2E4WA

Crystal structure of the extracellular region of the group ii metabotropic glutamate receptor complexed with 1s,3s-acpd
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
538
structure length
518
Chain Sequence
b'RREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDNYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNICIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAANRVNASFTWVASDGWGAQESIVKGSEHVAYGAITLELASHPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQCSLQNKRNHRQVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPQTTKLCDAMKILDGKKLYKEYLLKIQFTAPFNPNKGADSIVKFDTFGDGMGRYNVFNLQQTGGKYSYLKVGHWAETLSLDVDSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYLVDEFTCMDCGPGQWPTADLSGCYNLPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Metabotropic glutamate receptor 3
publication title Structures of the extracellular regions of the group II/III metabotropic glutamate receptors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 162
structure length 518
sequence length 538
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
A PF07562 NCD3G Nine Cysteines Domain of family 3 GPCR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.50.30 Mainly Beta Ribbon Tumor Necrosis Factor Receptor, subunit A; domain 2 Tumor Necrosis Factor Receptor, subunit A; domain 2 2e4wA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2e4wA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2e4wA01
1ZH4A 3EGCA 2TMYA 2CHFA 2KYRA 4MR8A 4H3HB 2FQYA 4RY9A 1QPZA 2PUDA 4XASA 2FMKA 3KJXA 3LUAA 2HSGA 1QQBA 5JS2A 2E4WA 1J56A 4LRQA 2PUFA 4EUKA 4YP9A 3RVMA 1JHZA 3I42A 3HSYA 2E4VA 3K4HA 1LK0A 2J48A 4XFKA 1WETA 4YR7A 2PUAA 2VUIB 4D6XA 1YIOA 3IP9A 4O1HA 3F73A 3OQMA 3A10A 1ZVVA 3CZ5A 2L18A 4JA2A 3FFXA 2R48A 3S99A 5C5CA 4IRXA 1DJMA 1TJYA 3CTPA 3FFWA 4WXEA 3L49A 1P6UA 3QLUA 3F7NA 3GV0A 1OXBB 3P9YA 1XHEA 4S04A 2P9HA 4MLDA 3HDGA 3Q7SA 2IYNA 2JVIA 2NT3A 3HEBA 2RJNA 1K66A 3JVDA 1CEYA 5GQSA 3MM4A 2GWRA 3LUKA 4HNQA 4FB4A 3NHMA 4MGEA 4ZMSA 2HQOA 3HZHA 2MYTA 3OO0A 4MS3B 4XARA 3H1EA 4Z9BA 5BRAA 3BRQA 3N6VA 1QMPA 4O1IA 4E7PA 1BDIA 2PMCA 4EYOA 5BQ3A 3I09A 2W42A 2F8TA 4Z4FA 1KMIY 2FN9A 1PEAA 2FMIA 4KV7A 4FE4A 1PHRA 2MSLA 2QVGA 3SAJA 3MF4A 1I3CA 1RXIA 7ABPA 2IKSA 2YHBA 1QO0A 1S8NA 2R4QA 2WY2D 1CYEA 1FFWA 5IBQA 5JNTA 2JK1A 3CFYA 5DTEA 4YO7A 3UK0A 5TPZA 2FVYA 4PYRA 1JL3A 4LDZA 3T38A 1NXXA 4MS1A 3A3KA 4RK1A 1H9CA 2PJUA 1ISRA 3DBIA 5CNJA 5TE9A 2RJOA 1ISSA 5HM6A 1QNLA 4Z4CA 4H3KB 3A0UA 5TPWA 1JYEA 1PUXA 3CLKA 4WXMA 1E6KA 4YCSA 1JWLA 5IULC 5IUKC 1DG9A 2DRIA 3LTEA 2PKXA 1APBA 3LUDA 3LUGA 4HNSA 3C97A 2ZAYA 3EQZA 3EULA 3O2SB 5DKFA 1XHFA 2WJWA 3F6PA 3SM9A 1TM2A 4G86A 1F51E 4OG2A 1PNRA 3C3WA 3O75A 1DP4A 4JP1A 4L4UA 4G0QA 2FEKA 2PLNA 1EAYA 3ILHA 4JOQA 2QV0A 3OMWA 1Z25A 4MS4A 1YMVA 4EYKA 4HYEA 4LZLA 1PNTA 1EWKA 3HUUA 3DGFC 3LOPA 3EJWA 1USGA 5DLEA 3UUGA 3HS3A 1MVOA 5TQ0A 5CNIA 4MS4B 1DBWA 1EWVA 1BVHA 4F06A 4KFCA 5T7BA 4KPYA 1A04A 2L2QA 3H5IA 1GCAA 5EWJA 1TMYA 4EYGA 2NT4A 3TD9A 1BDHA 3OM0A 3RQIA 4NCBA 3NBMA 3RVLA 3H6GA 1EHCA 1URPA 2AYXA 1Z18A 1NXSA 4Q6WA 5EWJB 2E4YA 3FFTA 4G0XA 3DGEC 1LJLA 1MIHA 4ETNA 1QQAA 3FGZA 2NZUG 2H3HA 1DC8A 1M5TA 2PAFA 3JPYA 2QSJA 3RVRA 3KKEA 2I6FA 5CNKA 5IX8A 2WJAA 5ABPA 2P4UA 3RH0A 5CNMA 2IDMA 3MQ4A 4QYMA 5F64A 3OLZA 3BILA 4F3TA 2ZWMA 1D1PA 1ZESA 1U04A 2PUBA 2QW1A 4MR8B 4YS6A 3H5LA 3F6CA 4M88A 4RK4A 1YVUA 2FSPA 1YTUA 3Q7TA 4LX8A 2A9PA 5IEBA 3HDVA 4EVRA 3H1FA 1NXTA 4MYRA 2FW0A 4HNRA 1Z26A 2IPAB 2MYUA 3G1WA 3OLWA 3H75A 4JASB 1YK1A 2HQBA 3LKVA 1ABFA 9ABPA 3M9XA 4Z99A 1FFSA 3RVKA 4S05A 3O1IC 1ZGZA 3T8YA 1A0OA 5KC8A 4Z4IA 3NNNA 2VK2A 1MB3A 1SXGA 1AB6A 1W9HA 2A9RA 2IPLA 2V0NA 4E7OA 3HXMA 3EDCA 4RDCA 1M2FA 5FBKA 1L5YA 1FQWA 3QX9A 3CS3A 3KLNA 3GRCA 4NV3A 2FMHA 3E61A 4JAVC 4OLBA 4RK7A 1DCMA 1QO0D 2AYZA 3I5AA 3NNDA 3RVQA 3KHTA 3N0WA 3Q41A 1QP7A 4L85A 1ZN2A 2QR3A 3O21A 2IOYA 1QP4A 1NXWA 4P98A 1ZHHA 5TPZD 3D8UA 3N8IA 2LPMA 3O1HB 2MYPA 3QLVC 2JRLA 4QICA 3CKMA 5E3JA 2VYCA 4ZYLA 1BAPA 3FDFA 3ROTA 3H1GA 3HVRA 3TO5A 5ED4A 2GX6A 5IUNC 4G97A 3QEMA 4RU1A 3DLBA 2QZJA 4MQFA 5EWLA 1A2OA 1JYFA 5HSGA 2CHEA 5CHYA 1DZ3A 4KK4A 3KYJB 2A9OA 2RDMA 4DN6A 3KS9A 3LUJA 4WZZA 2FMFA 4W5QA 3QEMB 4OLAA 4GPAA 3QLTA 3MYYA 5KQMA 1JFVA 4RS3A 1XWWA 2FLKA 2MSWA 1VLZA 1JDPA 4W5RA 2N9UA 4KQ9A 1EWTA 2E4ZA 2WWVD 3EODA 4MS1B 4G0MA 1M2EA 1DRKA 4OATA 2L19A 1DC7A 4N76A 1NXPA 4RY8A 2O20A 5TPWB 1YS7A 4Z4HA 2HQRA 1ZDMA 4ZPJA 4NCAA 2ID9A 3CG0A 1YMUA 4Q7EA 1RPJA 4Z4GA 1ZGGA 4ML3A 1U2QA 2MYNA 4LE1A 1VKRA 4OBBA 1ZH2A 1F4VA 4RK0A 4NICA 5TQJA 3RVJA 1USIA 5I4CA 1JBEA 2GBPA 1RNLA 3OMXA 5BRJA 1UDRA 3IP6A 1GUBA 4B09A 1NXVA 2PL9A 3MIZA 3HK2A 3K9CA 3CRNA 1MAVA 2FLWA 1ZAYA 2JVKA 3BRSA 3EQ2A 3MA0A 1P2FA 5JNUA 5KQLA 3TB6A 1NATA 2FEPA 1TVMA 3QX8A 1Z12A 3O2QB 2NZVG 4IMIB 2XDYA 3KTOA 4G0OA 4MRMA 1Z13A 4TMYA 5TQ0B 5BR1A 1Z2DA 4KRFA 3LUCA 3D02A 4LDAA 4W5NA 2PUGA 2QU7A 1DCKA 2QXYA 5EWMA 2MSKA 1JLKA 4EY3A 4YV7A 3FMVA 4MR7A 4RKRA 4F12A 1EFAA 4YLEA 4MRMB 1L5ZA 3DZDA 3T6KA 2GKGA 2H0AA 3QEKA 4G0ZA 3IP5A 1SD5A 1U0SY 1Y1LA 2FN8A 3R0JA 4UHKA 5EWMB 5PNTA 5TQ2A 4MR9A 1C4WA 3C3KA 3LUHA 3N0XA 1E6MA 3I45A 2R47A 1SXIA 4KZKA 3W9SA 3HUTA 