2E4YA

Crystal structure of the extracellular region of the group ii metabotropic glutamate receptor complexed with 2r,4r-apdc
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
538
structure length
518
Chain Sequence
RREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDNYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNICIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAANRVNASFTWVASDGWGAQESIVKGSEHVAYGAITLELASHPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQCSLQNKRNHRQVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPQTTKLCDAMKILDGKKLYKEYLLKIQFTAPFNPNKGADSIVKFDTFGDGMGRYNVFNLQQTGGKYSYLKVGHWAETLSLDVDSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYLVDEFTCMDCGPGQWPTADLSGCYNLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metabotropic glutamate receptor 3
publication title Structures of the extracellular regions of the group II/III metabotropic glutamate receptors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 147
structure length 518
sequence length 538
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
A PF07562 NCD3G Nine Cysteines Domain of family 3 GPCR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.50.30 Mainly Beta Ribbon Tumor Necrosis Factor Receptor, subunit A; domain 2 Tumor Necrosis Factor Receptor, subunit A; domain 2 2e4yA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2e4yA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2e4yA01
3CZCA 1QP0A 1Z2EA 2WJAA 3TO5A 1GCGA 2ID9A 5TE9A 4XFKA 3RVPA 4WUTA 3K4HA 3O75A 4H3HB 4XAQA 4Z0NA 1NTRA 3IP5A 1T34A 4LDAA 1MVOA 2HPHA 4EYKA 4S04A 4XARA 4KREA 1U0SY 1MB0A 4E7OA 3HS3A 3CU5A 2JCGA 3Q7TA 1ZGZA 2W42A 1KRXA 2CHEA 2QW1A 3H1FA 3LUCA 3KCNA 1USKA 4RY8A 4YS6A 4MS4B 4TN5A 1LJLA 4Y9TA 1DBPA 3N0XA 4W5QA 3SM9A 3LKBA 2QVGA 4WXMA 4YWHA 3GWGA 3G1WA 3QLUA 3CKMA 4MRMB 4EVQA 4L4UA 2GKGA 3KTOA 2PKXA 3N8IA 4FB4A 4PE5B 3OLXA 2E4VA 2B1JA 1USIA 4F11A 3H5LA 3ROTA 2MYNA 1YS6A 1DCMA 1L5ZA 3NHMA 1GCAA 2FTKE 3HZHA 2A9PA 3QEMA 1EFAA 1C4WA 3LUAA 2QZJA 4WWHA 4LE0A 1B00A 4XASA 3MQ4A 1D4ZA 4RSMA 3K9CA 4Z4FA 1JL3A 2PAFA 1DBQA 3O1IC 1P2FA 3S99A 1DG9A 3C3WA 4PZ0A 1SXGA 2NUBA 2L2QA 2JK1A 4ZYLA 4ML3A 3CLKA 5HKOA 3MYYA 3A0UA 1Z2DA 5DCLA 4O1IA 3HEBA 4O1HA 3H1GA 1EHCA 3RVRA 5TQ0A 5KQLA 4YCSA 5C5CA 1JDPA 3R0JA 4MR8A 4IMIB 2FW0A 3I5AA 4EYQA 4MR9A 3O2JA 4G0QA 2M1ZA 3JVIA 3UKJA 5D2CA 5TPWA 1NXXA 3CS3A 5CNIA 2QSJA 3I09A 4CBVA 5DKFA 4DQDA 1U2PA 4IILA 5EWMA 4TLLB 3TMYA 5JS1A 3FFTA 5JS2A 1NATA 4DN6A 3GT7A 5EWLA 4N76A 2FMKA 3JTEA 2FLWA 1RXEA 2QVCA 3LTEA 4KK4A 5IUJC 1DZ3A 4YO7A 3CTPA 4ZJPA 1Z26A 3QX8A 4FE7A 4MS1A 1YTUA 2MYUA 2MSLA 2GI4A 4RU1A 4L85A 1RPJA 2Q5CA 3NBMA 9ABPA 3H1EA 4JAVC 1GLGA 3Q7SA 3L6UA 4PYRA 2FEWB 2IPNA 1VPWA 1TJYA 1VKRA 3NNSA 5C5EA 5JNTA 4W5RA 1E6MA 5TQJA 1E2BA 2A9RA 1ZN2A 1JBEA 4PEVA 4ZMSA 3OLYA 4KZKA 3MIZA 2IOYA 4EYOA 5JNSA 3EGCA 3DZDA 2E4YA 1JLKA 1W25A 4MYRA 4W5OA 3LKVA 4OG2A 6CHYA 1OXBB 3MMNA 3QLVA 4RK6A 4TLMB 5IX8A 4OLBA 3A0RB 3IP7A 2QR3A 4F3TA 4Z4GA 4Q6WA 3QEMB 1A2OA 5CNKA 1Z17A 3T38A 5FWYA 1D1QA 2PLNA 4W5TA 1AB6A 2ZAYA 3C3KA 1JDNA 1U8TA 3RVQA 4ETIA 4D6XA 4JB0A 1P8AA 4RDCA 1ABEA 4MGEA 5KWSA 1QQBA 4Z99A 2LBPA 2AYZA 3JVDA 4MLCA 4RXTA 2WMYA 3L49A 3C3MA 5HQJA 3H5VA 2FLKA 3I45A 1Z15A 1K66A 3M9XA 5FBKA 1BAPA 3KHTA 4MQFA 1UDRA 5PNTA 2FEPA 4W5NA 1ZHHA 4N03A 3FMVA 2CWDA 3F7NA 3ROFA 3HSYA 3HUTA 1A0OA 5TQ0B 3RVSA 4KVFA 4MR8B 3HCWA 3CFYA 4MR9B 1VLZA 4NCBA 5KI6A 4KFCA 4HNRA 5T3YA 5TPWB 1QNLA 3CRNA 2B4AA 4G0MA 2LPMA 4O5AA 2PUDA 3D02A 5EWMB 1ZY2A 5B3JC 3OO0A 2PUFA 4KRFA 3GBPA 3JPWA 3KJXA 5EWLB 3GYBA 1BDIA 3DGFC 2IPLA 4MS1B 1IIBA 1NXVA 3OMWA 2JBAA 3CG4A 1NXWA 2P4UA 2E4WA 4MR7A 4M88A 3UUGA 3LUGA 1KMIY 3HXMA 1TMYA 4WT7A 5F64A 1I3CA 1TM2A 3LUFA 2LUOA 4XXHA 3DGEC 2RJOA 4G0OA 5CHYA 1SXHA 3A3KA 1F51E 3HM9A 5GQSA 3OLZA 2WY2D 1DCFA 1QQAA 1XWWA 3OM0A 1JFSA 5JNWA 3H6HA 2PMCA 5KQGA 4Z4HA 4KNYA 1AB5A 1HEYA 3OO1A 2OQRA 3KS9A 3RQIA 1LK0A 4RKRA 2PUAA 1FSPA 3O2SB 2M98A 1EWTA 3G85A 5FWYB 4D6YA 2I6FA 2OENG 4Q6BA 5HSGA 2ZWMA 5T7BA 2PE5A 2ID7A 4HYEA 4N41A 3GA5A 1CEYA 3O1JC 4EY3A 2PL1A 1MIHA 5E3JA 1OXKB 3I42A 1JX6A 2GWRA 3TX6A 2E4XA 4QPJC 4MQFB 3H5TA 3OMXA 1JFTA 1BA2A 3C97A 2JVIA 4IMJB 4EVRA 2YHAA 2PUEA 1S8NA 5CNJA 4JOQA 3VNBA 5BRJA 3DBIA 4RK0A 5TPZD 5KQMA 1H9CA 4YR7A 5BQ3A 2QU7A 4Z4EA 2FXIA 3TD9A 3OLWA 1M2FA 5I4CA 3E61A 4HNQA 3RVJA 3SNKA 4Z4CA 4RXMA 1ZH4A 3IDOA 2GBPA 3HVRA 4E7PA 4KQ9A 2FVYA 1Z18A 3JS5A 5IC5A 3OM1A 3GL9A 4JB2A 1YMUA 1FFWA 2FMFA 2JVJA 2CD7A 2HJ9A 1USGA 3H5IA 3M9WA 1DCKA 4RXUA 1RZRD 4FE4A 5FBHA 2FSPA 2JBAB 3BRQA 3F6PA 3EULA 4MR7B 2WJWA 8ABPA 3CG0A 1W9HA 6ABPA 1YS7A 3HO1A 1FFSA 3QLTA 1KGSA 1MAVA 4LX8A 4IF4A 1ZESA 1NXOA 2QXYA 4TMYA 4F8JA 5KC8A 2PL9A 3HDVA 2PJUA 3IPCA 2L19A 2YHBA 3M6MD 2L17A 3IP9A 3Q7RA 1E6LA 4B09A 1C0EA 1YIOA 2CHFA 1GUDA 1ZITA 4G0PA 4EYGA 5DTEA 2NT4A 1QMPA 3VNAA 1APBA 1DJMA 4N0QA 1P6QA 4QICA 4YLEA 5IULC 1FFGA 4RKQA 1TLFA 1SD5A 2R25B 3Q9SA 4JP1A 4KPYA 5IEBA 3HV2A 5ABPA 1XHEA 1JF8A 2AYXA 4ZMRA 5HM6A 3CZ5A 1ZAYA 4F06A 3QELA 2FKAA 3N6VA 5B3JA 3SAJA 3H6GA 4RV5A 2IPMA 1TVMA 3C6QA 3D8UA 2VUHB 3P9YA 4QYWA 4RZSA 4S05A 2A9QA 3GRCA 3RVKA 1M5TA 1QP4A 1D5WA 3IPAA 