3HEBA 4Z4HA 5IEJA 3FFTA 4P98A 5JNUA 3KS9A 3SAJA 4Z4CA 3EJWA 3CHYA 3G85A 4MAAA 4JB0A 1FSPA 1P8AA 2OENG 4DADA 2A9QA 1YK0A 3OO1A 1A04A 3C3KA 1E2BA 2JVKA 1VRVA 2PKXA 1TJYA 3O2QB 2L19A 2FW0A 1ISSA 4OG2A 4RY0A 4ETMA 2VK2A 5EWJA 3OQOA 3QX8A 5EWJB 2FQYA 3LMKA 4G0XA 1ZHHA 4ZMSA 3JS5A 1QKKA 3S99A 4G0PA 4Z4EA 1Z26A 1JX6A 2PUDA 5IUJC 2R25B 3BBLA 4ETIA 3KHTA 3N0RA 1VKRA 1HEYA 2PUCA 1YIOA 2NZUG 4LDZA 1M5UA 2HQRA 3H75A 4KREA 4JP1A 5KI6A 2FTKE 3RVMA 3M9XA 1NXPA 1DC8A 3MF4A 1Z16A 3HXMA 1XHEA 1Z18A 3FMVA 3CU5A 1EWVA 2JVJA 2QW1A 3F7NA 4WWHA 3MYYA 4HNRA 5IULC 1EWKA 2FN8A 3HZHA 4L85A 3OQMA 1ZN2A 3T6KA 3JPYA 4N03A 1DBPA 1U2QA 2WY2D 1ISRA 4EVRA 4ZPJA 4RY9A 1E6KA 4Z4GA 1GCGA 2NT4A 3NNNA 2QR3A 2RJOA 3DZDA 4F3TA 1DCFA 1EWTA 3CTPA 3NNSA 4RY8A 2PE5A 4MGEA 3E61A 4JB2A 1CEYA 2WJAA 2V0NA 5JNVA 5C5EA 5PNTA 1DRKA 1C4WA 4RK0A 4N0QA 4IF4A 1DCKA 4G97A 1D1PA 1Z25A 3D02A 5FWYA 4O1IA 2J48A 4Q7EA 1QNLA 4PEVA 4RDCA 1D5WA 5FWYB 5KQMA 3KG2A 2JRLA 1SXGA 3QLVA 4KZKA 4G0OA 2FEWB 5KC8A 5JNTA 2PUGA 2P4UA 1C0EA 3CLKA 3O21A 1RZRA 4W5OA 4G0ZA 5F64A 4MR9A 5CNJA 4N0PA 3UK0A 1ZDMA 4MR9B 1YK1A 3LUFA 3GT7A 5IUKC 5IUNC 3H5WA 3CG4A 3K9CA 4MR7A 1IIBA 1USGA 1JDPA 3HSYA 3DGEC 4EGSA 4D74A 4F12A 5KQPA 4EVSA 2IPMA 2YHAA 4PE5B 1NXVA 5TPWA 5TQ2A 5TPWB 2ZWMA 4W5NA 2GKGA 5TQ2B 5DLEA 1DZ3A 3HO1A 3CZ5A 4WXEA 3C6QA 4RV5A 3N6VA 1S8NA 2FLKA 4EUKA 4NCBA 4N76A 1OXKB 4IMJB 1QQBA 4OTZA 4EYKA 3CG0A 3IPCA 3E3MA 5TQJA 3C3WA 4KQCA 4M88A 3H5TA 3OLVA 2QSJA 2E4YA 3F6PA 4KV7A 2JK1A 4ZMRA 2QZJA 3IP5A 3QEMA 2MYTA 4NICA 2A9RA 3QEMB 1Z2DA 5KC9A 1K68A 3MQ4A 2CHEA 1RPJA 5CNIA 3SM9A 4OLBA 2IPLA 4GNRA 3H6GA 1W9HA 2CD7A 1P6QA 2HJ9A 2F8SA 5JS1A 5TPZD 3O1IC 4NQRA 2GBPA 4FE7A 3FDFA 2PUBA 4F8JA 1FFSA 3CRNA 2PJUA 1PEYA 2IOYA 1KRXA 4EY3A 1D1QA 3Q7RA 4RK5A 5E3JA 2PUAA 3T95A 1NY5A 1TM2A 1FQWA 3MA0A 7ABPA 5KWSA 1QMPA 3JY6A 2P9HA 1DBQA 1DRJA 3HCWA 4G0QA 1OXBB 4MLCA 1DP4A 6CHYA 1JFTA 5JNRA 1APBA 2FMFA 3O75A 3C97A 4IMIB 3LUCA 1SRRA 4ETNA 3TX6A 1Z12A 3RH0A 1L5YA 1ABFA 1DJMA 4XLTA 1TMYA 3N0XA 3OM0A 1SD5A 4RXMA 1B00A 1YS7A 1QP0A 2R48A 5CNMA 4Z99A 3JTEA 2VUHB 3HDVA 4W5RA 3CFYA 4W5TA 1L5ZA 2M1ZA 3NBMA 1PNRA 5ED4A 3MM4A 4XFKA 3QEKA 3ILYA 1LJUA 4LRQA 3MMNA 4Q6WA 4KQ9A 1URPA 1QO0A 1CYEA 3ROTA 3CKMA 3EQZA 3LUGA 4P1ZA 1U0SY 3N0WA 3QLVC 3IP9A 4F11A 1QQAA 4YR7A 8ABPA 1K66A 4Z9BA 4NCAA 4YO7A 3BRSA 3OLYA 2M98A 2FQXA 3H1EA 3HUTA 2FQWA 2WMYA 4Z0NA 3IP6A 5BQ3A 5IX8A 1JWLA 3KYIB 3I09A 4RXUA 4G0YA 3OLZA 1ZY2A 1MAVA 3TD9A 4XXHA 3P9YA 3OMWA 4RS3A 1TLFA 2LBPA 5IEBA 4FE4A 4EYOA 1A0OA 4PYRA 2FEKA 4HNSA 3SY8A 4RK6A 3JVDA 3VNAA 5TQ0A 4WXMA 5HKOA 4QYWA 5B3JA 3LUAA 5TQ0B 9ABPA 4YV7A 3O2SB 2ID7A 3HJFA 5JNSA 1RZRD 3BILA 4MPTA 4XARA 2FMIA 1USKA 2H0AA 4MS4A
chains in the Genus database with same CATH superfamily
2B4RO 4U0KA 1SVMA 4IEFB 3SEQA 2EBHX 2ENWA 3D8SA 2D62A 3L7OA 1BW9B 4ZDIA 2V7PA 2JAXA 4DIMA 2Q5OA 2P1ZA 5AVWA 5JTTA 2ZETA 4R40A 1XC7A 3U44B 2B61A 5DHQA 1Y3DE 1JEYB 2UXDB 1T3SA 5C5CA 5CT8A 3AJEA 2PZ8A 3IR7A 4LWQA 2WHPB 1QO7A 1Z4OA 4Q93A 4GECA 1Z5NA 1JGTA 1SKBA 2ZSIA 1T3GA 3JQ9C 3PEUA 5HCNA 3NTOA 3ZD8A 1DWOA 3UT5B 4B31A 3C24A 1OH6A 2O6HA 2X13A 1U0JA 3DE3X 3ETLA 1JKJB 5C4IA 2UUAB 2C3MA 2UZ1A 4G6ZA 4JDPA 4YCSA 3IMKA 2O5EA 2G76A 1OV4A 4D57A 1ZO8A 1R27A 2CHUA 1V16B 2XHZA 3A4LA 5KX5B 2CNNA 3MWJA 3IUQA 3KOXA 4RKRA 1GKKA 1D2HA 2YN0A 4ESVA 2CLKB 1P0PA 2IQ5A 1O8CA 4LVOA 3EXHC 1J8DA 3M6VA 5AKXA 3GGDA 3B9RA 5CUQA 1A7JA 1A4UA 4XD7A 2D7CA 4KU4A 1WO8A 2DR2A 3PJDA 5D3MA 4MUEA 3F5DA 4KNVA 1GCIA 1SU8A 2G0NA 1E1DA 1RSZA 3IAXA 3NWOA 1DINA 4IGFA 4NCJA 4AL4A 2CJFA 2L42A 1ML4A 4BBPA 1J99A 1ZWLA 3OZ7A 1PJTA 3ZNNA 3S7TA 3H2KA 1ND6A 4Y2GA 2R7AA 4C3UA 2GZAA 3QYPA 3WJ2A 1QOQB 4OGFA 1XEFA 4DNPA 2ZWOA 3R0IA 4OHZA 3BRCA 5ALKA 4BRUA 4IUCS 1W59A 2HJHA 1HOTA 2VYCA 4IIEA 1E58A 3BXPA 4K8OA 1HOXA 1IEVA 1G59A 5LBUA 2OESA 4QUIA 2MR5A 3AERB 4B7UA 1K5PA 2MJLA 4F3NA 5DYIA 1K08A 3MTBA 3PGMA 2QMOA 3RUHA 4S05A 1MX3A 3AUUA 1RPTA 1LU9A 2GERA 3WK6A 1P18A 1W94A 2OOKA 4N1AA 2H9YA 4MRMB 3IV7A 1JUDA 3LA8A 3MIIA 2VL7A 4MI3A 1TTTA 2J67A 3E4CA 1RQLA 4FFVA 2EBFX 4K26A 2HZBA 2C4MA 1V6AA 5AHXA 5BXYA 4IY1A 1KY5A 2FZVA 1C1XB 2DFTA 2WJHA 3PRYA 2NLOA 4C14A 4H4EA 4P36A 4MS1B 2QVZX 5E8RA 4CQMA 3MCVA 4YT8A 4XYBA 1I0LA 1FTSA 2XIQA 3AEQA 1JHVA 3PF8A 1J0DA 4D96A 2Z9CA 3E9ZA 4GZMA 4OXQA 4BNNA 3OPXA 1G38A 1HE2A 4JJGA 4TOIA 1T5OA 1ZIOA 1LTHR 3GJZA 3KEGA 3EGIA 3R3XA 2VWHA 1S0UA 2OBXA 2ZXFA 4B1FA 9LDTA 4DOMA 4D98A 3ZKWA 4IZHA 1KJZA 2MSLA 4KMMA 2COEA 5GQSA 2ZXUA 1E5XA 1F2TB 2DJIA 2GJSA 3P0RA 4TSKA 4ZVRA 5JZSA 1FSGA 2DBQA 4ONEA 1KMHB 2VCEA 5IXYA 1NBEA 1L1FA 3H6HA 3A70A 1G4AE 4KQHA 2ICAA 3ZDEA 1CB7A 1C4KA 