2E4YA

Crystal structure of the extracellular region of the group ii metabotropic glutamate receptor complexed with 2r,4r-apdc
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
538
structure length
518
Chain Sequence
b'RREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDNYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNICIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAANRVNASFTWVASDGWGAQESIVKGSEHVAYGAITLELASHPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQCSLQNKRNHRQVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPQTTKLCDAMKILDGKKLYKEYLLKIQFTAPFNPNKGADSIVKFDTFGDGMGRYNVFNLQQTGGKYSYLKVGHWAETLSLDVDSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYLVDEFTCMDCGPGQWPTADLSGCYNLPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metabotropic glutamate receptor 3
publication title Structures of the extracellular regions of the group II/III metabotropic glutamate receptors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 147
structure length 518
sequence length 538
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
A PF07562 NCD3G Nine Cysteines Domain of family 3 GPCR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.50.30 Mainly Beta Ribbon Tumor Necrosis Factor Receptor, subunit A; domain 2 Tumor Necrosis Factor Receptor, subunit A; domain 2 2e4yA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2e4yA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2e4yA01
4DN6A 1A04A 2I6FA 3OLXA 3OLYA 3NNSA 1DJMA 2X7XA 3RVPA 3CZ5A 5JS1A 4IMIB 3T8YA 2YHBA 2MSLA 1ZGZA 2A9RA 3CHYA 3GBVA 5C5CA 5HKOA 1YTUA 2MSKA 1NTRA 3JTEA 4N0PA 1P2FA 4F3TA 4MQEB 4P98A 5DTEA 2IOYA 1MIHA 4MLCA 3RH0A 3TD9A 1GUDA 5T3YA 3D8UA 3C97A 3CG4A 4G0PA 2PAFA 3LUJA 4RS3A 3T6KA 2VYCA 3GV0A 3P9YA 1SXIA 3H6HA 1YMUA 3O21A 5JNSA 3E3MA 1DRKA 3KLOA 1PHRA 2KYRA 4G97A 4F12A 1EWVA 5CHYA 4KVFA 1Y1LA 3KTOA 1CEYA 4NCBA 2RGYA 3LTEA 2FMHA 4MPTA 2FW0A 4F06A 2NT3A 3UK0A 5F64A 2FTKE 1PEYA 4RK6A 1LJLA 1YS7A 4MS1A 2CWDA 3Q41A 3IP6A 1NXOA 2LUOA 2MYNA 5BRJA 5BR1A 4OTZA 2PLNA 3K4HA 1ABEA 2PUEA 1Z16A 1MVOA 2OENG 1TM2A 2MYUA 3FFTA 3OM1A 1L5YA 4F8JA 1EHCA 3LOPA 2FN8A 1JYFA 1BDJA 4TN5A 4QYMA 2GI4A 2H0AA 1Z2EA 2QVCA 2VUHB 4EYGA 2PUBA 3MQ4A 2P9HA 5GOTA 1SD5A 4RXTA 5TPWB 1MAVA 1RPJA 3KSMA 1URPA 3QLVC 4UHJA 1EAYA 3C3MA 3QLVA 1NXXA 2L19A 4ZPJA 1NXVA 3LUHA 1NXTA 1BAPA 2PUDA 2FVYA 5IULC 1JBEA 2VK2A 3N6VA 3RVRA 1UDRA 4E7OA 3LUGA 4KK4A 3EQ2A 5EWMB 3OQNA 2B1JA 3QEMB 4WT7A 3QELB 2R25B 3ILYA 4KK3A 4Z4IA 4Z4EA 1QNLA 3MM4A 1M2FA 3TX6A 1ZESA 1Z26A 3A10A 2E4YA 2FEWB 1XHFA 3RVLA 1KMIY 3O2SB 1D5WA 1U04A 2FSPA 2OQRA 3OLZA 4RU1A 2HJ9A 3KG2A 5T7BA 4MQFB 3EJWA 2ID9A 1Z25A 3O1IC 3HV2A 4LX8A 2VUIB 3H1GA 5I4CA 4WWHA 3EDCA 1E2BA 4XARA 4Q7EA 1LBIA 5D2CA 1QO0A 3IP7A 4LE1A 1H9CA 1YS6A 2A9OA 2V0NA 2PUAA 2L17A 1VKRA 4N47A 3W9SA 4S04A 1JFTA 4JASB 1NXPA 4Y9TA 3I5AA 1K68A 1FFGA 3C3KA 2AYXA 3JY6A 3M9WA 3VNAA 4DADA 2HPHA 3O2JA 1R8JA 2HQOA 4RV5A 3EGCA 1DZ3A 3CNBA 4W5QA 1DRJA 3FFWA 4RXMA 1Z17A 4XXHA 3Q7SA 4YS6A 5ABPA 5IEJA 2PUGA 3LUDA 1YK1A 4YLEA 2RJOA 5JNTA 4MQEA 4W5NA 1ZDMA 4YR7A 4Q6WA 3NHMA 4YGXB 3QLUC 3F6CA 3I42A 3S99A 1DC7A 4ZYLA 2QR3A 4G0OA 5DGCA 4XFKA 4MYRA 4XLTA 3HUTA 1USKA 3RVQA 1QO0D 3MF4A 3MYYA 4D6XA 4RK4A 3C6QA 1JH9A 5JNWA 4MS3A 1RXEA 3HDVA 4RSMA 3O74A 4MS4B 3F6PA 4IGAA 4OG2A 2TMYA 3TO5A 1DCFA 1NXWA 1IIBA 4HNRA 1YMVA 3CZCA 2R4QA 3IDOA 4RK5A 4UHKA 4IILA 1D4ZA 4P1ZA 2FQWA 4GPAA 4F11A 1A2OA 5KC8A 3O1HB 3DLBA 2WB4A 2FLWA 4KQCA 5FWYB 5KQMA 1DBQA 1KRWA 1ZN2A 3KLNA 5PNTA 2WJWA 4MR9A 4HYEA 5IBQA 5HQJA 1XWWA 1ZITA 3H1EA 1JFVA 3JS5A 4H3KB 4RZSA 3OLVA 3HEBA 3GYBA 1D1QA 4KZKA 1D2AA 3FFXA 5EWJA 1LBHA 3O75A 2A9QA 1AB6A 1ZAYA 1Z12A 2IPLA 5TPWA 4EY3A 5TQ0B 1M5UA 3IPAA 4W5TA 1WETA 4OLAA 3H75A 4G0XA 1XHEA 1ZHHA 4ETNA 1GCAA 3K9CA 2NZVG 3M6MD 2FXIA 4Z4CA 1DC8A 1ZH2A 3D02A 3QELA 1QPZA 4N03A 3H5WA 2W42A 1RXIA 1ISSA 1E6MA 3HSYA 5B3JA 4WZZA 2FLKA 4Z4HA 4MGEA 4RXUA 3TMYA 3IP9A 2FQYA 4ETIA 4Z99A 3A0RB 3F73A 4NCAA 3SQNA 3GL9A 4EVSA 4MQFA 2GWRA 1OXKB 4MR8B 3GBPA 3RQIA 5FWXB 1QP0A 3N75A 4MRMB 2MYTA 3MIZA 5CNJA 2GBPA 2R47A 4Z0NA 4XASA 1EWKA 4WXEA 1APBA 3DLHA 1BDHA 3OQMA 3HJFA 5KQPA 3Q7TA 1PNRA 3L6UA 1DBPA 1I3CA 3N0XA 4KMRA 4HNQA 5KQGA 1L5ZA 1D1PA 4RDCA 3DGFC 3RVKA 4EYQA 3MA0A 4HNSA 3QK7A 2FKAA 3M9XA 5DKFA 2E4ZA 2E4XA 3KCNA 3LUKA 5CNKA 4LDZA 3DZDA 3QX9A 2P4UA 1TJYA 4OATA 3N0WA 1ZVVA 2WWVD 3URMA 4GNRA 2AYZA 1ISRA 2DRIA 2JVKA 1SRRA 1JYEA 1RZRA 3H5IA 1M5TA 1DCKA 2F8TA 4G0QA 1MB0A 2ID7A 2LPMA 2M1ZA 1CHNA 4RY9A 1JFSA 1PUXA 2WY2D 4D6YA 3L49A 2L2QA 1GCGA 1U2QA 2FN9A 2WMYA 4KRFA 1C0EA 5JNRA 1W9HA 2WRZA 2PKXA 1AB5A 3SAJA 1K66A 4WUTA 1QQAA 3BRSA 1QKKA 5EWLB 3DGEC 1P6QA 2FEPA 1TLFA 4MS1B 3OM0A 1JHZA 4G0ZA 1EWTA 1ZH4A 2XDYA 3HUUA 1A0OA 2QVGA 2FMIA 5TQ2B 1YK0A 1HEYA 2JBAB 3O2QB 3H6GA 4JOQA 4RWEA 3RVSA 2FEKA 5JNVA 1RZRD 3OMXA 2IPMA 4NQRA 4RY0A 1Z13A 1JDPA 3ROTA 4W5RA 3KS9A 3EULA 3OQOA 2E4WA 1MB3A 5CNMA 1NATA 3H1FA 5TQ0A 4DQDA 3QX8A 4JB2A 3O1JC 3CG0A 4RK0A 1FFSA 3RVNA 2IPAB 4PZ0A 1KRXA 3HZHA 3GA5A 3KJXA 2O20A 3Q9SA 4NV3A 3ILHA 5E3JA 1JLKA 1E6KA 1S8NA 4KFCA 4KREA 9ABPA 3G1WA 4PICA 2JVIA 2LIVA 3N53A 4LDAA 7ABPA 5HSGA 1GUBA 3A3KA 