2HQBA 4UHJA 2NZVG 5IEJA 3EQZA 3EDCA 1L5YA 2RDMA 4JA2A 5ED4A 5EWJA 2FMHA 5IUKC 2F8TA 2HSGA 2P9HA 2IKSA 1FQWA 3UK0A 5KQPA 2H3HA 4OTZA 2BGGA 1Z13A 2R4QA 2N9UA 4IGAA 1F4VA 4GPAA 1A04A 4KK3A 3E3MA 4QYMA 3BRSA 4WZZA 4KV7A 1RXIA 2FQYA 2LP4Y 1RZRA 4EVSA 4Q7EA 3EAFA 3OQNA 5JNUA 1U04A 2JVKA 4GNRA 4H60A 1JWLA 1DRKA 1PEYA 4LRQA 2FQWA 1VRVA 3BILA 3GBVA 3MM4A 4YRZA 2L18A 2MSWA 4OATA 2J48A 4P1ZA 1ZGGA 1PUXA 3F73A 3Q15C 3KKEA 3EODA 2MYPA 1M2EA 1BVHA 3OLVA 4G0XA 1E6KA 4LDZA 2FN8A 2R47A 3LFTA 5GOTA 4F12A 1Y1LA 4ETNA 4MPTA 3SG0A 4ZPJA 1Z16A 2GX6A 1ZH2A 1J56A 1YMVA 3BREA 4RY0A 3FFWA 5KC9A 1ABFA 2X7XA 1WETA 1NXSA 3HUUA 1XHFA 3FDFA 4NCAA 3H5OA 4RK4A 2VUIB 5BRAA 2PUGA 3RVLA 3HDGA 1LJUA 3LUHA 2KYRA 4MS3A 2FEKA 3RVOA 3ILYA 3Q41A 2VK2A 5FWXA 1K68A 4H3KB 4G0ZA 3BBLA 3LOPA 1DC7A 1MB3A 3FGZA 3HK2A 2IPAB 3H5WA 1ISRA 1BDHA 3FFXA 3KYJB 1NY5A 3NNNA 3JPYA 3SY8A 2DRIA 2WB4A 4RY9A 2PUBA 4Z4IA 1URPA 2O20A 4EUKA 1DBWA 4UHKA 4MQEA 3QEKA 1EAYA 3QELB 5DLEA 3SQNA 3QLUC 2E4ZA 1EWKA 3H75A 4NQRA 5TQ2A 1QPZA 5BR1A 4N0PA 1QO0D 4YP9A 1CHNA 3IP6A 4YV7A 3O1HB 3DLHA 2IDMA 3RVNA 4RK1A 3N75A 1JH9A 5EWJB 3LUJA 3EQ2A 3O2QB 4OLAA 3CHYA 3ILHA 3T8YA 4RS3A 1NXTA 4LE2A 1ISSA 2PUCA 1BDJA 3QK7A 1JHZA 3F6CA 1ZDMA 3QX9A 4LE1A 4G97A 4JASB 3B2NA 3KLNA 4LZLA 2LIVA 2F8SA 2FQXA 1SXIA 4MLDA 5DGCA 1P6UA 1QP7A 1PEAA 1U2QA 3KLOA 2WRZA 4NICA 1LBIA 4MAAA 1JYEA 1PHRA 4Z9BA 3A10A 3DLBA 1JFVA 4XLTA 3GV0A 4NV3A 1YK0A 1CYEA 3N0RA 1PNRA 1D2AA 2IYNA 1Z25A 3JY6A 3OQOA 2HQRA 1NXPA 5JNRA 4MS4A 2JRLA 3N0WA 4IRXA 4P98A 5CNMA 2NT3A 3NNDA 2JB9A 5IBQA 2R48A 1EWVA 4OBBA 1YK1A 4MRMA 1ZVVA 1JYFA 4RWEA 4PICA 4WXEA 4RK7A 4N47A 3EJWA 1R8JA 1SRRA 3KG2A 1LBHA 2RGYA 3KSMA 4HNSA 2HQOA 2FMIA 1RNLA 1M5UA 3MF4A 4MS3B 1GUBA 4KMRA 4RK5A 1Z12A 2XDYA 4EGSA 1DC8A 1DRJA 1QO0A 7ABPA 5FWXB 2FN9A 5IUNC 3HJFA 2NZUG 5TPZA 4DADA 3OQMA 5JNVA 1PNTA 1YVUA 2WWVD 4D74A 3LUKA 3URMA 4YGXB 2H0AA 3O74A 3O21A 4MQEB 2RJNA 3LMKA 4KQCA 3CNBA 4G0YA 1KRWA 1DP4A 3RH0A 4G86A 5TQ2B 3TB6A 2QV0A 2V0NA 2VYCA 3RVMA 3T6KA 2MYTA 1QKKA 3NHZA 2E4UA 4Z9AA 2A9OA 3N53A 4ETMA 3QLVC 3LUDA 2MSKA 3KYIB 3MA0A 3T95A 2TMYA 3W9SA 1D1PA
chains in the Genus database with same CATH superfamily
1J22A 1GPNA 5HZKA 1J9GA 1KJIA 2AXNA 2DSTA 3B52X 3D4NA 1QAOA 3VTKA 3G49A 3PNVA 4LNAA 2ID9A 3SZRA 3THWA 1UT6A 3HA7A 1J2RA 2YNMC 1T35A 3J81k 1FRVA 4RHYA 3K30A 5TRTA 2O0KA 1GGJA 5TT0A 1VCOA 4BEWA 1TDJA 4HDRA 2HDNB 3BTSA 3GZ4A 4XM2A 3PE4A 1QGAA 3H0EA 5DSXA 5BMVA 5A5EA 1EHIA 3Q7TA 4XLZA 4EHHA 1Y4SA 5ENDA 1WW8A 2WIFA 3FF1A 3UMMA 1G8JA 2DLDA 3H5AA 1HETA 1ORVA 1OXSC 1IRIA 5JCJD 4L78A 2GEKA 2Y1OA 2O23A 1LJLA 2ZWPA 4DC0A 5F9FA 1ODCA 4E0BA 3KX2A 3QWHA 4JBGA 3NFRA 2H8KA 1SVSA 3G1WA 4EVQA 4N8EA 1GG8A 1U2GA 3AX6A 1KI8A 2AOVA 2C03A 3N74A 2XWSA 1Z4MA 4AC9A 1THGA 3AI3A 3BB3A 1YCHA 2ZWIA 1T3HA 3HJGA 2NYUA 3LCMA 1RLTA 3OX3A 4PE5B 2IZZA 3H5LA 4QNRA 2QPTA 4W1QA 1CHDA 5MFZA 2HGZA 2WT4A 3HZHA 2W48A 4B6QA 4HS9A 2ZK7A 1EFAA 1JEEA 1W87A 1T4CB 1WW2A 2CDBA 3E9ZA 2BFAA 3ZVMA 1UC9A 2HNAA 2RFLA 4RQBA 5H80A 1XU9A 1L5KA 4QOFA 4WZBB 1JJBA 2BMJA 3U17A 1DG9A 4QDJA 3R9KA 4DREA 3AUFA 4ERNA 4WA7A 3SQOA 2GWHA 5EUCA 2NUBA 1NVTA 3JRXA 2EGGA 4QYIB 4F6RA 3CSUA 1IB0A 4J0IA 1YRYE 4C0AC 3SHFA 3TGLA 3ANNA 1DFGA 2KM1A 2ZB7A 3KHUA 3QSYA 3CN9A 2CSUA 3A06A 1CXZA 1EHCA 4HJXA 2A9KA 1NMEA 2ZBRA 1OYVA 2B4KA 2EP5A 4YP5A 1KMCA 3OQIB 4IMPA 4OAPA 1UPBA 2O1SA 4BTLA 3R3YA 1LPAB 1JBQA 5FTWA 3Q5EA 3UKJA 4RQTA 4X20B 4DY6A 3T3DA 3GLHA 4Z54A 3ND8A 3ZWDA 4BQRA 1GKLA 4WN9B 2B2XA 1NATA 2W71A 3ELUA 2WJJA 5FTLA 3QNWA 4I6JA 4REOA 2B92A 2O14A 4LYHA 1UAYA 2PGXA 4QDTA 4CR6A 4YO7A 1W4LA 1ZC4A 1EGAA 2JHPA 1VFNA 2ZJ7A 4B7CA 2JRCA 1SZDA 1CQIA 4BJ1A 4PC1A 3W77A 1P5ZB 4RU1A 1D07A 3ILXA 4XOIA 4Y2GA 4D8XA 4TTRA 4IR7A 3PHHA 5AM2A 2EFDB 3G0GA 3U1TA 4ZQHA 1WZNA 3FSRA 4KQHA 2R7LA 2WIDA 3E9DA 1HDOA 1IIRA 5C5EA 4X6LA 1ZNZA 4U7HA 4R1OA 1XZ8A 1KO5A 1O5IA 1QOQB 4TN1A 5JOQA 1LC3A 2VAWA 3N6RA 3UAXA 5F78A 5GM2A 2JJ8A 4PQRA 1P74A 1V1MB 1GU7A 4ZEVA 5DGIA 4V03A 4WK6A 1XQYA 1SFRA 3GB9A 4ENSA 1A96A 4DYVA 4J1TA 2E4YA 3VYRB 2WUFA 2D3TA 5DO9A 3R5HA 1M73E 3A04A 2YFYA 1L4MA 1SMKA 4NAVA 3TAUA 4J91A 1Y9ZA 4LXGA 1XDWA 4G67A 4OXNA 4Z4GA 5J1TB 5LBUA 5CNKA 1QV9A 3LCRA 4GKAA 2XYGA 3DFZA 4XE5A 1ZXLA 2PLNA 1D0GR 2IEZA 5DN6A 3SZMA 3UXEA 3OTQA 1P7PA 2GCGA 3DYIA 3K0EA 4JB0A 1CW2B 1AV6A 1QQBA 5JG7A 3AEZA 4L0QA 2ZJ4A 2BCJQ 2V3WA 3LNTA 1PD0A 1NJSA 3S8YA 4TZKA 4URYR 3M82A 2PT7A 3KHTA 1AA6A 4CUJA 1BU8A 1WDLA 1Z4NA 2H4XA 2MHCA 5JSQA 1GA4A 2BFBA 1T26A 3C8UA 3QPAA 4HK4A 3TSCA 1D1SA 1Q0HA 2HV8A 2FU5C 2WJZB 1UXGA 1KEPA 2DC1A 2X8WA 3O4HA 2ZJ3A 1QZXA 3VV3A 4JEIA 5ALVA 2EIXA 4J0FA 1TK2A 3GJRA 5CK4A 2V7QD 1IN6A 3BMNB 2C3MA 2J59A 3VC1A 1QNLA 1X0XA 1BVYF 3H7IA 3QUQA 4HJRA 4R3UC 2VXCA 1P2TA 5EYPA 4KQKA 4NDNE 1HTWA 4RM2A 1OH6A 4KRFA 2JFWA 5EWLB 3OEHA 1IN1A 3WI7A 5KCZA 1TEZA 4FC7A 3UTCA 4AZTA 2QVLA 5JZ9A 1U9IA 1DC6A 4LBVA 1DQPA 4QBFA 1Q0UA 4E33A 1LZLA 2A7XA 2FG7C 3MAGA 1GU0A 1XDZA 2GUWA 3I6YA 4MWOA 3DE6X 1GILA 3L43A 5FPHA 1IUKA 2ODEA 4LGMA 4MR7A 4CQMA 2W2LA 3OEEA 4JNKA 4P3XA 4M88A 3QOFA 4B40A 4RWZA 4UTPA 1C1YA 1E9BA 1JSZA 1N25A 3V1MA 1G3IA 1U5AA 1EP9A 3ZW8A 3I62A 2H57A 4C5AA 1RKBA 4QL3A 1E9VA 2AOUA 4FMCB 3JRWA 4AN1A 1HG0A 4MEAA 