2BKAA 4LS3A 4BJ5A 5IM4F 1UM8A 4IIJF 4FEEA 3UKJA 1XZMA 1B8NA 1FS6A 2PZKA 2QQFA 2H9IA 2XE7A 1KVRA 5F5XA 4CLEA 4AMVA 1NKSA 4DT1A 4MVJD 4UEWA 2QTVA 1I6LA 3AC0A 4CMIB 4F2GA 5KMGB 1ID1A 2YWHA 3FNGA 1SULA 3LZCA 3PFFA 3ZC3A 2H2GA 1L4BA 4K9LA 2GH1A 3KE9A 5FORA 3NAGA 3RRXA 3HJGA 2JLYA 4KOAA 3FZNA 1WB5A 1UKEA 3CE9A 2QR6A 4OGWA 3S2ZA 1V8DA 1QQTA 4RK1A 1RXWA 2BTEA 2WJJA 3C3MA 3EQ9A 2XXBA 4L08A 3UJ7A 2F6RA 3NBKA 1ISPA 3GLQA 3A25A 2R87A 2Y1WA 3ML1A 1BA2A 2GJ4A 3NHFA 1PLJA 1IHPA 3HO6A 5JSUA 2A9KA 3ODGA 1JDJA 1Q14A 3I2HA 3CSDA 3RVLA 2XVXA 1LV7A 1LPPA 3DM9B 4CIYA 1ISHA 3N2YA 3MMPA 2Q9UA 4H60A 1NRIA 3ESZA 1KVUA 1P3DA 2R6AA 5C32A 3QFTA 4OY3A 2GMWA 3FMIA 5IT0A 4QBHA 3DHEA 4LSMA 3V3TA 2Q46A 1ONOA 1UJBA 2PT7A 1CJKC 2P3QA 2RG1A 1T4CB 4ZVUA 1QIEA 1DAEA 3U9TA 4B74A 4KN6A 1PG5A 4DV6B 1UMBB 1JW9B 3T4EA 2V97A 4QLAA 5AM4A 1RWXA 1R88A 1W5FA 3I23A 3GEGA 4XLLA 2UAGA 4JXKA 3MJHA 1EVJA 4M2LA 4I4TB 3B5IA 4QDKA 3HVHA 4Y30A 4Y9TA 5D5HA 2VTKA 4ISCA 3E6AA 3D3JA 3EIQA 4C4OA 2HA7A 3KQWA 3AQIA 3B9PA 2QBYA 3REQA 2IIVA 1KJ9A 3QKRA 4U5QA 4AMBA 1IC6A 1K3FA 3GUYA 4BWYA 5CBPB 1A9ZA 4KQMA 3KPJA 4L22A 1K86A 2BR3A 2G71A 4EF4A 4JGBA 3VJKA 1V96A 2OAP1 3MT9A 4G2NA 2O8BA 1Z5VA 1R9JA 3GRFA 5FBWB 5A2GA 5A9SB 2GX6A 4I8DA 4CM4B 2OM6A 3GRPA 3C7TA 1LQUA 2GCEA 1CZKA 1M10A 9LDBA 1SG0A 3DWEX 3R44A 1YQWA 5UKDA 4DSTA 4KRFA 4G9BA 2XXAB 1PQYA 5K7SA 3LHDA 2PGNA 3GF4A 3RUFA 4H6WA 1LI7A 5I7HA 1TQ4A 4AKSA 1NZFA 1XCBA 2YWCA 4G8BA 2MU1A 3AKYA 1IK4A 1JA0A 1RRPA 2A33A 2QROA 1CP3A 4BX8A 4ENVA 3A2LA 2JIBA 5DIFA 3CPSA 1LDNA 1RS0A 1DAPA 1LDYA 1BEEA 3EISA 4YTEA 5DU2A 4WA8A 1RRVA 3IO5A 5GJVC 2E37A 3U49A 5JZ9A 3MFYA 3OZBA 4R9UC 1OY1A 1L4GA 3RC1A 1OI4A 1Q0QA 3IT3A 2ECPA 4NOMA 3VTZA 2X9GA 4DQUA 2I6GA 1Z4NA 1DT3A 1PNVA 3DMDA 1CRPA 2HGZA 2JZCA 4NBRA 2Q50A 5IK2A 1QHYA 1RT9A 2CXXA 4XRRA 2ZG6A 4GBED 4OQZA 3TM4A 4DLXA 5BQFA 1UPBA 1T10A 4R7ZA 2O0JA 2PR2A 2GI4A 2Y71A 3IQEA 2ZFUA 3CLRD 3PDCA 2GEDA 3ACCA 3EIXA 2W4QA 2XB9A 3OZCA 3JPWA 1ZH2A 2IWHA 3OMLA 5FBHA 2YQZA 4G36A 1KKLA 3L1HA 3DPUA 3H11A 3PNKA 4RIEA 4XUGB 5EIBD 3RF6A 1XAJA 3V8MA 4PHFA 2VDVE 4DQXA 1ENOA 1G6HA 1S6YA 3GYGA 3WQHA 4RORA 4L5IA 3L8FA 2E21A 4LMAA 1DUVG 4MVYA 5FP0A 4AP6A 4HZUB 4MINA 3EJWA 3CHYA 2PFSA 3OCUA 4OL0A 1J06A 5DHTA 4FS3A 1SXJA 2Z8YM 4M55A 4XQGA 2B37A 3G6KA 3HBNA 4NOLA 2NUAB 2GM9A 3U3TA 4FONA 4JJ4A 4C29A 1G8JA 1QQ6A 4OHCA 3WLFA 2CF6A 2LE0A 3IEUA 4CLOB 2K2WA 1RMTA 1HE1C 1PS8A 2PGIA 4KQXA 3WMFA 2PY6A 1CEQA 4J03A 3UWOA 3K8QA 4AY6A 4I3GA 3SSOA 4DUPA 3GA7A 1RWOA 4NNOA 3UFXA 3SXJA 1J2UA 1L7OA 2GTPA 3HYLA 4FCCA 4MVJG 4FR5A 4O2BF 1M7HA 4B6OA 2ZSBA 4R1SA 1CP2A 2VSYA 2QAJA 5JVDF 5D7NA 1XT6A 2C5BA 1HRDA 3O8NA 1W34A 2X1HA 5AR1A 5FNVF 1DC8A 5IKEA 2TMGA 4CM8B 4YN0A 2FFQA 2GLTA 3WS7A 1Z4KA 1JT2A 4R9SA 4G23A 5JZBA 1N7GA 1KXZA 3HB5X 2ZCJA 4FMCF 5B53A 3TS1A 1ZGBA 2W8BB 2XGSA 1CRWG 3SC4A 2X8BA 3M1IA 5JYBA 3OQMA 4RIFA 3D4BA 2RSLA 1OLOA 2PX8A 1L8QA 3NBFA 5ED0A 5B30A 4OQQA 1CNFA 1U65A 3DH0A 2FWBA 2B98A 4MCJA 3L0YA 2V7QD 3UT0A 3WP0A 2BN4A 3AWIA 4JC5A 2I7DA 4PZLA 4TV8B 4TUYB 2W2LD 3AUFA 3PIIA 4GIBA 7REQB 1KP9A 4DC1A 3FTFA 2UWIA 2UVPB 2RJOA 1LB1B 4U6SA 5D3QA 1OIXA 5J5VA 3ZQUA 3M6IA 3V4FA 4HVCA 1JLRA 3ILSA 1CEYA 2FPLA 4WASA 3X0DA 2ZUFA 4OAOA 4BWVA 4E14A 4QPNA 3ZLVA 5LQAA 3DV0A 1C4WA 4OA8A 1CJCA 1SCDA 4GX2A 1D1PA 1Z25A 3GQVA 5JALA 4Y2YA 3AP1A 2ZVDA 2DOKA 2AN3A 2IITA 3PWKA 4H3VA 3PDUA 4JIGA 2PVCA 4LDQA 4QG7A 4ZT2A 5B3AA 3P9XA 1RP7A 3HU2A 2VJPA 3W6NA 2QNRA 5AUPB 1Z6YA 2WMDA 1Y9JA 4A0SA 1OB2A 2P2DA 2IYQA 2R1UA 3BZWA 4QJ3A 4CGZA 1UBKS 3E9RA 3O8BA 1SU7A 3OFVA 4MI9A 4YONB 3S40A 4D41A 1T6XA 2JNWA 5H59A 2VWQA 4YDQA 4HLDA 3TDMA 1Y9EA 2ZT6A 3BQ9A 1JKJA 1ML3A 1ODLA 1W29A 3RSSA 5JSQA 4CL0A 5CVUA 4WBNF 5KQPA 3OM9A 1XMVA 5CRIA 4IDOA 2FEMA 3TD2A 1V47A 4GLFA 4Z7OB 5J43A 5KJCA 1EPUA 1XZHA 3BN3A 4RHFA 4EA7A 5AW8A 1QC5A 2AA3A 3CZ5A 3QNMA 4EF5A 2IH5A 3H9GA 5HIKA 2WFAA 1S8NA 3L4SO 5C4GB 2QX4A 1PRYA 5AJVB 5HKAA 3A6EA 3E9EA 1PU2A 5BNFA 3VHXA 4N54A 4CKWB 1DX6A 2FZ4A 2B2CA 4OK6A 5A4MS 4RV9A 4M88A 2QSYA 1Z4LA 3W5AA 3IE2A 3MAAC 1ZG3A 5GV7A 4ZGWA 1MC8A 2CLIB 3TWOA 4DDKA 3RRZA 1FDWA 4B7CA 3G2IA 3QEMA 3GXOA 5C8XA 4PLGA 1AQLA 2XRZA 4MVJF 4ZZIA 4XE5A 4LY3A 1VIDA 2O8FB 2X8AA 1X8LA 1LK5A 2R6CA 3ORQA 5HKKD 2YWRA 3NKLA 1U0EA 3PA8A 1VHLA 4NJEA 1B8OA 5AW7A 1D7AA 2VHJA 4QGHA 1NJ8A 1W9HA 2G83A 2G80A 3QPBA 4HFNA 4K86A 4EUFA 4CIWA 4W7SA 5I01A 4CTMA 4DFDA 5FCDA 1A8PA 3AERA 3GFPA 5AVYA 1SZDA 2NACA 4DRXB 2RHOA 4TLCA 3PR1A 4YROA 4G5XA 1VLVA 3LQKA 1JLLA 3FUUA 4N7BA 3OBIA 1NLMA 3OU6A 1W4LA 2Q7DA 3IILA 1D7OA 1EVKA 4LVNA 1NY5A 4K6CA 2HNKA 4H1WA 3JALA 1SURA 2IOHA 2O3UA 3FIJA 3O2NA 4I3FA 5E1OA 5THXA 2NZJA 