4ZMSA 4JB0A 3LKVA 3SG0A 1DBWA 4MLDA 1SXGA 1Z2DA 2JK1A 5JS2A 4LZLA 1KGSA 3TB6A 1C4WA 2HSGA 3OLWA 3CRNA 4LE2A 1DG9A 3OMWA 1JL3A 2QXYA 1LK0A 3JPYA 3NNDA 4Z4FA 3KYIB 2Q5CA 4MR7B 4KV7A 5DCLA 2N9UA 5BQ3A 4RK7A 3T38A 2M98A 4Z9AA 1FQWA 3UUGA 2YHAA 3JVIA 5IUNC 3EODA 1VPWA 1GLGA 2NT4A 4FE7A 4CBVA 1BDIA 1E6LA 1JWLA 4IMJB 1OXBB 4TLMB 4D74A 2FMKA 2J48A 4O5AA 1T34A 3LKBA 4O1IA 5ED4A 2QW1A 5KQLA 3CU5A 3JVDA 1FSPA 1SXHA 5EWMA 4L4UA 3GRCA 3QEMA 3BRQA 4PEVA 3LFTA 1M2EA 1LJUA 3H5OA 5B3JC 4E7PA 3GT7A 3R0JA 1DCMA 1DP4A 3LUFA 4LRQA 2MYPA 1USGA 4Z9BA 5IUJC 3CTPA 3EQZA 4H60A 5IX8A 4OLBA 2PE5A 1VRVA 2JVJA 1VLZA 3OO0A 2PUCA 3CLKA 4YV7A 2GKGA 2LBPA 2MSWA 1F4VA 2QV0A 5IUKC 5IEBA 4MS3B 3I09A 5FBHA 2PMCA 2QSJA 1B00A 3IPCA 5FBKA 4EUKA 1U8TA 3IP5A 1TVMA 2FMFA 2IKSA 4FE4A 4G0YA 3JPWA 3KHTA 3EAFA 2IDMA 2BGGA 8ABPA 2F8SA 1EFAA 4XAQA 3BILA 5EWLA 3FDFA 6CHYA 4O1HA 2E4VA 3CS3A 4QICA 5KWSA 4LE0A 2HQRA 3DBIA 4FB4A 1W25A 2FQXA 3VNBA 6ABPA 4MR9B 5TQJA 2B4AA 5TQ2A 3I45A 3MMNA 2JBAA 4RKQA 3Q15C 4Z4GA 2JB9A 2R48A 1BA2A 1JF8A 2IPNA 2PL1A 3CKMA 5BRAA 4KPYA 1PEAA 5EWJB 4M88A 2NUBA 2HQBA 3Q7RA 2ZAYA 2PL9A 1P8AA 5TPZA 4YO7A 3E61A 5JNUA 4TMYA 1Z15A 1ABFA 3LUAA 4N0QA 5TE9A 5C5EA 4JAVC 1U2PA 1QP4A 4MS4A 2CHEA 2ZWMA 3HM9A 1J56A 4PE5B 4JA2A 1BVHA 1PNTA 3GWGA 4W5OA 3G85A 1NY5A 3HO1A 4IF4A 5CNIA 2L18A 1YVUA 4YWHA 1JDNA 4MAAA 5FWYA 3C3WA 3SM9A 4ZJPA 2CD7A 3B2NA 1QQBA 2E4UA 4Q6BA 4QYWA 2CHFA 2JCGA 4ZMRA 4B09A 1ZGGA 3SY8A 3F7NA 5TPZD 3H5LA 3N0RA 3T95A 4N41A 4PYRA 5GQSA 3SNKA 3KKEA 1U0SY 4MR7A 4OBBA 3KYJB 2IYNA 3BBLA 3FGZA 3LMKA 2LP4Y 3NHZA 4WXMA 2RDMA 4KNYA 4RK1A 2H3HA 3UKJA 2A9PA 2QU7A 4YCSA 5HM6A 4EVRA 2JRLA 4IRXA 1FFWA 1P6UA 2RJNA 4G0MA 4S05A 4EVQA 4H3HB 3RVMA 3NBMA 3H5TA 5KC9A 3RVJA 1QMPA 1YIOA 4QPJC 1NXSA 4KQ9A 3N8IA 3CFYA 4ETMA 1F51E 4JP1A 4EGSA 4RKRA 3HDGA 3HK2A 1TMYA 3OO1A 1CYEA 3LUCA 4ML3A 3QLUA 3HS3A 2PJUA 1USIA 1Z18A 1ZY2A 3FMVA 3QEKA 3QLTA 3ROFA 4EYOA 3BREA 1RNLA 4MR8A 1JX6A 4NICA 5FWXA 2WJAA 3HXMA 4EYKA 4MRMA 4L85A 5KI6A 2QZJA 2NZUG 3A0UA 3NNNA 5IC5A 3RVOA 4YRZA 3HVRA 4RY8A 3HCWA 4G86A 2PUFA 4N76A 4YP9A 1QP7A 3H5VA 4TLLB 2GX6A 5DLEA
chains in the Genus database with same CATH superfamily
2BUCA 4IY1A 2GBLC 5C7IO 4BY9E 1KBQA 3LD9A 3R8CA 4YRMA 1RRGA 3GFPA 5TX7A 3GPCA 4IMIB 1V6SA 3WWPA 1QGUA 3JD3A 1YVDA 2YHBA 3F2VA 1WNTA 3S44A 3RTBA 1YZYA 2AG8A 2W6JD 5HKOA 1SUEA 3AT1A 3E7FA 2E5FA 3TTXA 4YPVA 2RGBA 5E4JA 2VOEA 2VF8A 4N54A 1RTKA 4R8VA 5A5FA 3ZLJA 1FXWA 1XXHB 2ZVDA 3RE1A 4R1MA 4ZCMA 1MIHA 1MIOB 4DQXA 3ZDFA 4IKPA 2ZI5A 3BEOA 4PNPA 2C7RA 1W0JA 1P9WA 1K7YA 2QT9A 5A0TA 2C4NA 4BJ6A 2X40A 3AJRA 2HKIA 1IJEA 3A4TA 2PWYA 1JVNA 3B7GA 1V7PC 3L4BA 4G4SP 3QPDA 4UARA 1L4FA 2ZI4A 3CY6A 2ID8A 2YJZA 4RA6B 5SZIA 5T64A 3KTOA 5JXJA 1W0KD 2R5NA 1FQJA 2CLDX 2FWBA 2G9QA 3ITDA 3LTEA 4DDVA 2FW0A 1CUDA 5ALQA 3CEJA 4KDEA 3G2OA 3ML1A 4MS1A 4F71A 4RTQA 5BR1A 3BWYA 3DZJA 3RSHA 3WA7A 5B64A 1T0UA 2ORYA 3EB9A 3MMSA 3ECAA 4NCJA 3AHFA 1YMQA 3KYDB 3OPQA 1KJNA 1W2HA 4NFSA 2I7VA 4JU9A 3M1LA 5GP1A 1EUYA 2WYOA 3UJCA 1CJUC 3A32A 1HE5A 5FWNA 1EHCA 3M1IA 2QI9C 2E18A 3Q11A 1RVDA 3OA2A 5E6SA 1N3YA 1JYFA 1M2VA 2WBLC 2YUTA 4X1KA 2I8CA 2QLJA 4Y0NA 5FI5A 4YRKA 2IX3A 1Z2EA 2ACVA 3OCYA 4E21A 4M3NA 3PQ6A 3U1VA 3BHIA 4RXTA 3L0YA 4HEA1 2ZSAA 2CLEB 3LF1A 4MUYA 2PMBA 4X00A 2BKVA 1C1XA 4MI9A 1I1QB 2V5VA 2VNJA 3T4UA 2G6BA 4K9PA 4B6PA 3WYBA 4OHCA 1POXA 1RXUA 3RVRA 3UXYA 3UG6A 3E9DA 4YJ2A 1VGRA 1PFVA 1VMAA 4YK7A 4B85A 5LZ2A 5I9SA 4ACBA 5AKZA 1FTYA 2YV2A 4US2R 1H2FA 3IQWA 2LNDA 3MWEB 4V2IA 3WL3A 3ZCPA 3RWBA 3FFAA 1RAAA 3FDZA 2R44A 4IDHA 2DERA 1QFXA 2CXXA 2DPXA 3DOJA 3O2SB 3VAYA 5U9CA 4JIMA 2HJ9A 5KNDD 1N77A 1XD9A 1QH8B 1NUQA 1K2VN 3GLUA 1KEPA 4LX8A 4WACA 3SVZA 4TKVB 4H1WA 2FW7A 4M7OA 2MJLA 2XPCA 4I9HA 3MGGA 3PKJA 4HWOA 1L5HA 1KK2A 2PFKA 3BWMA 4UVEA 3DTVA 4KMOA 2ZVQX 2XBLA 3A6EA 2P11A 3W9SA 2ZCJA 1Q15A 2GEFA 3DEJA 2OG1A 4ZYYA 1N92A 1BU8A 1K88A 1NJ5A 2YYSA 1HSOA 2GEKA 5LA6A 3IV9A 1C2YA 1FFGA 1RD4A 4KE7A 4U9HS 1YR3A 2X7JA 521PA 1KEKA 2O4UX 1J42A 3VOBA 2UWIA 1W6RA 4NI5A 4X1IA 4BASA 5JZOA 2OM2A 1W30A 2X14A 5ABPA 2ZQZA 3TD6A 7AT1A 1NPTO 1L6RA 1OLUA 2ZREA 4GC9A 2ZM6B 1ZDMA 2XF8A 3AXTA 5EXEA 2ZDQA 3OUUA 3NUZA 3EBOA 1ZBDA 4F8EA 3EZXA 5AFSA 1GG8A 4B4WA 1HPLA 4G0OA 4RQAA 4EKGA 5JH7B 2BELA 3U40A 4CKWB 1P2BA 3I6ZA 4UAGA 1J8VA 2DBYA 1D4FA 4JWTA 5EUBA 3WISA 3HDVA 1VLHA 1IIRA 1AHIA 3O74A 1E1CB 1U3WA 2AW5A 5FNVA 4FQ7A 4DT1B 4OLHA 4PSCA 2D5BA 4ENVA 2IYPA 3REFA 4EG6A 4MUXA 2ZUUA 1NMYA 1I6KA 2X1VA 3TZHA 4DV7B 1OXMA 1PVOA 2HK6A 2GAIA 4P1ZA 5KKNB 2EGGA 3EVNA 1J49A 1PGJA 1U6KA 2G1KA 3PDHA 4E4RA 4RHYA 5G2OA 4DMHA 2VHEA 4CLOA 2QZZA 5FWYB 4QNRA 1JV2B 4I4IA 3OSUA 3LQRA 1Q21A 1SHZA 1WDLA 2ZRNA 1G9TA 5EXPA 2JAWA 2XQKA 2QN7A 5JPDA 2ZSJA 1LH0A 4RGVA 3BH0A 2FMUA 1XF9A 4PAQA 3FFXA 4ND8B 3P9NA 2X5KO 4D4HA 1E63A 5EXXA 3HWX1 4BWGA 1YZQA 3P9RA 3II6X 1J2TA 4GXTA 1E2FA 3IJPA 5B1HA 5L7YA 3IX7A 1GQRA 3Q40A 1VBMA 4QT4A 1TCAA 2VC2B 1SHJA 3OEED 4EY3A 4M4RA 3JAMA 1X77A 2CLSA 3IUYA 1BU5A 3E2PA 2Q3CA 2V7TA 4ZPXA 3WSWA 3GJSA 5LQNA 1YA8A 1KPGA 3SEFA 2FX3A 3PTAA 6AT1A 1JJVA 4RBNA 3TIGA 2NZVG 2QYOA 2NU7A 2XMDA 1NBWB 3JARA 3MS4A 3ZDEA 4WKCA 4C3VA 1E9FA 3RC7A 2IBMA 3OPVA 1PNVA 1GQQA 1JKIA 