1UQUA 4OSPA 3HVUA 4ZOBA 4EI8A 5JS8A 3DEJA 2RAUA 1DKRA 3IB6A 2YDXA 5F2KA 1W2HA 1B8OA 1HG1A 3VGJA 1UFKA 3AUXA 2FQQA 4L15A 4KWIA 1U8XX 4H4EA 3A36A 1NOJA 1XWWA 1ZUWA 4YVFA 4DW8A 4TGLA 2HTEA 2I80A 3UB4A 1NNEA 1R5NA 2F48A 3F3YA 2BEVA 4LOAA 3VDMA 1EX6A 1P9NA 4C2BA 3KQQA 3FAKA 1J0XO 1NN3A 1OLUB 1QF7A 4UHBA 5JE8A 3WYFA 4R8KA 5HZHA 3GDWA 3KEFA 3TG2A 1E2MA 2Z04A 3PUYA 3NTQA 2JJYA 3I01M 2ZIFA 3OUTA 3BJRA 4ZAXA 2EDAA 5KTKA 4LFAB 1W5TA 3LLMA 4MW4A 1VB3A 2QRZA 4R54A 4YPVA 2FJ0A 4ZT2A 2ZWMA 4PLTA 1V1JA 1JZSA 5FOVA 3OIYA 3O4GA 3IIJA 1FDRA 1KI2A 2BFPA 3KKZA 2DR3A 1LKZA 4ZCMA 4KFSA 1Z0FA 4GSLA 4H7FA 2EYQA 2AJDA 1PNQA 3IT3A 4UMVA 2R1VA 5EMHA 2JG3A 5HS6A 5IBRA 1EX9A 1FXUA 1MX3A 2OP1A 4U2CA 4B43A 2YINC 3AF3A 1HV8A 2CT8A 2CVPA 4BRZA 3PFIA 1RQGA 2ZFUA 3DE0X 2IHKA 2ZSBA 3F74A 1LF5A 2XEXA 3MS7A 3L4BA 3PEFA 4M22A 1RJFA 4AIRA 1CY6A 3F8SA 2C8JA 3IEVA 1P18A 3ONFA 5BNZA 1KMHA 1GO2A 3QBDA 2YXEA 3SNKA 4AKSA 5KOIA 3IQDB 1CX9B 1PVVA 2HPVA 1AGXA 2KS6A 2ISSD 2OCYC 2I6GA 3UG7A 2ZRNA 3PSAA 4KQ9A 2CXQA 2EBUA 3FYUC 1CFJA 1BKSB 1CUFA 4GEKA 4KMOA 4JI2B 4TS4A 4GW3A 2QZ4A 2ZPTX 5KTPA 1RRMA 1S89A 1JAIA 2QRNA 2QROA 3HR8A 3UIEA 4BWGA 1SG6A 3IKVA 3FLBA 4JUCA 1WEHA 1V26A 3PDJA 2BFFB 2GJ4A 1INLA 3OEWA 1D7OA 1V4NA 1W9HA 5IDYA 2POQX 3UO8B 3M89A 5DF1A 4YYZA 3LHKA 4JXZA 2J87A 4D9JA 4DYHA 4DDTA 1XAGA 2VJNA 1QZUA 3PXUA 4E4YA 3C98A 4LYAA 3A31A 2HA2A 4ZDKA 2L17A 3Q7RA 3TE7A 4BB5A 1I8TA 4WK4B 2P2DA 2F62A 1UBUS 2LW7A 3O4FA 1BX3A 4F5YA 3HU5A 1ST3A 2XDQB 1P39A 3JQGA 3A1FA 3ANLA 1XXHE 1APBA 3REQB 4CJXA 5CUQA 1UF9A 1JDBB 1IBMB 1C0LA 3HRIA 1GFZA 2KHZA 5H4HA 5C51B 4HADA 1CG6A 3QXSA 3BA6A 4DLNA 3WWYA 1HORA 5ALXA 2GXQA 1KVTA 1KSFX 3GFBA 3WDKA 2I1WA 2ZTHA 4HNAB 1QVWA 1A71A 3C6QA 3MWJA 3V8RA 2D2VA 1ZXBA 2EGHA 2OD2A 4OQFA 2C2GA 2WHXA 3AVPA 4ER7A 5A3RA 2A67A 4PS0A 3T7CA 1CD5A 3C7KA 4MVJP 5ESWA 1T0BA 1EI9A 4TMKA 2FMHA 3AEYA 3U31A 4BBJA 3AZQA 2HPZA 2ACKA 3HABA 1QC5A 1G7SA 2HSEA 1Z13A 3IPYA 4KQXA 5ALRA 1RPZA 2EV9A 4LVCA 4BJHB 3DAOA 5CDFA 3T1NA 4PFQA 1R9MA 2EBHX 10MHA 3FMGA 4AD8A 3ZHSA 1RZUA 1GYPA 4K9NA 3Q6IA 5DBFA 3VYTB 4OIFA 1Z4OA 3P2KA 3VR3D 3CLUD 1YBVA 1XCJA 4JJGA 1KDOA 1FFDA 4W6ZA 4TLBA 2L18A 3AJ9A 3D6TB 3EGWA 1UBEA 3DMTC 3QMMA 4IWNA 3GLGE 3DEIA 3Q15C 5DT9A 3CXUA 2AW2B 1FNSA 3AETA 3VMMA 5FL7D 2FPKA 5TB5A 5K0CA 4L3VA 1YU9A 4L8VA 4TSKA 2HX1A 1JVBA 1PLJA 3CX4A 2BGWA 2FPIB 3OAAA 2XUJA 1GR1A 1U31A 3KR2A 3TUZC 1E2DA 1ZVJA 4HDKA 4AMZA 1O9BA 2R97A 2FG5A 1P91A 5IYZF 1P31A 2FYTA 3KTAA 1NASA 4LYJA 1JEQB 2QTAA 1SC3A 3H2BA 1ZOLA 3FDFA 4HWRA 1XZGA 3BEOA 3TTTA 1SUAA 3PUIA 2VUIB 3QFHA 3CUYA 2QMOA 2FRXA 1LNQA 1R5JA 1XI2A 3VPHA 1Z6GA 3I01A 2C9YA 1X77A 1RP7A 4JSTA 4CR7A 3P4UA 1X1QA 4QWWA 2DQ4A 2J33A 3FGZA 4JZKA 4KX3A 3UXMA 4A8JA 5ERXA 2CXSA 4MV4A 4CUZA 3VKHA 2GO1A 3ESCA 1KEZA 4FN4A 4K6OA 1C41A 2BONA 1LRLA 4TTTS 4ZO6A 3ZGOA 4CF4A 5I7AA 1J8MF 3OTGA 1DBWA 2ZTLA 1JEYA 4LBYA 1E3WA 3T15A 1UWLA 4GZ6A 1J06A 3MBOA 4CG0A 5SZIA 1ZP6A 1NUHA 1R4MA 3L8GA 2CXTA 3E2PA 3MSXA 5DNEA 3ESXA 5HF6A 3EGEA 4KHZA 5JXJA 4MOWA 4C7MA 3CX7A 4BCCA 1ISIA 2DT8A 2ZJ6A 4R3NA 3WWZA 1SK8A 1YSCA 5EWJB 3M3PA 5FFFA 2XGOA 1N3BA 1EZ4A 4H7KA 3G9UA 3GGGA 4LE2A 4LXXA 4W63A 1B2LA 1PGJA 1PCXA 1A72A 4J6GC 3MWEB 3QV1A 4L74A 4UM5A 4WCFC 1BNCA 2KPOA 3IVAA 5DFAA 3L01A 4K0KB 2PKWA 3G8YA 4NZMA 3B2NA 5DNYB 1J00A 1YZKA 4K3VA 2XKAA 4MPJA 4QC2A 1SCAA 5H7XA 1Q0SA 1T8PA 4FYKA 3CF6R 4QUKA 5L3VA 2WWGA 3DVSX 3JR3A 4LF9B 3WHLA 4L51A 4L50A 3K9WA 2AZDA 1ESEA 3D3WB 3F8TA 3DKKA 1DG1G 1ZUD1 1OH8A 3H8JA 1XNRB 3KZCA 1M6HA 1PJTA 2CLKB 1DV2A 1NXPA 3B5EA 1E1QA 2CXUA 4PO3X 1PJ8A 1IATA 4AMVA 3CT4A 5FUQA 4OCZA 3N0WA 2HQ1A 2NZXA 3K4PA 4RTOA 1L5SA 1M3SA 4WJZA 3I4LA 3IDAA 4Q3OA 3TINA 1VM6A 4MIYA 4N5LA 1YK1A 3I12A 2V65A 3ZXIA 4RJIA 5K3FB 5LXTF 4CLHA 3G2LA 4PICA 3TOSA 1YZQA 2J1LA 5KTTA 1JIJA 1QK4A 3KM0A 4ZO9A 1R8JA 1P9RA 1VI5A 4FWTA 1UPFA 2W6JD 5A2QA 2YXPX 5JJBA 4YDQA 1IXRC 1LSSA 4HRAA 2NU6A 1TK3A 1XZBA 1VDMA 2EFEB 1FSZA 1I3OA 3PA8A 3UJNA 4ZAYA 2YKGA 3LJKA 3GY0A 1H2XA 1YBAA 5DM1A 5FAXA 4FEEA 1GWNA 2BKUA 3ZHXA 1J20A 1QO0A 4WDQA 4RORA 2R1TA 1EFUA 4WW0A 5DRYA 2EF1A 1T8UA 1T0JB 3AY6A 2J5XA 4MAMA 5E38A 4Y2XA 3UK6A 3W2EA 2IBSA 4D74A 4RKEA 3N87A 4BQPA 4Q15A 4C5CA 2O0HA 3B6JA 3IVGA 1KEEA 1UWCA 2RJNA 2D7CA 2CGEA 3OEYA 4PZ9A 5KJ1A 3OIWA 1M74A 2G9QA 3PUWA 4M46A 4PY2A 5BR8B 3L02A 4NPAA 3TF5A 2J7PD 3OURA 4UFPA 2MYTA 4N01A 2ZJ5A 3F98A 5F12A 3WQRA 2X3FA 4W1SA 2GEVA 3NRCA 4YRIA 3E27A 4M1KA 1T3GA 4C6SA 3KSBC 4P2GA 4PC7A 1QP0A 4I8DA 1V8DA 1EZ1A 2AD5A 3ED1A 1ZH0A 4RJJA 5BP7A 5CVTA 3HXLA 2YOGA 4YB8A 2HY7A 5AKGA 5AJUA 3LQ1A 2JIZA 2QAGC 2QMUA 4EZEA 2ZCVA 4GOXA 1ZA3R 1PDWA 4C78A 4HYTA 1RP1A 4OP1A 2RH9B 3JR7A 2P5TB 5A6SB 2FWMX 4CCAA 2XD4A 1ISHA 2Q6TA 3B3AA 4OHVA 4GKBA 2XGGA 4MVJM 4WA8A 3MRSA 4R5HA 2C2KA 4HWTA 5G0UA 3U62A 1JR4A 2GBIA 3H99A 2VDPB 3BCSA 5B2FA 1GFWA 2H1FA 4IIYA 4XFJA 4B80A 5KOJA 1PV2A 2PV0A 4TS9A 2O1XA 2FDRA 1VIVA 3CE6A 3FTNA 3A7DA 5CIYA 2JI8A 3C6BA 4UKDA 3E7FA 3O8QA 4TN5A 3TWOA 1EG7A 1QK3A 4C0JA 1DWQA 1QM5A 2XVMA 2QVGA 3S40A 2CL7X 4IXDA 2A0KA 3ZNOA 1N32B 3UH0A 4DLVA 3LF2A 3CUUA 3WLSA 4UOEA 4YLYA 4EEZA 1XPRA 1KY4A 2E4VA 3HDYA 5A3JA 1NQUA 5C80A 1W29A 1J8YF 1ZBDA 2VRBA 3IP3A 3AJAA 3JZDA 4FGKA 3R5KA 4IXNA 