2E5AA

Crystal structure of bovine lipoyltransferase in complex with lipoyl-amp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
343
structure length
329
Chain Sequence
b'GLILQSISNDVYHNLAVEDWIHDHMNLEGKPVLFLWRNSPTVVIGRHQNPWQECNLNLMREEGVKLARRRSGGGTVYHDMGNINLTFFTTKKKYDRMENLKLVVRALKAVHPHLDVQATKRFDLLLDGQFKISGTASKIGRNAAYHHCTLLCGTDGTFLSSLLKSPYQGIRSNATASTPALVKNLMEKDPTLTCEVVINAVATEYATSHQIDNHIHLINPTDETVFPGINSKAIELQTWEWIYGKTPKFSVDTSFTVLHSHVEIKVFIDVKNGRIEVCNIEAPDHWLPLEICDQLNSSLIGSKFSPIETTVDELHSKWNILCEKIKGIM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoyltransferase 1
publication title Crystal structure of bovine Lipoyltransferase in complex with lipoyl-AMP
pubmed doi rcsb
source organism Bos taurus
molecule tags Ligase
total genus 108
structure length 329
sequence length 343
ec nomenclature ec 6.-.-.-:
pdb deposition date 2006-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2e5aA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e5aA01
12ASA 3V7SA 2E64A 4YRNA 1ASZA 2DEQA 1Z7MA 3A7AA 2AKWA 4Q6GA 4ZIBA 3RL6A 1WQ7A 1YFTA 1NJ1A 4RMFA 2PMFA 2E1HA 4TWAA 3E9HA 2RHQB 1RIQA 4P75A 1N5WC 2Q7HA 5KNNA 2HNIA 2XGTA 3VQVA 4PHCA 1B7YA 1SETA 1USYA 3EUB3 3V7RA 1X01A 1N60C 1G5HA 3I7FA 2DXUA 4WJ4A 1BBUA 2ZZGA 4P74A 3HXXA 1X56A 1EVLA 4J15A 3W3SA 2ZT8A 2ARTA 4XEOA 1WYDA 3ETRB 2RHSA 4XTZA 3BJUA 4P3PA 3TEHB 2QHTA 3P8VA 1X55A 3V8LA 2EL9A 4YRRA 4HA8A 1N62C 4ZOHB 1NJ5A 3HY1A 11ASA 4H02A 3A7RA 2DVEA 3A5YA 3VBBA 4CH6A 1EFWA 4WF2A 1B8AA 4TVYA 2EJFA 1H4TA 3MF2A 3HXZA 2AMCA 2QHUA 1Z7NA 4K88A 4TVAA 3LC0A 1ASYA 2ZT5A 4P73C 3HFZA 2ARSA 2DZ9A 2ZZFA 3IKLA 3RF1A 2ODRD 1YFSA 4L87A 1B76A 4P3OA 3OD1A 1JJCB 4KR2A 4YRJA 4CH4A 