1R8JA 4EVSA 2OENG 3VNAA 4RXTA 1KRXA 1PEYA 2JCGA 4MR9B 4CBVA 2JB9A 1FSPA 4RSMA 3SNKA 1SXHA 1VRVA 4Y9TA 6ABPA 1JFSA 3RVOA 1ZITA 3HO1A 4RK5A 4RY0A 1JDNA 4TLLB 2CD7A 4ZMRA 3H5WA 3UKJA 4KNYA 4EVQA 4PEVA 3KLOA 4TLMB 1JH9A 1JFTA 1USKA 3HV2A 4MQEA 1DBQA 4JB0A 5IEJA 2FQXA 2PL1A 5C5EA 1P8AA 2M98A 4QYWA 1DCFA 2LBPA 4P1ZA 4XXHA 4YGXB 3IPCA 5KQGA 4PICA 4MQEB 3E3MA 1NY5A 1YK0A 5DGCA 4D6YA 3HM9A 3IPAA 3HCWA 4RXMA 3SG0A 4RWEA 3EAFA 3MMNA 5JNWA 1AB5A 2B4AA 4EYQA 3KSMA 5FWXA 1QKKA 5KI6A 3JTEA 1MB0A 1LJUA 3A0RB 3LUFA 2X7XA 4H60A 1GLGA 3SY8A 3GT7A 3GBVA 4KQCA 4MAAA 3IP7A 4O5AA 5FWXB 3G85A 5KWSA 2Q5CA 1FFGA 1JX6A 3BBLA 3H5TA 3JPWA 4W5TA 4ETMA 4ETIA 3TMYA 1D4ZA 4JB2A 4MS3A 3C6QA 4G0PA 4EGSA 4F8JA 5HKOA 3GBPA 3RVNA 3H5OA 3JVIA 4WWHA 3O2JA 8ABPA 5JNRA 3CG4A 4IMJB 3L6UA 4N0QA 1KRWA 1Z16A 3URMA 1LBIA 1ZY2A 4XLTA 4PE5B 2F8SA 1GUDA 2ID7A 3OLVA 3OQOA 4MPTA 4MQFB 5IUJC 4RZSA 3N53A 4IILA 4RKQA 5EWLB 5HQJA 3CHYA 3GL9A 2JVJA 3KCNA 1M5UA 4Z9AA 4KREA 4NQRA 2RGYA 5B3JC 1BDJA 3IDOA 4GNRA 3ROFA 3H6HA 3ILYA 3OLXA 4Z0NA 3BREA 6CHYA 2A9QA 3JS5A 2E4UA 2WMYA 3GA5A 4F11A 4N47A 2GI4A 4RK6A 4ZJPA 1D2AA 2PUEA 1D1QA 2QVCA 2JBAA 1NXOA 4MLCA 4Q6BA 2YHAA 1Z17A 1SRRA 4D74A 4YRZA 2CWDA 2FQWA 4UHJA 3Q9SA 3T95A 1RZRD 2LIVA 3O74A 2FXIA 1U2PA 2M1ZA 2JBAB 1K68A 4QPJC 5D2CA 3OM1A 1KGSA 5T3YA 3OO1A 3TX6A 1VPWA 4LE2A 4WUTA 3CU5A 2IPNA 1BA2A 3RVSA 3HJFA 3M6MD 1E2BA 2HPHA 2VUHB 4KK3A 4KVFA 2OQRA 1DBPA 2B1JA 3O1JC 5IC5A 5FWYA 4LE0A 4G0YA 1RZRA 3C3MA 1GCGA 3GYBA 4RXUA 5JNSA 4N41A 1T34A 3QLVA 4OTZA 1LBHA 5JNVA 3QK7A 4XAQA 1RXEA 5FWYB 4Z4EA 2FEWB 2HJ9A 4IF4A 1D5WA 3H5VA 1E6LA 3B2NA 3SQNA 4WT7A 2WRZA 3LMKA 1B00A 1QP0A 3N75A 1U8TA 4TN5A 5DCLA 5JS1A 1OXKB 1YS6A 3QLUC 4DQDA 1Z2EA 5FBHA 3CNBA 1ABEA 1DRJA 1HEYA 2FKAA 1TLFA 3OLYA 4MR7B 2PE5A 2NUBA 3RVPA 1P6QA 4W5OA 3NHZA 3CZCA 3KYIB 1JF8A 5TQ2B 1C0EA 3LKBA 3Q7RA 3M9WA 5B3JA 4YWHA 2R25B 3OQNA 2FTKE 3Q15C 1IIBA 3JY6A 4FE7A 4N0PA 3GWGA 3QELA 1CHNA 1Z15A 4KMRA 5GOTA 2IPMA 4PZ0A 1W25A 2WB4A 3VNBA 3DLHA 2E4XA 3LFTA 4RV5A 2LP4Y 2L17A 3N0RA 3NNSA 4N03A 3KG2A 4DADA 2LUOA 2BGGA 3QELB 4IGAA 2PUCA 5KC9A 5KQPA 1NTRA
chains in the Genus database with same CATH superfamily
3KTDA 2B8WA 3TLXA 1YZQA 1GVHA 3EYWA 4WLVA 5B6IA 4H27A 5L40A 1LBSA 3NATA 4EMSA 5MN4A 5A02A 2O1SA 4DCUA 2W2XA 2B34A 1OR8A 2R6AA 2XMDA 4Z8YA 2Z2JA 3BRWA 3Q3GE 1HE8B 4I1IA 3PXDA 1YR7A 2G71A 4PZEA 3ORYA 5ALXA 4DUGD 1DKOA 4L2IA 4DG8A 1HDYA 4UQLA 3TLEA 5KZMB 4HNAA 2I76A 2C9YA 3BFPA 2R00C 4G1CA 4REMA 4RWZA 2B4RO 2QL9A 4ZKEA 3DONA 3EVAA 3IJPA 3VR4D 2OT3B 2WTMA 3U3MA 1WETA 2GDJA 3ET4A 1KQFA 2Q29A 4IUBS 3BIJA 3IMKA 4I6GA 3TOZA 4RJLA 1IHOA 3R3WA 4ENRA 1KYTA 1NSYA 3GMDA 621PA 1FQOA 1TMOA 4HAYA 4KWCA 3K0CA 5NULA 1EXNA 1W49A 1PFKA 2AR0A 2CHVA 4UVIA 3UCXA 2SKEA 2O8EB 1P6UA 2PSSA 3F96A 3I01M 5AI4A 1EHYA 1GR0A 1XAGA 1EQUA 2RI0A 2VWQA 2ZLBA 3DAGA 4O2BB 4X9XA 2H59A 1FT4A 5ETJA 1TKBA 4Z7OB 1U63A 2O59A 2JLVA 2GRUA 3QBEA 3AM4A 3RNLA 5LZ9A 2C2MA 4U9UA 1RHMA 4W63A 2UUAB 3NJRA 2FPIA 5HBRA 3RJ9A 1WCIA 5K0LA 3BBPA 4MS3B 3QU5A 3OU6A 2NO4A 5IJ9A 1SY7A 3T5CA 3BRQA 4HVLA 2BFCB 2O7QA 4ZAXA 2VNHA 4C20A 1RBYA 3MUNA 4WK0B 1ZJ5A 4Z4FA 3QY9A 2AGVA 2OO5A 3G49A 5F2NA 5L9AA 4RVHA 5SYAA 3L8DA 4B4VA 4J0QA 3PR1A 1Y1RA 1I7DA 2EL7A 3INGA 4GPZA 1W4CA 2IU3A 3GEEA 5CFZA 5JSZB 3JYQA 1BJRE 3A9VA 4R31A 4R4JA 4C7BA 4GDFA 3VPBA 3VR5H 1VI2A 2ZB7A 4D9HA 1AMUA 1QO0A 1W44A 3A28A 5FNZA 4JI5B 1LI5A 1PLKA 2JCSA 4DLYA 2JK1A 1BZYA 3I32A 4LECA 4OI1A 1PJCA 3EVFA 3L1IA 1KSHA 4FFVA 4P22A 3VO9A 1QS0A 1RC0A 1SUAA 3I34X 3GGCA 3K70B 5JYCA 1E9DA 5DTQA 5AI0A 4H1UA 4IIGA 5CNJA 2G9UA 1NX9A 3A9UA 3INNA 5EG5A 5FUYA 2P3QA 2ZSFA 4H3KB 4YDHB 4QZVA 2XNJA 3LHSA 2C9CA 2J3DA 3DZJA 5IBCA 1WUHS 3JD2A 3HA7A 3IQEA 4C01A 1OWMA 4DAEA 4QPDA 2P8SA 4IWYA 3UB3A 2F62A 3R9WA 2F9FA 4QXOA 4JJ8A 4YT5A 5B55A 1HFEL 4LZWA 3E7XA 4FGZA 4DRZA 1XPRA 1H8HD 1OROA 3RW9A 5KHOC 1I10A 1Z5ZA 2H7VA 4G0QA 2FEKA 1YZTA 1EAYA 1GYQA 4QRHA 5HJEA 3GGOA 3T3OA 1AGYA 2BM8A 4TTAA 1T9GS 4HWPA 4F9GA 1LNZA 5BUSA 3AFOA 3TLCA 3BT7A 3D9QX 1X2EA 2VBIA 4UD6A 2V59A 2ANCA 1E98A 1CY4A 2G5GX 1EWVA 4JC8A 4U8HA 3BMCB 4JNCA 1XQVA 4PGAA 5B3AA 1QANA 1IRIA 2QQGA 4K5QA 2PFGA 5EY5B 1G3MA 1G5RA 2NT4A 4DWOA 5EVCA 2H2WA 4GKBA 5H9VA 2OGTA 1QU3A 2DUWA 3GJQA 3ESBA 3MTIA 4HUTA 4AXXA 1ENOA 4HWOA 3GELA 3FSGD 5DLPA 3KSZO 2IY9A 4DNQA 2OYRA 2IS1A 2AR9A 3SQMA 4IRUB 3T61A 3NHUA 1G6Q1 2Z2YA 4TS3A 2DKFA 3TOXA 5AUOB 3FCXA 3TN7A 1WIWA 1WSBA 2EG5A 4HAZA 3FNIA 4HS9A 1CERA 1KE1A 4JVMA 3QMMA 1PVVA 3B1WA 4OP3A 2IYUA 3KKEA 1NMXA 2GOYA 3QEJA 2ES4A 1IZYA 1S3SA 2QRHA 3GGSA 1EHIA 3R24A 2B1QA 3AL2A 4NJOA 3WGYA 3FVRA 4TKVA 3SQOA 1BW9B 1QYDA 4CLRA 1QDEA 3T3DA 4HPJB 1PUJA 4O2BF 2P4SA 3T7RA 2EARA 3KWLA 2VP0A 1A9QA 1A4UA 3LL7A 3ED5A 1RFGE 1QF6A 1GZ3A 4DBLC 4XFDA 1U2DC 3EZ7A 3RJZA 2XCOA 4AURA 5KVVA 2K7ZA 2OV4A 2QNIA 3D3QA 2UWIA 2F1IA 3T3EA 2H1LA 1OLUA 3Q7TA 2QVBA 1T5SA 2Y66A 2Y9PB 3HDVA 3R76A 1OYVA 1ZIXA 2CNBA 2OYSA 4MUIA 4OVKA 3RM3A 2VXBA 1U1FA 1RYEA 3PB3A 3VQTA 4P7KA 4IKOA 3ZCUA 1KI8A 5HOEA 1II0A 2BGKA 2OHHA 1FLNA 5I9SA 3IULA 1WB6A 1QAQA 2V5AA 1PZXA 4X64B 2IHVA 1E9CA 5FFMA 3ZHSA 1RI3A 3CJTA 4CIDA 4D9IA 4JU8A 3CY6A 4DMFA 1U8FO 3VOAA 1UKVY 2MMGA 1FXSA 1FXUA 3AERB 3MCUA 4L5BA 4CQMA 2Q8QA 