4P7FA 3TTXA 4ARZB 1N6RA 5LZ7A 3T5PA 4B8YA 2QUAA 5E1OA 4H3VA 3I92A 3VZDA 3HXQA 5U9CA 3IB3A 3GJ5A 1D9ZA 4J1SA 4WK2B 2PZKA 3IA2A 3I9KA 1JHRA 3MFQA 5I5GA 2BP7B 4U2EA 1K4MA 2WHPB 1OWMA 5ALMA 3HWWA 1UFVA 5JJ5A 2QQFA 1P0IA 1QHHB 2XOKD 3PU6A 4PTYA 2BBWA 3GJ8A 5K9ZA 3L04A 4FKBA 4O2RA 4PZ0A 2VUTA 3MD9A 5CA1A 3HRKA 1W49A 3DLTA 3O26A 4PBTA 1IY2A 1XQWA 3GVCA 3WYGA 2ZUDA 5A7FA 2Q5LA 2RJ3A 2HYIC 1M2WA 5DCLA 3U7IA 5DHUA 5FT9A 1Q7RA 1PR2A 4W7SA 4YCSA 1QKIA 2X86A 3E9NA 4BRWA 4ETWA 5L95A 4F97A 2QTBA 3CZ4A 4C6HA 4M9SA 1FA9A 3O2JA 1QGYA 1TAQA 5DLDA 5GINE 2PMKA 3IDFA 4X7PA 4D3XA 1OWOA 3EDQA 2C7QA 1LDNA 1U3TA 2Q28A 2HBYA 2YJZA 2FP4A 4LJ4A 4D1YA 1JLSA 2Q41A 3UICA 3T1YB 3M6VA 2QRVB 3FPFA 2XB9A 1WSDA 4V0RA 4CF3A 2F8LA 3D8SA 1J0CA 2R96A 2FLWA 1G7CA 3AI1A 3EWSA 5DHRA 2IBMA 1XZQA 2VJQA 3H11A 5CP8A 3WK7A 4BB6A 5DWVA 4ERXA 4KAXA 3EPRA 2UZ1A 3FSGD 3IMKA 4MS1A 3F46A 3B38A 1D7AA 2Y0EA 5AOVA 3OFKA 3K5HA 4QGBA 3ZHQA 5L51A 2GI4A 3CVUA 2CZCA 2CJPA 1QPGA 4KGDA 3ZYZA 5A5DA 3OE4A 1XEXA 5SYNA 5B1SA 4BLVA 3WGZA 3KKOA 3KV3O 3HJNA 2Q3HA 4URUR 1G16A 2J9XB 1VL0A 4ID9A 5DGHA 1T3SA 4OM7A 2BGRA 4G1BA 2F00A 4IXTA 2E2WA 1U81A 2AUMA 4ZD6A 2B9EA 1C1DA 1M6YA 4W6QA 3WL6A 3A6HA 4A7PA 4BO2A 4NG4A 5LYJA 1T1GA 1CTQA 1A1VA 2BM1A 3JX9A 2J5KA 2ZIWB 1H69A 4PIVA 4PAOA 1XNHA 4GBGA 1ECBA 3QF7A 4IHJA 3ANMA 2O0LA 4OQEA 3T9FA 1C7RA 1I94B 2IYSA 1S4MA 4IV8A 2JGKA 2XBUA 4YN3A 3O8DA 2ZAYA 4Y1RA 4DIBA 1R3DA 2VEDA 3S1LA 1PJQA 4IIBA 1X7YB 2Q5FA 4Z99A 1XMIA 2EF0A 2WWHA 1RQRA 5J4KA 3HYLA 4CFSA 3QMPA 2JLAA 3O83A 4GECA 1R9GA 4DDVA 4EJSA 1K66A 2NYVA 5AW0A 1FMTA 4K7JA 521PA 1KEWA 4XI9A 1CY7A 2WU4A 1ZK2A 1MV8A 2C7VA 1D03A 5DK6A 3WZMA 4V2UA 4BMPB 1F9EA 1PQ4A 1H85A 2Q2QA 4O4LF 3HL4A 3IIMA 1BROA 1MO5A 1UAGA 3K9BA 3M4NA 3NHSA 1ESCA 4OBWA 4C14A 1FUYB 2FLVA 4MP3A 3KVRA 1OOEA 2OCDA 2W6NA 3B60A 1UM8A 3PVCA 4MYUA 1XALA 4KFCA 5T3YA 1P2BA 2VTDA 3INRA 3T7TA 4G0MA 1L8XA 4ND6A 5FJIA 1YJXA 4NBTA 4B7UA 5HP4A 3TCXB 1N6HA 5BSVA 4GRAA 1RYFA 4AO7A 1NLFA 4MVJA 3OX2A 4UBIA 5FTMA 4EFKA 4AG5A 2OZVA 3JYHA 2ZB4A 3IPXA 1FQOA 2RARA 1FP7A 4U8GA 2P9EA 3HPQA 4F46A 1NQWA 3OP1A 3PUHA 1GPWB 2FDCA 3L7BA 4EPWA 1UBGA 1W4BA 2VAXA 4GPIB 4FYWA 5IAOA 4IXMA 4GXRA 4DM7A 2O9JA 3VNSA 1EFHA 1HZZC 3G9QA 1QNFA 1QGUA 3ZK7A 4LOHA 2ZQZA 1T5TA 2CXOA 4WT7A 4OYYA 2LUOA 4FTWA 3NBZC 2COEA 4H15A 3M5WA 4AKHA 2FSIA 4D41A 3I5UA 1T4DA 3PXAA 2A9JA 5DYIA 2WT9A 2DB3A 3B3FA 3FN4A 3WS7A 3C5CA 4EFDA 3M3DA 1IWPB 1F1BA 3WNQA 2GK4A 3A28A 1AQNA 4RTMA 2QTVA 4WIAA 2X1MA 3OO1A 4YRDA 3ENQA 3W8NA 4AY3A 2PUAA 4H17A 4LFCB 2VK1A 4V0OA 3F2VA 1LU9A 3QENA 1O6ZA 4G0WA 4MRVA 1PWYE 2D0PB 1KARA 2J5QA 2R7MA 1JI0A 4PTZA 4E6PA 3WZLA 2GN2A 4HDAA 4RPKA 2VK8A 4F4CA 4RD1A 2GXAA 1N8NA 2PL1A 5EP3A 1TQ4A 3IRUA 2EWVA 2F2TA 3E6AA 3CH6A 5DTJA 1O5TA 2BMAA 4O3FA 4D81A 3EXIA 4MQFB 1MCZA 3I6QA 1THTA 4A15A 2WYVA 3CJQA 4BKQA 4I0WB 2RB5A 1IWBB 1RAFA 5HWSA 3ES9A 2JGEA 3ENNA 4EVRA 2ZI3A 1NE7A 2ZB2A 1KKLA 1TFRA 1Z37A 1OZAA 1LNSA 1R88A 3LPMA 4S1VA 3VNBA 1RE1A 5KSZA 2IXGA 3AHDA 3KWLA 3PNKA 4LXHA 1YI1A 1J8DA 4ZICA 3TFOA 3TD9A 4YI3A 3MLEA 1W8DA 5TR9A 1N2XA 1UIMA 2EKQA 2R66A 3JQAB 1NC3A 2AFHB 4NI5A 1V5IA 4O33A 3Q1LA 1GT6A 2P8SA 3AFMA 3DC7A 4GQBA 4C4OA 5I7EA 4KRGA 1J33A 1UWVA 4QECA 2AVNA 3QU5A 3IAEA 4DSNA 4PN7A 4E7PA 1YUMA 5ETJA 1T9ZA 1MHTA 3K70C 4HPXB 2Y67A 1XVAA 1TLLA 3LSTA 5T3UA 2B34A 4G2NA 4FW9A 2C9ZA 3PQFA 5JMTA 1PR1A 1TK9A 3DT6A 2OXEA 8AT1A 1DJQA 1YB5A 1RZRD 1RYNA 1TVKB 3BRQA 3F6PA 3R23A 1AQYA 3DAFA 3EULA 4CV1A 4DTCA 1Q1QA 1WCYA 3GQBA 3UAVA 1Z45A 5DIZA 2ONCA 5T41A 2H4FA 6ABPA 1IUOA 4V0ME 3HJTA 2CNWD 4N82A 2I3AA 1Y1SA 1FTSA 3KZOA 5TDHA 3WLNA 4C4ZA 4BP9A 4F8JA 3GYGA 1CDDA 3O94A 4ER0A 1FS4A 4I4TF 4D25A 1IG3A 1QBGA 5TF0A 3Q7EA 4TXJA 4B79A 3GJYA 1WOMA 4B4UA 5FOTA 1W4CA 1W0KD 2W2NA 1S2LA 2JK0A 1EWRA 2PPLA 4HH3C 1Z56C 4MCHA 4BZQA 1CQPA 1KE1A 3MXTA 3D64A 1E4EA 4KU4A 2IUFA 3T5MA 3ODPA 2R8BA 3GMSA 3TM5A 4RNCA 1XAIA 3WGKA 4CI9A 2C9DA 4KXNA 4X61A 3H3XA 2ZULA 2VTEA 3Q9SA 4JP1A 4DZTA 2HIGA 2VDQB 3CUTA 3ER9A 4NBSA 2OPHA 3KIPA 1TIBA 1PK9A 4RHCA 1Y3HA 2PQ6A 3CZ5A 1IEQA 3QELA 4AL4A 3PPVA 1FNBA 1Q5PA 3BOSA 3OJXA 5DEIA 3AZPA 4Q3AA 1V1RA 1YQGA 4G8DA 4GF5A 4QYWA 3A4TA 1F2UA 4X8LA 4ND3A 4P82A 2YZ2A 3F3KA 4R2LA 4URFA 5K0GA 1I2MA 5K1ZA 2VHYA 2CJXA 1L4BA 5ED4A 5BYKA 4F2HA 2YMQA 1ODTC 1MIOA 4JLKA 4N3CA 3PITA 1JHYA 1M1YB 2IYZA 3OC6A 2WD9A 1NGSA 2R5WA 4YONB 3OZXA 1O0CA 1U0JA 1H1LB 1W0CA 4ND8A 2IUSA 4PGMA 3ZD8A 4JYZA 4L76A 1XTZA 4FEAA 4BKPA 1RXIA 3E48A 3VTZA 2XAAA 1OT3A 3G5MA 4PX2A 5CW2A 5KS2A 1W2GA 4MB2A 3A6PC 3KHSA 2ECQA 4EJ6A 3QO4A 3C8HA 3PGKA 1GHTA 5EIFA 2IK8A 1R0KA 2D2IA 3SN6A 4F96A 1QQ5A 5BSEA 3FUVA 3DE7X 3IMEA 4N9WA 4CM6A 4E3ZA 1NL3A 4OGGA 1R37A 2V98A 2BHRA 3NTUA 4FGUA 4RC9A 4RHTA 2MSCB 1RYYA 4QLAA 1IH8A 1MPTA 2IYQA 2MYPA 2O2IA 1GUAA 2JHCA 1C1XB 2F1RA 2C0QA 2BE9A 2NU7B 3RNOA 1DC4A 1TTHA 1MU0A 1U3UA 2NSDA 4PFSA 2FN8A 4UNQA 3QKIA 1VC2A 3GIWA 1NULA 1P7ZA 4G5GA 4JC8A 4JU8A 4AZ0A 5GOTA 4AAYA 4Y2RA 4H7DA 2Q9CA 2V0GA 3DMPA 2NZWA 1KYZA 2GX6A 4KN9S 4OMFG 1K6MA 1M2OA 4OJYA 2WYWA 1L5GB 1AXEA 3S2YA 1HF3A 1N33B 4A5OA 1KNQA 3I58A 3PYXA 3OUUA 4RCZA 3CR8A 3ELBA 3WLEA 3ABIA 3MLBA 3T3IA 1KAOA 1M6NA 5GONF 4UAGA 3CKKA 1ETUA 3V4PB 1ULTA 1CDEA 3NHYA 5B1IA 1QG2A 