1UFOA 1QPBA 2QQEA 3AI2A 4ZK2A 3T7DA 3KPVA 2J9XB 1SHTX 4B3FX 4BMZA 3PUVA 3K4PA 4JITA 2J5KA 4K6MA 3VYSB 1XQ6A 2DPHA 1ZH8A 2DR0A 2VDRB 1JR3E 1BQEA 2X86A 2WHPA 2C97A 4GXRA 3CB4A 4YXWA 3G9XA 4QX6A 4Z0NA 5LNK6 2XNDD 1FDIA 5EI5A 2C8LA 4WXEA 3WYGA 2G5CA 3Q7QA 4JLAA 4K1LA 4YRPA 5B2EA 1FOEB 1OYYA 1QOQB 2JJ1D 2ZUVA 3C5WP 4CT5A 3GZ4A 3U4HA 5KQPA 4AZVA 4OI2A 4CCSA 5FJIA 2XVYA 1H8EA 1R5OA 3AUAA 3PQ2A 3TRFA 1QHIA 2I2FA 5EIBC 1YJQA 3MBWA 3X2SA 5DJ5A 1KBOA 3IHLA 4NBNA 4EYQA 1XTKA 4FGWA 1V5IA 3IIJA 3TECE 5KHOC 2JRCA 5KO2A 1GQ2A 1LA2A 2B37A 2NU8A 5KJ6A 1SUFA 5AD1A 3LCJA 3OZDA 3TL6A 3RHTA 5CB4B 5H80A 1ZM2A 2B7CA 3WLIA 2GD6A 3PDIB 1A9YA 2VAMA 3RAGA 3V8EA 4EQZA 1OT5A 1S6YA 4A82A 3PQEA 2PSSA 1O08A 1SRRA 1P2GA 4HPJB 2V5UA 2HU7A 5LYJA 4PSAA 1DV1A 4KWIA 1N6OA 3STHA 2QAJA 5TMPA 1G41A 1JFSA 4N7JA 2XGMA 2OAGA 1E0JA 2B7LA 3I53A 4DLLA 4LVUA 3AL2A 4FYPA 4KRFA 1XHLA 4C7OB 4PIVA 1QO7A 3U4CA 4I46A 5TR9A 1HE2A 2GK7A 4CDNA 3I8OA 1RWXA 1XZHA 4FCTA 3UUWA 4CLHA 4MRRA 3FOAA 2QKYA 3KOMA 3NBAA 2WI8A 5EWLB 4DCUA 2FPWA 3I1FA 2BHSA 1Y89A 3V00A 2AE1A 4HL6A 1JHZA 1X1QA 4LXGA 3ETCA 1I01A 4CKZA 5DNEA 5K7SA 1SGWA 2Z3WA 4UZSA 3O2QB 4RWEA 4WK4B 1RZRD 1CC1S 4LYFA 4UFPA 2GM4A 4QTTB 4KAJA 4J2HA 2UXDB 4M8LA 2H6EA 4KMMA 4W5RA 1DQRA 3ASUA 3EZNA 1OBHA 4WCVA 4YP7A 3RFUA 3SEAA 4PN7A 1I6MA 3Q9LA 1U28A 2HIMA 3M4YA 2F3UA 4GOND 4EPYA 3I34X 4PIMA 3EEIA 1CQWA 4I99A 1LRKA 1E79A 2YV1A 3A6LA 2J3MA 4JB2A 3TIFA 1CLEA 1PDOA 2BE9A 4M49A 1P45A 4ZJZA 3LY8A 4AMBA 5E1OA 4PZ0A 5HILA 3R3YA 4DR2B 1PZEA 3E8SA 1ODTC 3V8VA 3EQ6A 1SM4A 3LZDA 4PPQA 4RZHA 2BFPA 2G72A 1V2GA 3F9RA 1SUAA 3AILA 1FYXA 1N5OX 5HBRA 4CU5A 4CZ2A 4C2AA 3WLLA 7ABPA 5HSGA 3QW2A 4KGDA 3R2JA 2VF2A 2WR8A 4JB0A 1NMZA 5KNLA 3M6UA 1U80A 1WHTB 1VJ0A 3T9FA 1DBWA 1Z62A 4F5DA 3QKRA 1VPDA 3JWPA 4LZAA 1P44A 3WBBA 2ROQA 1XZLA 3AYZB 4DRXA 4IHKA 2NU6A 2CNNA 2ZJ6A 4D4LA 3I73A 1TQ4A 1IJFA 2I9PA 3COZA 1RI5A 1JG6A 1PQ4A 3IT2A 1MRZA 3T9AA 2HCFA 2XUOA 1BXRA 5ILOA 3OCXA 2RGNA 1ZCAA 2YHAA 3E8XA 1J2EA 3IVCA 1T6ZA 3KZOA 4E1BA 1K7EB 4L95C 3ZV3A 2CZGA 4EGAA 4OXIA 4E13A 4OOFA 3U4MA 5JEDA 4DB2A 1DX4A 1Z6PA 4LXIA 3HKDB 2GCGA 2J7KA 1QOPB 2XIQA 3OM9A 4IJ5A 4PX9A 5KQLA 2VWHA 3DLTA 3KBBA 1A71A 2D5LA 2LCQA 3CSDA 3IEVA 1GT91 4K6CA 4MQ4A 3ZCUA 1ZUNB 4P3YA 4WY8A 4MLPA 2O5CA 1OX5A 1ADJA 4OA8A 4AY5A 3H5OA 4JP8A 1PKEA 4YCAA 1RM4A 2AC2A 3H3XA 1J0AA 4H35A 4CMIB 1QDLB 2KM1A 1IN6A 1E58A 3ZWCA 4WEQA 3MMPA 4MX8A 4D4IA 3ZN2A 2JGNA 3R7FA 4RYDA 1GRRA 1JG2A 3LL7A 4F1JA 3A58B 3GLFE 3IO3A 1I10A 3ANXA 3R5FA 5EP3A 5HDBB 5CT9A 2RCNA 3V8PA 4POOA 4GI2A 2GPYA 3V32A 4EGFA 2WT9A 3QVUA 5CGZA 4V0MA 4ZVPA 3IPCA 4ZJUA 3E2IA 3TW4A 4WLVA 5FFFA 1G98A 4DXDA 2EW1A 3EGOA 1RWKA 1XWFA 4BV2A 2HU5A 2IJGX 3JPWA 4G0YA 1JSLA 2Q41A 4GOLD 4HZIA 4NH4A 4A10A 4BNLA 5A0VA 1JKXA 2VAXA 5DBOA 4QHYA 2E4VA 3B3FA 1L0BA 3R0ZA 1I7SB 3SIWA 1AK9A 2H4FA 2WUVA 3D2BA 3DBHB 4UULA 5ADHA 3VTZA 5AVVA 2J3IA 3WLRA 2WKSA 3BWEA 3IJEB 5DHFA 1KE1A 3NVKI 5FOSA 3EPRA 4Z0TA 2IDKA 2CNBA 3FMOB 3NIWA 3OP4A 2X4GA 4HVAA 4M0CA 3RKSA 3SS8A 3VYTB 5ES4B 3BJEA 3O8CA 1Z56C 2HCBA 2A3NA 2M32A 2YNMD 3JQ7B 3RK0A 4I1YA 3ED1A 2DB3A 2C4WA 1NNLA 4U5QA 1RLJA 3SVTA 1BFKA 4GPD1 2WPNA 4DMLA 2MU1A 4RO0A 4DREA 3EXHA 3WS7A 1FFBA 3C5VA 1IPHA 4UBKA 3DA8A 3C6ZA 1SPBS 2Z30A 1QG6A 3NEJA 4K86A 4OHPA 5F4ZA 1YQ9A 4K6GA 3ETNA 2VHWA 3VZRA 4R0MA 1PE0A 4JLKA 1KJQA 1KMCA 4AJJA 4TSFD 4HDRB 5A2GA 2D74A 4Q1CA 2ZUDA 1YUNA 4Y2UA 4FYWA 1NA5A 1JDNA 1PZXA 5ERGB 4LHWA 5FO0A 5CPBA 1SQSA 2BFCB 2CD7A 4IZ6A 4BMSA 1JSCA 2O2ZA 1KF0A 2K2QB 1XRLA 4GC5A 4JL6A 2QQ0A 3KSUA 3RSOA 5J2UF 1QCDA 3R8FA 1SY7A 4HGOA 2PXXA 3C2QA 3MW8A 4PX3A 3U3PA 3WOVA 2YDXA 3G6WA 2QV7A 4UTNA 4N41A 1M2JA 3GAFA 4RAOA 3RIEA 3SNKA 3T1VA 2ZT7A 4KWCA 3QVVA 4OLJA 3CVVA 3BBLA 3QEBZ 2O8CA 3G8DA 3NHZA 3B1JA 3O3OB 3NTXA 2R65A 1H66A 1F2TB 3HCRA 5DTQA 4Q4JB 3A2KA 1Z8FA 1YU6A 3TS1A 2F3QA 1BXKA 1OTHA 3KJEA 4O2AA 3U13A 5IF3A 1KJZA 4AX4A 2J9GA 4XWAA 4BN4A 4CKBB 1VIAA 2I55A 4R6XA 5KJFA 2E9SA 2H1IA 3ME5A 5DNYB 1Q92A 3QEJA 3TM4A 2HMWA 3VBEA 5I7UA 1K8QA 2QD2A 4KXFB 4J0JA 3GRAA 4CIDA 4JLSA 4RCZA 4TQ9A 3OCJA 4RZ2A 2X22A 3DMGA 2DTDA 3FNGA 1HLDA 3JWHA 1NXSA 4QPCA 2AKYA 4L2IB 1T9ZA 2I66A 1K06A 1U1GA 4L4SA 5AW4A 4RULA 4IDCA 1HX7A 4YBRA 4R05A 5DLQC 2X0EA 3AFHA 2W2PA 3QEKA 3G8AA 4ALJA 4CN9A 2ZU0C 4EG1A 1WZCA 3BREA 1SK8A 4WN9A 5H81A 4AUEA 2C78A 1J00A 4TWRA 4B7UA 1D2RA 3VSCA 4DDWA 2FN4A 5K3CA 1QFJA 1U7OA 1AIPA 2NZUG 5AI6A 2ZR0A 3R40A 2PGJA 2ZIXA 3GF4A 4JC0A 5IC5A 3AERA 4DWVA 3D1LA 3HKBB 3N2LA 3NBQA 4MUNA 1Z4NA 1SU6A 2A6PA 2CL5A 3DQPA 3I0ZA 3QUQA 1GU0A 2WUFA 2WFAA 2PUFA 2ZU6A 1VJ1A 4HAYA 5C0OE 1ATIA 3VZQA 5B12A 3BD8A 2CLIB 3L7NA 2WYWA 4DPKA 1ZMRA 5IZCA 4TRMA 1P62B 1PT5A 1DUVG 1Z3IX 2ONYA 3IELA 1NNEA 3KQWA 3OLXA 5AVTA 2ZRHA 1C30A 1B42A 2D2EA 4GL2A 2ZBGA 1F8YA 1I1HA 3OTWA 5AOCA 1JG4A 1A2QA 2HCRA 2Y2VA 1N2OA 2A9RA 3AZPA 4I5DA 4IUYA 4J1TA 3VAZA 3LVQE 3PC8C 4M98A 4FHEA 4GR9A 5BURA 1DXOA 1PFKA 2W2LD 4P98A 1GPJA 1U90A 4WH0A 8ATCA 5JRZA 3NPMA 3U7IA 1WBJB 1GUDA 4Z49A 1Z8DA 2YYYA 1N2CE 3G0HA 2B8JA 3OIDA 2QM3A 4C7JA 1DU4A 4KR7A 3DOHA 1DS6A 5REQA 4A5SA 4YCLA 1RBZA 3E3MA 3QU7A 4TV8F 3KLOA 3HJNA 2RGCA 4ZCLA 3SZUA 3RYIB 2J4FA 4ROTA 1NBME 1S4MA 1D8TA 4FN4A 1QIKA 3C4QA 1I4TD 3QXGA 