5LN1A 1JAYA 1NLUA 2ANCA 2X40A 2X2OA 3INGA 5IN5A 3U9LA 1ZK3A 1E9EA 4ZHQB 2GBCA 1K8XB 1D6JA 3BHIA 5AUQA 2Q5LA 4DTIA 4GL2A 3HO8A 4RJIA 4H3SA 3UAWA 1NXQA 4N5NA 2BBWA 2JGJA 3ZEAA 4EAQA 1BE0A 2ZRMA 2HA5A 2WEKA 3MERA 3RAPR 3GNTA 3F5QA 1EXNA 4MK4A 5EGSA 3KD2A 1A7KA 4M36A 2WB2A 3OD1A 5A1JA 2ILVA 3AIKA 3HDVA 3RK4A 3G7SA 4MQ4A 2D54A 5J4YA 1TYEB 4PYKA 1P4SA 4BB0A 1SEPA 4IGEA 1NWHA 4KFTA 4JJIA 2W6ZA 4IYJA 1A9OA 3T34A 4YN3A 1QO0A 2QUJA 1M6VB 4QBFA 3NVKI 5I9LA 4EW6A 5C51B 2ROQA 2OUIA 4XFDA 2JJMA 3C14C 3BD6A 5JC8A 5F4BA 1K66A 3R0ZA 3HMQA 1KK1A 1IK6A 4V1CI 4Q3LA 1Z34A 3MYRA 5FF9A 4HRVA 1F5NA 4X7RA 4EB3A 3K73O 5HNKA 4RXUA 3V1YA 1HYGA 2G0AA 4DF3A 2OHFA 5EIFA 2ZR8A 1Q19A 3ZW8A 1ZY2A 1DKNA 1MAVA 1Y3BE 1KXJA 4H0CA 4XXHA 3O26A 1VCOA 1IZ9A 1A9RA 1SFRA 2BI8A 1YA6A 1ZIXA 1FUUA 3F71A 1I0ZA 2K87A 1EM6A 4QFBA 4QEDA 4KQJA 3YASA 2CFTA 4DIKA 4F4HA 2RMKA 1O97C 3KZOA 1H4TA 1IXSB 3DZJA 2PRZA 4JUIA 2ZYIA 5CH3A 4E5YA 4KFSA 1AMNA 1W88A 3M4JA 3DDOA 1PK8A 5BR4A 5K3CA 2IYYA 2JAPA 1L7EA 2Z8YA 3R5XA 4YBRA 5E7QA 4I9GA 3W05A 1P19A 1YR1A 4FEGA 4R6WA 2FMIA 1K4MA 1UFOA 3HEBA 1M5RA 1EVZA 3WL8A 3O1JC 3OO0A 1QFSA 3CLTD 3ENZA 3VYTB 3X1JA 4EKEA 2ETXA 1P7VA 2NTNA 2P41A 1YDWA 2MWMA 4HP8A 4NG4A 3WHPA 4HV4A 3KL4A 1D2AA 2QKYA 2RHMA 1HV8A 4LY0A 3DUWA 1G6Q1 1PR0A 3KSAC 4INAA 2G40A 2VXCA 4PSAA 4I1SA 1Z6PA 2E18A 4L5YA 3LP6A 4RW0A 1F12A 2P3LA 1LTQA 4PRZA 1WHTB 4NCHA 2E4WA 1JEDA 1MB2A 1XZEA 3V9PA 3WXBA 3ZCRA 3OT5A 4AP5A 4U8GA 3VKVA 3RNOA 4KVFA 4I4TA 4LCEA 1ACLA 2CNOA 1SD1A 3N2ZB 1O6GA 5FI0B 4ZK6A 5KCZA 1L5HB 5HPYB 4HAYA 4BPBA 1NP3A 1OLSA 5FUYA 4RMNA 4EEKA 3NDRA 3ZZTA 2WQZA 4HY3A 1WUKS 2EERA 1H6CA 3O74A 4YMWA 4JUBA 2WF8A 4DRYA 5FADA 4R71A 1FJGB 1AK2A 1KYWA 3QFCA 4JCOA 3PBKA 5CXSA 4GGPA 1G8SA 1I7PA 3AFHA 1P2DA 2AZDA 1RPNA 2XB2A 3BAFA 3E9QA 4KXUA 3RD5A 3TYXA 3HUUA 3QU2A 3MTQA 4M98A 3VZCA 3BS4A 1JWAB 1NXXA 3LGXA 1Z3CA 2OCGA 4J7AA 4UMVA 1GUDA 1XI2A 4D3XA 1S1MA 3FTDA 4QHSA 3RSLA 3BIFA 1KOGA 4WNYA 1H8HD 2VDWA 3EY4A 2E6KA 1TAHA 2M6RA 2Q5EA 3SQNA 4ZQBA 2HIAA 3RUIA 4KFCA 2VF7A 2QRLA 2V1UA 4FQ5A 3WGOA 4GZ3A 1J0BA 1I33A 2PYZA 3EH2A 3FPHA 1A9PA 1MZPA 1M33A 2EJCA 2PZLA 5B2EA 3N8GA 1EHCA 2P2NA 2O2YA 3GT3A 1YF3A 5FJIA 3KZVA 2FSVC 4CHTA 4NR0A 3M9WA 4N6NA 4J0GA 4QDZA 4PSCA 2AJTA 2VPQA 4ITRC 3I9FA 2DSTA 1YRBA 1PT8A 2C9DA 2OLJA 4TTIA 3ZLUA 2D8AA 1TU4A 3FFAA 4MPRA 3GJRA 1J56A 4ZVLA 4ND8B 4WN9A 3KALA 3JQAD 3KAJA 1VA5A 5A2QA 2PT5A 4J1QA 4BLVA 1Z07A 3KR9A 4B3SB 1TU0A 4MOWA 5FA5A 2PWYA 4FGUA 1NMXA 4KN5A 4MGIR 5C9ZA 3GUUA 1A69A 3RU2A 4S1PA 4XDYA 1P0MA 2UYQA 1A95A 2JJ2A 3NIBA 3ZTYA 1CR4A 6REQA 1MT0A 3DLBA 4XAQA 1V4NA 4JJ7A 2CZQA 3AIMA 5DP2A 4K1XA 5TNXA 3ZEIA 4YPOA 4TMZA 2WSLA 4CQLB 5LR6A 1FIUA 4ZQGA 3HKBB 5L4LA 4XVRA 3FNIA 5DISB 1CULC 5CVJA 3DFZA 4JLVA 2V7GA 5EKXA 2AMJA 1UPXA 1MZVA 3MK31 1ESZA 3TZHA 4QD3A 2FETA 2VPTA 5T4BA 1O77A 1JAHA 3C4JA 2OM2A 4RMJA 1PS0A 4KHZA 1MABB 3DMYA 4GEGA 4A0RA 4AVYA 2JLVA 2IY9A 1Y42X 4DCVA 4CM9D 4E5DA 1R4MB 1GPUA 3TUIC 3WZMA 4CMKA 1H2XA 2AJ8A 1LWOA 2EIXA 5TJHA 3VI4B 4Y6GB 2WSYB 2G67A 3T4PA 2N1MA 4EHIA 2VDPB 4OAPA 1P7PA 4JU8A 7MDHA 3G5MA 3PX2A 2YZMA 4BK4A 4K6MA 4OQ4A 3PK0A 4J7CA 1YKSA 1FMCA 4RGQA 4JI7B 3GL9A 5A0FA 4LC9A 3SZUA 3UK1A 4K40A 3N87A 4R1PA 1XD2A 2QY9A 4S2UA 3AHCA 1CUCA 4TTQA 4BNGA 3COVA 5BRJA 2XDYA 5JR3A 2I6XA 4MYCA 1GPAA 4BP9A 4HGOA 1U99A 4LE0A 3W5BA 2QZ9A 2B7BA 2YWGA 2E82A 3EVGA 1XDWA 3MVEA 4BFZA 2O0KA 1GUBA 1WCYA 5EUBA 4PTLA 3LYAA 3CVVA 2JCGA 1K0FA 1YR9A 4LZAA 2CFRA 1WUTA 3LI2A 3LW7A 4HEJA 4CN8A 4XGIA 5AJUA 1HG1A 1NJGA 1RKVA 3NRCA 4ERXA 1EA7A 4EVRA 3GYBA 4I55F 5BNTA 1CUZA 4TV9A 5GY7A 5BORA 2PD4A 4RSMA 1X14A 4DG8A 1KI6B 4DGQA 4TV8A 5K6TA 4FFMA 2NPIA 3IMCA 4GIQR 4F38A 5J23A 1K3UB 3MWDB 3ZK7A 3ICVA 2AX3A 2GCOA 2Q45A 1O87A 4U7HA 1LK7A 2FR8A 4WBXC 4X54A 1RC1A 2OEPA 3FUVA 3I6MA 3MLAA 3IAAA 2GNAA 1SA0B 4HTFB 3CF6R 1W0JD 1AZTA 5IWAB 4H6VA 2JCVA 1TEXA 4XIGS 2ZAYA 4EUSA 3M6MD 1P1HA 1CRQA 4NTZA 3TPCA 2GAFA 2H2DA 2H31A 1QLHA 4IHJB 4YNBA 5CA0A 1EFVB 3W2TA 3LCUA 4EI2A 3VKGA 2AW2B 5AI8A 2MR6A 5CX1B 1A2OA 1NL3A 2VS1A 4PGGA 2FW6A 1JYFA 1XKTA 2Y1LA 1DC6A 1JZTA 4QYIB 2AYXA 1VQ1A 2YIJA 1OREA 1ZD2P 4QGGA 2WILA 4Z2YA 1U7OA 1JHDA 3QVTA 3VR6A 1GWNA 1UEIA 2WUGA 4CNBA 4WUVA 1CVIA 1Q91A 4PZDA 3I30X 2DBVO 4BE7B 2F8TA 1L7DA 2O2XA 3L8DA 1R0BA 1H93A 2C82A 1KBZA 1T9AA 1C9JA 1ZVVA 1GSHA 2YASA 2XMCA 1GA4A 1Q1QA 1L8AA 1X80B 1VJCA 1CZNA 1J22A 1WVMA 1XCJA 1XEWX 4G9GA 2MCFA 1P4GA 4C01A 1CY0A 1JPNA 2F59A 3PE4A 2A7XA 4G25A 3AF3A 4H7HA 4CT4B 5GINE 4Q4AB 4NMHA 2E48A 3SC6A 4DLAA 1IVYA 1NVKA 3MLEA 1KHTA 4DC9A 3IAHA 1FX1A 1GVNB 3RQIA 1PJRA 5IH3A 1A8SA 1M2VB 2CBXA 3KJFA 5HK8A 4C0AC 3BMQB 1AG9A 