2BI7A 3H19A 2XMBA 2C2OA 5BSGA 1CQJB 1L4EA 1U1IA 1SB9A 2Z95A 3QP9A 2OFXA 4LY0A 5DZSA 3T5TA 2QRGA 3WGTA 1U1GA 2EJCA 3GJ3A 4DE5A 4MB6A 1WMSA 4DKXA 1CNEA 4KLCA 3EF3A 4PX5A 1KOLA 4L1KA 5DN9A 3V4ZA 4FUTA 4D79A 3SZUA 3GMIA 4XPZA 2E4ZA 1EWKA 2C78A 4YXWA 3OT1A 1SBCA 4HL6A 5LXTB 2ROQA 3MGGA 1TMGE 2B37A 2C5LA 2YFQA 4CRWB 2V4ZA 3ICPA 2GVZC 2VXYA 1MN6A 1A4XA 3KXDA 4C4SA 1OFVA 3TQRA 2IHJA 4BGVA 1KYWA 2C4UA 4V1CB 1DPGA 1JFRA 1W96A 3T8YA 2P2YA 4K9PA 1YRWA 1ISSA 4A1OA 3G88A 3QVUA 2QX4A 5LMCA 3P2IA 4RMIA 1UL1X 1WPRA 3DLIA 1KP9A 2BFDA 4I66A 4IX1A 5D87A 5ALNA 4QDZA 4EGAA 6PFKA 1VLLA 2NXCA 1SXIA 3U3DA 4V0NA 3DULA 5BN5A 4LQLA 2DE0X 4WFIA 2QVXX 3GQVA 3P2JA 1Y1KE 1LWOA 2XE8A 3EVZA 1CUYA 3FNQA 3JZMA 2QPAA 2FEMA 1WMFA 1NNSA 4J0EA 1LDEA 1FYFA 2BM0A 2WNIA 4FEYA 1C3VA 4UXIA 4AQDA 4B7ZA 4EHDA 5KEIA 3DLBA 3BDIA 1JFVA 2UKDA 1EE9A 4TVOA 3ZU3A 2AE1A 2FW6A 4XWKA 1L8AA 4Z0PA 4ZC1A 3TRIA 2GYYA 3AR2A 1UBNA 1I14A 2WAOA 3LAWA 4N4AA 3I30X 2B69A 3UYKA 3W6PA 4G56A 3QY9A 4GYJA 3VKVA 4RFVA 3ZE6A 1C3XA 2JB9A 3K9LA 1W93A 1G5IA 4LECA 2XUOA 4ZRNA 5IBQA 1QRDA 2RG7A 2FSVA 1RI1A 1TTTA 4A3SA 2J85A 1WVMA 4QRHA 4C4XA 4LHWA 5JAUA 1IL0A 4RK7A 4N47A 1GR0A 2CF5A 3RSCA 5THQA 3KG2A 3EH2A 4I3FA 4BVBA 1X7WB 2PK3A 4NEGA 1UJBA 2EQAA 1XF9A 1QCZA 3EFOB 3ER8A 4DUGA 2V7VA 4JHXA 4Y30A 1AS2A 1GUYA 1YKSA 3DE4X 1UADA 4JX8A 2ZIVB 4BLUA 3Q85A 2ENUA 4MWBA 4QWMA 1IFXA 2P3SA 5K0NA 5LLDA 4OKIA 4RKFA 1I4EB 3ALQR 2DUWA 5CB4A 2PZLA 2HXGA 3DT9A 2F1HA 4S1TA 3P94A 3URKA 1YQUA 4L7VA 3KZMA 1Y8CA 4PS1A 2X13A 3KELA 4WCFB 3GEBA 2XBLA 2YN0A 3EG9A 3LMKA 3N2KB 4KQCA 3VA7A 4BMZA 3L6CA 2ET6A 2J4FA 3RSFA 5F1PA 2N42A 5DNCA 5KMGA 2QGFA 5CLHA 4L22A 5EUMA 5JQGF 3C74A 1U7PA 2ZSEA 4JBHA 3VJLA 4WKCA 1Q74A 4JB3A 1TKAA 1VI2A 4L8GA 4XGNA 3SOZA 3ZE8A 3IR7A 4QG3A 5IJ9A 3DL0A 5ADUS 2IP2A 4DG9A 1WO8A 1ZH8A 5I47A 3BN3A 3E3AA 4CCSA 1HI9A 2Z5FA 5AVZA 1YJCA 4ZCSA 1WRBA 2W93A 4M0PA 5K6AA 3QFFA 5SZHB 4X9XA 4Y9UA 5H02A 2HHCA 1BWPA 4WUTA 1X0VA 4D57A 5AVWA 2QTMA 4XSHA 4ARVA 2FRDA 2JGAA 3ZBTA 4CTOA 4TKMA 1ZIYA 2BWJA 1K4KA 3NHFA 3H18A 2ASVA 5B2EA 4YUZA 2OUKA 1ECPA 1QYWA 4WE3A 4B32A 3QXCA 2IW3A 3ETCA 3SIWA 1WVIA 1UBKS 2W58A 4JJEA 3HCBA 2XTZA 5TMEA 3DVAA 1QFXA 1YH3A 3DWGA 3R20A 1M2VA 2A5DA 4JMPA 4Y9TA 4ZVNA 3TLGB 3HKCA 3TW8B 1F5SA 1ONPA 3TBHA 3BUSA 4WXMA 1CF4A 3SOPA 3RUIA 5BVGA 4GZLA 4WASA 5HFAA 4P92A 2ODAA 2V5UA 1WV1A 1HEUA 3E8SA 1NN1A 4KWHA 2I1VB 5FL3A 3X44A 2GJ9A 2V6BA 3IQXA 4Q0MA 1LW6E 4WOBA 3UW1A 1Q1ZA 4RPGA 2H00A 5JATA 2AZ4A 3S7TA 4IFBA 4O6VA 3MEQA 1VJDA 4EG7A 4IZHA 2FZEA 3LW8A 5A1TA 3ME2R 1C4WA 2O7SA 3ABRB 3GP5A 3AKDA 3T3NA 4HTFA 2JLSA 2FHSA 1C3OA 2QGNA 2FY8A 2VHEA 2ZUFA 3QBVA 1VGQA 1YCDA 3VJKA 4KR3A 3VU0A 1XJ0A 4LJ5A 4Q3NA 5F51A 2D0OB 4XB2A 4CGYA 4NJEB 4IJQA 5FO1A 4E07A 1OCEA 3RS2A 3ZHOA 4JBYA 5EE5B 4UNPA 3M6LA 2XRZA 1E5VA 4E5SA 1L7EA 3EY4A 2MOKA 1CBUA 5C34B 2RGCA 5KYUB 1R4AA 1YDMA 4URHA 3T4PA 4D5EA 1N92A 4O1IA 4I5EA 2XZPA 3U3SA 1EHYA 2BUBA 3BTUA 1Y4DE 3H1GA 1A7JA 2XF2A 5TQ0A 3UEOA 3W9BA 4BL5A 5IYZA 4OJMX 2EEZA 1Z4JA 3D5TA 2H4HA 4H4DA 2ZETA 5AKKA 4ZP1A 1Z0KA 5L3ZA 1OSNA 3JVIA 3OCYA 4FHZA 2NAPA 2P35A 5C53B 2PZBA 3M5DA 3K1YA 1TZCA 4EEKA 2R65A 3PHGA 2QL5A 1OROA 1UZAA 2H9IA 4X3OA 1FP2A 2V55B 5EJEA 1BS1A 5LWHA 5JCJA 3UJBA 2WR8A 1D9XA 4IS2A 4RSRA 4ZJPA 3HCNA 3A2NA 2Y1KA 2AI1A 2OQIA 1E98A 2AJTA 2PXCA 2UVPB 5F23A 2Z43A 1RPJA 2YMLA 4LW8A 1NBMA 4NCJA 5DWQA 5EE1A 3GZNA 5FH9A 1FLAA 2XEDA 5DYGA 4O4LB 3O4IA 4Y1FA 4BQSA 1L1RA 1QYCA 1U6IA 2II6A 3D3QA 3Q7SA 3L0CA 3TPZA 2R5FA 2AKYA 1AHPA 1NRWA 4NMHA 3MPOA 4I2VA 4KYVA 2Q7OE 1LTHR 1TJ4A 1EAMA 3UGQA 4HVLA 3K1TA 3UNXA 2RKOA 2GSDA 2RGBA 4P35A 2XTJA 4QUIA 3W6NA 5IU6A 4C2UA 3BQ9A 1JBEA 3B53X 4YRCA 1AKYA 4FMDF 2IOYA 1CUAA 3L7DA 1VKZA 4FFDA 1AKEA 1H0RA 4XR4A 2Z08A 3UV6A 1X15A 5E95A 5EJ8A 1X8JA 3A7EA 2CMFA 5JALA 2DTDA 4ZT6A 3AL0C 1LC0A 2ZS8A 3HU2A 1PJ3A 1B2RA 2YC2C 3D4IA 2DU8A 3Q0EA 3UYLA 5FWYA 4LGYA 3VR6H 1U8TA 1Y89A 1ZVKA 1L2TA 1VKJA 5DX0A 3EHEA 3THRA 1I36A 3S4YA 5IDQA 3OZGA 3ZR4B 3NP7A 4MLCA 1Y42X 2WIBA 3IOCA 5LBTA 2P9TA 3I45A 3L8YA 3UOWA 2IHUA 1MTZA 4RETA 4LZOA 1OXVA 4GSYA 4BV9A 5HK8A 3D2AA 5K0JA 4UXJA 1MC8A 4Q4JA 2C7GA 4WECA 1X3SA 3FMVA 3M2PA 2RGXA 2O5CA 2Y05A 2FK8A 1GNVA 2NSYA 3QRWA 5BO5A 2IPXA 3KQMA 4MA4A 1P72A 1ZCJA 4L9AA 4RFSA 4YYEA 1HK7A 4UUOA 1HYGA 3L0SA 2QNIA 1IOZA 3DXXA 2DFTA 2CV2A 2YTZA 1UAAA 4B33A 2VNIA 1JB9A 1IZ0A 3GRKA 1KIMA 2G17A 3SHQA 4EFLA 4R6WA 2PUDA 4WESB 1JKJB 4PHCA 4IH1A 1QG6A 3A4LA 3OFSA 2BSXA 4JZYA 1D2HA 4ZIRA 6YASA 3GRAA 3O8BA 2J9GA 2VQ6A 1NIPA 4GXNA 3AXTA 4AB1A 2EWMA 1A8PA 4XYGA 5E1DA 3K94A 1BDIA 3NYWA 2IEBA 3OG9A 3P9RA 4UEJA 2I8AA 4RE5A 1JA0A 3TBKA 5KWIA 2AHRA 3Q6NA 1PUJA 5BN4B 3VSAA 4Z51A 5KB3A 1NXWA 2YYYA 1QLWA 4GWGA 3QVLA 7AT1A 1E7SA 4KQFA 1BEZA 2PR2A 1KMIY 2WD8A 3G2MA 1DIAA 1CS0A 1JDSA 1I3CA 4ZEWA 3KNZA 4NU8X 4YP6A 4EECA 3C2QA 3AUUA 3DE1X 4LRXA 4X92A 4EF6A 5CHYA 2G3YA 4N9QA 1UBJS 1BJRE 5I9SA 4OMDA 2BBTA 3ZLJA 3B78A 1QG4A 1PQUA 4OI1A 4O59O 2JGDA 2X22A 4IIGA 4B4WA 1Q12A 1VRWA 5K0ZA 5E4TA 1RKVA 3ONWA 4OGFA 3I52A 3SQLA 4NOLA 1P5FA 2DKFA 2EU8A 3MAAC 1KJQA 1FSPA 2FJUA 1OC2A 4RH0A 8GPBA 4EMUA 4CMKA 2AR7A 3QWFA 4D6YA 1X1AA 2OENG 4V0LA 4AYXA 3OU6A 2WKWA 1ADGA 3ME4A 2G9UA 4E94A 3CCCA 1ZJWA 1GTRA 