2PRJA 3PS9A 3QLEA 3RO7A 1KU6A 3NIBA 2ZBQA 3ZDXB 2XODA 5EMNA 4KOAA 3L6EA 4B7XA 4XYLA 1UP6A 3IB6A 3LQQA 3PR3A 1F8FA 1FS6A 1MORA 3Q41A 3P2EA 2W6PA 2BKLA 1ZH0A 3L40A 2JCYA 5I9LA 4IXWA 1Q0SA 3ROPA 2FPUA 1LD3A 1LF0A 3GLGE 1K3UB 4LMRA 1W4AA 4X20A 2M9MA 1OZGA 4RD0A 1CUCA 3VO1A 4DG8A 1I4OA 4ETWA 4ZOLB 1QS0B 3O93A 1ENYA 4CEHB 1UT8A 4YUWA 3LOPA 1T1IA 4E4DR 3G79A 3M33A 2YRWA 1LGYA 1E1QD 1TT5A 1Y5LA 2HI0A 4QYMA 1XA3A 3S1LA 2P6MA 3VC2A 3NHKA 5DSTA 5GOTA 1J97A 1TKAA 4Z1MD 4DNPA 1P8JA 3E3AA 4V02A 3KOOA 3FROA 3FYHA 5H16A 5FPHA 4FS8A 2O7VA 1N2JA 1N6PA 4F8YA 1MUUA 3ESYA 3EISA 4ZPJA 1E9EA 1K08A 2M6KA 1RWOA 1PDWA 1VL1A 4PC1A 5IULC 1DAMA 2FWAA 1T25A 2Q6VA 4D92A 3ND8A 4ID9A 1P33A 2HIHA 3OQNA 5JAZA 1HL3A 4I6EA 1V5FA 4ER5A 4LA4A 3L93A 3ZJVA 2H52A 3W3AA 3B38A 1AQYA 2PRKA 2G06A 4NE9A 4UQPA 3K0KA 4H3VA 4BE4A 5JSHA 2HRQA 3WTBA 1XHFA 4RZQA 4WBSA 4DDTA 2ZJAA 1PFYA 4D56A 4RU1A 4KR6A 2LZ0A 2Z95A 2CSXA 1GDDA 3FA2A 4QUJA 3RU9A 4PO8A 3K73O 4OUDA 3BFJA 2BFNA 5EIBD 2PD3A 2HNAA 3T7EA 2A78A 2WOJA 4GKAA 2QTWB 2WP8J 3WRWA 1P9OA 4Q9IA 3PJGA 4LNHA 1D4VA 4Q7EA 1YA4A 3VU9B 1Z08A 3LRPA 1RS0A 4LE1A 4CQLB 5BNZA 3TEJA 1QZXA 3EIQA 5DCYA 1UJ4A 1ADGA 1YRBA 3VO2A 1LV8A 2FPIB 3H9UA 4B4DA 4PC6A 1LLCA 2BMAA 5EE5B 3UOAB 2WJ6A 4ZVKA 6ADHA 3W5CA 2JI8A 4KLZA 2IHNA 4L08A 4N4AA 4BQOA 4RD6A 4EKNB 4FDVA 4CTJA 2EFHB 3OZCA 4AIIA 3OG9A 5FPQA 1AN0A 4A0RA 2YVKA 5MDHA 1PL0A 4E0BA 3IEMA 2ZEJA 3I3OA 4MQEA 4N5MA 3D6JA 3W8NA 2C2GA 2CVFA 5FTKA 2VPIA 3I42A 3AP3A 2B8TA 3P8ZA 4MV6A 3TRHA 1B4DA 1RR6A 3UVEA 3WXMA 5CA1B 1LW6E 2V7WA 5JAQA 2I8AA 2Z56A 1V8BA 2Q3HA 5L36B 4YASA 2OBBA 3A9CA 3WHKA 4X3PA 3NDBB 1XZDA 1XYYA 3DWIA 4H1TA 3C6QA 3D6UA 4C30A 4CVNA 3E9QA 5CYGA 3UN1A 4FMCB 2EL7A 1FZQA 1RI1A 2CLFB 4BMPB 2ADOA 1CW2B 3DHWC 5C53B 1EDEA 1P5ZB 2GXQA 4N8SA 1XZCA 1I3LA 5K6AA 3IAXA 3WAJA 2R4QA 4AMUA 2E6KA 1SCUB 4WK6A 4W6ZA 2P90A 4LYDA 4QDOA 1A5SB 3DLBA 2C58A 4HUQA 5JIBA 5ALZA 2PKCA 3A6ZA 2FWPA 1YZ3A 1IY9A 1KYWA 2JCVA 2YOGA 3G2IA 4MR9A 4REMA 3WQRA 1QYRA 4H3KB 2D00A 1UKZA 3KUCA 3I64A 3Q87B 3RUPA 3Q3GE 3U44B 3NTLA 5L6MB 3PD0A 3KKKA 1H2ZA 4QUGA 1HNZB 3JQGB 2EZ9A 2FAXA 5DVZA 2BFEA 2XSZD 3GVCA 3NIGB 5C81A 2G7ZA 2W6MA 3FTNA 2UVPB 1FTWA 2C20A 2XWJI 5KTPA 1PT7A 5U1PA 3MS2A 1PKXA 3W5IA 2VKQA 2O0MA 3M82A 1KSHA 3KQTA 4KWTA 4XR4A 4IOJA 1ZR2A 3VJRA 3F5DA 3GNLA 3ICCA 3H2GA 1E7RA 2XE8A 2OCYC 2VJYA 3PI7A 4NJMB 4BJ3A 2P40A 1L6IA 2PMKA 3QBVA 2G4CA 1MNQA 4CR6A 4L78A 4ETNA 3TUIC 3UAXA 1FDUA 1CS0A 1QBKC 1WOMA 3KR2A 3QOYA 5G4KA 2YN2A 2PNJA 2P3QA 3ZC3A 1JGTA 1KO7A 4N03A 3QVGA 3GP5A 4JJAA 5FULA 5FOUA 1RE0A 4YFVA 4DZTA 4AKIA 1YDWA 4WVFA 4D4MA 2FEOA 1P0MA 2D3TA 2FLKA 4J0GA 4MWSA 4P7FA 4PZZA 2DUMA 5AO9A 5KTKA 1N25A 4ETIA 4FS3A 2ZRMA 1C3OB 2R0QC 1KRHA 4WKGA 2PM8A 1KAQA 5CLQA 1EJ2A 1DC6A 3CUTA 4G5RA 4D8XA 4BB5A 1UJBA 3VKVA 4XM2A 2R47A 1WXQA 2Y1FA 3CE9A 1V48A 2JC3A 1D8AA 3GVPA 4YDHB 3TLYA 2V8BA 3BMCB 1JXQA 1IZ7A 1JJFA 3ZJ5A 1JQLB 4I4NA 4IJWA 1QHFA 5ADVA 2GARA 4UD2A 4DIKA 4I55B 5K1ZA 4ZGWA 3QI2A 4YJDA 2GOYA 4BLQA 1RRMA 1TM4E 3LUKA 4CNBA 3OF5A 3ZQJA 2QQFA 2XCTB 3ORFA 5IK2A 1NG9A 4QELA 1ENPA 4JGIA 2ZT5A 4J0EA 1VKZA 1PJBA 3LQ4A 1KEVA 4MWGA 1ISIA 3REGA 5C7LO 2MSDB 3SF8A 4EW6A 2Q5FA 2R85A 1D07A 3CRRA 3DKRA 1A4XA 2ZFUA 1XN1A 1KMNA 5AI5A 5KOIA 3PUKA 5BT8A 4IZIA 4NCIA 1V39A 3UAGA 1IHOA 4L9RA 1PGNA 2AYZA 5J5VA 3Q3HA 4IDFA 4EMUA 4OAQA 4AJKA 2H3EA 2NUPA 2OO5C 3Q8LA 2OGWA 2O50A 1KP2A 1S01A 1QAMA 4RY9A 5EJGA 1PK7A 3VU3A 5IXYA 3DYVA 2J7PD 1OPXA 3D6HA 1F2UA 1MC1A 3ORYA 1TRHA 5TY0A 1C0EA 4EB8A 3J81A 1ZD9A 4I0WB 2OT3B 2ASVA 1DKQA 4XX0B 3GLTA 2EJUA 1EVLA 4BNXA 4NHOA 1QQAA 3R77A 2G1AA 2BEJA 2OVBA 5HMMA 4DS3A 2BHNA 1CR2A 1JJAA 3MJRA 5M29A 3U7HB 1NF8A 2G40A 3SSOA 2FJPA 3P71T 2VTBA 1ZGAA 2PBZA 1XFAA 2BEWA 2XUGA 4XGRA 1SZPA 4OH1A 5P8WA 3ELWA 3NS7A 4RY0A 1Q0UA 1XMPA 4ZARA 2NV0A 1SWWA 1W6UA 5K3DA 2WJHA 1Y3AA 1JDZA 3NKFA 1U02A 1Y7PA 2HD4A 2QW0X 5MF6A 3QOXA 4U1RA 4F3NA 3TG2A 1SCJA 2XB6A 2C57A 4BRSA 4GDMA 2O2DA 1FW6A 3LIIA 4TWZA 4MV9A 1G8HA 4YJGB 1O97C 1TU3A 4YI5A 1CEXA 3K6SA 1RAEA 4AO8A 5K4GA 5F1KA 1VA4A 3LDFA 1NVAA 3KJXA 1YOVA 4NV3A 1MEOA 2JGJA 1VHJA 3INTA 1OW3B 2E5LB 1L4YA 1BJTA 2IZ1A 3CW9A 3TQFA 5L3SB 3ZVMA 2X4LA 4BUZA 1W5AA 1MG0A 4KN8A 3HKCA 3D31A 1MF7A 1GUBA 5KHLB 4E5MA 1SVSA 1LWOA 2NO1A 1C7ZA 4LV8B 3OQ1A 4GYJA 4TZKA 4D4GA 3L7MA 1N78A 1VYHA 2QE7A 5DWDA 2ENWA 5BOSB 2WIGA 1ZS9A 3GPIA 1P0IA 4GG1A 3EPPA 1QJ4A 3DDCA 3T52A 3KSZO 2DFPA 3KOZA 4GRDA 3AB7A 3OHPA 1TT7A 3ABIA 3FB4A 2Q4DA 3FDJA 2I2DA 2WWRA 5ECDA 4KV7A 4ZV4A 5JHGB 1VCHA 3M9LA 4HADA 2CLOB 5K0CA 4A23A 3X1JA 2AHRA 3DO6A 2E49A 3MT0A 3ZNPA 4E88A 2CVQA 2VP6A 6PFKA 3ORQA 1XZ8A 2AUNA 5CA0A 2VP5A 4G5HA 1KSJA 1G20B 4DCTA 3ZGZA 1YJ8A 2LTAA 4PPGA 4BYGA 4B2IA 5JH7F 1FJXA 2OYRA 4DAOA 2COUA 1ZBQA 1JSXA 2G67A 1TJ3A 2VDNB 4BQIA 2XNKA 1F5SA 1FDTA 3AB3A 4AB1A 3AUSA 3BRQA 1RJFA 3ECCA 3F6YA 3FVTA 4WLUA 2WHQA 4LY9A 1U8EA 2MIIA 5E9WA 1LBQA 3L7YA 4YRBA 1B16A 1Z4LA 2V7VA 1Q11A 3N3AC 3EXIA 2QTHA 1E3WA 1GITA 4BZXA 5DEIA 5CG2A 2MYPA 4LW8A 1CD5A 3WIDA 4LSZA 3E7PA 2VYVA 4G4SO 1SCBA 1P17A 2GXUA 2H4ZA 2GHTA 4JT8A 4HTAA 4WERA 5FADA 3W5HA 4TL7A 2ZE8A 3RS8A 2YVLA 1KMHB 4CU2A 2JLXA 3IP5A 2C9YA 1TVMA 4LZZA 4MYHA 2YIVX 5A6VA 2BGGA 3WXBA 1E8MA 1HTBA 3W8EA 