1FFVC 2ZGWA 2W55A 2I4LA 4CH3A 1EIYA 3P8TA 3RGLA 3AMZA 2P5IA 1YGBA 2QHVA 4YRCA 3ICAA 5C53B 3HRKA 3UGTA 3RKWA 3V7CA 2ALYA 2DU7A 1H4SA 1L0WA 4P71A 4YROA 1NNHA 3DSQA 3HXWA 3P8YA 4H2XB 1B70B 3ERRA 4XEMA 2EAYA 4EX5A 5C51B 1E22A 3PCOB 4HWRA 3LSQA 4YRLA 1ADYA 3NVVB 1GGMA 1H4VB 1G5IA 4CS4A 3HY0A 4EO4A 4O2DA 1N9WA 2IY5B 4XTVA 1C0AA 1X2GA 2CJAA 4H2SA 3TUPA 4H2VA 1SERA 2ZINA 1FFUC 2DKGA 4WJ3M 1WYGA 2W3SA 4DQ2A 1JROA 1VDVA 4P72A 4UP8A 1BIBA 4P75C 4XU3A 1SB3B 3QO5A 3MEYA 4H2WA 5ELNA 2ZZEA 3BFMA 4CH5A 1EOVA 3TEHA 1USYC 2E65A 1B7YB 1NJ6A 1X54A 1N61C 1IL2A 2E3TA 3RACA 4UP7A 3A7UA 3A74A 1NJ2A 3LSSA 2ZT6A 4P74C 4AH6A 4HWPA 1WNLA 2ZXFA 3V8JA 1N63C 5G5GB 2CGHA 4Q15A 4P73A 2Q7EA 3QO7A 2ZNIA 4YRGA 4HWSA 3RUXA 2ZTGA 4YP0A 3QTCA 1E24A 1ZXIC 4KQEA 4E51A 4YDQA 3IALA 2E41A 3MF1A 4H2YA 2J3MA 3HTZA 3QNEA 2DU5A 3A5ZA 4KR3A 1E1OA 2AMCB 2CIMA 3L4GA 1YFRA 2EJ9A 3HFZB 3NS1B 3R07A 2E10A 3AN1A 2FYKA 4DPGA 1G51A 4YRPA 2PMEA 3UFGA 2W3RA 1BIAA 2ZIMA 4XTUA 2C7IA 4HWTA 1N5XA 4XTXA 5G5HB 4YRMA 4K86A 1WLEA 3KFUA 4CS2A 2DXTA 4H2XA 4TVWA 3E9IA 4K87A 3QO8A 1T3QC 3NVWB 4NCXA 3HFVA 4XU0A 5C52B 4ZTUB 2DDZA 3CMQA 2RHQA 4RQFA 1SESA 3SR6B 2ZR2A 2ZR3A 4YCUA 4BWAA 2IY5A 4P71C 3NVYB 1PYSB 1VQZA 1SRYA 3FJPA 1EVKA 4H2UA 1E1TA 1LYLA 1RM6B 1ADJA 3A31A 2Q7GA 3NETA 2ARUA 1FIQB 3WQZA 5E3IA 1H4QA 3NVZB 3M4PA 4YRSA 4OLFA 2AKWB 3HXVA 1KOGA 4CS3A 4XU2A 4YRIA 2QHSA 2I4NA 3B9JB 3NELA 2EWNA 3VQWA 4YYEA 4TQDA 4YRTA 1V97A 2I4MA 5K1PA 1W66A 3NRZB 1KMNA 2ZCEA 3RKXA 2ODRC 2DQ0A 1YB3A 3HRDC 2ZT7A 4LNSA 3VQXA 4P72C 2J3LA 2G4CA 2ZIOA 4XU1A 2DJZA 1J5WA 1HXDA 2W54A 4YRQA 2DZCA 2XTIA 3IKMB 3TEGA 1HC7A 3HRIA 1NYRA 4YCWA 3NENA 2RHSB 2DQ3A 2CJ9A 3EFRA 4WI1A 4UP9A 1ATIA 