4AJ2A 2Z5GA 2AFIA 4NY1A 1JT2A 5E6UB 3RUAA 1AOXA 1JX6A 2R2GA 3I34X 1E8NA 2V7QA 1UQTA 3FCUB 4I4TB 2PGDA 4UVEA 4O08A 2O3UA 2O8BA 2G07A 1QE0A 2QJWA 1U0RA 3A32A 2JI6A 3NXSA 4JIMA 1CQXA 2B9VA 2JGJA 2Q1YA 4UMDA 3A1CA 4N5NA 3R74A 4AZ3B 1WTAA 3ET4A 3PQ7A 3W78A 4G8BA 4LMAA 5FPQA 4MW2A 5BRJA 1Y33E 2CBGA 4ONEA 4KX5A 3KRTA 4TVKA 4EG8A 2REQA 4YR7A 1F12A 5DNUA 3T52A 5GVSA 3VKGA 1ECCA 2IUUA 3B9BA 4M60A 4PWZA 3EC2A 2F9MA 4RVHA 3RLIA 1TD9A 4OA5A 4RJKA 3O7WA 3E61A 3TSAA 3NT5A 4FFSA 1W4ZA 3M4XA 4OHCA 1XKLA 4C7OA 1SXJC 2NVBA 1SC4A 4GIQR 3QJGA 1IU9A 4WZAB 5REQA 4KQ2A 5LB4A 4ESHA 3HNPA 1Z5ZA 5F52A 2ZJ2A 4UXHA 5CLIA 3JW8A 2CXPA 3ADKA 2GJSA 2PEYA 4IS3A 3TDNA 1V3UA 1MC4A 2XA9A 3K09A 5AKEA 1Q0QA 1YC2A 5BWNA 4X6XA 1NW3A 4UULA 1GADO 4KKXB 5AW1A 4WUVA 1UDAA 3U26A 3LZ6A 3ABQB 4D0SA 4IINA 5AI6A 1DWUA 2E1PA 3I9V1 5F5NA 3SICE 4UD6A 4XIYA 3ER6A 4MXDA 4LVOA 4HSEA 1NBOA 3AP3A 2BFEA 2JKVA 1ZD5A 1E4YA 3CONA 4RIGA 3RS9A 1BVRA 3S8EA 5D5HA 3KB2A 4XWGA 3IPCA 4TTVA 2CMKA 5M04A 2W4MA 1ZIOA 3IJ5A 4C3ZA 2WAYA 3GFOA 5TARA 2AUNA 3OJLA 3O3MB 1CRLA 2BD0A 2IDKA 4FQ5A 1BE1A 3CZRA 4M37A 5IARA 3NEYA 4KO3S 3WBBA 5DTEA 2RI6A 4PG5A 1VYHA 2QP3A 3PQDA 4OJNA 4XJVA 3MJTA 5C8YF 1P6QA 2VH1A 2QJTA 4OXQA 3HB7A 4KPYA 2PEZA 1TKCA 3ML1A 1EUDB 4HXFB 1J7KA 4HBZA 4BASA 1S96A 1M6VA 4J3JA 4OSEA 1GKYA 4F06A 5BSTA 5FIUA 2XE7A 5IJAA 3ZIUA 3PQ8A 1KS9A 4PO8A 5J40A 5J9FA 1NP6A 4IGIA 3FCEA 2WWWA 3RVKA 4X7MA 2ZXEA 2MR5A 3FHLA 2O3QA 3EDCA 4IIHA 4B8ZA 3FHOA 1YZFA 1JR3A 1YZGA 4CTNA 2HU8A 3D7SA 2G25A 3EH1A 1YS9A 3GEHA 4J8PA 1WV0A 5GMOA 2WJHA 4YPOA 3E3MA 2FOLA 1T2NA 4JVOA 4RTQA 3F3SA 5BXQC 1FYDA 2C4VA 2P90A 5G4KB 3QKRA 4EDHA 3RTDA 3KK0A 1G5PA 2JATA 5B53A 1L7QA 2JAQA 4OA8A 5LA6A 3KOWA 2BTEA 3KVNA 3U3OA 3GBVA 5KSYA 1W0JD 3IALA 1RMTA 4DY4A 1NA5A 3PI6A 2HRCA 2P5UA 1RQLA 2XB8A 1XBTA 2WFLB 3DOIA 3A58B 3FYDA 3T5CA 3WGJA 4W9RA 2DX7A 5AW8A 4RENA 4XVHA 1ENPA 3H6KA 3VZRA 2A5GA 3QSGA 2EJBA 3KKEA 4QUEA 4TRNA 4BV3A 4CU5A 3EC7A 4CIXA 2IUYA 1VBKA 1A5ZA 1EFKA 2J9YB 3AJDA 2YQZA 1ZGAA 5GGYA 1G3MA 1OZ0A 4MRAA 1VLVA 3TL6A 3RU2A 4M0FA 3AM1A 4DJEC 1EEHA 3BMXA 3HHEA 3COSA 4MUBA 1PD1A 3L8DA 1QQ7A 4YV1A 3GPLA 1PI3A 2B3DA 3ZZUA 1ABFA 3QF4B 4C21A 4YCAA 1NWCA 7ADHA 5CITA 1YOBA 4OJQA 1SA0B 4YJ2F 4ZC8A 3VHQA 4J2TA 1Y3IA 3I2KA 3DAYA 1BCSB 4MS3A 3R75A 2FEKA 1VJTA 1E1CA 4PLHA 3ILYA 3COJA 1OV4A 1PR3A 5CB6A 1ZM7A 2AD1A 1PJAA 2Y1LA 3HCPA 4RUKA 1SM4A 4GMXA 1EJ0A 1I3LA 3NNNA 3JPYA 1DAGA 4J94A 1JPVA 1NAIA 1Q19A 1Z8HA 4IUBS 4RHXA 5IJZA 2O20A 1WKVA 3DEAA 3ORFA 4MKHA 2ODPA 4CR8A 2NP6A 1P5JA 1N9ZA 2OHGA 2CVHA 4XWTA 2HHJA 2PGAA 4U4AA 3TIXB 3SLGA 2AEEA 3FPJA 1FPMA 4D8VA 5A5FA 3L1IA 4QEKA 4NTZA 5FV4A 1XZIA 1MXFA 3A1DA 3F5QA 1EM8B 2DOKA 3DBLB 3LLUA 3O9VA 2SBTA 3O1HB 5EAIA 5FLYA 2IH2A 5GJBA 3BXPA 1F17A 3HP7A 1STOA 2FWRA 3CPHA 3EIOA 5DB4A 2RIPA 2VT7A 3UUEA 1N9GA 3FGPA 5JYDA 2DMRA 2NVUB 3MUOA 3WLFA 1H3FA 4GPBA 3I0ZA 1X13A 4RLSA 3N1UA 3RSGA 1XPJA 3NHLA 3QK7A 2G4VA 3P9KA 3AFHA 1ZLXA 3DPIA 2JAPA 3H97A 3QYFA 4BNXA 4G85A 3RJTA 3JAMA 2QZSA 6NULA 1BMQA 4KDCA 5FL7A 1WUHS 3QQ5A 1HYEA 2Z8ZA 3FPEA 4JGBA 5HEKA 5HCIA 4QUDA 3TNJA 1QFMA 5PGMA 1RRVA 1E0SA 3SYRA 3DCIA 1QIHA 1CY0A 1XFDA 1ZWKA 1N5LA 3H65A 3HKDA 3MCVA 1LBIA 4N6GA 4O4IA 3SFTA 2ZJBA 2WMOB 4CLRB 1K98A 2O8VA 1E3IA 2VWPA 3H05A 4Z9BA 2IU4A 4CMBA 1XZNA 3AR3A 2NIPA 4ZU1X 5A3SA 3D2LA 1X39A 4HGYA 3JY6A 5AJYA 3WIVA 2X5NA 1YCFA 2JLZA 3QKUA 3PB3A 3R44A 3Q7IA 2VVTA 3AHJA 5J4YA 3JVVA 4UAJA 4IWYA 1EYZA 2HR1A 1T24A 2AOTA 2X7JA 5HW0A 3NTVA 4M8LA 1IM5A 2X10A 2P3QA 5IJ0B 4AMGA 4ZI7F 1HRKA 2BEUA 3QVGA 3PGA1 3JASA 1EVEA 3WR5A 4NDZA 3BF7A 4DB2A 3EJWA 1YJQA 4FZ3A 4CG1A 2FX2A 5I8ZA 3MTDA 5B6PA 4HNSA 1KYQA 4AJPA 1L5HA 2OGZA 4U7GA 1FJXA 4UBKA 4U00A 4G09A 2AFVA 3AV0B 5DHAA 4NZNA 5CM2Z 2HLDD 2P77A 3ZDDA 3WGQA 3RT9A 1HE1C 3TDKA 1S2MA 1YVUA 3TVTA 3TI9A 3O95A 1OMOA 1Y7IA 5IF3A 3QHPA 3DTTA 5C81A 4AY6A 1OWLA 1D09A 3EEIA 4YGXB 3TRFA 4NEQA 1M34B 4UPEA 4E51A 5KJCA 1H5UA 4OHXA 2GTPA 1V5WA 4KTTE 4PHGA 1HE3A 2WWYA 1KQPA 3MCZA 3PIRA 4YRLA 3E1GA 1GARA 4DAOA 4L7QA 5EHIA 3MINB 1JPUA 1ODFA 2JZNA 1NX6A 1IBRA 3Q9NA 3SYMA 3EVGA 3ZWNA 5LB2A 4LSZA 4DMCA 4M0MA 3UMSA 2OILA 1FRFS 2JFVA 2VDNB 4GOMD 4K6CA 2NVWA 2IFTA 1RWOA 3A9SA 2GARA 5FBZA 1DPFA 5I7HA 4N48A 2TRSB 3OCXA 2IF2A 4BRUA 2VNHA 1SOVA 4M4SA 1Z6ZA 2ZUBA 1J9EA 3HO6A 4OU4A 3LK7A 3SHTA 3I6MA 1XDDA 4GYWA 3OPYB 3ZHVA 1SVOA 3RUHA 2WHEA 1HDXA 1S2NA 4JLAA 5IVDA 4E7OA 2QBYB 3HZZA 1I80A 1B7GO 4AF7A 4M6WB 1YQ9A 2KBEA 2HRZA 3C3AA 1Z3IX 1JR6A 3G13A 4V0KA 3JQEA 3N2GB 3PQCA 5BPHA 2YCBA 2MT9A 3MTJA 3VU9B 1SH7A 3OQVA 3IQHX 4KDFA 4G0UA 5BNWA 3NPAA 4H35A 1ZYUA 3WLPA 4JQYA 1GSHA 1OFUX 3T7IA 4BFCA 2VZLA 3K0KA 4QQ8A 3OA0A 5AD1A 4J6EA 1P4JA 3X3FA 3RWMB 2BMWA 3CLRC 2RGRA 2HCJB 3L7OA 3WK4A 2J6HA 4POOA 2YASA 2Y0BA 4QXMA 4BZXA 1OZFA 2Q99A 3P2MA 4YJFA 3L7MA 1JSXA 1XWIA 1YS6A 3HEAA 4NMWA 4YV2A 1VBNA 4B3TB 4AULA 3CJRA 4R1TA 1GCAA 2HO5A 3GHHA 3ZWAA 4XJXA 4CF7A 5HJEA 3PDHA 1J25A 4K46A 2QQ0A 3K92A 3R7SA 1O97C 3ZY3A 4BFZA 4XYLA 4IOJA 1TM3E 5LZ9A 1WUIS 3UC5A 4B74A 1SCUB 4WD3A 4INJA 4CKCA 1U0TA 1J90A 1NMSA 4HV4A 2ATIA 1AUPA 1U4NA 4Q9NA 3ZHZA 3ZCPA 1T8SA 2OBBA 3CUWA 3LV8A 5MN5A 1LXCA 1SXGA 1U3DA 1AKWA 3A1NA 3AEUB 4BBAA 1JG7A 2J3HA 5DE3A 1FDWA 1AZWA 