5HFJA 3I5YA 2EZ4A 3CUWA 3FGNA 3P27A 4KE8A 1SC4A 3W77A 4B4KA 2B35A 4M1MA 2Q62A 4YJFB 5D3QA 2O3TA 5JVDA 1V5GA 3B6JA 4R1UA 5KDLA 2VUUA 2E37A 1NM5A 1G1AA 4HN2A 4AN1A 2OC4A 2XGOA 2H65A 4W63A 3UQYS 5DW3A 2PD6A 4FP9A 4FN5A 1M6YA 1WZUA 2Q2OA 2Y1EA 2F1JA 3EUWA 3OESA 3SBXA 5EWJB 1PR4A 1RHKA 3G0GA 1IG0A 5B37A 2C61A 1LI5A 1Q84A 1YGYA 3W34A 2D1SA 2CXTA 3IQIX 4GZMA 4EHBA 1ABFA 1WZIA 1ECGA 4V39A 4YRIA 4WZ6A 4RA9B 1U2SA 1HWYA 2EWVA 1I7DA 4KXNA 5BQXA 2BFOA 2IPOA 4TRRA 2X1HA 4CL0A 5HFNA 4ENSA 3ESQA 3RBXA 3AHEA 3C7DB 3E48A 4E5SA 4TGLA 1YV9A 4EAQA 3VNRA 3FI9A 3GAZA 4YWHA 4P9NA 1U8ZA 3GHYA 2XT9A 4BNDB 4ZGGA 4ZT5A 4ZOQI 1BIFA 5CLIA 4LMAA 1GPKA 3P7MA 2XCSB 3TRKA 4H6XA 2EP8A 3FVQA 1EUCA 1T5HX 1CU1A 3U80A 4HPXB 4B3BA 3ZV5A 1UFKA 1ZPDA 3WGHA 3HFRA 1SXJA 4HAOA 1U7DA 4HNAB 3T3GA 3P19A 4YP1A 5BQFA 4EFDA 5LNK1 1U0SY 3PX7A 2E21A 1MOPA 2EKDA 4AYTA 4P2GA 3WR5A 2HBZA 2IVZA 2NVWA 4PHHA 5CB4F 1E3EA 1VHLA 2QPAA 3FCXA 3KBOA 1PJRA 4XUCA 1EHYA 1EP1B 5DPMA 2HSJA 3QF4B 2KQUA 1KARA 3D1VA 3AH8A 4D9FA 3CT6A 3W6NA 2C07A 3FDIA 4EVQA 3OZTA 5JPCA 2J0QA 1P31A 2WD8A 1GL7A 1WPXA 1Z7WA 3C3YA 3QVOA 3STYA 2HPAA 3HCBA 1E1NA 1W4BA 1LX6A 2UUPA 3ROZA 2JFXA 4FNGA 2P9FA 4G23A 4ETMA 3AM5A 3DP9A 2RD2A 2QSUA 2E0IA 2QVXX 5FLYA 4EHJA 4KC0A 5ARBA 1DEOA 4X5OA 3ZZ0A 3K8ZA 4I4CA 3G2PA 1T0HB 1GR1A 3AEQB 3DKVA 3DAGA 3FMVA 5WRFA 2HV8A 1F1BA 1H42A 1HDOA 1SKYB 1KTIA 3RRFA 4QQRA 4MR8A 1HR0B 3HFJA 3OU2A 5ALKA 4R16A 4DTIA 3JQBC 3KKLA 3VSBA 4EJSC 1Y9DA 3B1YA 4CRWB 4ERXA 1TM5E 2JGKA 1XMVA 3JU3A 4MHSA 4A92A 4BNFA 2R4UA 4CPDA 5AUNB 4OK5A 3ZHVA 2YVUA 4CEIB 3ENVA 4YJHB 1K98A 2F1RA 3ZJ4A 4NZZA 4RY8A 3I62A 2IVFA 3QG5A 4JLOA 5GV7A 5EP1A 1N2ZA 2Q5JA 3CJTA 4NMHA 2IW1A 4GQAA 1FUKA 4UNNA 5KYYA 1QR2A 2BN4A 1Y8QB 5DYYA 3FOZA 3MTAA 2A4KA 2QN2A 4IH9A 3O4GA 4BCBA 4HC4A 2GYYA 1DE0A 2R2AA 1ACMA 4LVNA 3DP7A 2O2JA 3A36A 3OJEA 1XNJA 4AZ3A 3AR9A 2G71A 3U3VA 4OXXA 5FPPA 4QDUA 1V2HE 4TTJA 5KMGB 1J2JA 5L3RA 1NKSA 3EBPA 5J4LA 2OGUA 2XVXA 4IEIA 3KWMA 4M8SA 2J3QA 2P9JA 1WLSA 5SZKB 3LUJA 5HKAA 3L0ZA 1AGXA 1VL6A 1XRPA 3BK1A 4OM7A 2OAEA 1JA9A 1IXSB 1UANA 3KOYA 4CTOA 2QTLA 3PPVA 3PUXA 4ESOA 4UBIA 2MINB 1CUZA 1OKKD 3KJIA 4IDQA 3ZHOA 2IU6A 3M89A 1CY4A 3X1MA 1LLUA 4WMLA 2J9FB 3WB2A 5FL7D 1ODKA 3DLPX 2MHCA 1F0NA 3OFSA 4GZ3A 5K3BA 4QXQA 1UFRA 5DMXA 1J1ZA 4ZEXA 2ZYUX 2J5BA 4E32A 2F43B 4QJIA 5BRJA 1G8JA 1MB9A 3MGBA 4JLWA 2NWQA 4LBVA 2CFCA 2X2OA 2ZRKA 1QWSA 3CSUA 4OJMX 3L8MA 1CZOA 2W8BA 4Q3DA 3AEZA 2IV7A 1WXGA 5EZ6B 2NTVA 4HMOA 4KGZA 5L53A 4Q0MA 5G1NA 2C7OA 3PRHA 4RSRA 2YN4A 2VHQA 4TUYB 2GCOA 2YBDA 4WLFA 2FH5B 4L0QA 2FN8A 3ZV7A 1ONNA 1D6NA 1R4ZA 4M4SA 4YJKA 1ND6A 5HIIA 4ZEMA 2V03A 1L4KA 1NVKA 2QN3A 1BO6A 2WAYA 3I28A 5I8PA 1CK4A 3MQ4A 4KE9A 1D09A 1VIYA 1IEQA 3FOFC 2EFGA 1K1EA 3SR3A 4K26A 3F74A 3GFFA 1URPA 3CGWA 1PEKE 1Q7EA 3DAFA 5K0BA 3JVEA 5IJ0B 4JI0B 2VJMA 3QA9A 4UM9D 1XU7A 3CPEA 1BMQA 1AXGA 1RC8A 1K8ZB 4C5CA 2X23A 1IG3A 1MAWA 2LCIA 3FX2A 2QG9A 3I8SA 3EMKA 1UMDB 2Z58A 2QZ4A 2IHJA 3LF2A 4LTMA 3FL7A 3ILYA 5LN1A 4EMTA 2VK4A 2C3MA 3NYQA 4HUJA 5I3CA 3DMFA 1VP9A 1FIUA 2FFJA 3IULA 2NSYA 2OCGA 3AEYA 4LRWA 3OLZA 1D5WA 2OQRA 3WKBA 5K8CA 4YR9A 3O94A 2Y77A 3WDKA 3C5CA 1SD2A 3HVHA 4YPFA 2NM0A 3VKFA 4NH0A 3FWPA 1Z2NX 2EJBA 2NXNA 4U6QA 4ZYVA 1GGVA 2JH3A 3FCSB 4LJKA 2UYQA 4LTDA 2FLVA 2CF6A 4XARA 1Q22A 1DAOA 1FP2A 2HA5A 2IOHA 2H8KA 1KY4A 3WL8A 4EHHA 4I1OA 2Q3FA 5C1DA 5JC8A 5F9HA 1IDN1 2A9OA 1TA0A 4OAPA 2ZUWA 2VCHA 2XCOA 1TQ6A 3AHDA 1EFVB 1HV8A 3L6DA 5MN4A 1JFTA 1SOMA 4N5NA 1O8CA 2G17A 1U7PA 2X77A 1TO2E 1KZ4A 1WD7A 1K68A 3JY6A 2CXOA 5LIPA 4GWKA 5FUXA 2D2XA 5K3EA 2W4QA 2Y2UA 3DLIA 4EI8A 1DT3A 1ZOLA 3QYFA 2WMDA 4BHTA 2AL7A 4RTRA 1UAYA 3CIOA 1HMYA 5KHAA 3WYAA 4BO9A 1WSBA 1YDFA 1X1DA 3AJ9A 4RSHA 4UDOA 3UFXB 2FB9A 3EVCA 2HYDA 2O3RA 3LBFA 3ZBQA 3V8QA 1EXTA 4AC9A 4HZGA 4FC6A 1Z6XA 3OFND 4XLTA 4HG2A 4L50A 1OGIA 3E4DA 2JLBA 2QMYA 1KY5A 5TMBA 1G4UR 1G38A 1XLTA 5DOVA 1QGOA 3IC5A 3RUCA 4Z7QB 2Q6OA 4S12A 1EQ2A 2Y0EA 3D6TB 2H92A 3QHAA 2H9IA 2OXTA 4Z7JA 2BCGY 3CZCA 1AC5A 1IQRA 3QHPA 2ADFA 2Q0QA 2ZBDA 4U7JA 4HNTA 4ENTA 5T4FA 2FFRA 1J9GA 3RD5A 2FLWA 3IDSA 1ITZA 3ETEA 5KTMA 1NUPA 3OPXA 3B6KA 2FQ1A 1HORA 4KYIB 2CLHB 3WL6A 4G89A 1M1ZA 2PR2A 5F1OA 1JI0A 1SBQA 2X9NA 3H2KA 4CCAA 4Q4AB 3IKJA 4D8VA 4OJYA 2Q8PA 3TZLA 2C7PA 3TLJA 1XVAA 4M6WA 1F2DA 1K86A 4CR8A 1DRVA 1RT9A 2C3PA 2XE7A 1RYDA 1ZUD1 1ULZA 3C70A 4ALMA 3R6DA 4KRYA 4QOEA 2QAIA 4L22A 4DGQA 1VM6A 4U5XA 3IXQA 1DJPA 5TQ0B 2CV1A 1WBBA 5AK0A 2RGRA 5C80A 2CEKA 2NO5A 5ALVA 1WETA 1C1DB 1XLUA 2PPLA 2V8OA 4LS3A 3W78A 7ADHA 5EGSA 3GJ7A 3KP1A 2Q5LA 4Y2JA 3FETA 4IQGA 4JXXA 4FMPA 5AICA 3VO9A 2Q9CA 2QRGA 3D1JA 2X5OA 2HJVA 3O1LA 4GYKA 4CM8A 4WOCA 3STUA 3D02A 3U4QA 2XJ4A 1UBMS 3H5WA 4MEJA 1ISSA 3OECA 4BNHA 3IT1A 2ZJ4A 4D3SA 4HTFA 3H4IA 3ANNA 1WSDA 3HH8A 3A0RB 4Z99A 5C1BA 1TF5A 2VO1A 4X8HA 3AHIA 3BORA 4M99A 4NMMA 4QRIA 4MKIA 5AESA 1QP0A 2VUTA 4CW7A 1T1JA 1X42A 2GBPA 1YCHA 5I8WA 2VTDA 3CBGA 3MUFA 1DARA 3PHHA 3RYTC 3ZNQA 2CFIA 1R6TA 4ND4A 1XZBA 3V4LA 2ZRJA 2CJWB 4LJ7A 2JJ2D 3WZ2A 2FSFA 3DAOA 3L6UA 1R88A 2JAUA 2G76A 4MIOA 1Q0PA 2R1TA 5KTRA 1S9HA 4JLUA 2PHZA 1GEGA 4A2QA 5A62A 3ZH2A 2XB9A 2F9LA 4IGKA 4Q39A 3QY0A 4P3NA 4H59A 4WLOA 3DFMA 5EG5A 2G04A 4FSHA 