3GNSA 1JSCA 3PNSA 3TMYA 3PDJA 2VH2A 4C04A 3VYWA 1EFDN 3NMUF 3PX7A 5LOVF 5FBKA 3GDWA 3K1YA 5D2CA 2CCKA 3M1LA 1M0EA 2ESRA 1N6KA 1P1BA 1QCYA 3D6FA 2OTCA 3C3AA 3ZS8A 1JLHA 4N7RA 4RESA 2O8FA 4FFOA 3B9QA 4X1YB 5D84A 1ZW1A 3CH5A 3LFUA 3GAFA 3SEFA 5IASA 1IHDA 1M2OB 5JMTA 1U9CA 3G9UA 2BTQA 3VJMA 1FDVA 1DAMA 2WICA 4PRLA 5EYPA 3HYNA 2Y92A 1EFLA 2HPHA 3FCOA 4DV5B 3EEYA 4DRXA 3ORFA 3EXFB 4TSRA 2Q6OA 2HA3A 1RYBA 2HO4A 2EKBA 3J7TA 4EKIA 1DWUA 3DVRX 1QU3A 1SWWA 4XB1A 2EFDB 2X77A 1UQTA 1T13A 2ZBVA 4MAAA 2JLQA 3QO4A 3BGWA 4OSEA 1QRTA 3J80A 2ZTVA 4GLBA 5FA6A 3HVJA 3BQMB 1GRNA 3BGDA 1KARA 2F17A 1VLHA 1A5SB 2LRHA 2C4TA 4ZHQA 4P8RA 3PQDA 3T7AA 2I4RA 3M4XA 2WF9A 3WFJA 4DMKA 2FMUA 4DZZA 2X8JB 2HKIA 2FHPA 3A1NA 3EHEA 2FQYA 4V24A 3OQOA 3EFEA 3W9UA 1YI0A 3LLSA 1VHDA 1N2IA 1H2RS 1OX4B 3ABOB 3HLYA 4G3XA 2JF0A 2BV3A 4LHWA 1TK2A 3JU3A 4KXFB 1N78A 2WF7A 1GZSA 1ZPDA 2FWJA 1BCSB 1SCNE 2ORYA 3PTZA 4L0QA 1ZOPA 3FVQA 2Z3VA 4IJ6A 3NATA 2ZOSA 4TGLA 3FKQA 2BF7A 1NYLA 3OPYB 3RWOA 2FTKE 3VPGA 4IKEA 1CERA 2O1EA 1BVRA 2DLCX 3WMGA 2PLRA 4YMVA 4HX2A 2R8ZA 5CM9C 3NOXA 2X1LA 3H2HA 4AB1A 3IDFA 3WWCA 1B41A 3W8FA 2JGIA 2GEBA 4MWZA 1J0EA 1AURA 1IULA 1IN5A 1M34A 2FN8A 1YFKA 5LWHA 2JJQA 3L01A 1U6JA 3HYRA 4O63O 2O2CA 1UXKA 1RJDA 2V4MA 2DAPA 4FNMA 4NOKA 1VKJA 2JA2A 13PKA 3QIVA 3CLTC 3ANLA 1UDWA 4G5RA 2XQKA 3MMSA 2C84A 5CJJA 3E7PA 4UPVA 3T35A 1V41E 3ZWPA 3UA3A 5EHGA 4TQGA 4NENB 1AVTA 2X6TA 1X3SA 1YR8A 1Z8DA 3L7YA 4ILEA 5AK0A 1ENZA 4E13A 1K6IA 5KIAA 5DT9A 4ARAA 2A5LA 1QPGA 1AQYA 2P27A 2WHRA 3A11A 3A7EA 3K8YA 2IEBA 2YN2A 3O4JA 4B2LA 4BDSA 1EESA 5EINA 2OZEA 1XTBA 1ZYUA 4LEIA 2WBLC 3DKVA 1U98A 1T9ZA 1WMEA 4A2CA 4C06A 1ISGA 5LQUA 3AV3A 2AGVA 4MVWA 4MRVA 4PN3A 2CL6X 5ITSA 2A3RA 1RM4A 2GHRA 2WD7A 3DONA 5J47A 5LJLA 4OI4A 4YRRA 1W46A 5DNVA 3QBQB 5KC8A 2VDNB 3FJOA 1GGKA 4GQBA 3NS7A 2WKQA 2H9GR 1US8A 4J2OA 2OFOA 2P67A 2XMBA 2GSDA 2WC1A 2ZVQX 3N8KA 1YK1A 1I9GA 1F8XA 5F51A 5U9CA 5IW8A 1IJEA 2PX2A 4ZV7A 3PI6A 5ARBA 5AVTA 2NPOA 3GVXA 4E2WA 3BTOA 4HAOA 3EQ7A 2D0IA 4ES6A 3T12A 4EGSA 1KS2A 2R6DA 1L5HA 1X70A 5EJ7A 1TM5E 4C0HA 2OXRA 5EP1A 2C88A 2FPMA 3C7CB 3V7YA 4IRMA 4DA8A 3QKUA 5TQ2B 4Y1FA 1H65A 3IEMA 4RV5A 3N6VA 1ZCFA 3FOZA 1THTA 1XJ0A 4EUKA 1FFXB 2EZ4A 3AB3A 3GROA 2AEEA 2NUPA 3HU1A 3NHJA 4NH4A 1XEXA 2NO5A 2VP4A 4HMPA 4OMCA 3WKBA 5JSZB 3NWJA 3CZQA 1XPRA 2AD5A 3HXTA 4JC4A 4C3ZA 2YXBA 3OU7A 3NYQA 4V0MA 4XJXA 5JFOA 5KNCD 2Q7XA 4NYIR 1G66A 1S7CA 1QM5A 3FNFA 3P0FA 1K68A 3OQBA 1BMTA 4PVCA 3M6UA 4QNRA 4OLBA 3HSKA 3L41A 4L0MA 3IBCA 4GNRA 1D07A 5BN3B 1HL3A 3ALQR 3UM9A 3TXYA 3TCNA 1ODCA 3I2IA 5TMPA 1IHUA 2VLIA 3K7EA 4HDSA 3GPIA 1NQXA 3DQZA 5FBLB 3G8CA 3L04A 2IYVA 2P65A 5K99A 1U81A 3AGQA 3JYPA 5FBZA 2EF1A 4UBKA 3HCFA 3HH8A 3MUFA 4KJXA 2PJUA 2QN6A 1V5EA 1LVGA 2G5TA 2OILA 3CW2A 3CUSA 3I12A 4ZVKA 1E3SA 3DAGA 1ZONA 1FQWA 3NEJA 4BQIA 2BZSA 4N5HX 4KI0A 3DDZX 2J3HA 5GONA 1DWPA 4C0XA 2BMDA 2QGFA 3SE0A 1XZPA 4O4JA 2DHQA 1QE5A 3ECSA 3RYIA 3GOQA 2PX5A 3E7FA 3HV0A 4U9IS 5JXIA 4EG4A 1JQLB 2NXCA 4Q1FA 5KAMA 2V7TA 5B1IA 1L5YA 2IYLD 3FYHA 3QNWA 2DUNA 2V8BA 2R7LA 3DVQX 1TZJA 3EYAA 3IKJA 4KWCA 4LXGA 4UBLA 3GO4A 4WCDA 1YBFA 3STWA 3U9SA 2X9QA 2VEDA 3QU5A 1NASA 5HTOA 1DFIA 3N05A 5B4UA 4IV5A 3V33A 2LTAA 2XPCA 2A92A 4X66B 4X8HA 2HSWA 4IZ6A 5IAGA 3ZN2A 4FFWA 3EFBA 1QG6A 3E8MA 4E0BA 2VDRB 3EK2A 4EUHA 1D2GA 1NE2A 2Z0MA 4LGCA 5D00A 4YDSA 3HM2A 2QRGA 2YY5A 4BC1A 3ZDAA 4WCFC 1N2XA 1GG8A 3CKMA 2CK3D 1QGOA 5C35A 1U0SY 5J4HA 2WZQA 3HKDA 4AXXA 1MQ9A 3VSEA 4BAUA 1RQPA 1UKCA 2J8ZA 4U9HS 4WNCA 5G4KB 1XD8A 3L1JA 4YR7A 3HHPA 4P3NA 4NCAA 3H42B 4UU7A 2RCYA 1J0XO 2ZZNA 4MDFA 1OD6A 4GQAA 5T6BA 5U4QA 2P35A 3IT0A 4B2YA 2JCSA 3HCAA 5JISA 2W6JD 4CLRA 3AHHA 3KVYA 1DBSA 4BOYA 3AI7A 1NFQA 1P4JA 3B3QA 1U1FA 1NUTA 3ZTTA 3TRKA 4RFSA 5ADUS 2B83A 1RAHA 3PHCA 2ZJAA 2GBGA 3VNAA 4JYZA 2F1RA 4RNDB 5TQ0A 1SB9A 1T0BA 2QL6A 4PZZA 1QDEA 2P2LA 1W5BA 1N0VC 1X1QA 4LNUB 4TLBA 1R5JA 2ID7A 4UFOA 3T7JA 2GGSA 2XZLA 2CKMA 2XNHA 4RANA 5JMOA 2EBUA 3AYZB 2TRSB 3KOWA 3CEAA 1I4DD 3G5LA 1QU2A 2C3PA 3NHZA 4CF7A 4MS4B 2Q4RA 4K5QA 1AS0A 4AJ2A 1Q7RA 3LUBA 3EA0A 5B4TA 3FLAA 2OV4A 3B3GA 1ZHFA 4I66A 4RTJA 5DDIP 1MHTA 5FEUA 2HRQA 3K9LA 4FINA 2HAEA 1ZA3R 3JR3A 1UDXA 4MWOA 4OB6A 4P34A 2GEUA 3SZ3A 1N5RA 1ZVJA 2O0LA 2PA3A 5F73A 5ALZA 3M5DA 4DIEA 3DDNA 1ZISA 4KR2A 5FPHA 1KVQA 5ALIA 2JIDA 2QE6A 4UQOA 4ISBA 2QUAA 4DBZA 4D9MA 3VO1A 5H3LA 1AZLA 4XPIB 5SZKB 1RPAA 2QNIA 5DTEA 3AETA 3H8WA 3QNUA 4J1NA 5DN6D 1TGVA 1X7WA 1EZZA 4ZQIA 2J09A 3T3HA 1EUDB 2YXPX 3IL2A 1B1AA 5LXTF 3DKKA 2AN5A 3MILA 3PC8A 3VQTA 2QTTA 4OFBA 2JHAA 2OV3A 1DIRA 4M1MA 4FHGA 2BCEA 1ODTC 4HG2A 3R41A 2D00A 1P39A 3D8RA 