4G24A 2A86A 1O4WA 3PDWA 4R0MA 1RACA 1Y3BE 2PCJA 3E4DA 4FMDB 4F45A 1E18A 4RGBA 3E03A 4AZVA 4MYCA 1A9XA 1WXXA 2QUHA 1N6KA 2HIAA 5KYKA 1VL2A 1RI5A 4MR9A 4DARA 4G0QA 5BYBA 2ZR9A 5DYNA 4LHVA 2KB0A 5FTKA 1YJAA 4KYTA 2BIFA 4KO1S 3EBPA 5FPSA 5GONA 1RS0A 1T5LA 1W2WB 1BEUB 1CJCA 5JS1A 5DV9A 4WH0A 4IFIA 4H16A 3TSWA 2RKBA 5IJWA 2FMKA 2V5VA 4KK4A 5EVCA 1CZNA 1O9HA 2QVCA 2F17A 4QBIA 3RVBA 4HAZA 2VDKB 3RIXA 5F2EA 3ZHRA 4PPNA 2CDAA 3P0IA 5D84A 4C07A 1I5OA 5K3DA 4P3NA 1U7TA 1YJBA 4Z1MA 4YUYA 4F04A 1WXFA 2IIPA 1P2SA 4MV5A 2V7BA 4E31A 3T94A 3UJAA 5DYWA 2VF7A 5FOUA 2GTHA 2R1UA 2X8JA 5LDGA 1IB6A 1K7YA 4Y2QA 4YXFA 1ZRSA 2ZZMA 4BCDA 2BZGA 1KK1A 3NNSA 5IASA 3FAZA 4JI3B 3ANYB 3GCZA 2A0FA 1DKMA 3BCHA 4HR7A 4R8MA 4DBLE 1GY8A 4MIKA 2ZT7A 1KZGB 2RK3A 1SCJA 4MO9A 1AMUA 5BW4A 4P93A 1K7CA 1MT0A 2CHVA 5CVUA 5K3AA 4W8HA 2PRSA 4OLBA 4JI1B 4Q4HB 4DQXA 3BXHA 3EPJA 3AOEC 4CNQA 4RZ2A 1Y6FA 3T9EA 5LKAA 3T38A 2HW8A 5KYYA 3P20A 1D1QA 1RYZA 2HSDA 4NR0A 3BT7A 4JOBA 3UK2A 5H3CA 5ITZB 5KNCA 2BKXA 2ID8A 1WMBA 2JKZA 4UU0A 4KJZA 5CFRA 1DS6A 1F5NA 1XTPA 4NULA 1E3JA 5K8JB 5KWSA 4IOKA 3JVDA 2N3ZA 2ZS9A 2AMYA 2F43A 1J0EA 4TUYB 4O8CA 1WOYA 1XOIA 3ITEA 5KSPA 2GN6A 2VBGA 5HRAA 1I7PA 1QGOA 4YJHB 3UT5A 2NXWA 2IODA 2R8EA 3EGXA 3ZHBA 3D4LA 5E6RB 2BFCB 2C54A 4B2PA 3FVVA 3Q72A 2WM9B 4EBFA 4EW2A 1D3AA 1H2EA 2CWDA 2IOFA 4TMWA 2QLTA 1M8JA 1WUTA 2E21A 3WGOA 3HUTA 2VF2A 4JQCA 4R7GA 4BLOA 1MJFA 3WNDA 3TD6A 5LMZA 2CDRA 3FKJA 3KQPA 4LGCA 4MR8B 1ARZA 4CEIA 3HCWA 1PFVA 4TTQA 4Y18A 1M5RA 3P45A 3V2IA 4CEHB 3RYFB 2OORA 2ZPAA 2GCOA 4UVIA 2VJOA 3CRRA 3GFGA 4AECA 1NU6A 1EXDA 1MEJA 3FGNA 3NHPA 1ZUHA 1J8VA 3QLJA 4R5MA 1GEEA 3LDAA 2Q1XA 5E9QA 2G8LA 4UTVA 3DUWA 3FYHA 4FNMA 4M1QA 1V16B 4ZOLA 3V7FA 4YCMA 5L6MB 2ZDGA 3ZIAD 1I9CA 2RHMA 1HDIA 3HKEA 3X2FA 2HNKA 5LCXA 1EMDA 5FUMA 4UFNA 4BWYA 3MOGA 4C06A 1AU9A 1ZGBA 5CLFA 2Z57A 1NXVA 2DY0A 2HA6A 3PCXA 4LJAA 5KUTA 2WVJA 2O8EA 4KQJA 3IUJA 4JDPA 3P26A 4FHGA 1FNDA 3OPXA 1M8GA 5JQGA 1T3TA 4J9UE 1OXUA 1K7XB 3PF8A 3KZNA 2H1SA 2XB4A 3HNRA 1I0LA 5F64A 5FLKA 5ALZA 5E2BA 2HUNA 1J2YA 2OCPA 4WNIA 4GMGA 1X14A 4J90A 3NHMA 1R64A 4JLDA 5LJLA 4ZI5A 4ZEOA 3QUAA 5F4ZA 4KXXA 3VAZA 2FHPA 3Q2OA 4V2IA 5BWMA 3E9YA 1NF8A 4AVYA 5LL6P 1P0FA 1RRFA 2GN0A 2J8ZA 4Z4HA 3E1KA 2F4VB 2VR1A 1I1OA 3KLMX 2QM8A 4GO1A 2OD7A 4G1FA 2O2GA 3MBWA 2JFUA 4KQMA 3WB9A 2UZ4A 3IP1A 3OWXA 4IDOA 3P52A 3ZTYA 1MQSA 4N12A 2QP9X 2XCSB 1OV6A 4JI6B 1J2TA 3KR1A 4KXQA 4FD2A 4MV1A 3UWPA 5HSGA 2ZU6A 2XIQA 2ID7A 4DV5B 3O1JC 3P71T 4H1HA 4PHFA 3U1VA 3CEJA 5LP6A 5FJJA 1T43A 5G40A 3WMXA 3W2GA 4D43A 2ZYIA 3VR6D 1VZ3A 3BRCA 4C7BA 3IP8A 3TX6A 4F7DA 2E4XA 1EGHA 1DDOA 1T10A 1N4AA 3I53A 1ID1A 3DD5A 4AX8A 4BXOA 2ZYWX 1RMYA 4F0JA 2X15A 2F3PA 2WV7A 4TM7A 3C6KA 3AOGA 1LD3A 3OKCA 1TZ2A 3ESBA 4MO2A 5IDXA 2JASA 3VHXB 2OXFA 4NCXA 4AXXA 2H2WA 3D8NA 5CDFE 1PZXA 1Z34A 2VPTA 4CM9A 3BZUA 3AF5A 3COPA 3PT9A 3GXOA 3HCCA 3N2ZB 2GB4A 4YRTA 2FPSA 4Q05A 2B0JA 2TMGA 3WMFA 1K6EA 4HD8A 4D44A 5A0TA 2EEPA 4TV9F 1I6LA 3SFZA 2PTGA 3Q7PA 5CVVA 1Z2OX 5I7UA 5J2UA 1NVMB 4WBSA 1Z8NA 3R5JA 2A6PA 4IIUA 4DQLA 1KQOA 3N3BC 3NGLA 3LDFA 3L0ZA 1A8HA 3D1JA 1E6WA 3MUFA 2O2XA 5C1BA 1N1MA 2VUUA 4WRRA 3IEXA 2YWFA 1USGA 3NDIA 4HYQA 1UKCA 5ER6A 2FH5B 2HXYA 4CDNA 2WJWA 4QU0A 2QT9A 8ABPA 5C7YA 4BJ3A 4OV6B 4BNKA 1JQEA 3CBGA 4I2NA 4D9CA 3MJCA 4MTCA 1DEOA 1ZIDA 4BMNA 4FBLA 3DOUA 1Z6YA 4TMXA 4WLUA 3MJHA 3HCAA 1PQWA 1CUZA 1RWNA 2Y2VA 1C0EA 2R6ZA 4U63A 3ROPA 3Q5DA 3TVYA 5JS6A 2O57A 4DLKA 3AVTA 4GPD1 3IJ2X 1E9DA 3SBEA 4DIKA 5FB3A 2WA1A 2Z3VA 4HXGA 2ZIXA 4RTKA 4CQLA 4HNVA 1KA9H 1GNSA 1Q1BA 1PTJA 2M9MA 2R751 2H31A 3AW9A 4K5QA 2ANCA 5D3MA 1DU3A 2VF4X 3KU1A 5A02A 1JF8A 1MNAA 5JTTA 2ZJYA 1IY0A 1E1KA 3TLKA 4QSHA 4M9UA 4BFTA 5A62A 4UC0A 2IS4A 3G59A 2I8CA 3BGIA 3H6GA 5EQTA 4Q9KA 1ZR2A 1TVMA 4B45A 2PNFA 1SELA 2IYWA 1GNLA 1T2UA 4QO8A 4ASUA 2R11A 1BRTA 1SXJB 4AS2A 5EFZA 5EPOA 1Q95A 3LG2A 4G01B 3AG5A 1GFSA 4OFZA 5DNDA 3RF6A 3VTFA 1C30A 2QTTA 1ZX1A 2PWYA 3KT0A 4YQZA 3T7KA 5DLQC 2BAGA 2OO7A 3CNEA 1V6AA 5KQRA 4DSAA 1NIJA 5DMJA 1GPYA 1IMOA 3CX8A 2VWHA 1IUPA 2VZ0A 4K9OA 5EMMA 3BRSA 1QLJA 4O2AF 4PAMA 4WPGA 4FX2A 4XYEA 1RZRA 3TLXA 2PJDA 3AT1A 4P7KA 4CQLB 3OQNA 6Q21A 1C80A 1KY2A 1E1RD 2DFKB 3TXYA 2QQ5A 3EXG2 2W8BB 5BOSA 1QH0A 2GCIA 3LVFO 4EHKA 1EDOA 1N5DA 2FUG6 4ZZ0A 4US2R 3WIEA 4K86A 2UUCB 4KUEA 2VHXA 2ATVA 5FUYA 3TOVA 4L4ZA 3WNCA 4DT1A 4E5YA 5E6SB 2JIQA 2VHJA 4DR5B 1ZI8A 5AESA 1TE2A 3F5SA 3ITNA 4NNJA 4BMSA 2Z6AA 4LDZA 1N2JA 1CUSA 2FR8C 2R47A 1RBYA 5B6IA 1ZL0A 1GLVA 2FR0A 4HLCA 4LBWA 4LYGA 1U7ZA 4ETNA 4U9IS 4KGQC 1F2VA 1H2BA 2C99A 5DYYA 3UXHA 4PAGA 4BC0A 3LWDA 3BIJA 3CPJB 1UM9A 4NHEA 4NATA 3FIJA 1MORA 3REQA 1SVWA 3MWFA 1DBVO 2IX3A 4W5JA 1RLMA 1GL7A 4OBEA 5B58T 3ZS9A 4MPRA 1CRZA 3WWDA 1CY4A 3IE1A 2JW5A 3G0BA 4PCLA 3RVDA 3SMQA 4FSDA 3VZCA 1AS0A 2R00A 2JARA 2IPAB 5KKAA 2GAAA 1KAQA 5THKA 4ZAVA 2FZLA 2B2CA 3AESB 1JFFB 3FDZA 3HM2A 3NGMA 3HWX1 2G6BA 5SY4A 1FP6A 4YCCA 2R85A 2BF4A 3C15C 4BWVA 4G37A 5A0FA 2ECKA 2O7QA 3OCWA 3I2YX 5DCUA 3ZWBA 1E2HA 1E69A 1KZ4A 1YL5A 3ZD7A 2GLXA 3U0BA 1T1RA 1LLUA 1ZMXA 2VRNA 4EB6B 1KR2A 3RRBA 2IDMA 1E6CA 2PL3A 4ZKEA 3NVAA 1A8SA 2CYAA 3AYXB 2EIHA 2QM0A 5AM0A 3VV2A 1T2AA 1VLJA 2FW7A 4Q4AB 4QDOA 