4F4HA 1SQ0A 1KQGA 3U5TA 1ETHA 3GU3A 3IB3A 3G79A 1W4BA 1DOHA 3PQ8A 4JKIA 1E79D 5CA0B 1UBNA 1EM6A 1ZP6A 2X0FA 3TKLA 3VSBA 5JG7A 1XP8A 4KO2S 1DB3A 2BMFA 2Z5LA 3C6KA 4L15A 1LSSA 3U4GA 4YXFA 2ZQ5A 1LX7A 1PIWA 1XP5A 3JYHA 2O5VA 4P93A 3PLNA 4E6PA 1DAPA 3ZDXB 3O21A 4YMHA 2HPZA 1G21A 1M6NA 2FZEA 4FFBA 5AI9A 2MYPA 3ETGA 5EWJB 2CHUA 2Q27A 3FTQA 3AIOA 2OXFA 4AP9A 1A4RA 4PBTA 5FKJA 3RASA 3R3ZA 4S35A 4G36A 2J9ZB 5JQGB 4ZZ3A 2C1XA 5IUNC 2FSVA 1MAHA 1KEPA 5SY4A 5AHKA 4IGFA 1QYVA 4TLAA 4BP9A 3ZHQA 5AH0A 3KYJB 2A0UA 4NFLA 5ARCA 3SJAA 2YIVX 2O2EA 1OE0A 1NJ2A 2PH7A 2QX9A 4B3HA 1FJXA 1WO8A 3NHPA 4V03A 5AJYA 5TS2A 1LK7A 3AXSA 1EDOA 1AD2A 3IPRA 3K30A 4PG7A 2AFVA 1LVHA 3LHDA 4AZSA 1KYZA 5D8DA 3KEQA 5JEDA 2VPWA 2ZKLA 2A84A 3GRFA 3P0EA 4QXQA 5C4MA 1YDMA 4CM7A 4MQMA 5J5AA 5LU8A 2NU7B 1N32B 1S6YA 2JGDB 2HU7A 3SYRA 4OUDB 2QW0X 1G291 1UK7A 2IYOA 2H6EA 3ZE1B 4DIBA 2I8LA 3TUZC 1HNXB 4AZWA 3JWIA 1GPBA 1NXPA 2HTEA 4KN6A 1NBMD 4FWTA 1JU9A 1QIHA 2AVDA 2WSSD 5BP7A 1LJ8A 3FSJX 4Z4GA 3O4FA 1VMKA 1H66A 5BSFA 4H3SA 2EW8A 4V2IA 4ZCPA 1TEVA 4G0WA 3PA8A 1REQB 5AKIA 1J0AA 2B5OA 4OQEA 3UT5B 2R97A 2P30A 2P2SA 1Z0UA 5C8YB 1NLZA 1VMIA 4CR6A 3PK0A 2V9CA 5IAKA 5E7JA 5BYJA 4DV5B 1BEZA 1VYTA 5AIAA 3KZXA 4FFOA 4H59A 4C4AA 3NANA 3QVGB 4AMYA 1W73A 2HN9A 1YRWA 5I45A 2N47A 3L7MA 4HZGA 3SEQA 3HB9A 1XU4A 3P9SA 4OHRA 3UATA 1QO7A 2HDOA 3FVTA 3IQGX 4F12A 2I7VA 2VIIA 1P17A 4MRMB 4YR9A 4E2FA 2DQSA 3PDWA 1RU3A 1XCMA 4IJUA 1YHNA 2CXXA 4UHKA 4EVIA 1B73A 1E7QA 4I46A 4X00A 5AHXA 3LE8A 1XCLA 2AMFA 2PA0A 4J6EA 1GUAA 4KACA 4EVSA 3DOCA 1DQYA 2BHNA 1N6PA 1Z8NA 1W2HA 2B9EA 4P83A 4HT3B 4KN5A 3V1UA 2QM7A 2WG2A 3ZQUA 3WGMA 3HBMA 2JB9A 3P94A 5FPSA 3X3HA 2LDXA 2DERA 1KZ4A 2C94A 4OHVA 1JLRA 3L2OB 2OG2A 2NIPA 1Q6YA 4ZTUB 2QTNA 1PJ8A 2LTAA 3I0MA 4ID3A 4UUNA 2CD7A 3ZCPA 1WHSA 4LNUB 1SOAA 2GZDA 4QEKA 1JQBA 1ADJA 3AUFA 4C7MA 1K7FB 1U1IA 3I83A 2F6RA 3JAKA 1VE1A 2Q4TA 1TXGA 4TRNA 1USKA 1RD4A 4QREA 2PANA 4ZD6A 5K0GA 2EV9A 3I9KA 2A7QA 1D0IA 4B3TB 4IWNA 5LQSA 5L36B 5FI1B 5KSWB 5IJWA 5HBGA 2NACA 1AZSC 3CT4A 2X8JB 4GPIB 1K4YA 4Q7JB 1JIJA 3QUSA 4KXLA 1V16B 3TXAA 1HDOA 5CX1B 1NX6A 4ZXPA 5FH9A 4ALJA 1T6NA 3GLSA 4NIMA 4X3OA 3VU9A 5K9ZA 1UJ5A 3U7RA 3LKDA 5JCXA 3HM9A 2A9VA 2YDXA 5JYDA 3ABRB 2OXRA 3LC7O 4RXMA 4C22A 3IAEA 4EDHA 4EW1A 1VB3A 3CRRA 3D4OA 1DMRA 1AZTA 2WD7B 5G40A 5H3HA 4MGIR 1TEZA 2PX0A 3ROZA 3RG2A 3E81A 3W6UA 1KC3A 1ZN7A 5TDHA 6ADHA 3MBWA 4FHGA 3ICWA 1OLXB 2X1HA 4GR5A 5JJ5A 5ICGA 3G1UA 2ZB8A 1CUBA 4IIHA 1WZIA 2NSLA 1E3DA 3BFKA 5BQ5A 1ZD3A 5LJLA 1FP2A 1KY3A 2N46A 2ZIEA 2ZULA 1NAHA 2LCIA 3KB8A 3K8YA 4HQ6A 4R6XA 4CM4A 3GT7A 1PO7A 2FPPB 4AJOA 4EYSA 3U6KA 4FZJA 4Y9DA 4NZMA 1O0SA 2Z5VA 1IQ0A 5LA6B 3CE6A 1IEXA 4GOKA 3KKOA 4MRSA 5EE1A 1DWQA 3WKAA 4UOEA 1J24A 3HJGA 4X94A 2PUWA 3CLUD 1PR0A 1BGXT 3MPUA 4HDSA 3NHWA 1Z0JA 4J16A 1YV9A 4L0CA 3WMGA 5ILOA 1N5JA 3E2IA 1OXMA 2EJBA 4IMJB 2UU9B 5DNUA 1Y3AA 2JIQA 1YC2A 2YWCA 4G5HA 4BFWA 4EKDA 2O1WA 4FNAA 4PCLA 3T7KA 3WLAA 2KB0A 5DJ5A 5DI9A 4G1EB 1Q0ZA 2IF0A 3CHYA 3EDOA 4M49A 1CZRA 2B8EA 1BMFD 3R3JA 3WKCA 1HNWB 5J63A 2ZJAA 1BX0A 2HMUA 2NO0A 4NJMA 2CB0A 4ARZB 1WDMA 1R0SA 3RRNA 3TOVA 1YNSA 2ROQA 4MVJG 4E46A 3EZ9A 3BTSA 4FW9A 1H2XA 3AL3A 1NYQA 1YQDA 3P1JA 4OLHA 4J6GC 4V0OA 4DGSA 4UDYX 1MMFB 4FBGA 4OM8A 4ISCA 5JV5A 3QWAA 1SUFA 5ECGC 5COQA 1VJRA 3WRWA 2Y1GA 3C70A 3G6KA 4AJ2A 3ZD9A 3FPJA 5G0SA 4MJ3A 1DAIA 2GS9A 3ZHBA 3OJ0A 1IY0A 5JC1A 3CX6A 1AGNA 1YS9A 2M1ZA 2HCBA 3CWCA 3LWZA 1I1NA 3R6DA 1O95D 1N2BA 4HWRA 3T7SA 5A5EA 3HNPA 5DHFA 3I64A 4EI7A 2UDPA 3TL3A 3DTVB 1KMQA 2BKEA 4FDLA 3QPCA 2B20A 2CBZA 4HNTA 1W36C 1BA2A 2H2AA 2PV0A 4CGYA 2VP6A 1LU9A 1NR1A 3BMNA 1YRLA 2Y2UA 5KTRA 1HGXA 4PIPA 4V0MA 2Y27A 5MF6A 2F1KA 1KEUA 3LF1A 4MA0A 1TQ6A 4K40A 4BBZA 3ZWKA 1JG3A 1QGAA 2O2CA 1TF2A 3QLVA 4RELA 2Z4SA 4Q00A 1C4KA 2JNWA 1UQRA 1R0CA 3IKVA 1QTIA 1WQ3A 4BASA 4ZIRA 3V8RA 2XF8A 3N2LA 1CQJB 2LDBA 1GTL1 5GP1A 5BW5A 1D0SA 1KEZA 3L8FA 3LC1O 3QFTA 1PFQA 1CLEA 2QEQA 4FEEA 1ABEA 2DOKA 3B53X 2IUYA 4AZ3B 3D0OA 2I1VB 5EIXA 3UT6A 1E96A 1TEHA 3A3YA 4CL3A 4RIHA 1OMOA 2E3JA 1UDAA 2UZ0A 3IQIX 5K6RA 3M9WA 2YJ5A 5CCXA 1FDRA 4HFNA 4GXNA 4QUJA 3TPZA 1GILA 3S1SA 1HDZA 4D92A 2EYUA 2GN1A 2RG7A 5CJ2A 1L5VA 2DWOA 5AKKA 1G41A 3PFBA 5IBPA 1IHXA 2E2WA 4KQXA 2I66A 4BGDA 1II8A 3SC6A 2CV1A 3LWBA 2J9FB 1PF7E 3DE6X 1FYEA 3NNSA 1U8EA 4FK8A 4WEOA 3WC4A 4KU4A 1TOAA 3DXXA 3RKRA 3AGPA 4K87A 5BN1A 3BVPA 3A2KA 1JU3A 4L57A 1AV7A 1T1EA 5KYUA 3WGIA 1UK9A 4MW2A 3O1LA 4AROA 4XLZA 5CLFA 5AJHA 1CUYA 5EP3A 5BQFA 1IN4A 2AB0A 2X1MA 3TM5A 3VA7A 1XKLA 1RAFA 4BO0A 5GPBA 3IHKA 3QW4B 1J56A 1GPKA 2C3PA 3CLSC 4NARA 5FA8A 2PMFA 4I1YA 4IOLA 2YC4C 1VZ2A 1J70A 2Y92A 1NNSA 5JJIA 3CLTD 3HEMA 1LD3A 5I48A 5KTPA 4CLOB 4PGHA 2NTVA 3NP7A 4UUBA 5AVSA 4XFKA 5BVHB 4HN9A 1RWOA 4NLLA 5J5VA 5K0ZA 1FX1A 1FFEA 4IIBA 1RP7A 2Q2WA 3QV1A 2C92A 1S02A 2NQTA 4O1HA 4RADA 4X6XA 4ZVUA 5NLLA 4CF5A 1Y6JA 1J5PA 4D6PA 2BFFA 3LHIA 3PUIA 4YAIA 1OJ7A 1I3KA 3L49A 5A1TA 3FF1A 3KLBA 5JY6A 1OLSB 1QYRA 4LNHA 4XSGA 2HNAA 1ACMA 3DEIA 4U6QA 4HQ0A 2FWAA 4NEHB 1TYAE 3WGOA 4LOKA 5H70A 2A5LA 4BO6A 4EG0A 4LZOA 3ZLUA 4RH1A 5JAPA 5IDYA 1US8B 3IX7A 3VSAA 1PV4A 1AOXA 1B16A 5J3JA 4UFNA 3OKPA 5JCOC 3G0HA 3D54D 2WUWE 4RQUA 2HLNA 