4INOA 1QH9A 3N0WA 5KNCA 2BYTA 1E3MA 2CLMB 4WNAA 4N5IX 1FDSA 1E5QA 1E60A 3BD9A 5ITSA 1TIBA 2BLLA 2JNWA 2AFIA 1LPMA 3G9ZA 3URMA 3TH5A 2G88A 1QH1A 3FWZA 3QA3E 4MXWR 1IZYA 2OBXA 1TI7A 3M6LA 4I50B 4NPCA 3T5CA 5ENZA 4I9GA 1L7QA 1M5TA 4KPUB 5G0UA 5JYCA 2IZOA 4ARZB 4C4PA 4RX1A 4BQFA 4QVKA 1ZYUA 3WFZA 4ALKA 1J9ZA 1PUXA 1M0TA 5DX0A 1NHWA 1XTIA 2EDCA 3H4MA 1L8QA 4X8MA 1G5HA 1XAHA 3PFNA 2QM8A 3B3GA 4RL6A 4ZOLF 2E87A 3AEXA 4FFPA 4J75A 5EFZA 1O57A 4C4OA 2WRZA 4WFJA 1LPPA 3GJRA 4BJ1A 2QTFA 1QKKA 2C9CA 1O89A 4YUYA 3ZHTA 3Q8MA 2VAWA 3I01M 3VR2D 4YA6A 2VHZA 5IVPA 4ZOEA 3WKEA 1HXHA 1G8GA 1A77A 4FNMA 3TIVA 3BKWA 5FI0B 4YROA 2XCUA 4I9NA 1TAQA 3HWSA 5FOQA 2JBHA 2HMAA 4URZR 4J29A 1G6HA 3JZMA 4L5CA 2G1PA 1JR3D 1QV6A 4X93A 3WP0A 3W9BA 2OV2A 2ZOSA 2MMCA 3G5LA 1CJCA 1ZJ6A 1X7XB 5CNMA 5AWFC 4DQDA 2I2BA 1DFIA 4D0NA 1S3SA 3ZDBA 1OV4A 1Y5IA 2TSYB 1B6TA 4AXBA 1KKLA 1KRXA 4WOJA 2JIMA 2HPZA 2NPOA 3OT1B 4HB0A 4E70A 4GQIA 4XH9B 1V7CA 1ZU5A 4WJLA 5KKCA 1N2GA 2DSTA 4OJKA 1E6KA 3TVYA 4KFCA 3A6JA 1B8OA 3PR2B 2O07A 2AWNA 4PICA 3CLUC 1SG0A 2GYWA 3HU5A 1WUIS 3I2HA 3TTYA 1C9KA 2YMPA 1GNRA 4G5YA 1DO0A 2VJKA 4ZALA 4DG5A 4DG9A 2OGTA 3KAKA 3EF1A 3ZY4A 1T8TA 1U0OC 2YMQA 2E1PA 5DN6D 3SBOA 5DO9A 3MRTA 1T36A 1XZKA 4N7RA 3I52A 4CF3A 2NP7A 4EG0A 1LK0A 3MQFA 2PNFA 4XQGA 1VYTA 2RKBA 3L7DA 1KMQA 1JJBA 1P7VA 2AOTA 3SC6A 4A8JA 2M98A 3D6VA 2XZTA 3JALA 1SVWA 4J0CA 4O2BA 5LYYA 5SZJA 3BFXA 3ENNA 5I51A 5DZSA 2G0NA 3K8YA 1XJWA 4V0OA 2VBFA 4CM9D 5CCXA 5AMXA 1SBIA 1XZFA 1Y3IA 2AA3A 3V1LA 3WFIA 5C8YA 3TNJA 5CA1F 3NGLA 4IHJB 3C3AA 5JJLA 1Y34E 4I4TA 5FUVA 4DDMA 2K4MA 1H6BA 1A9QA 3P1JA 2QW1A 3CF0A 3B1FA 5BN3A 1JUDA 4K8RB 4LDNA 2YV5A 5HPYB 3BJMA 1L7OA 3GRPA 1YQDA 4FMCF 1W36C 3EQ7A 1SXHA 4KQFA 3GRCA 1REQB 2A5YB 4RZIA 2O06A 5EE0A 2N46A 4FHFA 4NYJR 1AV7A 5B3LA 4JC5A 2IHYA 5B3JC 4DSUA 3U16A 1OXVA 4GXQA 3NHSA 5IG2A 1XT6A 1FPMA 3LRXA 4P38A 4NFYA 4ZVQA 2G08A 4B7CA 4H60A 4NAVA 1KEWA 3ZE1B 1JHRA 4OL9A 3V7NA 4MQ6A 2BHTA 2IDZA 5K8IA 8MHTA 1NGSA 2MSWA 2AXQA 3LNTA 4GU5A 3PWKA 4Q1EA 5FBHA 5G3YA 5IUKC 2NXCA 1BOOA 3GCZA 3OJFA 4XRRA 4JBNA 1GU1A 5DYWA 5IBRA 3ELYA 3SFTA 2E89A 3NHYA 3EAFA 2C42A 1HYEA 2OZVA 4RZUA 4FBMA 1ZGHA 5DM70 4U3JA 3FDFA 5JMTA 4JLDA 4DW8A 2W6QA 2O5EA 3B85A 4I3HA 1JR4A 1OE0A 2B3TA 4LE0A 4MIYA 4QL3A 3Q12A 3HUFA 4QG3A 4BVJA 1TD9A 1U7WA 2Q5EA 1N2SA 2ZG6A 1ZI9A 4U6NA 4QDZA 2H4HA 5EMJA 2A67A 4GNKA 3WYNA 3U4AA 1R6DA 1N5JA 1JB9A 3RREA 3WGQA 2IPNA 1H0HA 4MYTA 3LLSA 1YR2A 3CZPA 1SVKA 4RELA 4PLPA 5JCOA 5BSEA 1GAWA 4MVJF 1FX0B 1NQWA 3Q7RA 4JYBA 3DXFA 2R97A 1ZG3A 3CZRA 3BUKC 3EZFA 2MCFA 2HMVA 5HQ3A 4B3JA 3HVKA 2Q1SA 3D59A 1IM2A 3E7XA 5DSXA 1U2PA 5KNBA 1VIMA 3S7TA 1BEZA 2ZWMA 2SNIE 3HVJA 3VPSA 2LRHA 4URFA 4D8WA 4PZCA 2A2ZA 2QLMA 4ZFNA 1YKSA 3N87A 1O2DA 3OFKA 3QYJA 3C3WA 2NGRA 3LO8A 1CY0A 1LUAA 1VDMA 1T2VA 4U8GA 3L4EA 2EOAA 1B8VA 4I55F 2FPGA 3HYNA 3W5BA 1JEOA 1SA0A 3HWWA 4YH1A 2ZJFA 1DUSA 5D87A 1MPTA 4JI5B 2IUFA 1PJQA 3EFOA 5F51A 2UZ0A 1E62A 4YAWA 5EE9A 3KKEA 1NP3A 3QFFA 3OZAA 1P2VA 1SWVA 3PENA 2AR0A 1VKOA 2HNBA 2VT7A 4PCAA 4KKVA 3SWWA 1YR9A 3L5OA 4R2KA 3DFZA 4YC7A 1PS9A 2IYRA 4MUJA 4PQYA 3L6OO 3BMNB 3UKJA 4OQMA 4FZVA 4ZANA 4JMLA 1WV1A 4IRXA 1E0DA 4LYEA 3OIGA 1ML3A 3QFSA 4IXDA 2XNCA 5DHPA 1RXVA 3EOZA 2HH9A 4FDMA 4IXTA 4BKPA 3KM0A 4K1XA 1P81A 4LYYA 3D8SA 2IP1A 3EGXB 3HJRA 4CFZA 3ZHZA 2ZBEA 3DEIA 4JSTA 3U39A 4OHVA 3L79A 4ZCQA 4EI9A 1LFAA 3GIDA 2ZSUA 1PK8A 3FZNA 4H6WA 5TS2A 1M1YA 3W2HA 4PY2A 2VXYA 2AKAB 3EY4A 4P36A 1AOXA 4RW0A 5DYTA 3H8SA 1ZY2A 4OHFA 5LJIA 2AR9A 3ZPXA 4JYCA 3MWDB 4EYOA 1VSQA 1RKQA 4XVUA 2HJWA 1A1SA 2W6JA 1FC0A 2ZSIA 3F7OA 3KB6A 5CU7A 3S55A 3ZHQA 1H05A 2VNKA 5K5EA 3C45A 4IG4A 4A2PA 2AOUA 4XB6B 4CHTA 2BGIA 5E4FA 2VYFA 1E99A 2JIPA 1HURA 1Q0RA 3QU5A 1BYIA 2BMVA 2PSEA 2G9NA 4A0HA 4DCMA 1C0LA 2OV3A 4URYR 4C1BA 1U81A 4RKWA 3E1GA 3F49S 1HRDA 2HOQA 1LS1A 5JEEA 4KJZA 4KKXB 2A9KA 3A1VA 3OM8A 3A4NA 4NLLA 1DKOA 1W0KA 3V4OA 1TZJA 1N2HA 1Q7CA 4GYWA 4IDOA 5TT1A 3BF8A 5EQFA 2OQVA 4JB3A 1RP7A 2R6HA 3A6FA 3BIWA 1D2CA 1DELA 5DF1A 3FUWA 5EEHA 3PPYA 3ROQA 4ESHA 5BVGB 2YWHA 3SDSA 3LSYA 3L1UA 5TVKA 5BWLA 1IMOA 1WOYA 4F5WA 3THWA 1FP4A 4TVKA 1G9SA 3MRXA 5CYOA 1CUAA 1GL6A 3EE6A 5D7NA 1ZSVA 4B7ZA 4C89A 2FUG6 3L4SO 1MEEA 4RPKA 2FRXA 1DRUA 2YHUA 2GBFA 3FJYA 3ZE0B 5FDFA 3HBLA 3R5KA 3P9QA 4BNWA 2O2HA 3EPHA 1YGPA 3ONFA 2BMDA 4MW4A 4DQKA 4DLYA 4FDUA 4GUAA 2NXEA 1TTQB 4WFKA 4AG3A 4RHEA 1W73A 5EY5B 4OKIA 4AJ4A 3PCRB 2CJPA 1AKRA 4Y9UA 5LU8A 1XZQA 3ES9A 3N8GA 3TX2A 3BE6A 4LG1A 4WBXC 1AS2A 1HRKA 4I7EA 3UWSA 5JD6A 1ONOA 3WQHA 4JYAB 3TNFA 4BX9A 4E12A 1EDOA 5LLSA 4F06A 3TW6A 2XOXA 2YDYA 4LJ5A 5IHPA 4MJ3A 1AZLA 1OLSA 4PSKA 2YY5A 2LUOA 1RMQA 2EJWA 3IUSA 2OD9A 3PXCX 4QBTA 2IH4A 3CW8X 4IBOA 1ICIA 2XT6A 1UP7A 2PEYA 3BHNA 2XQJA 3DV2A 3ESXA 1ABEA 4II3A 3NFYA 4QYXA 4QDTA 2YTZA 2ECFA 3IA7A 1M8FA 3IE1A 1VDZA 3AL3A 1TM2A 3F9IA 1IK6A 5C4GB 2DBRA 2VXOA 2PVPA 2NX2A 1K6XA 4LRSB 1IY2A 1T6NA 1YCGA 2ZIVB 2VZ8A 1Y6ZA 4HS9A 4UCXA 5KNDA 4MVJH 1L7EA 2QR5A 3KXPA 5CMLA 1O95D 3GZNA 5ALYA 5COQA 1GQFA 2ZK7A 1NBHA 1XU9A 3WK4A 3C3MA 3W5UA 4DVJA 2H1HA 3GPLA 2ERCA 3JASA 2QTTA 4BLPA 2YXLA 1N6LA 3SJCA 1UDRA 1CE8A 1G16A 3TOXA 1U7XA 1JEJA 5EWMB 5HCNA 4JJ4A 1QHXA 3ZS9A 2UUBB 