4BW9A 3REUA 3RKYA 4YPFA 1EQRA 3AM9A 3A32A 3NEMA 5ELOA 2DTOA 1BBWA 2DTHA 4ZTZB 2C8MA 4OP0A 4RQEA 1JJCA 4UPAA 3HXUA 1QE0A 3L1AA 4YREA 4TVAB 2ZNJA 3IG2A 3HXYA 1WQWA 2EJGA 4H2TA 3M4QA 4RDXA 1HTTA 2Q5HA 4HVCA 4TTVA 4XTYA 3V8KA 5HGQA 4YRFA 1KMMA 2E5AA 5F5WA 1FO4A 1NJ8A 4YRKA 1WPYA 3G1ZA 1JRPA 3EFSA 4G84A 3L4GB 1EIYB 3R07C 1B70A 4HWOA 2CJBA 2P0LA 4XTWA 1NYQA 5K1XA 2E3CA 1WU7A 3VQYA 3PCOA 3UH0A 4TQFA 2ALYB 3REXA 1PYSA 4P3NA 1FYFA 4X5OA 1QF6A 2I4OA 3L2ZA 1X2HA 2DTIA 4PG3A 4G85A 4YCVA 3UGQA 2Q5IA 3RIRA 3PZCA
chains in the Genus database with same CATH superfamily
12ASA 3V7SA 4EQRA 2E64A 4HCDA 4YRNA 1ASZA 2DEQA 2NPXA 4H4YA 2V6OA 4H1ZA 1Z7MA 3A7AA 3CK5A 3DJGX 2AKWA 4Q6GA 1H6VA 4ZIBA 3GY1A 1WQ7A 3DJJA 1YFTA 1NJ1A 4RMFA 3RL6A 3RGTA 3EEZA 3UJ2A 2PMFA 2GH5A 2E1HA 5FS7A 1DTNA 4TWAA 3E9HA 4EMJA 2RHQB 1RIQA 3DG7A 3SQSA 4P75A 1N5WC 1XS2A 3QLDA 2Q7HA 2YAUA 5KNNA 2QQ6A 2JK6A 2HNIA 5ENLA 2XGTA 4FI4A 3GRSA 5JCIA 4PHCA 1B7YA 3VQVA 2EQ7A 2OZ3A 2A8EA 3N6HA 1SETA 2XGZA 1USYA 1FEAA 4LA1A 4ADWA 3EUB3 1NELA 2P0IA 3V7RA 1X01A 4LVLA 1N60C 3RCYA 2OFJA 1G5HA 1NHSA 3I7FA 4H4UA 3NO1A 4EWJA 1TYTA 2DXUA 1EC7A 2XH4A 5JCNA 4WJ4A 2RABA 1MOKA 1BBUA 2I5QA 3ZLFA 3ENLA 5JCLA 2X99A 2ZZGA 2TPRA 3HXXA 2PSNA 4P74A 2NS6A 4GRTA 1X56A 3VDGA 1EVLA 3R0UA 3SBFA 4J15A 3W3SA 4K1WA 2ARTA 2ZT8A 1PDYA 2GR3A 4ZCWA 4XEOA 1WYDA 2OLAA 4EMWA 3ETRB 2RHSA 2OZTA 4H4VA 1F8WA 4XTZA 1JPMA 3BJUA 4P3PA 2PU1A 2HQMA 3TEHB 2QHTA 3FG2P 2GR0A 3P8VA 3RNMA 2ZZCA 1X55A 3V8LA 3SSZA 2XH2A 2OVLA 4FDCB 2GGJA 1R6WA 2EL9A 3THUA 3DFHA 4YRRA 3TTEA 2NVKX 4HA8A 1N62C 4ZOHB 4ROPA 1ZK7A 2A8XA 1NJ5A 1S7MA 3HY1A 11ASA 5TR3A 1EBGA 4IT1A 3ES8A 1DNCA 3A7RA 3KLJA 3RO6A 4H02A 4KWSA 4H4ZA 