4RIGA 1T8UA 1A8UA 2GN1A 3FBWA 4Q9JA 4R3UC 2WT9A 3EEIA 1JI0A 1UT8A 3INTA 5IVIA 1B8PA 1X80A 5CDGA 1QUFA 5E0KB 3ME4A 5K0TA 3BCSA 3LX8A 1JEEA 1K06A 1NOIA 1UF9A 3QELB 5H1YA 3W1VA 3GLHE 4OGGA 5GGYA 3I39X 1XDSA 4KR0A 4KR9A 1SC3A 3DZBA 4IGAA 4UVDA 4CUJA 4B0PA 3MIZA 2CF5A 4NS4A 3Q5DA 3SXPA 2Q7OE 5IPFA 2QLMA 1NVBA 4PZAA 2I66A 4B3RB 2EKDA 5BSHA 4UUOA 2VPWA 2IYEA 1TE2A 4B8YA 4F91B 2D2IA 2QG6A 3C41J 5FOXA 2IXFA 2IUFA 3W8DA 2HCTA 2RBEA 4OYLA 3EZ2A 2VKQA 1YQEA 2LV8A 3L6OO 3Q85A 4HADA 3DE5X 4OBBA 1RXCA 2J5XA 5EOVA 3ONNA 2QM7A 1XUOA 1M8GA 3L8MA 5CNKA 1EMDA 1TO2E 1PDOA 3NHPA 3TLXA 2IHZA 3E1SA 1GM5A 3A9RA 1GG5A 4XIJA 1GLNA 5EHNA 1M2OA 1W75A 1V4VA 5DV9A 5KSZA 1HFKA 2QOEA 2WOJA 1QG0A 3MQFA 4UUAA 2XGOA 4Q4LA 5JUWA 5FIUA 2BGUA 2MHCA 4UPEA 5JQGB 2G88A 2R96A 3RIEA 3FTQA 4OIFA 3AOEA 4RDIA 5K8LA 4IO1A 2R65A 3PXDA 4RK4A 3EXFA 4WZAB 5JFGA 3Q5GA 2F64A 5MDHA 1GTSA 4UU0A 5BO5A 3ZJ5A 1DL5A 3RYHA 4WFJA 1QJCA 1Z15A 2H48A 5EG5A 1P9LA 3PLRA 3UICA 5B36A 2ZYSA 5JH7B 1CDOA 1JH9A 1WDKA 2E4ZA 1AA9A 3T5GA 4TQAA 1JEQB 1YTUA 1YB1A 4S1WA 5G0WA 4UHDA 2RAPA 4YHBA 3ROZA 4KODA 3F73A 5B3JC 1MTOA 1TM1E 4MQLA 4YRBA 2BM1A 5TPZA 3ZVRA 3FOCA 2X1MA 1IZ0A 1PE0A 4HWPA 3DTVA 3RUPA 1ISFA 1W19A 2X7XA 2IEIA 4LHVA 1TQ2A 1YZTA 1PR9A 2UZIR 4UCWA 4GI5A 4XJVA 2W43A 2GDZA 3GAMA 4JB3A 3BWMA 1OX4A 4ZO9A 4QYXA 1QE0A 2BR4A 3O31A 3A10A 3LWZA 2ARKA 5DSTA 5EZYA 3PPVA 5EWMA 4ER7A 4F1KA 3ESAA 4PU0A 4YRTA 1E79A 1EX6A 1FNMA 1U9JA 2JJ8A 4FYJA 4QPJC 2WIJA 2D1FA 3ZZNA 2OD2A 4BV2A 4UTZA 3B6KA 4CE6A 2NZYA 2ZUVA 4D97A 4I9NA 5LL6P 2O1SA 4FYWA 3LXMA 1SXHA 3S6JA 3CPEA 3LBAA 3W2FA 3WX0A 5JBQA 3UMVA 1Q1AA 4UBNA 3Q9LA 1PV4A 1Z0FA 5TMBA 4FJ1A 4PFQA 3KV1A 4TYMA 4Z8YA 2QVCA 2QTFA 1ULTA 2JKZA 3CRMA 4NL4H 3O95A 5KWEA 3I01M 4UMDA 3WC4A 1SVUA 2BGGA 4OHVA 1I4EB 4RV4A 3AVUA 1M5TA 1KAEA 3U81A 1QUEA 4U2DA 1KQOA 4XFJA 4CDNA 1KDRA 4N40A 3ZU4A 2VWPA 3ZK9A 2YNMD 4D46A 2UXBB 4QUGA 1GZUA 4KNYA 3GUVA 4PCVA 1X87A 4NENA 4TN5A 4Z1OA 1WF3A 3VR3A 2OHHA 5JS2A 3NLLA 3EEOA 1NNUA 2DWQA 4MR8A 4A9AA 2ZB8A 2CCGA 4TS4A 3Q12A 3N7UA 5KYTA 3VRHA 4LRUA 5IT5A 3NQ41 4Q4HA 3U56A 4E5MA 2OGWA 2BJVA 4NYMQ 4AY5A 4D6YA 5HZKA 1YFZA 2A0YA 3DR5A 4MWSA 4MKFA 2YWBA 5LYJA 4F7WA 3EWIA 3OZRA 3F6YA 5LDHA 3A28A 4KB5A 3ZXSA 1P3JA 1MKYA 1YA4A 3LUDA 4EHKA 1PR1A 1O5IA 3QGMA 2HY7A 2WUWE 5DOZA 1ZR2A 1QJ4A 4HWGA 1UH5A 2Z2YA 3L4KA 1Z8HA 1U04A 2Y1CA 2O8CB 4CTJA 1NA5A 4BJ1A 2F7SA 2OG2A 4TVOA 1VLLA 2O7VA 1JU9A 1XVIA 2RC5A 4TLAA 4A03A 5CVTA 4J9UE 1GAQA 3W4JA 1XRNA 2BD0A 3BMCA 4PNPA 2WWWA 1C30B 1S01A 3S29A 3ZJYA 4O25A 3ZV7A 3ANXA 3NIGB 1CE8A 2ZSUA 2VHYA 5HIMA 2X41A 4K6FA 2ZJ4A 4NJOA 2AV6A 2D5AA 4US2R 4XM1A 2NAFA 2B30A 1IQRA 1K92A 1LWNA 2E85A 3U3SA 2X2PA 3GN1A 2IHTA 3K20A 2IFTA 3BRWD 3QUSA 4ZREA 3TZQA 2O2IA 3K32A 3QX9A 1M0TA 1NXTA 3ZIAA 5FUXA 1ZESA 2Y68A 4O2BB 1EXMA 3D6AA 3X1ZA 1SRQA 1XA0A 2ZR9A 2XCRB 2BT4A 4JI3B 4E5NA 5JSZA 3C15C 1GZDA 4UUPA 4K2AA 1J9GA 2MINB 3K0SA 4C3OB 3WQRA 4YUWA 3P9IA 1DX4A 4OBXA 1JN0A 3E84A 1XEAA 3ZLTA 4DG5A 4NK5A 1UJCA 4M1KA 3S1AB 4JX9A 1SUIA 3SR0A 4ZZ0A 1PEDA 1ST2A 2J41A 2F43A 2GO7A 1H3EA 2HTEA 3BA1A 3VPFA 1BU5A 3K1AB 2GRAA 3CS3A 3WGMA 3ZXXA 4EDFA 4TS3A 1Q0UA 1LI4A 4HXGA 4JXZA 5C5IA 1UP7A 1SZPA 3LF1A 2QJWA 3G88A 4G0WA 1DHTA 2B5OA 2YHUA 1OAAA 2HDHA 5JDCA 1PJ8A 4ZCQA 3ZLBA 3DWGA 1TZ2A 4K9SA 3UJ8A 1JJAA 2GAOA 5JNUA 5CFZA 3WQSB 1U9YA 4B45A 1MQ8B 2A9QA 3H99A 5E6RB 4RDXA 5JPCA 3EEQA 3FSRA 2CXUA 1TNRR 5LP6A 2HU2A 3MJVA 1W5EA 5IKXA 1TJYA 1A4RA 3OIYA 5FTMA 2F1HA 3O2QB 1E1RA 4UVHA 1W76A 2K2QB 1MGOA 4IXWA 4KR3A 1U5CA 2VHQA 4HUQA 4B6PA 1TYZA 2YFQA 4P54A 1M1YA 3DKIA 2R5NA 4Q5IA 1TPYA 5CEEA 1WPGA 1IJBA 1E0DA 3LMKA 4UOZA 4JI1B 1LDBA 1HTTA 4CCYB 1AM4D 3T7RA 5ARCA 1RHJA 5DSXA 2HA0A 3LECA 5AP9A 4AJOA 1DUSA 1TKBA 2QL5A 3L93A 4UNSA 1E8MA 4O1MA 4RE6A 2ERCA 3UB3A 4PAQA 5MGNA 1LH0A 1KIFA 4I1YA 5CAEB 5LZ2A 3K72B 1G0NA 1OOEA 4BNWA 1QNFA 3DZKA 3KFLA 1QF6A 2CBGA 2FE1A 3T15A 4RHCA 4MRAA 3X2EA 1OBCA 2E49A 1N7JA 2ADOA 2YWFA 4J16A 3OECA 1SK9A 1E3LA 2AHRA 1TVCA 2VJMB 2DC1A 2ZBRA 3LCMA 3H18A 3QXGA 2FP4A 5A71A 1JJFA 4UC0A 1EX9A 1ZOLA 2JKYA 4L74A 4OQLA 4A1FA 4B4KA 3AVWA 3ZI0A 2JFNA 1ONSA 2FUEA 2HA2A 2XNKA 4K88A 3AJ8A 1MV5A 5JCOC 3CCFA 2YDYA 4X20B 4MWGA 1BFDA 1IAQA 1JQJC 1FVHA 1WQ1R 3FB4A 3RJZA 1IFXA 2JFPA 2XE4A 4JEMA 3OUUA 4LI0A 3FMGA 4TTRA 3VNQA 1B3RA 3KZ1E 3OP1A 1A8QA 1N0HA 1E1QA 1QFJA 2EL9A 4JSRA 1PTJA 1CWUA 2NT4A 1HE4A 2QR3A 2RGWA 2W6ID 2WSIA 4IH1A 2YOHA 3RFTA 3TQOA 1FTQA 3N0VA 1H2EA 1V11B 1YD7A 2W58A 1BQ3A 2DH6A 4LNUA 3TTVA 3ZJUA 1QFXA 3V8NA 1WHSA 5BSEA 5AYVA 1V1RB 1ZGHA 3W5SA 5AIBA 4RTPA 2H59A 1YE8A 3AEUB 4R98A 1NQWA 4B6QA 2VNAA 3UUFA 4C4SA 2BE7A 3S1SA 4R8LA 