3QU4A 4E7PA 3MWJA 3ZG6A 2ATIA 4RANA 5CCDA 4JI7B 2WOOA 5BQ3A 3VZSA 1GRCA 1HE3A 1I6WA 2HJVA 5MN6A 3DAPA 5BNQR 1QOZA 1TU4A 3DTVD 1IN6A 1WPGA 4IHAA 1DT5A 3BXGA 1DV2A 4O4JB 3UFXA 3ASZA 4BKMA 3HYRA 3P26A 4FS3A 4UOQA 4DM3A 1SC9A 3V9AA 5JBNA 3D8BA 3LPAA 5J2UA 3MMXA 1X80B 2HREA 1FU4A 1FBNA 3TGLA 2RAFA 3RSZA 1UJBA 3WTCA 4IO1A 2H1WA 4X95A 1B76A 1JQJC 1XDZA 3HP4A 3W4IA 1PDWA 3I8XA 1ZW1A 1SQSA 3BJZA 1E2HA 3NVKI 1MAUA 1A9RA 4HGYA 1XEAA 1UMCA 3OBBA 4IHJA 4ARUA 4EGJA 3RU2A 1BN7A 5DI3A 1R2QA 2AC2A 2JKYA 2W37A 3VV3A 5GIPE 2M6LA 5I3ZA 1IJFA 1JR3E 3TG8A 1Q0HA 5B57C 1XL0A 2R00A 1T25A 3C1AA 3CH6A 3EHDA 4XUCA 4WESA 9LDBA 2GJKA 3GO4A 1I80A 5IPFA 3NHAA 2W43A 1CUVA 3K6RA 3C87A 3TW0A 3FWKA 4W99A 3NDIA 4G86A 4FSHA 3ZWWA 4A8HA 2I3ZA 4FC7A 4TKMA 5HRCA 4EG7A 1GADO 2PA3A 2WV9A 2YZ7A 2J7KA 1J2RA 1U02A 4V1CA 4RA6B 2FWBA 4JOQA 3ZGXA 1NW3A 2V3VA 1KVTA 3VJRA 3W6OA 3JATA 4L0MA 3DKKA 3BG5A 1B2LA 2GN8A 3LNTA 4ND8B 1Q14A 1XFAA 2AG6A 3A9RA 4POAA 5ALWA 3NBYC 3OPMA 1EFPB 3VGJA 3VU0A 3AWIA 3IEKA 4ZOAA 3WAJA 2BEUA 2BKUA 4AG6A 4L6AA 4F86A 3SYMA 1L7DA 4LXYA 1AMOA 3OZFA 2ZIZA 1QG2A 3EGWA 4MS4B 1ZSNA 3U3OA 1TT5B 4C76A 4OMUA 5FJIA 4HB0A 4PVDA 4UBMA 5K3BA 1M75A 5KJ6A 5DWQA 2N3ZA 4GYWA 4I55B 1DTWB 2VPYA 1D03A 4WKNA 1NGSA 2G63A 5FPKA 3FNEA 3NBMA 3GA7A 3RVLA 3GVXA 3DBRB 2YWRA 4AY3A 2IVZA 5CM8B 5I47A 2IQIA 1GEEA 3KIPA 2YXBA 1A7UA 3NH6A 3GG2A 1PVDA 1WUIS 1MC8A 1Y0BA 1Y5NA 3EEBA 2JS7A 1TQ2A 4LSGA 1D7AA 3DUWA 1RHQA 2ODEA 2H4XA 3DMYA 1YDEA 3EGXB 5EE5B 3GLTA 4D0GA 4Y2SA 3ADBA 1YH3A 3SYNA 3ZKWA 3ZOKA 2WA1A 2X14A 4C1NA 4DYDA 3MB8A 4S24A 2ZB2A 3A1CA 1N6RA 3I6BA 2BIFA 3FHOA 5IYZB 2BSAA 1SXPA 3PGXA 1TRHA 5DPMA 2Q2OA 2M6SA 2BKLA 4C89A 2WAMA 3GZNA 3STUA 3RWBA 3C5WP 1TUBA 3R8CA 2IEGA 3NAQA 3W78A 2AF4C 2AS0A 2C7GA 3QI7A 4KRGA 1N1EA 4FPXA 3KZOA 3I4LA 3JQPA 4IVQA 3N5CA 5JW6A 3EISA 4ECEA 4QQNA 2YY6A 1AZWA 4MYRA 5A5VA 3Q10A 3GLHA 1Q17A 1SXJE 2QLLA 4G5GA 2PG3A 3LX4A 1E60A 2YCBA 5CP8A 2A1UB 4JIGA 3HN7A 1NC3A 1XLTA 2ZTVA 4M89A 3MYRA 1QVZA 3LOUA 4EF6A 2O2HA 1UPBA 3GDOA 5JDIA 4IMPA 1L0BA 5I4BA 4BLRA 2FZLA 1DINA 1EX6A 5LOVA 4P7BA 3VTZA 3QOXA 1LH0A 2QRQA 1Y4DE 3R7WA 1XPOA 3CF4A 3F7TA 4ZYWA 4TYNA 5ITZB 1JHAA 4NV3A 1YZLA 3JD3A 2ZYAA 3SC4A 2GCGA 2OK8A 1T4CA 3D43A 1WB5A 1LNSA 5BR8B 2JAXA 2OFXA 3GYGA 2VQEB 5IK2D 4DV6B 5SY9A 3RVJA 4ON9A 3UPDA 5E9JA 4XX0A 4JSRA 5GOZA 1M10A 4F9EA 2FY8A 1J9EA 3N8IA 3O1HB 1BIFA 1SOVA 1K6XA 1VBKA 3KV3O 4N18A 4L3WA 4X6LA 4YAOA 5CT9A 1Z4NA 4B3CA 2Z6AA 4CKZA 5F5LA 1EVJA 3AU8A 1DRUA 2UYQA 3QKWA 3DLBA 1YGPA 2UVQA 3EIHA 4NPCA 5G3YA 4AP6A 4D4KA 5FOQA 3ND7A 2BKXA 3OZVA 4KLZA 4EZIA 1FNNA 1IQRA 2GN6A 1KQNA 3U3PA 1IXKA 3B8HA 4DIEA 5CB6A 3OX4A 4MUMA 1OBFO 4GG1A 3S1AA 4WZZA 5EKSA 3IOBA 2GETA 1FNDA 2PH1A 2IXFA 2PQ6A 2W9XA 3HR8A 2XNCA 3ON5A 2O48X 4ZDWA 3TJRA 1ZHOA 1YDGA 2R84A 1JFVA 3ILXA 4N0DA 1U2DA 3DMRA 2D2FA 3IMFA 4PZZA 5LN1A 2WZQA 1K8RA 3AKEA 3IQFA 3PFNA 4R2XA 4D1YA 4WDQA 1HNZB 3JQFC 2RHJA 2GYUA 2VF7A 1C8LA 1FDIA 1J00A 1MJHA 1WS6A 2CLHB 2FV8A 2G9RA 2WHXA 3CUTA 3N2GA 4ITVA 4UDOA 4I55F 1UDCA 2MDTA 4Y98A 4B33A 1IEQA 4KB5A 3TQIA 4K28A 4LTNA 1KBQA 1WXGA 2J3LA 3CV3A 1DRKA 4UJ3A 1ORDA 1L5KA 3SICE 3UNXA 1RJ9A 3CEPB 4RY8A 4UXJA 2VQ3A 2X22A 4N6NA 1XK6A 3R5HA 4BXOA 3V7WA 4CE6A 1UC5B 2Q1XA 1R5NA 1TC2A 2VT3A 5EN4A 4O4IF 5IMBA 3SE0A 4I4LA 1O6CA 3F9CA 2R8XA 2I4RA 2E1RA 2HLPA 4M8IA 3RS0A 2GBPA 5KWEA 1X1AA 3CEJA 4I1OA 3O93A 5DW3A 1L7AA 1VOTA 3EVNA 5HF6A 4F1WA 1B8OA 1SC4A 3CRNA 4JR1A 4TXJA 1TZKA 3E58A 3EXG2 2Y2VA 3JZAA 3AFMA 4UBKA 4XYGA 4H9GA 4ASUD 1Z33A 3TW8B 2AI3A 4D42A 3N70A 4K0KB 5D87A 3QMVA 4NU6A 1DKQA 3L4KA 2CY0A 3SYKA 2XDYA 2PR7A 4LY3A 3ZGNA 3V8VA 1L3IA 1UPFA 1J8QA 4DLNA 1OVGA 1P0IA 2D7CA 3FOWA 4J0DA 5FT9A 5BMVB 1T2DA 2O3TA 4S1OA 4EI2A 3G59A 2YJGA 3HYSA 1CVRA 3O8NA 1I36A 3MRVA 3OTQA 2R7LA 4E88A 2P5TB 1UJNA 1LLQA 3ER8A 2I54A 2HRRA 2FN8A 1YB4A 4DV7B 2SBTA 1ZM3A 2IITA 5AJZA 1YR9A 3W9SA 3GPIA 1YAHA 3MWEA 2OLEA 3NKLA 2O8FB 1Q77A 1HI9A 3H6KA 4LTMA 3GVHA 4PC2A 3RSFA 3EBLA 1RXSA 2XGJA 2QL7A 3H19A 3MVEA 1FFHA 1DT3A 3EGVA 4MR9B 3P96A 3I1FA 1SUCA 4BBAA 3WIBA 4HHEA 5JD5A 2C3UA 3LWNA 3OCZA 1RQ7A 1NVKA 3AUYA 2JI7A 3DEZA 3NBXX 1FU8A 5FR2A 6AT1A 1A27A 1IB0A 1RRMA 3PNMA 5DHUA 3IUQA 2VC2B 3RROA 4RMHA 1U5BB 4NV0A 1HURA 221PA 1C9MA 4G8JA 4JDPA 1KK3A 1SKYE 4YB8A 1HTWA 2O54A 1Z83A 2B99A 3PQDA 4HH4A 3O73A 3TRKA 2B36A 3HDYA 4Y0VA 2VTEA 1VBMA 1PZFA 4JI6B 2C04A 4BY9E 1NW4A 2WM9B 3FSEA 5A04A 1FDSA 2G40A 4ZQCB 4NCXA 1QVWA 1IY9A 2OBYA 1QIIA 1Z3CA 2HEGA 2P9YA 4E4TA 5B12A 1LDMA 1P75A 3D8NA 4IQ4A 4XXHA 2QM3A 4NU0A 3EOBI 1DQSA 1GN9A 1XRRA 3D0RA 1JLSA 1SURA 3NHSA 1NY5A 9GPBA 1Z0FA 4FJ2A 3DS8A 4EKYA 2C1EA 2DSNA 2JZCA 2DFVA 4I36A 2J6CA 4IHKA 4C4XA 3C98A 2C4WA 3B52X 3C3JA 3QUBA 5F78A 1Y33E 1WY7A 2FPLA 1KZ1A 2KQUA 1PJAA 1NMQA 3M70A 4UNQA 3OZTA 1CF2O 2AK3A 4X1YA 4KPFC 1Y3HA 1P5JA 3GCZA 2GCOA 1GPYA 1QB7A 5FO1A 3SY8A 4CZ2A 3JSXA 1XYYA 3I04A 4RFVA 3JYPA 1QF7A 4MAAA 2X8WA 2O8VA 2R9VA 1B3BA 1VI5A 2I1QA 4US0R 3D81A 1FEZA 3S44A 2XCTB 3AEXA 3IAS1 1FU7A 1KPHA 4PTLA 4RZ2A 5FI3A 2VNIA 5HF9A 4W5TA 2JLYA 4KSCA 4YJ2A 1RM0A 4FZVA 3USZA 4ZFNA 4LF9B 2PSFA 2DQKA 4A0RA 1RI4A 2EW1A 5JNRA 3BZWA 4JMLA 4O2AF 1M34A 5IZ4A 4CQLA 5M3BA 1G5PA 4PE5B 1ZU5A 2CCJA 1LRLA 4HAIA 1XQWA 4P0PB 