2DVEA 3A5YA 3VBBA 2PCEA 1XANA 4WF2A 4CH6A 1EFWA 1B8AA 3MQTA 4TVYA 2EJFA 1H4TA 3MF2A 3HXZA 2AMCA 4GGHA 3K1GA 3P0WA 2QHUA 1OEPA 4DWDA 1XDIA 3TWAA 1Z7NA 4K88A 4TVAA 3LC0A 1ASYA 1KKRA 3TJIA 2ZT5A 4P73C 1GRTA 4FX9A 3N4EA 3DIPA 2POZA 2ARSA 3HFZA 3CXBA 2OX4A 2DZ9A 3ZLGA 5KVIA 7ENLA 3DGZA 4EM3A 2EQ8A 2ZZFA 3IKLA 3RF1A 2AAQA 2ODRD 1L8PA 1YFSA 4L87A 3IC9A 1Q1RA 2PGEA 2QJJA 3IJLA 2YVFA 3ZVIA 1B76A 3OD1A 1JJCB 4P3OA 4KR2A 4LVJA 3FJ4A 4GIRA 4YRJA 1JDFA 4F4RA 2V3AA 4CH4A 1FFVC 2FYMA 1EC9A 4H4WA 2ZGWA 2W55A 3P93A 2I4LA 3NEMA 4CH3A 1EIYA 3Q4DA 4GFIA 4DNAA 4LVKA 2OQHA 3B97A 3TWBA 3P8TA 3RGLA 4BURA 3SQPA 3PFRA 3AMZA 2P5IA 4MMWA 3H70A 1YGBA 2AL2B 2WOWA 2QHVA 4IHCA 4YRCA 3ICAA 5C53B 2HXTA 3N6JA 3O0HA 3HRKA 3UGTA 1XHCA 3RKWA 2PS2A 2ALYA 3V7CA 2PTWA 2P3ZA 2DU7A 1SJAA 1H4SA 2WPCA 1BQGA 3BJSA 2OG9A 3DK9A 3CAWA 3CGDA 3DK4A 3NXLA 1L0WA 3R1ZA 2ZC8A 4P71A 5FS9A 4YROA 4JN8A 2C3DA 4K7ZA 1NNHA 3DSQA 3HXWA 1GSNA 3U4FA 4BV6A 3MQZA 3P8YA 4H2XB 1SJCA 1B70B 1W6TA 4GGBA 4GISA 2MNRA 4M0XA 5BOFA 3ERRA 3V4BA 4XEMA 5JCMA 2EAYA 1GEUA 1GERA 4ZA0A 3QFBA 1E22A 4EX5A 3PCOB 4HWRA 5C51B 4J57A 3MZNA 3LSQA 1PDZA 1GRAA 4YRLA 1ADYA 4EQWA 3NVVB 1GGMA 1H4VB 3STPA 1G5IA 4CS4A 4E4FA 3HY0A 4EO4A 4O2DA 1N9WA 1MDLA 2GSHA 4H4QA 2IY5B 5FJUA 2PGWA 4XTVA 3MWCA 3V5FA 1NHQA 3Q6JA 2O56A 1C0AA 1FHUA 1X2GA 4H4RA 2CJAA 4H2SA 4E4UA 4LVIA 3TUPA 4H2VA 1SERA 2ZINA 2XH7A 1FFUC 3GD6A 2DKGA 2V3BA 4WJ3M 1WYGA 2W3SA 1BZLA 3DFYA 4KPRA 4DQ2A 1JROA 1VDVA 2GGEA 1MDRA 3GRTA 4P72A 2WPEA 3MSYA 4JN7A 3CYJA 4UP8A 1NDAA 1BIBA 4P75C 5JCKA 4XU3A 1SB3B 3QO5A 3MEYA 2PTYA 3TOYA 4H2WA 4K2SA 5ELNA 4KPLA 1JPDX 2ZZEA 3BFMA 4CH5A 2X50A 4E6MA 4A3RA 1EOVA 3TEHA 1USYC 2E65A 1B7YB 1NJ6A 