2XXAA 1UH5A 2YBEA 1ZUNA 5I9BA 4KR0A 1E7WA 1VI6A 3EFBA 4N18A 3K8ZA 3VUEA 4KWTA 1NMQA 1XJCA 3TEFA 4EG1A 1TM4E 1JVSA 2JF0A 4DDHA 4CL3A 3EDYA 3VSEA 2CXRA 4WXHA 4XGIA 3JD0A 3QXJA 3ZCQA 4CV0A 1XVTA 1PT8A 3PPYA 4NYJR 2EFYA 1U5BA 3GEDA 2QSUA 1UOEA 2CXHA 2YHIA 4GEGA 1NJ2A 4WLNA 2BCGY 2O1WA 4G0VA 2Q4BA 4LMBA 2HF8A 1MUUA 2VP3A 3RKUA 1P19A 1YS2X 4MS4A 2JJQA 2Z30A 2ENWA 3GOHA 3HCRA 3HFGA 1CUVA 4I55A 2BTOA 2YXDA 3VSCA 4UOZA 3K71B 5KZMB 1MABA 3S1SA 4A9AA 1BHSA 1GV0A 1UDXA 2CLDX 2FF5A 3SNHA 4G5YA 2HA0A 2QY6A 3H8WA 3HTXA 3AF4A 1YACA 4GKVA 5BWCA 5JS7A 2AZXA 2EBWA 5FAKA 5J2TA 1SVLA 1Z5GA 2WHQA 1WCXA 3QKSB 3WNZA 3EOZA 2VQ3A 4PSDA 2J0SA 1PIWA 1XX6A 1E5LA 4OXKA 1PNOA 1M5UA 4KG7A 3MD0A 4MWCA 4KLAA 4ZT4A 5BN3A 4RK5A 4MSVB 4QG7A 1KJJA 5GZ1A 1W5FA 1XXHB 2A0YA 3L9XA 5TPZA 3TG8A 3FDJA 4MVWA 4Q3BA 2JLUA 1OI2A 3N9IA 4K8OA 3RS8A 4H7PA 3MMSA 3NDRA 2GCNA 2OHJA 2V7GA 3PP8A 4JJ4A 2RGEA 1KEKA 1N2EA 1J0DA 3GGDA 4FI3C 1QHYA 3NBXX 4TYWA 5FLXA 2CMHA 3AGPA 1NF2A 4DMUB 4CKZA 3RH0A 1O54A 1BIFA 2QV0A 2VYCA 3R5SA 4MWSA 3OHMA 3BEDA 3GAFA 2AWOA 4MV7A 1JSRA 3NOQA 4XX0A 5TS2A 4DJAA 1J6UA 4F4UA 4WBNF 5CDYA 4NOMA 4AJ4A 1YI8A 2HCFA 2WG0A 4DPMA 2WILA 4B76A 5AKJA 2B8WA 2J9ZB 1U1DA 3CZCA 1TCAA 3TO5A 1GIAA 2DH6A 4C1NA 4PYIA 1JJ7A 1LPSA 1OIXA 1ZM9A 2GHIA 5I9TA 2PANA 3KSZO 1N1DA 4HFMA 3KJNA 1JPNA 4NYIR 5C8YA 4EF4A 3WP0A 4BMYA 3SXJA 2XYHA 4OI0A 3ZJVA 2D1RA 2CFIA 1JMAB 3IP5A 3IAAA 3KLPX 3VR1A 5JWOA 4S04A 4RSHA 3V4RA 3TRJA 5IZCC 1ZCFA 1Z29A 3SC2A 2PRIA 4DCOA 2QU8A 4DR2B 1ID8A 3DT8A 1P29A 4WAUA 2NN3C 4Q4LA 3ASZA 2FUCA 1EFPB 3PICA 4NECA 3GLGB 5GOZA 1ZRMA 3J7AC 2Q7XA 2QRQA 3P4YA 2C5EA 4ZHQB 3PR1A 2R6CA 1Q7BA 4YWJA 2PLAA 3TZEA 2PH5A 2PY6A 2H11A 4UCQA 4DDUA 4MK4A 8OHMA 4X3CA 4YV0A 4R2JA 3AHCA 2A7QA 3BL5A 3KZKA 4OQMA 1HL3A 2A5YB 4B3RB 1GRNA 5ADWA 2OMEA 2XKJE 3BH7A 5DM60 5CEFA 1W5BA 4RW0A 3GNSA 1DCMA 2HCRA 3EA4A 1CUIA 1K7FB 1SKAA 4J3FA 4M38A 3DL2A 3G7SA 2AEMA 2FTKE 3GWZA 3ND7A 2C3UA 2B8NA 2GPAA 3P2YA 4OI2A 1EQUA 4EHIA 2HT1A 5GJCA 2YYSA 2PD4A 1EFTA 2Y76A 3FUUA 1OTHA 4ZJZA 5LQJA 4XASA 2HB6A 5HQTA 1RYDA 3WLAA 3MGBA 4A16A 3LPCA 2G5PA 4NFYA 4CMGA 5FOQA 2CNDA 1N5IA 4FS8A 1TYCA 2ATEA 2CB9A 4L5AA 3HYRA 3SX0A 4HATA 4IW3B 1NYTA 4QA9A 3R3SA 4HLUC 1SC6A 3R24A 1DXOA 2D1FA 2YN2A 3MWDA 1RYBA 4KRYA 3OQBA 1YULA 3O2NA 4PFJA 5CB0A 2W22A 1Y8AA 2B4TO 5IVIA 2Q45A 4MVCA 3ZY2A 3EMBA 3K96A 3AM4A 3IXLA 3M70A 2UZ0A 4GX1A 1HFWA 1LA2A 3KPJA 4P31A 2A2ZA 1MW9X 2SKCA 4W8GA 4YJ2A 2ZYTX 5TPWA 4O4HB 5EIHA 2XECA 2AMJA 5BSUA 3TLJA 4LNUB 2Z6UA 2JLCA 3LKDA 4IILA 1VIYA 3EZ7A 4MVJE 5EWMA 5F4BA 4TLLB 2O8FA 2H9AA 3MT8A 1NPTO 1CRWG 2G28A 4PLFA 1SVIA 2BFMA 3NWBA 5BV7A 5HPYB 2BE7A 5J4LA 1H4VB 2ACEA 3DV0B 3TL2A 3H9GA 3S8MA 1KKMA 2X2EA 1FEZA 1Y4AE 3JQ9C 1Q2UA 1GD1O 1SN7A 4HX2A 1KQ3A 1MB4A 4YRNA 1GPKA 2V6JA 3ORRA 1TT5A 4D6PA 1G8YA 4ITRC 4ECEA 1VCIA 5K3EA 4K8RB 5IM4F 1BC5A 1O96A 1T0IA 1GZ4A 4PYRA 1NT2A 2ILTA 2PQ0A 1NRXA 2PX6A 2I2AA 2E0IA 3OOYA 3RJMA 1KFCB 3A9VA 1SC1A 4W5RA 2IU6A 2GHTA 1SQSA 1POWA 3DO5A 2B6NA 3TR5A 2FMTA 3FBWA 3ZWWA 3I5MA 2XNKA 2H2IA 4KZKA 4PR0A 1Y6ZA 3SU8A 3ZU2A 2JNWA 5JMWA 4JLVA 1NG1A 4LMRA 2ZE8A 1WLYA 4ZOQI 3LKVA 1SUWA 4TLMB 1ZGCA 2C3OA 2AJ8A 3P1JA 3IP7A 1TQHA 1LRKA 1ZWLA 1B8PA 4RDXA 3CRQA 2Z3ZA 1A2OA 1XQXA 2VRCA 3ETGA 3NGXA 5SZKB 1LBSA 1T25A 3VNQA 1G21B 3HN7A 3NVMB 4D92A 3NHRA 1W581 2YNMA 3T9DA 2OESA 4QTYA 1VL8A 2R5NA 1YFJA 3QX3A 3B6EA 1NYRA 3NDPA 1DDIA 2AN1A 3VR0A 3I2GA 5EIBC 3A6DA 1L7PA 5TEWA 1D6NA 1NJFA 2V9PA 3B70A 2QN2A 5BSFA 3A9UA 4ZI7A 2QM3A 2PWAA 1VOTA 4JUFA 4AWXA 1ZGJA 2C84A 3EXFB 4ENTA 1Y1TA 3HXTA 3L05A 3O5AA 5F1KA 3T5BA 3WRYC 4DVGA 4QKQA 1DXHA 1SQGA 3GVHA 4XQEA 1DX6A 3FCSB 4I36A 2K87A 4PGHA 3NM5A 3LECA 4ZYWA 4L95C 4RQUA 1KAEA 1BHO1 1NDQA 1I3MA 1QV6A 2CFOA 1ZIXA 2ES4A 2PSEA 3LXRA 3D6MA 4PRZA 3V2GA 3OVMA 4ZYTA 3KQKA 1GV1A 3KKKA 5HKAA 3TN7A 1R7RA 4LHXA 4QXAA 4Y2TA 2DLCX 2PL5A 2XE6A 1QONA 3GJQA 2QN9A 2QRKA 2DT5A 2VYVD 4OP3A 4AG3A 4J0KA 1YD7A 4MHOA 1ZGHA 2QSZA 5DVZA 3OE7D 1BMFA 1Z38A 4BECA 1O6BA 2C96A 4MDHA 4HDMB 3W5BA 1FFCA 1XMSA 2HLPA 4MYHA 3ZVLA 4DF3A 4DBZA 4NV1A 4U0JA 2PJRA 5GGXA 3BA1A 1OAAA 4TM8A 2NMVA 5C52B 1SHTX 3B6IA 4PZDA 2ZUSA 4D3FA 3IQFA 3EXHC 4WLVA 4W7HA 3TZLA 3R0IA 2GUGA 4D99A 2I8LA 3TUIC 2PR7A 2ZYGA 3EYAA 3H16A 5L3QB 3K6SB 1XLTC 2ZE5A 3JYPA 5GWXA 1SG1X 1VKHA 3IH5A 3LBFA 4K87A 5FP0A 3FOEC 3HGMA 2PFSA 4YREA 3CVXA 4UUBA 3KUCA 4TV9B 3LUBA 1WCIB 3OM0A 1ZKMA 4HP8A 4MW9A 4ADSG 1P60A 4N54A 5KQGA 3P9CA 3I64A 1EXNA 2BJHA 4ZXFA 4PC6A 4DM4A 4CKBB 3OI7A 4Y3UA 3TYXA 2VFAA 4GI7A 5CB8A 3RSOA 3G85A 2AI2A 1A82A 3Q2IA 1ZZGA 3PFKA 4G63A 1JHAA 3MNFA 3DMHA 4BNWA 2CUKA 1ND6A 2LNDA 4HYEA 1Z7GA 5L7WA 1BWRA 5D5PA 5I7OA 5AIBA 5TVKA 3DE5X 1OAKA 2W6ZA 4FXOA 1OXKB 1X7ZA 3CVYA 4A6EA 4I5FA 3I1FA 5LD2C 3PCRB 2P4HX 2QLNA 1OFGA 3MBKA 1JFTA 2F3RA 1FSGA 2DY1A 3OMLA 3DB2A 1E5QA 4Q1AA 3DEZA 3IQWA 4NE2A 2YHAA 2ONJA 3VPFA 3JATB 2PUEA 1XU7A 4OQPA 3JQFC 4RK0A 5LMNB 2WYUA 4RZXA 2O2YA 2QU7A 2PO5A 3ECSA 4DSTA 4B83A 1V6CA 4BV2A 3O91A 1N5OX 1OILA 4LC1A 1A7AA 5HZGA 3X1ZA 1SUPA 5KYXA 4FDAA 4RA9B 2FWPA 2IQ5A 5CPFA 4XDGA 5BQOA 4GZ5A 3L82B 4WL0A 3L7JA 2X2OA 5ALJA 3I2JA 2ZVQX 4AO6A 1VKOA 1FYXA 3P96A 4DDWA 1NVAA 2INGX 2LCFA 1SVMA 2H3EA 1NI4A 3D6FA 1MO4A 1RJ9A