3OLVA 1YJ5A 3PWZA 1Z29A 5EQTA 2AE2A 2CZCA 4M1OA 1C2TA 1E8DA 1GGVA 2Y1EA 4M37A 2DPLA 4MCAA 1Z4MA 2IUSA 3GGGA 5AW7A 2EFDB 4DCNA 5A9SB 4BN5A 3L6OO 3AHIA 2QX8A 2KPOA 3DWGA 2XMRA 4FCVA 4NWIA 3IOEA 4QU9A 5DEIA 1HQYE 3BWCA 3H6HA 3PNLA 4B8WA 1EDEA 1JZTA 1ZCZA 3O4HA 1JECA 1DX4A 4R54A 3UHJA 3OLXA 4AJHA 4ZHQA 3HCNA 6CHYA 4QRDA 3U16A 2VTBB 2A9QA 1I3OA 1QVVA 1R9JA 1GA1A 3EUFA 1MA3A 3DP7A 3MGKA 4ZJPA 2QTRA 2FP4A 4RM3A 1D2HA 1RVDA 1EZ1A 2HADA 2OR3A 1GLVA 4O2AA 3GLVA 2HT6A 3NCHA 2V65A 4WZBB 3RYFA 2VTVA 1KDYA 3U37A 5A03A 1V11B 1WCYA 2OZLA 3M5PA 1RRPA 1PWXA 3LT4A 4FU0A 5CCEA 1TAUA 1TYCA 1XEXA 2VAMA 3JU3A 2CFTA 2CWWA 2FQWA 3HFJA 3DOJA 4JHXA 4MVJE 5DTMA 5HCNA 3ROMA 5A3JA 1TLLA 1RKUA 1YQUA 5K8LA 4UAJA 5J1SB 1TJPB 2ZWVA 3QA3E 3EAGA 4H6WA 5GGXA 5A6SA 4D81A 4W8HA 2H8GA 4WBNF 2WYUA 3MELA 4F45A 3OM1A 2EHJA 5DVZA 3VDNB 1KK0A 2ZCUA 1FDOA 4F2DA 3ROXA 5F76A 1Z0DA 2IZOA 2HPHA 1H9AA 2VQSA 1E6EA 3W5IA 3O1JC 1ECFA 4L0QA 2JC3A 3C3DA 3KKNA 1IFXA 4LE0A 5GJWC 4TRJA 1CUEA 3QJ5A 3Q7PA 1XJ5A 3E1GA 4AU1A 4AYXA 5BSRA 1EFLA 3H17A 4ITUA 3RNOA 4EMTA 5DHSA 2PZKA 4OTZA 1LBHA 1JZQA 1NW9B 1NVBA 2ZJ0A 3QK7A 4BO7A 3THWA 1MW8X 3L1KA 1OREA 2FEWB 1TJ3A 2HJ9A 3LD9A 2EZUA 3TTXA 4OXRA 1P2GA 4IW3B 5SZKB 2J9XB 3LMKA 4DDTA 4FYMA 4CT4B 5DU2A 4RY2A 1E1MA 5HZGA 3REQA 4DQDA 5E1DA 4JYPA 4BE9A 2GHQA 4NDAA 4MR7B 1MJNA 2AUMA 5EHNA 1JHVA 3W6ZA 5K6TA 4KG7A 4RL4A 4D8YA 1T1JA 4MKXA 2P67A 1VDZA 1N0UA 2C4HA 2CYBA 3RVPA 4RS4A 1E4VA 1IN5A 1MO5A 3QIAA 1CJMA 4OQLA 4RDIA 1XYVA 4DCPA 5F4BA 2O3JA 2OHVA 3CCBA 3EIUA 4B5KA 2ODPA 2RGUA 2QMYA 1VRCA 1IIBA 13PKA 2DPXA 5EHQA 5F4ZA 3AESA 2G1UA 3U2QA 3CYFA 3L0SA 2IPMA 1XJ0A 4INPA 4PZ0A 5DULA 1RACA 3DZHA 3E9CA 2ZXEA 3B89A 3CLRC 2FFAA 3AUSA 3N0RA 4MVWA 1X14A 1ZICA 2Z8YM 1N6OA 3E9EA 3AILA 4DMMA 3Q8LA 2Q62A 1EK2A 1XMVA 5KMGA 3FKSA 2O8DA 3SQXA 3C3BA 3QOWA 4R84A 1NCFA 3H2HA 3PF8A 2FWJA 3NM5A 2XUDA 1NTRA 2QRLA 2TMYA 2PZBA 4X1IB 4Y6PA 3VH4A 1L8OA 2FQYA 1C80A 3JZIA 4D43A 1U7OA 1V1JA 3RS4A 3V3KA 3UTCA 4X5OA 2QI9F 1V0JA 2DCMA 2W6IA 5IHPA 2HD4A 3ODGA 4HVAA 5JRJA 3IVMA 1VZ3A 2FK8A 3T9CA 4FBLA 5D3MA 5TQVA 3VR1A 4M6WB 2G83A 3UBTA 3MTAA 1COZA 1BQ4A 4P5DA 2GNOA 4E03A 1WD5A 5EMJA 4Q3NA 3I42A 2NSYA 2PXCA 4KE6A 1E9FA 3HSYA 3K9GA 4KDFA 5T3UA 5LZ2A 4DQUA 1GR1A 4M0UA 2XSZA 5I5GA 4CG0A 3JQ8B 3HXKA 4F5EA 1MNQA 2IHNA 2O8BA 2GD0A 2RHHA 3RC9A 1EFVA 4FEAA 2JKZA 2V7TA 5HEKA 3GEGA 1JAIA 1KY4A 1UOEA 2I3GA 4B3XA 2QTHA 2PZFA 3NYIA 4DLPA 4OHZA 1TO2E 2QA5A 1H0KA 4DMHA 4KWEA 2BGMA 3LK6A 4A82A 3QOFA 1E2MA 3O03A 5D5PA 1CC1S 1C5KA 2OAEA 4F85A 3I76A 4JOCA 2BH9A 1QIMA 3T1NA 3NHFA 4MLDA 3ANMA 3HDGA 2IYNA 4XDHA 4MK4A 3TAXA 4W6ZA 3E4DA 5KVCA 1Q1EA 3K2IA 1Z6TA 3TIGA 1VSBA 2E87A 5DX0A 3OEED 3ZD8A 1V6SA 1IXYA 1S2IA 2B4YA 2XYQA 1DJOA 2YZGA 4IICA 4CUZA 4DSTA 2GJ4A 4KQ1A 2BGWA 3D6VA 3EEQA 3GPLA 1FXWF 2WUFA 2O0JA 3AUAA 4D8UA 3PUXA 1V39A 1UL1X 2IZ7A 3M2TA 4KV7A 5EJ7A 1JTEA 3RS8A 4I99A 4FONA 1HK7A 4XPIB 5KNCA 3J7TA 2H2DA 3KR9A 4I66A 1CR1A 2Q46A 1KZ6A 1E5TA 2GLUA 2EZ8A 5C1DA 4RTSA 1JDZA 3DL2A 4UE2A 1KMMA 4BFCA 5BWLA 2HEYR 1Z88A 1QVRA 5IDVA 4CW7A 3BF8A 1NI5A 1ZNXA 1Z2NX 4IDHA 3BWXA 1T4DA 1MQ8B 2R4TA 3ADOA 4YO7A 4MIEA 3G2NA 3WLEA 5B7NA 3G13A 4LHEA 3PGA1 4PHCA 2OPBA 4X41A 1QV9A 4RD1A 3AQIA 3IVAA 3NIWA 5GINE 3A3KA 3J7AC 3HFRA 3IRVA 3VZDA 4LXQA 1PFVA 1NURA 5HM6A 1SVKA 5M29A 1Y80A 1HSOA 1P2TA 1U8YA 1XCPA 2VAPA 3I1YA 3E53A 5DN9A 5IH3A 3VTKA 5AYVA 2B8TA 3PTZA 3N5KA 4D5EA 3I1IA 4L4ZA 1BEEA 1F0NA 1XRSB 4OI0A 3L4BC 2PUHA 3O2SB 3QW2A 1XJWA 4JUIA 1JSZA 3RUDA 2KE5A 4OG2A 1T1SA 5AQEA 2OBFA 3A31A 5IAJA 3S55A 2ONYA 5LVAA 3HMKA 3K1AB 2P5SA 3FWHA 4IXWA 1CIPA 4N9QA 5AW5A 2VXYA 1ZUWA 4PSAA 5IJZA 3FHCB 3WI7A 5LJIA 4N8EA 1M3SA 1IY2A 2OHGA 3V8EA 1X9IA 1I4OA 2X15A 3RTGA 1UQUA 1P60A 3EJWA 4PRLA 4B71A 1C8KA 4IDGA 3Q3HA 2E9SA 3ZTTA 3ZWPA 3Q5GA 3FVQA 3QPVA 1U0BB 1VL0A 1PJQA 2EF0A 3KKZA 2JFBA 2XJ9A 2OAP1 1A04A 2O9JA 3PC8A 2B1GA 4IH4A 4KI0A 1E7YA 2MWMA 4XZ3A 1JN0A 1GCAA 5EGNA 2AN5A 4KQEA 5E4YA 1VC2A 3TD9A 4GM4A 4DR1B 1TIKA 8GPBA 1E18A 3AVUA 4LQCA 5MGBA 1ISGA 5CDGA 5DM0A 3PT9A 4MGYR 1N6LA 4FX2A 1CRQA 1PV2A 4H0FA 4QSMA 4C43A 5ELXA 3EPJA 1NXSA 4UHEA 4ZYXA 2QBYB 4CMEC 4Y1GA 2VA9A 3CQ9A 1H5QA 3EVTA 3CVOA 1ZRMA 3COZA 3B3FA 4IHQA 2WKWA 4B4DA 3FLEA 4I5DA 4R2LA 3D0QA 3L84A 3P52A 3PCTA 1OX5A 5ESWA 1SIUA 2FX2A 5A4AA 1JG1A 1LBEA 4K8RB 2OVFA 3N8GA 2G9QA 3EIFA 5ABPA 3SKVA 2XMSA 2I1LA 3HB7A 1QONA 5AVQA 3IVGA 4LHXA 3MT8A 4YRTA 1CUGA 1DSSG 1AHNA 4F6LA 1OYWA 1Q7BA 1GKLA 4Y2QA 3HA5A 4LF8B 3IV9A 5F64A 2Q4RA 1LS1A 2CXSA 3K09C 3WWZA 1XPUA 4FOTA 2ZWMA 3NTQA 1D1PA 1JHMA 4M0EA 3TMKA 4C7OA 1M33A 1OAOC 3HLKA 5FO0A 1AQNA 4B3MB 4UUMA 2UZ1B 4CMJA 3B6JA 3HCAA 4EHBA 4Q9KA 1SG1X 1CS0A 1N5KA 2BKVA 4PLYA 2PSEA 2A9PA 2A59A 2EG9A 4NONA 3AW9A 3QP9A 1TJ4A 1OGJA 2W83A 3LYAA 3OLWA 3AEKB 4L2IB 4R3UC 1YI8A 4BNLA 4BDSA 4OV6B 2IHUA 2QN6A 3JWJA 4HNAB 3N0VA 1TO1E 1OGYA 2EVWX 3CLVA 4NG4A 1B43A 2VP9A 4YRFA 5GJCA 5E3IA 4BRZA 1Y8CA 2ZS8A 2D13A 4MJ7A 4AY5A 4OOFA 4YMSA 1KDPA 3MS7A 3U17A 5AIBA 5IW8A 1ZNZA 4C2TA 1ICEA 1RM3A 1X9GA 2IPLA 4C0WA 4AMGA 4NFSA 3HXMA 4R9SA 1YDWA 2MR5A 1PKXA 2HLDA 4EB6A 1U4OA 3QBVA 4TTPA 3PXBA 1JKJB 1TIPA 2QDKA 1P1BA 1C7FA 4Q82A 1T15A 3KE8A 4XR4A 5IJAA 4RVDA 3TYXA 1P29A 1CJSA 4BFUA 1R18A 4NFYA 