4Z1YA 1X54A 1N61C 1BKHA 3IJQA 4E8GA 1IL2A 3R25A 2E3TA 3RACA 4UP7A 3A7UA 3A74A 2HXUA 3DDMA 2YVGA 1NJ2A 3LSSA 2OZ8A 2ZT6A 2CDUA 2ONEA 3H7VA 3SN4A 3VA8A 4P74C 4DYEA 2EQ9A 4AH6A 3H12A 3PK7A 3ZVHA 5ER0A 1LPFA 2QDEA 4H2HA 2PP3A 2GDQA 1V59A 4G84A 4HWPA 3UJFA 4K8DA 5EBKA 1WNLA 1XPYA 2ZXFA 2BC1A 3V8JA 1N63C 5G5GB 1DXLA 2PMQA 2CGHA 4Q15A 1Q1WA 3KUMA 3OTRA 3QO7A 4P73A 2Q7EA 2ZNIA 4YRGA 3S47A 4HWSA 1MO9A 5U1OA 4A35A 3RUXA 3RITA 5U25A 2ZTGA 1TZZA 3GD4A 4NEWA 3UJSA 4YP0A 1P48A 3QTCA 2QVHA 3II4A 1E24A 3L5OA 1LVLA 1NPXA 2W0HA 3LB8A 4G7FA 3UCCA 1ZXIC 4KQEA 4E51A 3V3WA 1GETA 4YDQA 4HNCA 3IALA 2E41A 3MF1A 4H2YA 2J3MA 3HTZA 3QNEA 2WP6A 3R0KA 5GRTA 5FJTA 2DU5A 1GV4A 3DH9A 3UJEA 2GQWA 3A5ZA 4KR3A 1E1OA 3JVAA 1ZMCA 2AMCB 4GYPA 2CIMA 4J1OA 1ECQA 1SJBA 3VC5A 3TQPA 1EC8A 5FJRA 4M6UA 4FP1A 1YFRA 1KKOA 3L4GA 4H50A 2EJ9A 4EMIA 3HFZB 1ZY8A 2CFYA 2EQ6A 2AL2A 3NS1B 3R07A 1TYPA 4DN1A 3CB3A 2OKTA 3I6TA 2E10A 3AN1A 2FYKA 4DPGA 3MKCA 4EM4A 3MY9A 1G51A 4YRPA 1R0MA 4H4PA 2PP0A 3S5SA 3VC6A 3IJIA 4DHGA 2PMEA 3UFGA 2W3RA 4IL2A 2HZGA 1BIAA 2J3NA 2ZIMA 4A6GA 2PP1A 4XTUA 3TJ4A 2C7IA 4HWTA 1N5XA 3D46A 2GR2A 4XTXA 5G5HB 1ZMDA 3ZLHA 3OZMA 1WLEA 1FEBA 4K86A 4CS2A 2XSXA 4YRMA 3KFUA 2DXTA 4H4XA 4H2XA 4TVWA 3E9IA 3MUCA 2AKZA 1SJDA 2WOIA 2X8HA 2ZZ0A 3L8KA 5FJPA 1GRHA 3T4WA 4K87A 1D7YA 3QO8A 1FECA 3DEQA 1T3QC 3NVWB 4NCXA 3OZYA 2PTZA 3N4FA 3HFVA 4XU0A 3RRAA 5C52B 3UXKA 2RDXA 2MUCA 4ZTUB 2GRTA 2DDZA 1F9CA 4YWSA 2GL5A 3T9PA 3CMQA 2RHQA 3U9IA 4RQFA 1SESA 3SR6B 3UCDA 4M52A 1GESA 1ONFA 2ZR2A 2ZR3A 1KCZA 3PWGA 1KN0A 3DGHA 4YCUA 5EU9A 4BWAA 4DXKA 4P71C 3CGBA 2IY5A 3NVYB 1ONEA 1PYSB 3JZUA 1VQZA 3SN1A 1SRYA 4H83A 3FJPA 1EVKA 2XH0A 4H2UA 3D47A 3PG6A 