1RJ9A 4F7DA 3G9XA 3V4LA 3JSAA 1H0KA 5FPTA 5CYPA 1E6EA 2BKEA 1P75A 4Z7QB 3WMEA 2I4IA 3PNLA 2AG6A 2C7BA 5AOBA 1FP6A 1RZRA 1A27A 3IOYA 1BDMA 3T1QA 4EBBA 4W5OA 3IEIA 5FRDA 2FGKA 2H5LA 4EI7A 4CF4A 3NHYA 1K89A 1R7RA 4JI4B 1SPXA 3P5SA 1ZK4A 1M73E 1JQAA 1X7XB 1W85B 3L0BA 2YVQA 3JR7A 3K71B 1J6UA 1V1MB 1RXYA 1AKWA 1MVNA 2ZSFA 1KPHA 1VL1A 1R5NA 1YB6A 4Y9SA 1Y33E 3TLCA 3DGEC 4FR2A 5IKOA 4FFNA 3AVXA 4CMJA 2ODNA 3NT2A 1J9ZA 5EZ6B 1MNQA 4O4HF 1C7FA 2ZAGA 1BXRB 2KM1A 3PQFA 4D8XA 4NCXA 3ZHVA 4E2XA 3T5TA 2VT7A 3QBTA 3I01A 3K2QA 5ITZB 2QPAA 4R41A 3HTXA 2XQGA 3MCTA 3L4JA 1G60A 5E8JA 1SUEA 3K6RA 1CJBA 4LGMA 5HZGA 3F6PA 5ECDA 1KQPA 1VPTA 2I55A 2JK1A 5AOVA 3V4PB 1KFCB 3T1OA 1B6TA 2P5SA 4BEBA 3OE7A 2V6FA 3IHWA 1LY1A 1R0CA 2ADFA 1RR6A 2BEKA 2J30A 3EF0A 4OJYA 2HMSA 3R75A 3SMQA 5KC9A 2B2XA 3C1TA 4GPD1 4E1VA 3DBHB 3EIWA 1YNOA 3EARA 4DR5B 3GUHA 2R1ZA 3E81A 2D1QA 1C8VB 4RC9A 4NHEA 3DOFA 2E9SA 2C7VA 1KDVA 4FMBB 4LTNA 9ATCA 5LVAA 5MN5A 3AHIA 2AYYA 3W8EA 4NAUA 4NQRA 3Q2KA 3THYA 3P0HA 1NLZA 4F8JA 4TSFD 2B8TA 1E8DA 4L5JA 4M54A 3ROXA 2GJ8A 3JD1A 1GP2A 1ZNWA 7ABPA 1P0CA 1NBIA 1ORDA 3ZDCA 4IFEA 3VZDA 1QMPA 1ATIA 1PJ4A 1C0LA 3SYTA 5BV8A 4ITUA 3IRVA 3UMYA 5JQGA 2DT5A 1JIUA 3K1ZA 4MLCA 5JROA 1DP4A 1UC4B 2BFBB 3HEAA 1CW2B 2MIIA 4BTVA 2XKAA 3FPSA 2HYIC 2G04A 3LQ4A 4PPYA 3U1VA 1GTG1 2BFOA 1K98A 3GFGA 1OW3B 3QFSA 4JROA 3A1FA 5I7AA 3WWEA 5B64A 5FWDA 4ZEMA 1U9ZA 1S9DA 4B6RA 4C08A 3U1BA 3G82C 4C2BA 2REQB 4UVIA 5HRCA 2ORIA 5EMLA 4CM7A 1QP0A 3E22B 1KY3A 1OYOA 4QC2A 4BNFA 2FZWA 4HKTA 3U4DA 1QAQA 5CR9A 4W5RA 5KTRA 1XDDA 3FDZA 1WMDA 1ST3A 3DD5A 3IOEA 3MJSA 4GWGA 3DLAA 4HGRA 4O4IA 3S2YA 2JEOA 4XFKA 1RJWA 3R24A 2IHKA 2R8OA 4FUQA 1SKYB 2IT1A 1URPA 4FHDA 4ZTBA 1X8XA 3BSWA 1Z47A 5LQMA 1OWPA 1R18A 1NVFA 4GFDA 3RS5A 3ER8A 3OFNA 3UJ9A 3ONWA 5I47A 2AN4A 2CJWA 4URXR 4AT1A 4BFWA 3RGWS 3U7QB 1IQUA 3A1CA 4RAQA 5AXBA 4NULA 4EJSC 3E5RA 3M6WA 1JFLA 1YGPA 4BQQA 1V3TA 1XRLA 4G5FA 1WDMA 3GLIA 5C7OO 1Y1TA 3T1TA 2YC2C 2JJ1D 3G89A 3GCXA 4JJKA 4P6VF 5IBRA 2FN7A 3M33A 1UWVA 4JQCA 2C4UA 4URZR 1NMEA 4H27A 5ES3A 3C8HA 4URUR 3PYXA 1FU8A 3O83A 1SQ0A 1JAIA 1C3JA 3BX1A 3OIGA 3QOFA 4OXKA 1X15A 4ME6A 4NNJA 5DTJA 3HPRA 1P8JA 3FWNA 1XO1A 2DR0A 4US1R 3RIGA 1Z6AA 2VOJA 1ZNYA 3SBDA 4MPTA 1XL0A 2WPNA 4TM8A 2B6NA 3JAWA 3URFZ 2VTBA 2CD9A 1FJHA 1X42A 4NFYA 3SQDA 2FWAA 2B4AA 3LK7A 5CIWA 1T15A 1O9BA 1UKAA 1VMAA 1FXWA 4IFBA 3B3FA 5JMPA 2FZ5A 2WJIA 3HLKA 2Y1EA 3TL2A 3RASA 2IUTA 4AIRA 4M37A 4ZGGA 4TLEA 1JPUA 2HF7A 5M29A 4YRQA 3GG2A 3BUKC 3G8BA 2HT1A 4YJ3F 3UB4A 3FUCA 1P2VA 3ZWOA 1R0KA 4RSUD 1SQSA 3T8YA 1Y8RA 3O9ZA 4FN5A 1DEOA 1Z0KA 4JASB 5ALOA 4X8LA 1ZUWA 3E53A 5CA1A 1KY2A 2QSUA 1L5NA 2D13A 4MSVB 4XZ3A 1AZWA 3ZY6A 1VHWA 3F6SA 4J0EA 2V6MA 1FF9A 3H65A 3DDUA 2BKUA 2P6OA 1OBFO 2IWRA 1PUXA 3CSUA 5TS3A 3MOGA 2F8MA 4DIOA 4O4LA 1XVTA 3FZEA 3TSYA 4C4XA 3THMF 2ZS7A 2WJGA 5EZ5A 4H6PA 2Q0SA 2H1VA 2AJCA 4NZNA 3ZU5A 4C05A 4DEXA 4P3YA 5BNWA 3DVAA 3NUZA 3NM5A 3G02A 1EIWA 1PFGA 1T9GR 3H5OA 3P20A 3PUHA 4EHHA 1I7QB 4AIIA 2I87A 3C6YA 3IJPA 2AFIE 1A82A 3Q9SA 5H4GA 5HVNA 3OZGA 5EL0A 3WDLA 2IW3A 1EUCB 1IIRA 1PR4A 1E6WA 4D9HA 5IDXA 1U2DC 5DE3A 4NDZA 1CT9A 4MVJE 1V7PC 4D43A 2YYYA 1YB5A 1N34B 1Y4UA 1ZM4A 1IG0A 5A0TA 4UOEA 2BFEA 3VJLA 4C76A 1WMFA 5B7NA 5ALEA 3H5VA 3EGCA 3W9BA 3N70A 2BFCB 3IIIA 1ZCZA 3N8IA 4QOIA 3ROMA 1H0HA 1ZICA 3JWGA 5SZJA 3RRFA 1SG9A 3Q6NA 4WKCA 2C8LA 2B94A 2JI9A 1FP4B 3MXOA 4F4UA 1SOWA 2AFRA 2VK8A 2WIFA 3FZQA 2R7NA 4FSDA 4XIFA 4U7DA 3K6SA 1RXIA 1MF7A 3A3KA 2XLBA 4L3WA 4JL6A 3AVOA 2VTEA 2RHJA 3IFSA 3KQTA 1I2MA 2CWDA 2Q0XA 1G16A 4PXYA 1YTLA 1E0SA 1XVUA 4FMPA 4GP6A 5E95A 4DHEA 2FHSA 2FG7C 3AKCA 4EW2A 1YBMA 1BVYF 4ENQA 3F6EX 3EGDB 1NJ2A 4HEA1 2F9MA 3UO8B 1RAGA 2FDRA 1SBCA 3DO6A 1TVKB 1RKXA 4YFYA 2NVUA 3BFXA 1T24A 2ZSKA 4NOJA 1MJNA 1QSGA 3IMGA 1TIPA 1DDOA 3S4YA 4C5BA 4MGYR 4YACA 5J5AA 2OGUA 2O8VA 3ORSA 1GRVA 1LW6E 3BL5A 3L0PA 1TM3E 2YMQA 1GG2A 3Q11A 4D81A 1QR2A 1JHXA 3MFQA 3CB4A 2R47A 3OI7A 1GNPA 5G3YA 1H85A 3TBHA 2AS0A 3PRHA 1AXEA 1Y7LA 1UZLA 1W36D 5JAIA 2BC9A 1C9KA 4IDQA 1I2BA 5B58T 2P6NA 3OY7A 3LBYA 3RLIA 1PCXA 5AI0A 4LDPA 2Q3JA 3MBOA 4IX1A 4ND6A 4E5SA 1OIVA 2GHTA 2EGGA 1EE2A 1UDRA 2GN2A 3AM3A 2JIOA 2TMYA 5AK5A 4HN9A 5AWFC 3OJLA 2LNDA 3B51X 5MN6A 5F3WB 2RGNC 4LIPD 1SHZA 4S0ZA 5CU7A 4EMUA 3ESBA 1AGNA 4GBJA 4ND3A 1UR5A 4O2AF 3BOSA 5LSAA 5JRZA 3CVUA 4XQEA 2VAWA 3MJTA 2LIVA 2O20A 5GJBA 2Q3EA 1CZUA 3ND8A 1VLZA 4B3JA 1WSWA 4KPUB 1E7MA 2CDCA 2Y8EA 4I2NA 4PC3A 1KZ6A 1JG7A 2ORED 4IH9A 1N9GB 3CX6A 5EE1A 4JT4A 3PA6A 3RUEA 3RGGA 3T4XA 2ZSDA 1N6RA 1QWSA 3H0KA 3A1VA 4KQ6A 5DX0A 3T38A 5BQXA 1CPYA 1KF0A 2QTRA 5GJCA 5K01A 3LBFA 