1VHQA 4OLBA 2F9LA 4MP8A 4KWTA 1JSRA 1O8BA 2Y0BA 4RD6A 1J0XO 3QNWA 5EZQA 3HKDB 1UJ4A 1BE0A 2OY0A 4K6KA 4MYCA 4LI0A 3T5BA 4F9TA 1EUDA 1WCIB 5IJ0A 3EGOA 9LDTA 4MYTA 3CKMA 4ZK6A 4BIIA 5CFMA 4YAUA 2DR0A 1E69A 5A4KA 5LQDA 1A7JA 4WLUA 3BWEA 2EKQA 1P1KA 5ED4A 4DM7A 2GX6A 4Q01A 4C0AC 3WGKA 4E1BA 2JHFA 3C48A 3ENQA 4BQPA 4NDNE 5EXDA 1U5CA 2RDMA 1N2SA 1Y1TA 3NOOA 4BJ5A 2QZZA 2ZRJA 2CHQA 1G98A 1D8AA 2AHOA 2C8VA 1Y3IA 3FUWA 1F14A 2BMJA 4PCAA 3UPTA 1JXOA 2PMKA 2ADMA 4LHWA 4RS3A 2EIHA 3BL5A 3CNEA 3H5NA 2Q28A 2REOA 3B5IA 2XT9A 1JDPA 3GGDA 2ZYVX 3PFCA 1L5LA 1LDBA 2CFIA 2N9UA 4PS1A 3F6EX 3LPNA 1XN4A 2XH8A 1QS0B 2BV3A 3ISVA 2WPDD 4QAJA 1N2ZA 3TSOA 1M8GA 2B4QA 4XB1A 4DZZA 2FMTA 2H5EA 4OPMA 3F5DA 2OAQ1 2Q5OA 2XTNA 4TKZA 2O20A 3RSSA 3PEWA 4NAUA 4MWBA 5LLTA 5CXUA 3EXAA 3U4QB 2ID9A 3VR0A 1YVDA 4RVSA 5AUNB 1I14A 2CC2A 1NASA 2BL4A 1HBJA 1WXDA 5D3ZA 2OBMA 4ZYTA 5JEEA 2WTNA 1RQGA 2A1TR 2PSDA 1E3MA 1RYMA 4JVSB 2B21A 3OE7A 3PQFA 3Q2OA 1XZAA 3MIZA 3ND5A 1JSXA 1RTTA 2FGJA 2D6FA 5H4HA 2RG1A 1A8SA 1E9EA 2JIZA 3GW8A 2XBLA 5LD2C 1LLUA 1SULA 4CKWA 2NUTA 4WN9B 4AJNA 4M1EA 4MUGA 2HK7A 5KQLA 5DHPA 1Z4QA 5IDWA 2ODAA 1U7XA 5CK4A 3H3FA 3W1WA 1KEWA 2BFBA 2D62A 1U7ZA 3A9TA 3U9TA 1G4AE 3LDAA 4B75A 4EQZA 3D02A 3LCMA 1W8IA 4B4UA 1DCKA 1VG0B 1JWAB 4MITA 2O4CA 4UFPA 2OXTA 1SCQA 3FMVA 1SHJA 4X54A 2ESRA 1ZNYA 4E31A 4WZ6A 5KSZA 1W0JD 4U6NA 2JLZA 2FOLA 1H2BA 1VXOA 2IBSA 3AI1A 4G0ZA 2ORVA 5EP1A 2BR4A 2KBEA 2WD8A 3C5VA 3HL0A 4UEKA 4ZV7A 3W2GA 4E11A 4NNJA 1WXEA 3N0XA 3EY9A 2AZXA 3I45A 3L8CA 4MUJA 1X15A 4LNAA 1WE2A 4Y6LA 2AJCA 1MIOA 1PGOA 4M54A 2J9RA 3RRFA 1JNYA 2QM0A 1NFQA 4BGEA 3VR2D 5J2TA 1KORA 2PD6A 4HP8A 1BA3A 2ZWIA 3NVMB 1EYZA 3PQ5A 5ANRB 4R98A 1NT2A 3VKVA 1E6WA 3D3WA 2X4GA 1SHTX 3JQFA 2WWFA 3QUAA 4GUDA 4Q18A 3TQFA 5KKNB 2I03A 2WPNA 5KX5B 1QM5A 2ZETA 3HBAA 4HDNB 4K9NA 3RE1A 4YY3B 4GMFA 3TNJA 4CTNA 1VSQA 3GD7A 1GU0A 1R0WA 3HVJA 1OD6A 4KAAA 1L7BA 3EDQA 1N3LA 3HLYA 3WNDA 1XDSA 1Q1GA 1QDLB 2EWVA 4OYRA 3THXA 2VT7A 2BBOA 1QZ3A 2Q3FA 2VPIA 3VR2A 4ALKA 4F56A 4MKFA 4JI3B 1Y81A 4R0MA 2O50A 1W93A 4ZHSA 5LOVF 5KNCH 2P5UA 1OLUB 4DAOA 1VI6A 2OD2A 3RBXA 4UAUA 4RIGA 1Z9BA 2IUUA 5K3SA 4LOJA 5EE3A 1QUEA 1WHTB 1YRYE 1Z5VA 5MFZA 1UBCA 2PZ8A 1XK7A 2J32A 2Z2KA 4JJAA 3AIMA 1IBCA 3TLYA 4RWEA 3MMNA 1WCV1 3ENZA 4FE3A 2FA9A 2ZS9A 3L7YA 4A0FA 4M9ZA 1Y98A 1PT5A 4F1JA 5A7FA 1ZL0A 1P80A 4KFTA 2AOWA 2AC7A 4PFJA 2HSEA 3L41A 3A4MA 4JVLA 4KODA 5CW1A 1PS0A 3WQSB 3ZJ5A 2J07A 4PPFA 1GYPA 3U5ZB 2Z30A 4FHEA 3BXZA 2PT5A 4F04A 2VDRB 3A6FA 4GM0A 3DL4A 1ZXBA 3IKTA 1D2EA 2JHGA 5DBGA 3TUIC 1FFGA 2BN4A 3PKJA 3H5TA 4BQQA 1HPLA 1ZD8A 1GSIA 1NOIA 1M2VA 2F3TA 3N2NA 3Q7IA 4GQAA 2N0SA 4WA8A 3TRIA 3DLIA 1G8KA 2QF7A 3C6QA 4X8HA 4ZAZA 1WQ1R 1XB2A 3HRIA 2HSWA 2LZ0A 3STHA 3QF4A 4BEVA 1GKKA 2IZ6A 2PUTA 4N90R 1M66A 4GWLA 4H18A 5SY6A 1QK5A 4YV0A 4TRMA 3URMA 3H42B 3X1YA 1F4LA 1HF3A 2W5UA 2CT8A 3KDSE 3IYLW 4BGIA 1DIBA 1RWQA 4MPTA 3FOFC 1N57A 4CEJA 2GEKA 1MKYA 1WZNA 3PNOA 4TPKA 1CY8A 3GL9A 3ZWMA 3KWJA 4YJHA 1R6TA 2W6QA 4M86A 4TZKA 2Y1FA 4EAQA 2J8ZA 4GNRA 2XNHA 3HQ4O 4ARSA 1X19A 2YJ6A 4RKYA 3WLTA 4RM2A 4Q9LA 2W6OA 1T6YA 4QVIA 4ZVPA 3JS5A 1EZ4A 1OA1A 1HDIA 1SBYA 2JFXA 3UXHA 2ID8A 1IK4A 3VRHA 4CV0A 2H3EA 1JV2B 2UUPA 1WU7A 3ZU6A 3NHLA 4KYVA 4D74A 2CNDA 5L95A 2SCUA 2GBCA 3Q9SA 2R1TA 5G1NA 2LIVA 4U63A 1JT9A 2FXIA 2HCFA 4TWZA 4JV5B 2H2FA 4AP5A 4GPEA 3T34A 3COPA 5FB3A 4DMKA 3SZOA 4UD2A 3JRXA 2RSLA 4BMZA 3KZMA 2Z56A 2X0EA 2V7WA 2P9ZA 1DBPA 4XCXA 2B1JA 5EL0A 3PWSA 3WA7A 4N7BA 5ES4B 3RUFA 3RTBA 2YJ3A 1PZHA 2VOEA 5DT2A 2QXTA 1T5BA 5EXEA 3PR2B 3RU7A 1FBTA 5JNSA 3QPBA 3CZ9A 4XB2A 4LFBB 1JJ7A 4A91A 5BYBA 2CFRA 4LKOA 3KOXA 1S8FA 5DNYB 1TF7A 4Q3LA 2FW8A 5L3QA 1AVTA 1B6TA 4CLDA 1OI4A 5A4DA 5EUCA 4BLTA 4URHA 2H9AA 3AKYA 1CY1A 3GK3A 4M8SA 4X61A 3G1TA 4ZGBA 3KQLA 2Q2VA 1GAJA 4MWOA 4O0MA 3OG9A 1K63A 5D01A 1DX9A 1X7WA 5EEGA 4B79A 5ADUS 1N4DA 1QZTA 1SA0A 1TLFA 4F60A 3HKCA 4EL0A 5EOVA 2SICE 4Z1MA 3KPWA 4OSOA 1JE0A 1UKYA 2ZAGA 3AZQA 4QQ8A 1ZRNA 2ZIFA 1JFFA 1B14A 1D1TA 3B20A 2NUPA 4MHOA 1A9PA 3K1ZA 1XTSA 1NI3A 4IH9A 3DCNA 2XYVA 5DFAA 1JXAA 1ZK0A 3IE0A 3E1KA 2E6KA 3WADA 4B35A 4FE7A 4JUFA 1DUVG 4N0PA 4B8YA 4F6RA 4ZDIA 4JI0B 1E9RA 3LP8A 4RBNA 3QELA 4FNOA 2P2NA 5HPYB 1ZI6A 4EWLA 2Z8XA 3TJZA 4OB8A 3URKA 1TK9A 3I30X 2QYOA 4QJIA 1M1UA 2VHTA 2W4QA 3K4PA 1OBCA 3KG2A 1KAGA 1Y9ZA 3B1ZA 1EP3B 2PZJA 4P2GA 2BSXA 5K0NA 1E2KA 3TRJA 1WHSB 5LP1A 3I92A 4FNGA 4BFYA 4ER3A 4GIBA 1ZFNA 2I2FA 3WHIA 3JAKB 1UBOS 2XWPA 4LWQA 1KIFA 1BD4A 3I9V1 2O3RA 2WD9A 4M46A 5D6OA 3ZBUA 2PMWB 5CAEA 1T5DX 3GJSA 3LXMA 1QR2A 1R7RA 2X4DA 3M49A 2CLOB 3EHEA 1MJ5A 3GQBA 3O8CA 3MSXA 3A1SA 3RVMA 1JHZA 1GGNA 3S2FA 1HX7A 1FZTA 5KSPA 4EBFA 1UH5A 3VNVA 2GEFA 4DL9A 5A2QA 3E70C 2ZJ5A 5JANA 2ZSHA 2VDNB 4I3FA 2Q5JA 4FYXA 1NRWA 3LV8A 5JH7B 3WL5A 1VHJA 4IH1A 3A1DA 5K99A 4L28A 4ENPA 1DJMA 1E2GA 4B76A 5BYAA 3ZDAA 3A4YA 4QQFA 4HTFA 2VAXA 4DR6B 2YIMA 4C0SA 3UUEA 4CM4B 1R0XA 1ZO8A 2QIPA 2ATXA 5F9HA 2ZIXA 5IT4A 2GJSA 1W4ZA 2AN3A 3D7LA 5B4VA 2HHJA 3NHBA 1CEYA 4D96A 4C0QC 1NM5A 1TCAA 4FB4A 5DTJA 2PO5A 1WUTA 3IUPA 3VU8A 2MYTA 3JARB 1TM1E 3OTHA 3H1EA 4LVOA 3VC3A 1U0TA 3O8BA 1M8FA 1YRAA 2Q3JA 1ZX1A 1JI3A 2ZJFA 1YBMA 3MSCA 5CVCA 4F5DA 3O4RA 3AETA 