2E50A

Crystal structure of set/taf-1beta/inhat
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
222
structure length
182
Chain Sequence
b'MSAQAAKVSKKELNSDETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEAMHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHSSKSTEIKWKSGKDMFFTWFTADELGEVIKDDIWPNPLQYYLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein SET
publication title Relationship between the structure of SET/TAF-Ibeta/INHAT and its histone chaperone activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 55
structure length 182
sequence length 222
chains with identical sequence B, P, Q
ec nomenclature
pdb deposition date 2006-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00956 NAP Nucleosome assembly protein (NAP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.90 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 2e50A02
5DAYA 3GYVA 3FS3A 3GYWA 2E50A 3HFDA
chains in the Genus database with same CATH superfamily
4CXKA 4X9WA 4O56A 2UV8G 4RCPA 2OGQA 3HIKA 4HY2A 3Q1IA 2QZUA 4LKLA 3P34A 4XB0A 3LXQA 1F34B 5DMVC 4LKMA 4HABA 4O6WA 2E50A 4FDJA 5J19A 1FSUA 3P36A 4E67A 5AJ9A 5DNJA 4X9VA 4CYSA 4WHKA 5DAYA 1F32A 1A87A 1P49A 1N2LA 3GYVA 4N7VA 1HDHA 3GYWA 2IA9A 1AUKA 4WHHA 3BZIA 4RS6A 3P2ZA 3LM3A 1N2KA 1UMWA 2VKZG 4FDIA 3KDRA 1Q4KA 4G7NA 4CYRA 3HIHA 3P35A 4X9RA 4N7ZA 2OJXA 3C5LA 3FVHA 4NKBA 1Q4OA 4WHLA 2I9ZA 3ED4A 1E2TA 1E1ZP 1E33P 4HCOA 4DFWA 3RQ7A 4N9JA 3HMJG 4J7BB 4E9DA 2I9XA 2N19A 5LHZA 3P2WA 1E3CP 3FS3A 4E9CA 4H71A 4NK7A 4YYPA 4CXUA 5DMSA 1E2SP 4O9WA 4H5XA 3P37A 3HFDA 4CXSA
chains in the Genus database with same CATH topology
1E1ZP 4CXKA 1E33P 1FSUA 5AJ9A 3LM3A 1N2KA 2UV8G 4N9JA 3HMJG 2VKZG 4CYSA 4FDIA 3KDRA 2QZUA 5DAYA 4G7NA 4CYRA 3LXQA 1E3CP 3FS3A 4N7ZA 4NK7A 4NKBA 1P49A 4CXUA 1N2LA 3ED4A 1E2SP 3GYVA 4N7VA 1HDHA 1E2TA 3GYWA 2E50A 3HFDA 4FDJA 4CXSA 1AUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DAY A;  3GYV A;  3FS3 A;  3GYW A;  2E50 A;  3HFD A; 
#chains in the Genus database with same CATH topology
 4CXK A;  4X9W A;  4O56 A;  2UV8 G;  4RCP A;  2OGQ A;  3HIK A;  4HY2 A;  3Q1I A;  2QZU A;  4LKL A;  3P34 A;  4XB0 A;  3LXQ A;  1F34 B;  5DMV C;  4LKM A;  4HAB A;  4O6W A;  2E50 A;  4FDJ A;  5J19 A;  1FSU A;  3P36 A;  4E67 A;  5AJ9 A;  5DNJ A;  4X9V A;  4CYS A;  4WHK A;  5DAY A;  1F32 A;  1A87 A;  1P49 A;  1N2L A;  3GYV A;  4N7V A;  1HDH A;  3GYW A;  2IA9 A;  1AUK A;  4WHH A;  3BZI A;  4RS6 A;  3P2Z A;  3LM3 A;  1N2K A;  1UMW A;  2VKZ G;  4FDI A;  3KDR A;  1Q4K A;  4G7N A;  4CYR A;  3HIH A;  3P35 A;  4X9R A;  4N7Z A;  2OJX A;  3C5L A;  3FVH A;  4NKB A;  1Q4O A;  4WHL A;  2I9Z A;  3ED4 A;  1E2T A;  1E1Z P;  1E33 P;  4HCO A;  4DFW A;  3RQ7 A;  4N9J A;  3HMJ G;  4J7B B;  4E9D A;  2I9X A;  2N19 A;  5LHZ A;  3P2W A;  1E3C P;  3FS3 A;  4E9C A;  4H71 A;  4NK7 A;  4YYP A;  4CXU A;  5DMS A;  1E2S P;  4O9W A;  4H5X A;  3P37 A;  3HFD A;  4CXS A; 
#chains in the Genus database with same CATH homology
 1E1Z P;  4CXK A;  1E33 P;  1FSU A;  5AJ9 A;  3LM3 A;  1N2K A;  2UV8 G;  4N9J A;  3HMJ G;  2VKZ G;  4CYS A;  4FDI A;  3KDR A;  2QZU A;  5DAY A;  4G7N A;  4CYR A;  3LXQ A;  1E3C P;  3FS3 A;  4N7Z A;  4NK7 A;  4NKB A;  1P49 A;  4CXU A;  1N2L A;  3ED4 A;  1E2S P;  3GYV A;  4N7V A;  1HDH A;  1E2T A;  3GYW A;  2E50 A;  3HFD A;  4FDJ A;  4CXS A;  1AUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...