4GMEA 1E1TA 1MRAA 3DESA 3HPFA 3DGBA 1LYLA 3UGVA 1RM6B 1ADJA 5FMHA 4X2PA 4GR1A 1ZKQA 3A31A 3I4KA 5BOEA 2PODA 2PTXA 3H4KA 2Q7GA 3NETA 2ARUA 3FYYA 4IP4A 4HCHA 4IL0A 1FIQB 1NHPA 3WQZA 5E3IA 3QPEA 3NVZB 4MKSA 3M4PA 1H4QA 1TE6A 4YRSA 2NQLA 4OLFA 2AKWB 3HXVA 1KOGA 1WUFA 4CS3A 4HYRA 4XU2A 2GGGA 1STZA 5IDZA 4NEVA 2QHSA 4YRIA 1EBDA 3SN0A 2I4NA 3B9JB 2PPGA 3NELA 2EWNA 3VQWA 1E9IA 1ELSA 3FV9A 4YYEA 1FHVA 4TQDA 4YRTA 1V97A 2I4MA 5K1PA 4EQSA 1W66A 3FXGA 3NRZB 1KMNA 2ZCEA 4K8GA 4J3ZA 3FCPA 3RKXA 2WBAA 3R11A 2DQ0A 2ODRC 3HW2A 1K4QA 3HRDC 3SJNA 1YB3A 2ZT7A 2QJMA 1IYXA 3EF6A 5KVHA 1RVKA 4LNSA 4J56A 3VQXA 4P72C 2J3LA 3NZGA 3VFCA 2G4CA 2ZIOA 2OO6A 4XU1A 4JQ9A 5FS8A 2DJZA 2YQUA 4APNA 1J5WA 1HXDA 3GD3A 2W54A 3GC2A 3V5CA 4YRQA 4LVMA 2DZCA 2XTIA 3UXLA 2BC0A 4HCLA 3IKMB 3TEGA 1HC7A 2DW6A 1NYRA 3HRIA 2AL1A 1KD0A 2PU0A 4YCWA 4JDRA 1GRGA 3NENA 2RHSB 2GGHA 3Q45A 4HN8A 2CJ9A 2DQ3A 3EFRA 4WI1A 1JOAA 4UP9A 1ATIA 3QFAA 4BW9A 3OPSA 3REUA 3RKYA 3BOXA 1EBHA 2BCPA 2FKPA 3IK4A 3LXDA 2X8GA 2HNEA 4YPFA 1EQRA 3AM9A 1ZX9A 1GREA 3A32A 3BSMA 2OPJA 4IZGA 3TCSA 4E5TA 4ENLA 1BBWA 3PWIA 2DTHA 2DTOA 5ELOA 4ZTZB 1F3PA 2GR1A 5FJOA 2C8MA 4OP0A 1NU5A 4Z17A 4RQEA 3OP2A 1GRFA 1JJCA 4UPAA 4DX3A 3URHA 1AOGA 1MUCA 3HXUA 3CXOA 1QE0A 3UJRA 3D9XA 2ZZBA 1M6IA 3ZVHB 3DK8A 3L1AA 2AKMA 3P3BA 3CGCA 3H8AA 2QJNA 2QDDA 4YREA 2QAEA 3LADA 3T8QA 3OC4A 4TVAB 2ZNJA 3QN3A 3IG2A 3HXYA 4H4TA 2P88A 1WQWA 2EJGA 1YEYA 4H2TA 3VCCA 2F5ZA 3M4QA 4RDXA 1HTTA 2Q5HA 4HVCA 3EANA 2PA6A 4TTVA 4XTYA 3V8KA 2YVJA 4YRFA 5HGQA 1KMMA 3DG6A 1ZDLA 5FS6A 2CHRA 4G8TA 2E5AA 5F5WA 3FVDA 3QTPA 3CT2A 3JW7A 1NHRA 4EQXA 3DERA 3T6CA 5JRBA 1FO4A 1NJ8A 2P8BA 4H19A 5J04A 3CGEA 4YRKA 4GYPC 3TW9A 1P43A 