2NVOA 4Q7KA 4O4LF 3H2ZA 1E9AA 1OFVA 1RAIA 2NV6A 4IZIA 3EAQA 3W06A 1IN7A 3NUQA 2FMIA 1PP4A 2Q1SA 4E4DR 3HL4A 2V03A 4GICA 3QG1A 4MVXA 2JJYA 2NG1A 2GN0A 2CNWD 1BWPA 1ULSA 5HFJA 5ITWA 1QZUA 2CXPA 1EA5A 4TLDA 1FRNA 2Q6TA 3AM5A 2XD4A 2R4QA 3L4SO 5DB4A 3JQEA 3GAZA 4P38A 1EP9A 1YQQA 3K9LA 1MOPA 5FPTA 2IZ0A 4HSGA 5KTKA 4NH0A 5BV7A 1FS5A 5SYMA 5F77A 1RIIA 3VO2A 1PI3A 1C3LA 4K9OA 1NVFA 3ASYA 4K81B 4L3VA 1ZGAA 3OCCA 2HRZA 2ARKA 2C7BA 2DUUA 1DC3A 2GK7A 2IZZA 3GNSA 4X8MA 1TX4B 2ZT6A 2OQ2A 3PE6A 4NDZA 4DIMA 3OESA 1Z0KA 5HGJA 2DRIA 1SIBE 2PKXA 2YWGA 4FBMA 1G7RA 3EQZA 1YD7A 1FX0B 4YRBA 2BY4A 1CSEE 4A9AA 2AT1A 1IXZA 2C0QA 5JC8A 4LOHA 5ESXA 4FDUA 2P4QA 4E1VA 4YXWA 1IG3A 1PQYA 2PLNA 2VT6A 4L75A 3G2OA 1SCDA 3BMNB 1WNTA 2WDZA 4QDUA 4L4XA 4MCHA 5TT1A 4EYKA 3CR3C 4QXMA 3E15A 3CSDA 4KH0A 1RYZA 2D1FA 3FG9A 3RD5A 2EJUA 1U9IC 1LDYA 3DGFC 3JQAA 3NVDA 1N6IA 3IH5A 3G8BA 5G4KB 2WHPA 4D0LB 1MVOA 2HIAA 1PJRA 5ADHA 4DSNA 4AN0A 3CUUA 3VH2A 1Z0AA 2BJHA 2OHOA 2ECPA 3LAWA 1V8PA 1XWIA 5LM3A 3I9NA 4K05A 2WSMA 2DBYA 1JDVA 3IE1A 1B7GO 3CW2A 5EHZA 1K4KA 3DVAA 1Z38A 3OJOA 1DELA 1R1DA 4IV8A 1M2HA 2G80A 3SM3A 3SLRA 2GCPA 4EF5A 1J8MF 3DBLA 4KMSA 4ZVNA 4ZQFA 2HQ1A 4UQOA 3NC1C 2X8LA 2XVAA 3M89A 4ZOQI 5CLJA 4F4UA 4BPBA 1M5TA 3FGPA 2BKAA 2NO5A 2O6LA 5JH7F 3V4RA 1EWRA 3G7NA 1EU1A 1L1EA 3LQFA 3MLBA 4Y67A 4B46A 1SG6A 1XEWX 1Z39A 4C03A 1AA6A 2QR2A 5GVRA 5CDSA 3IAXA 1II8B 3SSMA 5K45A 1O9GA 2O1XA 3RR2A 3DDZX 3TVYA 4PN3A 3OT1A 4OEHA 1L5QA 2LXNA 3FDIA 3UW3A 5JJKA 1B26A 2JLSA 2GXAA 1OSNA 2OPHA 1E61A 1GLNA 5SZJA 1JB9A 2PZMA 3P45A 4P3KA 5BN3B 1DDGA 4ZVKA 4DR4B 1XZPA 1JW9B 2FSPA 5FL3A 3X43A 4KQJA 4LX8A 5AVOA 1DJQA 5IEBA 3H1FA 3CNQS 2Y1CA 2ZYGA 5IUJC 4WADA 1IDN1 1ZKMA 3OM9A 3S70A 1EM8A 5G02A 1VCOA 5JADA 1ABFA 2ZUFA 3OAAD 3NTLA 4URFA 4RV4A 3FZGA 3OQPA 5H59A 1E94E 3L4JA 2XHZA 3SNHA 1XXLA 4QLOA 3PUVA 1WZUA 1JLLA 2FHSA 1Z6QA 1N2XA 3PTLA 3WZMA 3HCDA 3UMJA 4EB8A 1X0VA 4ZEVA 2E5LB 1MB3A 1VMAA 2A9RA 3KYDA 4QTZA 4E7OA 5JNLA 1FNSA 4WINA 1GFSA 2OORA 3R0XA 4AUNA 4M0PA 2BFFB 2I3BA 3EDCA 4KVZA 3RYHA 8MHTA 5EJ4A 3P97A 1GDTA 4K6FA 1MJGM 4M99A 5CD9A 4ZVTA 4JAVC 5EKDA 3OIDA 5I9NA 4UNRA 1VIMA 3I5AA 4JXKA 5KTNA 2GO1A 3AJ8A 4JXXA 5JSQA 2A33A 2A6PA 4RCZA 3SMVA 4A03A 2QR3A 4NCBA 3T9EA 1VIAA 1U7WA 1T26A 5AM2A 2AX4A 4FWIB 5A3QA 2GBLA 2HBRA 3KYBA 5DW0A 1U3WA 1FTGA 1QHXA 3GZTB 3MTQA 4HBGA 5A7HA 1MGPA 2QVZX 3WFIA 1I4EB 3K32A 1MN6A 1AK9A 3LW8A 3VMFA 2FOIA 1GFIA 3TEFA 1CJUC 5HSGA 1I5EA 5CHYA 5IHXA 2EBFX 2YYSA 4EGFA 3KJIA 1QQ7A 5AJUA 4HN4B 1XAIA 3KS9A 3C7DB 3HVUA 3KQSA 2P40A 1HSZA 3WBJA 3K09A 3W5UA 4BNHA 2WF8A 3G9TA 3QLTA 3UGQA 5KQMA 3SF0A 2PCJA 5KJ1A 1U9CA 1PJBA 1QAMA 4KSBA 2EP8A 3HJTA 5F1KA 2F1RA 3EMDA 2YWJA 5CJPA 4U7TB 4RJIA 4YIHA 3FUVA 3TZEA 1P2SA 2F4NA 1UMCB 3DDOA 1SH7A 3JD1A 3ENNA 5DI3B 2VG8A 3RSLA 2L19A 1P1RA 5DCWA 5CYGA 4IDFA 1F9AA 2CLEB 4ZO7A 3O3MB 5CD1A 1M7HA 4OKSA 3G82C 1F0YA 4WESB 4XWGA 4L9WA 1UWVA 2N42A 1FA9A 3AI3A 3AP1A 4TV8A 4EKEA 4O63O 1PW5A 2D7JA 5C3UA 4OBBA 4AZ0B 4L8GA 4PSVA 1NIPA 3ILVA 1P3DA 4HQFA 2VQDA 5DSZA 2VYFA 5FL7A 4LV6A 3ZY5A 5EJ5A 5LQCA 4R9RA 4UUPA 3ISTA 2P0EA 1QIKA 2PL9A 1LPBB 3GJRA 4E30A 4PG4A 1MAVA 2K87A 3JATB 2EDCA 2JFGA 3QKTA 3ZWYA 1G4UR 1PWZA 4FKZA 3MI8D 2D1TA 1XMOB 4FQ8A 1MAWA 2BEUB 3I12A 3JWEA 3D8SA 4YREA 4D02A 1T0BA 2C31A 5I7HA 3QVUA 5ALPA 3C1UA 1Q3KA 4PF1A 3I6QA 5KTOA 3QYFA 2CJWA 3A9WA 4YUAA 3NOQA 4PZPA 1VJ5A 4YCBA 5L6MB 2X5NA 1N5MA 5LSAA 2OCLA 3U31A 1D6JA 4V0RA 1RKXA 1M0SA 4OXIA 5ILGA 4E14A 4OHYA 2H48A 4QOFA 1H69A 1XLVA 3GUCA 3BWVA 3FA2A 2PUVA 1UM9B 2ZAIA 2Q3EA 3MXTA 2WNSA 5T67A 1L6IA 4X6YA 5CB8A 4ZI5A 3JWHA 3HN6A 4KZKA 4RYDA 4F91B 5EJEA 1C0IA 2R8ZA 2OHFA 1WMBA 1WKVA 3VNAA 2CXTA 3HR7A 3OC6A 1QHYA 2RHBA 4MWZA 3OICA 4DNOA 4M9CA 1QH9A 2XQVA 4I8XA 2GPAA 2XVYA 3M1LA 1JIIA 2YFYA 4TWJA 2JPDA 4CBVA 4EUSA 2EEZA 2FPOA 3EVBA 2XCQA 1QIGA 2LNDA 3ND6A 5BXQC 2WWXA 1VE3A 4E3ZA 1B2RA 2JAWA 1R27A 3PWKA 5K8CA 4EK9A 3WVTA 1I9GA 5JY1A 5KU1A 2YUIA 5JMOA 5LXTA 4A3SA 3QKRB 2PY6A 4IIYA 4X1KA 1NLMA 3GZNB 4U7WA 2F43A 3AUTA 2J6IA 1IBMB 2JFZA 2C57A 1E0AA 1SCAA 4P3YA 5CLHA 1XD2A 1KZHA 3DXYA 5C3MA 2EJCA 4KIFA 1EFKA 4KLAA 4L8LA 4QYTA 4UDNA 3TOCA 1K8ZB 5TC4A 1QRUA 1KL7A 2QUJA 3KB2A 4IIFA 4ZC1A 3W7BA 1YUBA 4W8OA 4XE5A 2HTFA 4F46A 3WGGA 2R6CA 1JR3D 4PICA 3V2UA 2B37A 3DVQX 2JGAA 3GLHB 4LJ4A 5ED0A 4DJDC 1E3WA 3U0BA 4J76A 3TK1A 4NY1A 4LPKA 5FNVA 1H9BA 3V4LA 3BGOS 1Y9AA 2DHDA 5I7FA 4H17A 2GYWA 4X71A 2I4TA 4YDRA 4EEKA 4PC7A 1ZRSA 4MQBA 2B4AA 4G23A 1NLFA 1DBSA 2H16A 2R8EA 3ELBA 4GLBA 4RKWA 3U9LA 2FEOA 2K6GA 1FTYA 2YWEA 3VJMA 4RJKA 3ZE8A 3ZW7A 5C7OO 1YASA 3UA3A 2PD4A 1OILA 2QZPA 5FLXA 4HDQB 1FRZA 2HK6A 2GJ8A 4GZ3A 2VSOA 1JR3A 4KP7A 3R7WB 1FMLA 1Y5RA 2J7PD 5FWXB 3KJFA 2VZ9A 2G7ZA 1YJXA 2HEVR 2P6UA 4JBHA 4AO8A 4F8EA 3NBQA 1E7SA 4GX1A 5DDIP 3PX3A 3R5FA 4NI5A 5IH7A 4YAFA 1VSTA 4LVCA 1T4CB 3A4TA 2ZRPA 4F8JA 3W6PA 3ME4A 3BB3A 3IAM6 4XX0B 5ALMA 3MUFA 1ZD9A 3EXIA 4N0QA 2KI5A 4Y6OA 4F1KA 2QJOA 1Q1AA 3TJMA 3AVTA 3B7PA 3G0CA 2AWNA 5THQA 1NIJA 2VS1A 3QIVA 4BQNA 1JKFA 1PW7A 1MX1A 2TRSB 4A2CA 3N53A 4JI8B 1V8FA 1B8PA 2CE2X 1MW9X 4ZK2A 1S4QA 4HXEB 3OQHA 1OH8A 2FEXA 4IJMA 2IPOA 2DAPA 1DUSA 1M2OA 1ODCA 2RGYA 3K8ZA 4TVOA 3AB8A 3ER6A 1DDOA 3IDOA 2I67A 1D4OA 