1ETUA 2RI6A 3EY9A 1DX6A 2RHTA 1PJSA 3UTCA 2W2KA 3EARA 1OYWA 2QMHA 3C5EA 1OHHD 1TDJA 1R7RA 1U5CA 3AI3A 4G8DA 3RVLA 1WZEA 2Z2ZA 4H16A 3STTA 1EWQA 1DEAA 3DDUA 1SVUA 4H4DA 1CV2A 4LEIA 5CVUA 5BSFA 1W5TA 4JQYA 2NADA 3GX1A 2R9VA 3HV2A 3OD1A 3ZCTA 2ERXA 1PGQA 2VUIB 5LPNA 5CRIA 4PR0A 4FIZA 3BM5A 4U02A 4XIIA 2CXNA 4BXOB 4DV3B 1QG2A 1W75A 1GWNA 2H2HA 3RUAA 2F64A 2XTZA 4PNEA 1RXWA 4LRYA 3ZUGA 2SKDA 1QRUA 4LXHA 5JOQA 1YR8A 3O8BA 4JENA 2L17A 2PUAA 1TYZA 3B1ZA 3QKIA 1C9NA 3HXQA 2B2CA 1XN4A 2W6NA 1PTKA 2FETA 1DJOA 3UT5B 1NXPA 2YJ5A 1OJ7A 2GBIA 3G5UA 1JDBB 2AYXA 3M9WA 4YRJA 5NULA 1R0XA 2HPHA 1QLHA 1T43A 3AW9A 1FUYB 2GRAA 3DVQX 4EECA 3QV1A 2XVMA 3QJGA 3WLKX 1AGNA 4U7WA 3CNBA 4DWJA 1N9GB 4RXMA 1Y8RA 3YASA 4HX2A 4FBLA 2PUGA 1NMEA 2C2XA 3MGKA 2CUZA 1DIHA 1YJXA 2GQ0A 3LCUA 4DSTA 3AEUB 2B1QA 5DU2A 3F6CA 3I0NA 1O4VA 1TYDE 1P7PA 3LUPA 5KSWB 5D5QA 1E2QA 1DC7A 4HRXA 2AFHB 2CUTA 3ONWA 1SUBA 5DGCA 5J58A 4MYRA 4MVXA 3RWOA 2BEVA 1YZLA 5IN5A 3JV7A 4PG6A 2FDXA 1RXEA 2BE7A 1XX6A 2QSYA 2YV3A 1AHHA 3OZBA 4HD8A 1NWHA 3JAWA 5AI4A 3E7DA 4CE6A 4YNBA 5I4KA 3ENWA 2TMYA 3K16A 3OEEA 3AF6A 1FDOA 4Z3DA 2EX0A 3GLIB 3AKYA 4L74A 1QCCA 5EHXA 4NCNA 1B93A 2P7IA 3RIMA 5GIPE 2O52A 3GFVA 3LVFO 3TWOA 4WBNA 4E14A 2VJNA 3GCGA 4R54A 5IYZA 1IHPA 2WJWA 3VJKA 1CZKA 1S2IA 1XWWA 2XA1A 3PLNA 5IM4A 3AUKA 1WX1A 2GXSA 2WD7B 3CMMA 1NNUA 5LQUA 1E4EA 5SY6A 1X8XA 1GY8A 3OMLA 3L84A 3M49A 1NE7A 3ZEAA 3BGDA 3NDRA 4YMLA 3FPHA 1V95A 3QE9Y 4C7BA 1ZAYA 1L5VA 1KDRA 2H1SA 5HCIA 2Y27A 3VYWA 2EYQA 4F86A 2QL7A 3SHQA 3IPAA 1Z07A 5DHQA 2QL9A 2XNDA 1E0KA 2XBUA 2REXB 1SH7A 3CLUD 2IA5A 3E27A 4GH5A 4GFDA 1I4EB 2JJ1A 4FEYA 2QRJA 5CB6A 1Y3HA 2C83A 3SHVA 1RZUA 3E70C 1BXGB 3S70A 4KQ6A 2B8NA 1W7AA 2AQ8A 4JQZA 1M1NA 2QMEA 4FR0A 4Q4DA 2F90A 1IL0A 3KJZA 4G5XA 2IEGA 3OETA 2I87A 5E7IA 3SDBA 3VPXA 5J43A 2RK3A 1QC5B 3UGTA 3KJHA 3A1NA 1I3KA 4IG9A 1OAOC 3KT3A 3E3OA 1O1YA 2POQX 1M7GA 1N9ZA 3ZZNA 4GD3Q 4IIJB 3F73A 2AQKA 2HR1A 3SQNA 3GAAA 1ECLA 1YC2A 1BMTA 1KVUA 2XOKD 1NMQA 3IVXA 5EYPA 1VZ2A 5KOYA 3Q7EA 3W5JA 5FWXB 1RKUA 2NNWB 3DOCA 2REQA 1T6BY 4XGKA 1GARA 5CNJA 1YCDA 3BCUA 2V4UA 1CQIA 1UDWA 1D4AA 1L7RA 4CI9A 1VBNA 1W88A 2M6SA 4ON9A 2WF8A 5GM1A 4FVTA 4YP6A 3RBAA 3V1UA 5FTNA 4AZWA 2IYSA 3T12A 4EFMA 1M66A 2VJPA 1W36D 4B48A 3D6AA 4LXTA 2QN1A 1XWIA 4I5FA 1O03A 2QE6A 3Q8WA 1QYVA 3TLGB 3WLMA 4UAUA 5LMCA 2Q9UA 4EY4A 3JWGA 2QRKA 1DJLA 4FLFA 3UJ9A 4LJ9A 1P73A 1Z5OA 2AQIA 5CYPA 1SXJE 1KYQA 1WDTA 2WP0A 3PRKE 1OD6A 4JR1A 4Q82A 5LBTA 3TLZA 5HOEA 3VZCA 1AG9A 2TRSB 1Q1QA 2WYVA 1W34A 2Z0MA 3TI7A 3AHGA 4XM0A 3WGLA 1R8XA 3KC2A 1SBYA 2R7NA 4NAUA 1L5OA 1IN5A 1MZPA 2BGJA 3BXEA 2XUKA 2R6JA 1OH8A 3KAPA 3R5TA 1RZRA 3E53A 1OASA 1H4QA 1LJ8A 4G0QA 1MX3A 4R01A 1OFIA 1VL2A 4JI6B 3VTFA 4YLYA 4CCWA 4O8CA 4UE2A 1VE6A 4YY3B 1V16A 1A8HA 2OYCA 3G1UA 2DWPA 2L2QA 2YMMA 1TC1A 2R8OA 4LOAA 4EENA 2CLKB 3UKDA 3SQLA 1HDRA 2YWFA 4GW3A 1H5NA 1IEWA 1SR8A 4JS0A 2E3JA 3PITA 1A9OA 4OB7A 4PLYA 1X1BA 1G7RA 3WRXA 5AKGA 3S2UA 3SAJA 5JS6A 3BVPA 1E9SA 3HM2A 3KZKA 1JEQA 1B41A 4IDGA 4BFLA 5C18A 2J59A 3KPYA 1U7ZA 4G0ZA 5JZ9A 1XI2A 2I0FA 3CLVA 1NP6A 4UOQA 2FFQA 3T0GA 1PLKA 1L7MA 2CFOA 3A3PA 4LHEA 4DC0A 3K31A 3SK0A 1W76A 5EERA 1JLLB 4MAFA 2RGDA 5TDHA 1KU0A 4NQRA 2GZ1A 2RI0A 3PFIA 2WSIA 3QQ5A 3BJIC 1A95A 1NLFA 3UH1A 1TYAE 4HDMB 1TYCA 1U28C 4GI1A 1NATA 2B4TO 4FJ0A 5HRCA 5C3UA 4EW3A 5AUPB 3QX8A 5FH9A 3I72A 3O1JC 4BEBA 1HNXB 1MQAA 1P9NA 2I22A 4FYMA 4K9KA 5D1NA 4ZT6A 1P9RA 1KK0A 2AIRA 1KETA 2W0MA 3AG6A 3ZXSA 3PLAE 1WY5A 4IKEA 1TK9A 4CV0A 3BQNB 2YHIB 2AEEA 2CV0A 2ZUBA 4DL9A 3I37X 4V0SA 2OHFA 4JKYA 2IE0A 4YAEA 4J7CA 1V8DA 1N0WA 1GA6A 1I3OA 3K6KA 4Q3NA 2DTEA 5TJHA 3RNOA 4C7VA 4ZMSA 1Z37A 4EKYA 4DA4A 2RHWA 1U0BB 2BBWA 1ZK0A 4P4NA 2W2TA 1ONSA 4LJSA 1FTGA 1YB4A 2VBCA 2PZKA 1P77A 1U1DA 2OK8A 2G1JA 5KZMB 1X94A 4K9MA 4IOMA 4OMUA 2H48A 4RFSB 2HSGA 2RARA 5IFLA 1XOIA 4CUKA 3SZRA 1J5XA 1DG9A 1WKCA 2XXBA 2J08A 4HQLA 4GRIA 4IFEA 4QFDA 4MJXA 4PRZA 1ZUHA 4Q05A 4A0FA 3AWIA 1F9EA 3W2EA 2FP4B 2JGRA 2PO7A 2LCFA 2D2FA 3G9QA 5CFOA 5CEJA 1N3BA 3V4RA 3LBYA 4B3HA 1A2KC 4Y98A 4X8LA 4FCVA 3ZK9A 3E9CA 3MB5A 4FJ1A 3HPQA 1OFHA 1YUBA 2CBGA 2DWOA 3NT2A 4YI3A 3CBQA 3VC3A 2DR3A 2XDQA 3LQ2A 5JLJA 4M0FA 4UC0A 5ED4A 3SQOA 2AWOA 4J4BA 1JQDA 4WXHA 5DI9A 1FSPA 4DKXA 4N01A 1QRTA 4P82A 1KOFA 2C5BA 1V7QA 4QRHA 3RIHA 4CF6A 5TNXA 5JANA 4GLBA 1C9MA 1NF2A 3I1IA 4HUTA 3P5BA 1SHKA 4IJQA 3UGKA 5G40A 2PBRA 2BDEA 3HACA 4OHRA 3CTPA 2I7XA 4X6UA 4R8RA 1ZEMA 2Q5HA 2YNMA 1H2AS 2X2PA 2I1WA 3AKDA 1TEVA 1J7JA 1X7WA 3IO5A 4Z8YA 3D5EA 3CZ9A 5FL3A 3LWBA 1T35A 2FW8A 5D1HA 4ZAFA 5IABA 5JARA 4C4RA 3THXB 1GNLA 1QB8A 1R9GA 2I4LA 2QSJA 5FBKA 3N58A 3S1AB 1JLSA 5JPIA 3PEUA 4FIDA 3FNFA 3BA1A 3MHTA 2ENUA 2YS6A 4WCFB 4AJ2A 1SQGA 2H7CA 2HC9A 1Z6TA 4GOMD 2VVTA 2YWCA 2ZI3A 3PXDA 1EIWA 3N8NA 4N9QA 1EINA 2XT0A 3Q3JB 4H0CA 5E6UB 2BSQA 1RYMA 4TSFA 5DBEX 3S68A 4GLFA 1HYGA 4LY6A 1FXUA 1X1CA 1NXQA 3GA7A 1GZ4A 4RKQA 1TQ8A 1QGUB 3H18A 1GQYA 3ZGOA 3HR4A 1JF8A 4RC9A 2BTOA 1AKMA 3L1VA 5DLDA 4CFSA 4YRGA 4KPYA 1Q1BA 4P7KA 3AFNA 5EIAA 2AMJA 2BFWA 1SKUA 3O26A 1ZI8A 5GIOE 3MB8A 4AU1A 1NW8A 4U7GA 3DSRA 3HV0A 4N0QA 1P1HA 2LKCA 4ISCA 1PBNA 1WCIA 2P6RA 3LTNC 1MMFB 5D3MA 4K0RA 5I7VA 2ZRFA 3CR3C 