2E50A

Crystal structure of set/taf-1beta/inhat
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
222
structure length
182
Chain Sequence
MSAQAAKVSKKELNSDETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEAMHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHSSKSTEIKWKSGKDMFFTWFTADELGEVIKDDIWPNPLQYYLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Relationship between the structure of SET/TAF-Ibeta/INHAT and its histone chaperone activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Protein SET
total genus 55
structure length 182
sequence length 222
chains with identical sequence B, P, Q
ec nomenclature
pdb deposition date 2006-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00956 NAP Nucleosome assembly protein (NAP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.90 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 2e50A02
3GYVA 5DAYA 3FS3A 3GYWA 2E50A 3HFDA
chains in the Genus database with same CATH superfamily
4X9VA 3FVHA 5DNJA 1E3CP 4O56A 2I9ZA 3C5LA 1Q4OA 1FSUA 4FDJA 3LXQA 4HY2A 4E67A 3P37A 3P2WA 1N2KA 3ED4A 1E33P 4H5XA 1E2SP 2E50A 3GYVA 4FDIA 4HABA 4E9CA 4O9WA 4X9RA 4NKBA 4N7ZA 5J19A 3RQ7A 4CXKA 5AJ9A 3HIKA 4E9DA 5DMVC 1AUKA 3P34A 1E2TA 2VKZG 4YYPA 4WHKA 3Q1IA 2UV8G 5DMSA 4LKMA 4WHLA 3HMJG 3LM3A 4G7NA 1F32A 3P35A 1P49A 1A87A 4J7BB 3P2ZA 4CXSA 3FS3A 4NK7A 2OGQA 4HCOA 1N2LA 2N19A 2IA9A 4CXUA 4XB0A 4N7VA 4O6WA 4N9JA 3KDRA 4WHHA 4LKLA 1UMWA 1HDHA 4H71A 4RCPA 4CYSA 1F34B 5LHZA 3GYWA 4X9WA 1Q4KA 3HFDA 4DFWA 4CYRA 5DAYA 3BZIA 2QZUA 3HIHA 2I9XA 3P36A 4RS6A 2OJXA 1E1ZP
chains in the Genus database with same CATH topology
1E3CP 1P49A 4NKBA 4N7ZA 1HDHA 1FSUA 4FDJA 3LXQA 4CYSA 4CXSA 4CXKA 3FS3A 4NK7A 3GYWA 1N2KA 3HFDA 3ED4A 5AJ9A 1N2LA 1E33P 1AUKA 4CYRA 5DAYA 1E2SP 4CXUA 2QZUA 1E2TA 2E50A 4N7VA 2VKZG 3GYVA 2UV8G 4N9JA 4FDIA 3KDRA 3HMJG 3LM3A 1E1ZP 4G7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYV A;  5DAY A;  3FS3 A;  3GYW A;  2E50 A;  3HFD A; 
#chains in the Genus database with same CATH topology
 4X9V A;  3FVH A;  5DNJ A;  1E3C P;  4O56 A;  2I9Z A;  3C5L A;  1Q4O A;  1FSU A;  4FDJ A;  3LXQ A;  4HY2 A;  4E67 A;  3P37 A;  3P2W A;  1N2K A;  3ED4 A;  1E33 P;  4H5X A;  1E2S P;  2E50 A;  3GYV A;  4FDI A;  4HAB A;  4E9C A;  4O9W A;  4X9R A;  4NKB A;  4N7Z A;  5J19 A;  3RQ7 A;  4CXK A;  5AJ9 A;  3HIK A;  4E9D A;  5DMV C;  1AUK A;  3P34 A;  1E2T A;  2VKZ G;  4YYP A;  4WHK A;  3Q1I A;  2UV8 G;  5DMS A;  4LKM A;  4WHL A;  3HMJ G;  3LM3 A;  4G7N A;  1F32 A;  3P35 A;  1P49 A;  1A87 A;  4J7B B;  3P2Z A;  4CXS A;  3FS3 A;  4NK7 A;  2OGQ A;  4HCO A;  1N2L A;  2N19 A;  2IA9 A;  4CXU A;  4XB0 A;  4N7V A;  4O6W A;  4N9J A;  3KDR A;  4WHH A;  4LKL A;  1UMW A;  1HDH A;  4H71 A;  4RCP A;  4CYS A;  1F34 B;  5LHZ A;  3GYW A;  4X9W A;  1Q4K A;  3HFD A;  4DFW A;  4CYR A;  5DAY A;  3BZI A;  2QZU A;  3HIH A;  2I9X A;  3P36 A;  4RS6 A;  2OJX A;  1E1Z P; 
#chains in the Genus database with same CATH homology
 1E3C P;  1P49 A;  4NKB A;  4N7Z A;  1HDH A;  1FSU A;  4FDJ A;  3LXQ A;  4CYS A;  4CXS A;  4CXK A;  3FS3 A;  4NK7 A;  3GYW A;  1N2K A;  3HFD A;  3ED4 A;  5AJ9 A;  1N2L A;  1E33 P;  1AUK A;  4CYR A;  5DAY A;  1E2S P;  4CXU A;  2QZU A;  1E2T A;  2E50 A;  4N7V A;  2VKZ G;  3GYV A;  2UV8 G;  4N9J A;  4FDI A;  3KDR A;  3HMJ G;  3LM3 A;  1E1Z P;  4G7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...