1MO2A 3BD8A 1C9NA 3C0KA 3KDPA 5JCOA 3O0DA 1Z6PA 1BX3A 1FB5A 5AW1A 1YCFA 1YHYA 3ASVA 1K08A 3EIQA 2GM9A 1Z35A 4B2LA 4HNGA 1C1HA 2JBAA 5JAHA 2OFFA 3ELUA 3DKVA 1SVSA 3LYLA 1HOTA 1SZDA 2YMPA 3H8VA 4FYHA 3RIXA 2H2IA 4BE7B 3K6JA 1FFBA 4EG5A 2FPSA 4BECA 4IXTA 1H0SA 1UINA 2AX3A 1RJ9B 3EB9A 3BL8A 3HEAA 2QY9A 4KOAA 4LJ5A 3EWIA 1O7JA 1T0HB 1E20A 1YJ8A 4HX5A 2I4MA 3TXYA 1R6AA 2QYHA 2WAAA 3E8MA 1HLDA 3AF6A 1TD9A 5LZ4A 1EEXB 3R77A 1T3ZA 1Y6FA 3I2JA 2O5EA 4BKRA 1QX4A 2WJJA 2XVMA 2NU8B 3TDKA 3FKQA 3WNZA 1WDTA 3KQOA 1PD0A 1UKBA 2C4MA 4ZV9A 1SXJD 3H5AA 4BVEA 1NPYA 1KO1A 4B7UA 4HL6A 2J31A 3IKJA 3GLIB 4UCWA 2GN4A 1GCGA 5B1IA 2PGAA 3WICA 3ZC3A 4Q3KA 5CR9A 1L4YA 2D3WA 1ES9A 2BGJA 2FFRA 4LY6A 1G19A 4UBJA 5CVEA 5HG0A 3UAYA 4L16A 1YKFA 3Q6MA 3E7PA 4IF4A 5CB4B 1HKHA 4TXNA 4XM1A 8ADHA 5A1JA 4KEAA 5D85A 1QKJA 2DFTA 3G5LA 3PX2A 2C61A 3CEHA 4KAXA 1JQ5A 3AUJB 3UVEA 1QWOA 2R62A 4PLCA 3K3PA 2HWUA 2AMLA 1CQIB 4P53A 1LLDA 1U2ZA 1GQQA 2ISSD 2ZJ2A 4GI5A 4ZI7A 5IXSA 1HE2A 3LBAA 1NE2A 4JU9A 5ENZA 1XZKA 4DLVA 1K8YB 3MWEB 3GEHA 3OX2A 4ARVA 4CL2A 4GL2A 3GWGA 2ZK7A 3UGJA 5LMNB 3RWMB 3AR6A 3KCQA 4AKSA 4D80A 4ZCLA 3W2FA 2CMHA 1D2RA 1G7TA 4MWGA 4DLWA 2FDRA 4KO4S 2LP4Y 5BN4B 5CFLA 4W9MC 3HB4X 3IXLA 5AW9A 1M7BA 4MV8A 3GP3A 1KBZA 1ZOOA 3SZUA 1H1TA 1P4RA 4EB3A 5IVDA 4D98A 2XR1A 4NTZA 4QE3A 1HWYA 4RACA 4YJ3F 3ZX5A 2Z6QA 4A2WA 5JR3A 4UVGA 3ZZTA 3IT0A 5AR1A 5JFGA 3KWMA 4U00A 4UXHA 1PGJA 3FI9A 4U7HA 4BWFB 1SO8A 1FFXB 2NAFA 4FSXA 3HY6A 4GEKA 3N1UA 1LQTA 1U0FA 4LRQA 2Q1UA 2IGTA 4ZVOA 2B7BA 1RKBA 2WICA 3N58A 3PHJA 4RH3A 3BGVA 4BX0A 1EFCA 1OOEA 4QBTA 3JAWB 2YIDA 3MFQA 2CKDA 2XWQA 5D84A 3ESXA 3ESCA 2PUAA 2H1HA 2FZ5A 4GI3A 5K20A 2FKNA 2IELA 3EA5A 5KOIA 3S0JA 1NVMB 4BMNA 1L4KA 3DEYX 1J49A 1OTHA 3UC5A 4MULA 4MHTA 4IRXA 2LE0A 3GFRA 3M6LA 2JHPA 4QPPA 5ELMA 3DKPA 3NWEA 3ZBPA 1AMNA 1QFMA 4WKCA 5EMLA 1NR7A 4IOMA 1GNVA 2DWQA 3OQIA 1NVTA 1V1MB 3ROQA 4D4GA 1KAOA 4DQLA 4ZRDA 4JELA 1SU7A 1F8XA 4MWDA 4U5QA 4UVHA 4AJEA 2PKEA 2HHCA 4MPDA 1FLDA 5I9IA 1GRQA 2WSLA 1DFGA 1P1CA 3HWX1 3KXLA 4L78A 4PO3X 4DXHA 3OO0A 4YJ2B 3IAHA 1HRKA 5TGDA 2IIVA 3NWOA 2CMFA 3R23A 4WXPA 1V2GA 3LRTA 4UHBA 1CX9B 3F2VA 2ZW9A 3Q85A 3QWIA 2R66A 1M34B 1UBTS 4CQLB 3FAZA 2WG1A 3PC7A 4EFKA 3TE6A 5L51A 1RC8A 2RJ3A 1R66A 2VATA 3LHKA 3M9LA 3IIKA 3E5MA 4FVTA 4DANA 3D0KA 4G41A 1UWKA 4LG1A 1PGQA 2VWHA 3AWDA 4P7FA 3L3BA 4EO4A 5BNIA 4KR7A 2X5KO 4UAVA 2XYGA 3DWEX 2RHDA 3GLFE 1U6IA 4P0TA 1BX1A 3C8MA 3RHFA 1YA8A 2G36A 3PNYA 1H85A 2ZJ6A 1QH1A 4G8BA 2C58A 3QXGA 3BHMA 4CWAA 1I4DD 4ZHQB 1A5ZA 5CB4F 1T1RA 2G3YA 3UK0A 5EZYA 1NMEA 1CB7A 1YB6A 1Y1PA 4P35A 4XTRA 3AIIA 4H0CA 3GEIA 5EAIA 3QVLA 4XIYA 2Q50A 4IXMA 2B2NA 5TE9A 3RYFB 4B6QA 4KKXB 4PR0A 2XQFA 2OZLB 3ACDA 2B82A 3BH6A 4PIMA 3LTNC 1Z4LA 3KQKA 2W2PA 3C5CA 2P9CA 3DMTC 4YGYA 1QHNA 5E6RA 5ESDA 1L5MA 4J6FA 1ML4A 2I6QA 3I9FA 4K2HA 4QYIA 3L7LA 3R74A 4CG3A 5GVSA 2QZSA 3H3JA 4H16A 1SR8A 4GQBA 2WJWA 2WT9A 4BV2A 4CMIA 2HIHA 5K4AA 1X86B 1OFUA 4YRRA 3NWPA 2F4VB 3C3WA 4XVQA 2IP2A 2APJA 4Y6GB 4OJTA 1KA9H 3JYOA 2ZI5A 4O5OA 1JQAA 1A97A 2NPOA 2P35A 3HU1A 3OFKA 5AQ1A 3W2HA 4AIIA 3HBFA 4R05A 3RHZA 5FUWA 3DV0A 1KC1A 4LZLA 3JASA 2ABWA 4IUDS 5DBHX 2VBFA 4IGEA 4FDMA 4J1QA 2V7GA 1USGA 2BBSA 2GA9A 2WU8A 1CR2A 3CSUA 5U1PA 5B3KA 4Q1AA 1WP4A 3HU3A 2C7RA 4LFAB 2HCTA 3L04A 1EI9A 3TNFA 3OT4A 3DZBA 4MO9A 1BXKA 1H2FA 5I51A 1M6EX 3A6KA 2SKDA 2YHSA 8LDHA 2HA5A 4Q1CA 5CEFA 1FFCA 2WINI 5AK6A 3U39A 4HTAA 3L01A 4OMFG 1F9EA 1GU7A 4YONB 5FTNA 5K3AA 3REQB 2VJMB 3ZYZA 2Q6KA 4FYIA 1W9MA 1Z18A 3L93A 3SOZA 3GJYA 2G70A 2QXUA 3EXHC 3GC6A 4RNCA 1D6NA 1YVPA 1KDOA 4ETNA 7MDHA 1OCEA 3UJHA 1VPDA 2EQ5A 4JYBA 3A26A 1T6ZA 4Q4DA 3JAMA 1WA5A 3O9VA 5CVTA 4JBIA 3LCUA 1Q1NA 1ST2A 3ADPA 2FPXA 4RMGA 4DCTA 3AESB 1HE4A 3B3QA 2Z3ZA 4FOPA 5IAAA 5JSHA 2DHCA 2XB4A 1ID8A 1P7YA 3R7BA 4X85A 4DDWA 4PANA 1RWWA 3BGSA 2JFQA 1Z3IX 3F6YA 2IDMA 2CDCA 2UVPB 3P9ZA 5EMNA 1XTUA 3DLAA 4C4PA 1C1DA 2J5QA 5KMGB 1FTQA 2P11A 3DEKA 3IODA 3VJKA 3KR1A 2NU9A 3WKBA 4K9LA 4Z9YA 5BWOA 2PUBA 1A95A 5FTJA 4C9BA 4OP2A 1ODKA 1EVEA 2AFHE 1GSOA 4R0VA 1G0NA 2CMGA 4E94A 1E6UA 3HKBB 5ARBA 1FC0A 2YWHA 4QDZA 1R6UA 3O9ZA 3VPHA 4ER6A 4ESEA 1IATA 3DNFA 3HCPA 5ALLA 4EVRA 5AD1A 3EIXA 4PX3A 1W36B 5D3MB 1HLGA 3GFTA 1QR6A 3D7NA 3H9JA 4TVKA 2OCPA 5H02A 4ENQA 1EBUA 3B36A 4UDXX 3UFBA 5CMLA 5K3CA 5C31A 4BWVA 5C1BA 4KN8A 3V8NA 3X1JA 4TQAA 5A3VA 4PNEA 1IZ0A 2YJZA 4Z4IA 3W3AH 2O8BB 2C5SA 3L06A 1EFVB 4HB4A 1M0EA 1SXGA 1W9HA 4DJTA 1N7GA 4DT1A 2AQKA 3AR8A 3WRYC 3ZQKA 2HQSA 4KUGA 1BXZA 3GBSA 4MVJA 1Q19A 1GG2A 1L5YA 5KOHB 1MC1A 2Z08A 3UAWA 3ZJTA 3EG9A 2Z5GA 2V3WA 3WLFA 3E61A 4PAWA 2ZM5A 1DEKA 4YQYA 4PONA 3AW8A 2WUDA 4OB6A 1QZXA 2COUA 2PBRA 2Y05A 3N0WA 3D1LA 1ML3A 2ZBUA 4XVHA 2VL7A 4NCHA 5FJJA 3D8UA 3PWTA 2DPHA 1O6ZA 2CMDA 2R11A 3KQVA 3NVAA 4HLCA 2HA2A 4BZWA 1MR3F 3A7DA 5HZHA 1JMAB 4PYLA 2ISQA 1L3BA 4B2IA 4DTIA 2DG2A 4G4GA 3U7JA 3C8UA 4LMRA 3NEYA 4J29A 1NI4B 2DPYA 1JYFA 1J0DA 4TWRA 4V24A 1G18A 2A1TS 1XV5A 1SUBA 1WOMA 5F52A 2W6ZA 3PD7A 2VDJA 3LUJA 2CN1A 4CXMA 1DCTA 2WR8A 1SBHA 5FUBA 1O97C 4KQKA 1G2OA 5DNAA 2GZ1A 1U11A 3NJ4A 3IPXA 5AKEA 1RAHA 3FXAA 3GDWA 1T9DA 2OBNA 4QUGA 4C21A 3H1PA 1PJ2A 3NP9A 4F96A 4CKCB 4LF4B 2R44A 4W5RA 3M4YA 3N6RA 2G88A