3VI3B 4NV3A 1RE0A 1DOZA 1WD7A 1BG6A 4TTJA 1EGVB 4UASA 1YRYE 3KC2A 4LV6A 2GOYA 1U6IA 4PFSA 1T1GA 3AEYA 3SSNA 3LC7O 4LJKA 1JFVA 5BVHB 4FYIA 1GHTA 1EI9A 5CK5A 2IZ0A 1Q57A 3RIMA 1Y1LA 4XSVA 3ZDRA 2GLXA 4RA9A 1BN7A 2J0VA 1BYIA 5A4JA 1RHRA 1H1LA 1WP9A 3OUTA 3FWHA 5IH7A 5IABA 4KMRA 5J2TA 1YB2A 2HSGA 1S2IA 2Y4OA 4RA6B 4B09A 1UKBA 1AKMA 1X7YB 5HJ5A 4P93A 4PR0A 5TX7A 1A9XB 4HWKA 5L6MB 2ZR7A 5FI3A 2J4DA 2Q2OA 1MO5A 2JFWA 3EIHA 2XADA 2WIDA 4OPMA 5HQJA 3S2GA 5HBRA 4DMHA 1Y9AA 4JGIA 4LBZA 5ICEA 2OOSA 3H2BA 4GOXA 1E9FA 1XZLA 4K1LA 4IIVA 3Q98A 5FPYA 1JPJA 4BTLA 1G19A 2BP7A 2NU9A 1T2NA 1USWA 4TL6A 4GSYA 1WDLA 3ORHA 4LZJA 3VOSA 1EB8A 3IR6A 3R5KA 5ICMA 1XJWA 3QWHA 1KRXA 2FPPA 1B42A 3OTHA 4KV9A 3ZXUB 2EU8A 1DT5A 1O08A 1XG5A 3DR3A 2VZ8A 4IDHA 2VPXA 1FZTA 1SEVA 1R4ZA 3HYTA 2BDEA 1YJXA 1HNNA 2RAUA 1CY7A 4IWNA 1NUSA 5BQ5A 3KJEA 3OAAD 4ZQHA 1GSAA 3ADPA 5TQVA 1RM0A 3UOGA 3ZPXA 2Q6LA 1XU7A 1CZRA 2EBWA 4FEYA 2IE8A 3ASVA 5BT8A 1P1CA 2ZYVX 3ZNOA 2D2FA 3HB0A 4KLRA 3PQ8A 3IEPA 2H1SA 4GVLA 1OPRA 1U3GA 1UPFA 2GD6A 3KTOA 3M49A 3OIFA 4OQPA 4B48A 5A04A 1FUEA 2ZVJA 4OUDB 4R83A 3FYCA 3LP8A 4TLMB 4MQ5A 3KZCA 1GPWB 4QUEA 5J9FA 3IOMA 1RWMA 3KPYA 1Q6YA 2R66A 4H17A 4AS2A 3HEMA 1HNXB 1I2AA 1AK9A 1M1UA 1MC4A 2VG8A 3NHMA 4WXYB 5CM8B 4EEZA 4W7HA 4ARBA 3GRRA 3NHUA 4AP9A 1DOHA 1FDIA 3HCDA 3N53A 3JW8A 1K9SA 1YZNA 3HQ4O 1KZGB 4YECA 2N9UA 4B9AA 2PZMA 5BMOA 2O2DA 4BLUA 1G3RA 1LLFA 2ORVA 2PHZA 3PE3A 1MX5A 1ODKA 2X0JA 3I9KA 4OV6B 3TR5A 1CR1A 5J2UF 2PD3A 3LT0A 4KR6A 1UK8A 1NVMB 2E4UA 3D4PA 3FDJA 3R5SA 1Y6JA 4NFSA 1NVXQ 1P17A 1G9XA 3WNCA 4ALKA 2R6GA 1TVEA 4LBWA 3C1AA 1V0JA 4C87A 5FPKA 4ZPXA 2HI0A 3DOJA 4HXFB 3VMMA 5I7OA 4LVCA 3UMRA 1X13A 2FK7A 1Y4SA 4GZ6A 3UMGA 1DS6A 1UZMA 2PZBA 1CQIB 1HT0A 2VSQA 4M0KA 1W0KD 2JIZD 4MUGA 3W4KA 1KAHA 5LD2B 3IDSA 2FUKA 1J0CA 1TCVA 3FPFA 4GPZA 4I5IA 2GNOA 2OENG 4YQEA 2I4LA 1T1IA 5EAIA 3MAGA 1E2BA 1WJGA 2QRKA 4L75A 4RVGA 4LUCA 5TRTA 3RT9A 1E2QA 1M54A 1J21A 3USES 4LRSB 1K5DA 1JR3D 1GR0A 3P2KA 4YRPA 2F2TA 2XNDA 4CF5A 4CU5A 5KYYA 1L7RA 4ND4A 4EI9A 1MAHA 2PBRA 2ATCA 2BL4A 3DW1X 4KQGA 1LBTA 2A35A 1ZN8A 1OILA 1BMFD 1OU0A 1GRRA 1Q0RA 1SGWA 2EKLA 2P5UA 3F74A 3PC6A 3Q8WA 5D7BA 3SIXA 3L8YA 4US0R 1HURA 2P9BA 2IX3A 3F96A 5CDSA 4YXWA 1N5MA 2YYSA 2PBFA 4ODIA 1Y8AA 3ANMA 2JATA 5FNZA 2HQRA 3CH4B 3FMOB 5KTSA 3IAFA 4CDGA 4IIDA 2OR3A 2I7VA 3NC1C 3L1IA 1ZLXA 1LPMA 4KQEA 1LSJA 3M9XA 4Y8VA 5ANRB 5L7WA 3STHA 2JEYA 3WNZA 3EW7A 4JYMA 1Z16A 1ZJ4A 3ET4A 3HDTA 4V2IA 4BO0A 3A4NA 3FMVA 3K09C 4GYJA 1EXVA 3HDJA 4M6WA 3HI4A 4AWAA 3C48A 4UJ3A 3FOAA 4D8UA 2PRJA 4KPFC 2JH8A 5KOHB 3TGPA 4RH1A 1E4YA 3H83A 3DPSA 1AKEA 3JPYA 3T6KA 5BR7A 1Q74A 1E2EA 2L0XA 2Q1TA 4ZYZA 5E4TA 1T6YA 2C4WA 2IOFK 1Z37A 2FA9A 2Q6KA 3D6HA 1AF7A 1E3IA 4OQYA 1XLUA 4XW2A 5AW5A 5C8YA 1NYTA 1XDZA 2CHQA 1C7EA 2H0RA 2QX7A 4PLCA 2XZTA 5ES4B 3PFGA 2I6QA 2OCKA 2HM7A 3VSBA 1AGXA 1EWTA 1A5BB 3F5MA 1P7YA 3L7LA 4PG7A 2FQQA 4Y18A 3ADDA 3B9BA 3NV9A 1RLJA 1TQHA 1F0YA 2BGJA 2NYUA 3IUYA 2E0IA 1VB3A 4NU8X 4X1KB 1DRKA 1OASA 4OHRA 4Y2QA 1UC9A 3AR9A 2JASA 3D64A 3EBPA 1WEHA 3H8SA 4WLUA 3SQLA 5BW4A 3D02A 3LHIA 1YQXA 3MWYW 4DCPA 3WNBA 1XAHA 1D5WA 3D8NA 3CUTA 3CJTA 1VRWA 5H3HA 3RSHA 3AYXB 4RFLA 3TQIA 3DKRA 3KQHA 4HQOA 1ISMA 2R3SA 5F76A 5I3ZA 5A5VA 1NVEA 1R37A 3IS3A 2FR1A 3HVIA 1GUAA 3OD5A 3GGOA 3T99A 4CR7A 2JHCA 3FGPA 5IZ4A 4WY5A 5EERA 2VP2A 4LYEA 2CMFA 3NFYA 2XHEA 4N0PA 5FLEX 3ZZMA 3GP3A 4QU8A 4EKDA 1YS4A 2ANBA 3GJ4A 4F2PA 3NDJA 3MJCA 1P1FA 1A8IA 4JJ8A 2CSUA 5K3AA 1NLYA 4OYRA 5ETJA 3TCKA 2H52A 1KMMA 1QONA 3FG9A 3U39A 2JC3A 2RARA 2IPMA 4WV3A 3VHQA 2HBRA 2YR0A 4ZO6A 2UYOA 5TPWA 1N36B 2HIMA 4ZCTA 2OGTA 3S81A 3MJDA 3I2KA 1W8DA 3UJPA 3AI1A 3GD5A 4PR3A 2ZAMA 5EI5A 1X1DA 2FLKA 5I9BA 4DEYA 1X1AA 5FFFA 1QRDA 3M6XA 2ONYA 5D51S 4XGRA 6NULA 4K46A 2FZGA 3TF5A 1WMBA 1NFRA 1OH8A 3FSEA 4I50B 5DGTA 3QF4B 2PS3A 1FRFS 1ILWA 1E2DA 2Y93A 4L5CA 2AI1A 1FMJA 3OLVA 4KV7A 5G53C 1BJRE 4BVJA 3WLMA 3ZD9A 5AW0A 2ZE8A 1FFDA 2NSJA 2PGXA 3Q3CA 1I2ZA 3EB9A 4Q9HA 4E08A 4P31A 2BFCA 4CT5A 5DYTA 1RPJA 1V8OA 4YUYA 1AKRA 1A7AA 2N75A 4JX8A 4NQZA 3OOEA 5CW1A 5K3OA 1JSZA 2QAGC 1SC9A 2QZ4A 5EIAA 1L5WA 2D5CA 2WVAA 3NAZA 3TPFA 3L7JA 1ZS9A 3LTNC 4N9WA 4R3WA 2CNKA 2DTDA 2IX9A 1E3QA 5BW8A 2VT6A 3ZE0B 8MHTA 5FOUA 3MWKA 3CRNA 2C95A 3JV7A 3JYLA 4DXHA 4I9UA 4UEQA 2D0DA 2HHAA 3WVTA 2HXYA 2PSSA 4OMFG 4IX9A 2PUAA 4G8DA 2H5EA 5HA5A 2D1YA 5KYVA 1W36C 4KH1A 1H23A 1VJRA 2Z6AA 4H1TA 1SUBA 3I9V1 3LJKA 1QORA 2P9HA 4IP0A 5HX7A 1PZGA 3UMFA 3FA2A 3ZXIA 4BZPA 4F97A 1U0LA 3WKEA 3A14A 1VJGA 3H87A 4R84A 3TDKA 3PXXA 4BB5A 4B6SA 1OA1A 1POXA 1SO8A 2NOAA 5D8DA 1I6KA 2VHXA 1N57A 3FIUA 1LNSA 