3QLJA 4RPLA 4HNVA 3V2GA 1N3IA 5EZYA 1UJNA 1A97A 2UV8A 3KEGA 2EJTA 4JA2A 3RF7A 2BHRA 4B8YA 2JH8A 5K3OA 1RXCA 2XXAA 1U5AA 3DL2A 2YBEA 3L1JA 3U9SA 1I4LD 4Q9LA 3V8BA 4XUDA 1PI3A 3WO0A 1WWKA 1MTOA 2ZJ2A 1DFGA 3RRJA 4BEVA 1PTJA 1DAFA 3UPTA 2IIVA 2WDPA 3FCUB 2X3FA 2XMGA 4M54A 4WW0A 5EHQA 4OJNA 3C43A 3MN1A 3CRZA 4IH1A 3U7QA 3UAVA 1CQZA 5AK6A 3KSAC 2AI3A 5HRAA 1XQWA 2QRUA 4GGPA 4UPVA 4PO3X 4RK1A 5E6SB 5INTA 3RYCA 3OOEA 3IP3A 1M2VB 4L3WA 4X1KB 4ZHSA 3FOEC 4R51A 4UNPA 2H2AA 1YDMA 2OKGA 4G6ZA 2P0AA 4MJLA 5BRNA 5KYUA 4AQDA 4YUXA 2RK4A 4I50F 5E9JA 2HRCA 2HA0A 3LHFA 3W6ZA 2F17A 3V2HA 1C1XB 3R7DA 1QMPA 3HLTA 4GBJA 4QGHA 4OI1A 4J16A 3S2GA 3WJAA 4R4JA 3W5AA 3LUCA 3M4XA 4B4OA 1ZMTA 1ZRNA 1HF3A 3CPJB 3HN7A 1CBUA 3I04M 1M6EX 4EF5A 2VEDA 3OIUA 1NF3A 3FDZB 3MEQA 1M0WA 1JX6A 1UIRA 2UYOA 3W5DA 5AVYA 4EYKA 3QNUA 5AIAA 1NVDA 4L85A 2RSLA 1O0BA 4B80A 4HHEA 2W2LA 4YMUA 4D0RA 3PKIA 4II7A 4LQCA 4MCHA 3UMGA 2EU8A 4B45A 4YAKA 3MWJA 1E9VA 1XR3A 3HVRA 2HDNB 5EMMA 3HCWA 1ARZA 3U0VA 5EKDA 2VJAA 3HWRA 4A3SA 4DWWA 1GZUA 2I6TA 4X24A 2B0JA 1HZZA 4MVJD 5IZCC 2AG0A 4TLLB 4FOSA 4PZLA 5ALMA 4GKBA 3JQEA 2DF8A 5IAAA 4O6VA 3OLYA 5LA6B 3BQMB 1DJMA 2BHLA 3CZ5A 5DNAA 2P0EA 5B1SA 4G56A 4J1TC 4QE3A 3JRWA 4BC1A 1PNOA 5E3HA 4XIFA 3GBVA 1F8GA 1Q2XA 3PNBA 1CR0A 1IFXA 1MKYA 1GNTA 4G8CA 2WWTA 3MNFA 4N0PA 2DHEA 4NABA 5F4BA 4BGUA 5FI3A 1OLUB 5KCZA 2B21A 3EC1A 2FW1A 5JD4A 2W90A 3P26A 1VG0B 2WE8A 4F6RA 3EEOA 1HYBA 1XJ5A 3FDXA 1KI3A 3ZLTA 2VYCA 1XKLA 4GP7A 3RF6A 1GKYA 1MO3A 2HA2A 4FWIB 1H1LA 2Q6TA 3L8HA 2HT6A 2NAPA 4DDHA 2BSAA 1PZHA 1E1QA 2XE6A 1FU7A 1QIGA 3ANSA 4G97A 4JVSB 4MWOA 4S0ZA 3SX0A 2C2ZA 4Z1MA 5LFAA 2WUDA 2Q1WA 3K32A 2GJSA 4NCBA 3OQJA 5JRJA 4N90R 1GPDG 1ZH6A 1MVNA 2AFIE 3FPKA 3NASA 4S3MA 3RRYA 1NQAO 3E5NA 4J4HA 4RK6A 4CLOB 3I04A 4JJGA 1LLDA 3C4JA 3P0RA 1EHIA 4Y6LA 2PLFA 2HA7A 1P5RA 3VDXA 3KK0A 1ZMOA 2BIFA 4EDHA 4IHJF 3OF2A 4HCJA 2D62A 5IAJA 3VOSA 4QBGB 1YRYE 1SURA 3CWZA 4TMWA 2J6IA 4BK5A 1Y80A 2GNPA 1AF7A 3IT0A 4DCJA 2FZGA 1UEIA 4TT8A 2FQQA 3FUTA 3T35A 1UOPA 2ETXA 1VYUA 2ZQYA 3NCHA 2PSDA 3ZQUA 1DDGA 3PNLA 2GI4A 2GAJA 1E94E 3X1YA 4BBJA 3FSEA 4KO3S 2XUDA 4YREA 2YY6A 1Y4AE 3DVRX 4NU6A 2FK8A 3UBMA 3EIOA 2JHGA 1GQSA 1OFGA 2GN8A 3F9CA 3F0TA 1YTLA 1L4EA 3N6VA 2NU7B 4LPSA 2D0OB 1JIKA 4DLSA 3P9IA 3S5JA 1PEDA 3JZAA 1BRTA 2AMVA 2VOJA 5AOVA 3VYRB 1I94B 5H3LA 2YC4C 4Z4IA 3QVXA 3D3WA 3SQXA 1BMFD 2R6DA 5GTDA 4H1HA 1IY0A 3CR8A 1G8PA 2YWDA 5L51A 3CUSA 3F6SA 4NNOA 1R74A 3TNDA 4DIUA 2FEWB 5CVTA 3I12A 3A06A 4HRVA 1K6IA 2O7NA 3NHBA 3FWHA 1RJWA 4P0TA 4D8UA 4RTNA 3W6PA 3O1IC 3WGIA 2R8EA 4F9EA 2WHPB 2SCUA 2Y1KA 4DUZB 1QQ6A 1E1LA 1OAAA 2YXPX 4XJVA 4BO6A 3MCVA 4EI2A 5BMOA 2WTBA 4JODA 5I4CA 2D0DA 4UHDA 1U8UA 1XROA 2GF9A 3BCRA 4LCBA 1TVKA 3N8HA 3F67A 1EBUA 4N47A 3VBCA 2HU8A 1Q5PA 3HJAA 4HVCA 5C5DA 1J09A 1EH5A 1DINA 4LOLA 4M0MA 1J0XO 3UT0A 3G2KA 4F4IA 1S89A 2NZ8A 3ZHYA 1A4IA 2P2SA 3D7SA 3W04A 1J33A 1NVBA 2X1MA 1DSSG 3PNYA 3BZBA 1XZNA 3B1VA 1C9YA 3BGIA 1LCIA 2KS6A 1YK1A 4YLEA 2RJOA 4TTQA 4NV0A 5JUWA 3GJ5A 1RBQA 5G0TA 3ZXXA 2D0IA 3NOOA 3UYKA 4F56A 2C5SA 2JS7A 3RG2A 3KUUA 1I6LA 2Q3EA 1R00A 3Q6NA 1NVFA 3UOGA 4D6XA 3K3PA 4J2OA 5LYJB 3WLHA 2G9VA 3KPUA 4MS3A 2XSZA 1ZJZA 3G0CA 4I2VA 4GVXA 4RSUD 3L9XA 4PSDA 5JO9A 5BUSA 4C4XA 1FUEA 3MD0A 2BM0A 3IT3A 2H11A 1GGHA 3IAEA 4FDLA 4B0OA 2JH9A 1YMVA 3HSKA 1RAIA 4PBSA 3B8HA 2GNAA 4CLDA 4MW2A 4TWBA 2C8KA 3DDHA 1FZTA 2OQIA 1PF7E 1EB8A 1GTZA 3AFOA 5CFNA 4CIXA 2BFAA 1GIAA 2C88A 2PT6A 3ST7A 4M89A 3OD5A 1B6RA 4G1UC 3ZYZA 1GVNB 4QBFA 1W87A 1ZITA 3NTRA 4HLQB 4ZOCA 4JI1B 2DP4E 4RZSA 1R2QA 3ZWWA 1UFVA 2IV2X 5CM2Z 1TNDA 2FWMX 2GN6A 3VHQA 5BR4A 2V7BA 2YN0A 2ZRGA 4RF3A 2YVQA 1CR6A 1Q74A 2A9QA 2XV1A 3LS2A 4LSWA 3MELA 3B70A 5H83A 1FA9A 1XRMA 3IA2A 4XFDA 5BWBA 5DNWA 3RAJA 4UFOA 4BO5A 4P33A 1GKUB 3NUGA 1IRIA 1PJ3A 2PBLA 1PSWA 4F1WA 2XQIA 3H13A 4EQ6B 2DQSA 4PFKA 2G82A 4UMDA 3WIVA 5LIRA 4PHTA 3TOZA 4MRAA 1ADBA 4FGZA 1JTFA 4QLAA 2O05A 3M5WA 4EBBA 4ZQEA 1CZNA 1TB4A 2FWJA 2HNKA 4PANA 4GHWA 5CJ2A 3U5ZB 5I48A 1GTVA 1CJTC 2V3WA 3HSYA 4TMVA 4D9IA 1HKHA 3R3UA 2XUIA 4MUIA 2QLFA 2IGTA 5MN6A 2WILA 4FI3C 1OH5A 3RODA 4C6TA 3QKRB 3MJEA 2RG7A 4I19A 2HWUA 4U9IS 3M81A 5DDIP 4MKGA 3MIZA 4MTCA 4XIJA 4DMMA 4R2LA 3PCXA 3HU3A 1KSFX 1APBA 4IDEA 3ZOKA 1SJ9A 2B7BA 3C8MA 1L7XA 2MOKA 3TD2A 3OKFA 3GLQA 1DIOB 1UR5A 1P91A 1EGMB 1IC6A 2IEYA 1L1RA 1BXRB 2QPLA 3L8YA 3WBFA 1JQEA 1TZMA 3WQSB 4BTLA 2XB2A 1D1PA 4HI0E 2WAMA 3DMHA 3DHVA 1C8BA 3DGFC 4R1PA 4RIHA 2J7PA 2ZB2A 1Q17A 2ZWVA 3M9XA 4A27A 1NKTA 2YYAA 3LX8A 3JAKA 5CNKA 4CGZA 4RPIA 1QIFA 4JOSA 1CUHA 1NP7A 1GG5A 3DVSX 4B2YA 3SDZA 1KL7A 4YACA 4YEDA 1Z4KA 1ISFA 4MDYA 4QBHA 4TM7A 4FW9A 3VDMA 3X1XA 3AFIA 1C81A 4WFQA 4JD5A 2GVDC 5JASA 3EXG2 2XDAA 3AVUA 3IOYA 2FUG1 3AOGA 3DXXA 5U4XA 4JB8A 5CUQA 1YQEA 2EW2A 2WJJA 1RYEA 3SJBA 2YIDA 1NCFA 4QOGA 2OHJA 4EHNA 1IBRA 1DNPA 3T7JA 1SZCA 1UXGA 3IBTA 3I6MA 1PR1A 5A3QA 1FU8A 2J0SA 1T9HA 4AZ0A 4WZAA 2YZ7A 2CHUA 2GEVA 1Y8AA 5AI9A 2FN9A 1L5FA 4R9SA 4C78A 1OYOA 2MR6A 1BGVA 3EMDA 4IS3A 1M1YE 1ML4A 4KLNA 3HGQA 4KXXA 1T1EA 3MWLA 2BR4A 2J8ZA 1QP8A 2PXAA 4P3KA 5DB4A 2Q49A 2H17A 4GKJB 1L7PA 3ODPA 3L0IB 1FMLA 3NHAA 4M37A 5HP4A 1ZH4A 3LPDA 1LPOA 1LB1B 4D8TA 2QVGA