3QKEA 1WPYA 2WOVA 3G1ZA 1GXFA 4LIIA 1JRPA 4HNLA 2OQYA 2WP5A 4IP5A 4HPNA 2QGYA 1MNSA 3NFUA 4KT2A 3EFSA 2C3CA 3L4GB 2ZADA 3OW1A 3R07C 1B70A 1EIYB 3GO2A 2CJBA 1OJTA 3DG3A 4HWOA 2P0LA 4XTWA 1NYQA 5K1XA 2E3CA 1GRBA 2WPFA 1WU7A 3PCOA 3VQYA 2GGIA 1JCTA 1H2IA 3UH0A 6ENLA 4TQFA 4HT4A 3ES7A 4H4SA 4KEMA 3VCNA 1BWCA 2ALYB 2R9ZA 3REXA 1JEHA 1PYSA 2DW7A 4P3NA 4JHMA 1YQZA 2X8CA 4YWOA 1FYFA 3RR1A 3EAOA 4X5OA 2P8CA 1WUEA 1QF6A 2I4OA 3L2ZA 1X2HA 2DTIA 1TKKA 4PG3A 4G85A 4YCVA 3I6EA 3UGQA 2Q5IA 3EKGA 3R10A 3RIRA 3PZCA 4MGGA
chains in the Genus database with same CATH topology
12ASA 3V7SA 2E64A 4YRNA 1ASZA 2DEQA 1Z7MA 3A7AA 2AKWA 4Q6GA 4ZIBA 3RL6A 1WQ7A 1YFTA 1NJ1A 4RMFA 2PMFA 2E1HA 4TWAA 3E9HA 2RHQB 1RIQA 4P75A 1N5WC 2Q7HA 5KNNA 2HNIA 2XGTA 3VQVA 4PHCA 1B7YA 2A8EA 1SETA 1USYA 3EUB3 3V7RA 1X01A 4LVLA 1N60C 1G5HA 3I7FA 2DXUA 4WJ4A 1BBUA 2ZZGA 4P74A 3HXXA 2NS6A 1X56A 1EVLA 4J15A 3W3SA 2ZT8A 2ARTA 4XEOA 1WYDA 3ETRB 2RHSA 4XTZA 3BJUA 4P3PA 3TEHB 2QHTA 3P8VA 1X55A 3V8LA 2EL9A 4YRRA 4HA8A 1N62C 4ZOHB 1NJ5A 3HY1A 11ASA 4H02A 3A7RA 2DVEA 3A5YA 3VBBA 4CH6A 1EFWA 4WF2A 1B8AA 4TVYA 2EJFA 1H4TA 3MF2A 3HXZA 2AMCA 2QHUA 1Z7NA 4K88A 4TVAA 3LC0A 1ASYA 2ZT5A 4P73C 3HFZA 2ARSA 2DZ9A 2ZZFA 3IKLA 3RF1A 2ODRD 1YFSA 4L87A 1B76A 4P3OA 3OD1A 1JJCB 4KR2A 4LVJA 4YRJA 4CH4A 1FFVC 2ZGWA 2W55A 2I4LA 4CH3A 1EIYA 4LVKA 3P8TA 3RGLA 3AMZA 2P5IA 1YGBA 2QHVA 4YRCA 3ICAA 5C53B 3HRKA 3UGTA 3RKWA 3V7CA 2ALYA 2DU7A 1H4SA 1L0WA 4P71A 4YROA 1NNHA 3DSQA 3HXWA 3P8YA 4H2XB 3MQZA 1B70B 3ERRA 4XEMA 2EAYA 4EX5A 5C51B 1E22A 3PCOB 4HWRA 3LSQA 4YRLA 1ADYA 3NVVB 1GGMA 1H4VB 1G5IA 4CS4A 3HY0A 4EO4A 4O2DA 1N9WA 2IY5B 4XTVA 1C0AA 1X2GA 2CJAA 4H2SA 4LVIA 3TUPA 