2EJVA 1J5EB 2R1VB 5F2EA 3WLRA 6YASA 5T8KA 2NM0A 3P0JA 2QGNA 2EFGA 1DTEA 1C1DA 3IH5A 1M0SA 1TYAE 3H04A 5IS2A 4G81A 2P75A 3OEEA 1GEGA 4B7ZA 1FDOA 1RKBA 4HMOA 4KO2S 4COOA 1QYCA 4V0SA 5T4FA 2HT6A 4G01B 4GP9A 3VGPA 3FRJA 2G06A 4PZYA 1WY5A 1I5RA 5BMVA 3SZOA 4M89A 4H1VA 3K5PA 4MV6A 4F86A 4R1TA 5GAJA 4DDUA 5AOAA 1IL0A 2BI4A 3UF0A 4GR9A 1MAAA 2OXTA 2ZBGA 1EIZA 2QN3A 3CRQA 1S2OA 3FCXA 4GKAA 2J3JA 4D82A 1SHUX 3JQ8B 4ZP1A 4ZI3A 2ATVA 4IINA 3ZGYA 3PFCA 4TWRA 3QMVA 2I71A 1E9RA 3UATA 2WWYA 5L51A 3RADC 5H4HA 2X0FA 5ALGA 4L0CA 4OXNA 3MBWA 1DAIA 1XCGB 4JFAA 2H6EA 4RPLA 4M1TA 3RYFB 1XDGA 2ALJA 2IOFA 2OO3A 4QRHA 1AD2A 3IIMA 1N5LA 3JQ7A 4UE6A 1N9GA 2DG2A 4Q3OA 2ORWA 4IHAA 2OMKA 4QT4A 5H9VA 1SZCA 4Q1VA 4MH0R 3O8LA 3SEZA 4DVJA 1KC1A 1YR3A 2OCAA 2DPHA 1A0OA 3CF0A 3H13A 2BHRA 3PITA 1KQNA 5ISMA 1WNTA 4XKJA 4L5AA 4AWXA 1QH8A 2H2WA 5IDWA 3IVMA 2JFZA 3PDHA 3TAXA 2VR1A 4I1PA 5A05A 5H7XA 1SWVA 2QJTA 4CL3A 2YIMA 2EJBA 5C34B 4RPCA 5JNSA 3CJQA 3I32A 1SCQA 3O4FA 5LA6F 1NI3A 5KSPA 4L2IB 4WZZA 2R86A 2Z3WA 1PJ2A 2YWEA 5B4VA 1GEEA 3VUFA 2DYKA 2NZXA 1JBQA 1LQTA 3GJXC 2D1TA 1JYEA 2W4IA 1KO1A 2EHDA 2B36A 2HRDA 1OXSC 4ZVVA 3UIEA 2X8LA 1K6XA 4JZYA 3LQRA 4WZBE 1DXHA 5M3BA 1ZW6A 4IDDA 4Y0NA 1QRUA 2YHIA 1CUXA 1PNOA 2O2JA 3UN1A 4QECA 2I34A 4DA9A 1VZ2A 3II6X 1EK2A 3ILVA 1UFVA 2F1OA 3KLOA 3OM1A 3QXHA 1XTZA 4QTUB 4WY8A 3FD8A 4Z7JA 5A4DA 4XEHA 2C78A 3BIOA 4B4WA 2EOAA 5THQA 4RHYA 1EGAA 3ZK8A 1QWOA 1GQ2A 4B7XA 3T94A 1TUBA 1VJDA 2WIAA 2QT0A 3G2LA 4MUKA 1SH7A 2HX1A 4M1WA 1ZZGA 2X8WA 4OSOA 3T0FA 2XNSA 1NJSA 3H1PA 1E4VA 4EHAA 5YASA 4AMGA 4FSXA 4A0GA 1QFZA 4WA7A 4NJMB 4NABA 4YAIA 3R9WA 4AC9A 2FDXA 1OI3A 1EHYA 3DLPX 1XA4A 4PW0A 1NSFA 4ZVQA 4LZNA 3EGXA 3E9DA 3AINA 2QN9A 4D56A 1ZH8A 1K7FB 3IDAA 4ARIA 1W25A 1OA0A 1XROA 3PQ4A 3DCJA 2XF8A 3JYOA 3ZVLA 1X7GA 4MLZA 4JR2A 1GD1O 2IV7A 1FS4A 1O95D 3RFFA 4MA5A 1IN6A 4N9QA 5IJXA 1XRJA 4PWZA 4OP2A 2A9OA 1N2BA 4TXHA 4HDAA 3D3EA 3PD0A 3PSAA 4NYJR 5TXGA 4I3HA 2DKNA 4CCAA 1E2KA 1MB0A 1SXJD 3H3FA 5IT9A 1ZBQA 2J6CA 1E3DA 1H22A 1RWVA 2C2KA 2RG7A 3RTGA 3DC2A 4JENA 5IU6A 5K4GA 1RWWA 2DQSA 5K6AC 3NXSA 5IF3A 2AXNA 2V45A 4LZLA 2AQKA 4GO1A 4YAJA 4DANA 1PW5A 3ZUGA 3DBIA 3FHTA 1WW3A 2ZM6B 3UUGA 1GLVA 4BNUA 2IW1A 1Y8QB 3C98A 3U26A 2PMKA 5KNDH 1UBOS 4ENPA 2H1FA 3RJ5A 3OE1A 4JOCA 1RQ2A 1XCOA 1XN1A 5BYBA 4C07A 4CU2A 2RDMA 3MGGA 4DLWA 2GCGA 2C97A 3IAUA 3AJ9A 2FMHA 3EG9A 5B1DA 4JLSA 2NSDA 5A5GA 3WG9A 2WJ3A 4NPAA 2EGUA 2IPNA 4E94A 1XZAA 3PHHA 3EMKA 4DUZB 1RZ3A 4KR7A 3P2EA 2CNLA 1E1CA 5IEJA 3UCEA 1GCOA 4HRXA 2QR2A 3NRJA 3NJRA 1DC4A 3KXIA 4H7FA 3A6DA 3D3WB 4RJ2A 3RAJA 3TSOA 3CPHA 4U7JA 2UYHA 3WGKA 2JLWA 3HZRA 1Q83A 3IBGA 1Y6FA 1GU7A 5KYNA 4E7OA 2FZEA 2V7UA 3BYZA 2AXPA 2X5NA 7ADHA 4CQNA 3A6PC 1S96A 4KSBA 3PFIA 3BC1A 3UJDA 1FP1D 2RGAA 1WNFA 4RWEA 3VPBA 1QS0B 2A9FA 2DERA 2ZJ7A 3KEFA 3QG1A 3C3PA 1DAKA 3ODPA 4WEOA 3BB4A 5LDDC 1HWYA 2QVLA 3EAQA 3U5TA 4IO0A 2A1IA 5CFMA 4PG4A 1COZA 1G3MA 1XR3A 4LJ5A 4KPYA 1ODFA 5JADA 3ZDXB 1EQ2A 2VZ9A 4LYYA 1EEXB 1O89A 4QODA 4HDOB 5JCPA 1XLTA 3BGOS 3AV0B 2N3ZA 2VWGA 3WSTA 1YUBA 3OP4A 3WGIA 1EYZA 2ZYTX 5T41A 1NR7A 1TO1E 1XLWA 3EZNA 3F2IA 2V55B 4WMLA 4IXDA 2FZLA 1G64A 3OPMA 1XQ6A 4I8IA 3LSYA 3D8BA 2WABA 3LDHA 2GWRA 1IH8A 1WUIS 2I1QA 2VPYA 2XUOA 4QXOA 3MTDA 2EXXA 2ZRIA 1P9RA 1B6RA 3NTUA 5CG2A 4GXNA 4ENUA 4MYUA 3WWOA 1GY8A 4HB0A 2W93A 1K7YA 4LWZA 3N8HA 3HXPA 2UVQA 2ZZKA 3C7DB 3NKVA 5EJMA 5H3CA 4FKMA 4ITVA 3KEQA 4N5LA 1UDCA 4RTRA 2EFJA 2OFFA 2XDQA 4L9SA 2IP4A 2FSIA 3M4YA 5FUMA 1AY0A 4JLKA 3AY7A 3OCYA 2XY4A 4HF7A 1Y63A 4I99A 2RHLA 4HYYA 4LW8A 2Q99A 3K9GA 1EAYA 2ZKIA 3LK6A 3OEHD 5DW3A 3SHVA 3VSDA 2CJYA 5LMUB 3I28A 2VUIB 5GPBA 3C6BA 4XR4A 1L0BA 2XSZA 2VK1A 2EW1A 5CFLA 2DXIA 1BE6A 1QK5A 1C0KA 3HBAA 4IM7A 2VF8A 1PT7A 2Q5JA 4H59A 2B35A 1QGDA 1Z7EA 4ACBA 4GOMD 1I4WA 2A8YA 1F60A 4X95A 1IPHA 1X39A 4XVHA 3EZ6A 4WKPA 1LA2A 4OH1A 4BB6A 2VBIA 4J9VA 4FX2A 4TQUS 1GFSA 4LF7B 2VO1A 3ECAA 4Q9KA 3SGLA 2JBAA 2QTGA 1NGSA 1U7HA 2V59A 1T36B 3GRYA 4URWR 5JY1A 4FXOA 2Z2JA 1N3BA 5EIWA 5JCXA 2GJ9A 2R1TB 3R1IA 5EC8A 4GUDA 3D1JA 3MCZA 3DOCA 2A1TS 2I1WA 1F9EA 1D4FA 2VHUA 4RLSA 4FPXA 3STXA 3EJ6A 3QU4A 4BQRA 1ORVA 2PU5A 1DJPA 1VHQA 4AQYB 3H1TA 5CLIA 4YP7A 2AYZA 1V25A 2JPDA 2V3VA 3P4UA 5F52A 1G9SA 4XSHA 4EG7A 1B76A 4ND1A 4UHCA 2G5PA 2VQ3A 3RIYA 4B6EA 2CMDA 2O14A 1O5OA 2Y0CA 5BVGB 5JJBA 3ZGOA 2OZPA 1JDBC 1IB0A 4MTLA 3GW8A 3RKRA 3UHOA 2G8LA 3ZWDA 2VDLB 4FXPA 1H2AS 1I6WA 2SHKA 5E7JA 1OH5A 1P61B 4GKJB 1J5XA 4ZEXA 4G1VA 2PKWA 3CV3A 1ZOIA 4JI8B 2ONZA 4YLEA 2PH7A 1PO7A 3GMTA 4IBOA 4LISA 4OAQA 3TCXB 1ISJA 4HDQB 3ICQB 2BHSA 3EZGA 3H5RA 2Y9MB 3VDXA 3FHJA 3ENKA 3LS2A 5BP7A