4H2VA 1SERA 2ZINA 1FFUC 2DKGA 4WJ3M 1WYGA 2W3SA 4DQ2A 1JROA 1VDVA 4P72A 4UP8A 1BIBA 4P75C 4XU3A 1SB3B 3QO5A 3MEYA 4H2WA 5ELNA 2ZZEA 3BFMA 4CH5A 1EOVA 3TEHA 1USYC 2E65A 1B7YB 1NJ6A 1X54A 1N61C 1IL2A 2E3TA 3RACA 4UP7A 3A7UA 3A74A 1NJ2A 3LSSA 2ZT6A 4P74C 4AH6A 4HWPA 1WNLA 2ZXFA 3V8JA 1N63C 5G5GB 2CGHA 4Q15A 4P73A 2Q7EA 3QO7A 2ZNIA 4YRGA 4HWSA 3RUXA 2ZTGA 4YP0A 3QTCA 1E24A 1ZXIC 4KQEA 4E51A 4YDQA 3IALA 2E41A 3MF1A 4H2YA 2J3MA 3HTZA 3QNEA 2DU5A 3A5ZA 4KR3A 1E1OA 2AMCB 2CIMA 3L4GA 1YFRA 2EJ9A 3HFZB 3NS1B 3R07A 2E10A 3AN1A 2FYKA 4DPGA 1G51A 4YRPA 2PMEA 3UFGA 2W3RA 1BIAA 2ZIMA 4XTUA 2C7IA 4HWTA 1N5XA 4XTXA 5G5HB 4YRMA 4K86A 1WLEA 3KFUA 4CS2A 2DXTA 4H2XA 4TVWA 3E9IA 4K87A 3QO8A 1T3QC 3NVWB 4NCXA 3HFVA 4XU0A 5C52B 4ZTUB 2DDZA 3CMQA 2RHQA 4RQFA 1SESA 3SR6B 2ZR2A 2ZR3A 4YCUA 4BWAA 2IY5A 4P71C 3NVYB 1PYSB 1VQZA 1SRYA 3FJPA 1EVKA 4H2UA 1E1TA 1LYLA 1RM6B 1ADJA 3A31A 2Q7GA 3NETA 2ARUA 1FIQB 3WQZA 5E3IA 1H4QA 3NVZB 3M4PA 4YRSA 4OLFA 2AKWB 3HXVA 1KOGA 4CS3A 4XU2A 4YRIA 2QHSA 2I4NA 3B9JB 3NELA 2EWNA 3VQWA 4YYEA 4TQDA 4YRTA 1V97A 2I4MA 5K1PA 1W66A 3NRZB 1KMNA 2ZCEA 3RKXA 2ODRC 2DQ0A 1YB3A 3HRDC 2ZT7A 4LNSA 3VQXA 4P72C 2J3LA 2G4CA 2ZIOA 4XU1A 2DJZA 1J5WA 1HXDA 2W54A 4YRQA 4LVMA 2DZCA 2XTIA 3IKMB 3TEGA 1HC7A 3HRIA 1NYRA 4YCWA 3NENA 2RHSB 2DQ3A 2CJ9A 3EFRA 4WI1A 4UP9A 1ATIA 4BW9A 3REUA 3RKYA 4YPFA 1EQRA 3AM9A 3A32A 3NEMA 5ELOA 2DTOA 1BBWA 2DTHA 4ZTZB 2C8MA 4OP0A 4RQEA 1JJCA 4UPAA 3HXUA 1QE0A 3L1AA 4YREA 4TVAB 2ZNJA 3IG2A 3HXYA 1WQWA 2EJGA 4H2TA 3M4QA 4RDXA 1HTTA 2Q5HA 4HVCA 4TTVA 4XTYA 3V8KA 5HGQA 4YRFA 1KMMA 2E5AA 5F5WA 1FO4A 1NJ8A 4YRKA 1WPYA 3G1ZA 1JRPA 3EFSA 4G84A 3L4GB 1EIYB 3R07C 1B70A 4HWOA 2CJBA 2P0LA 4XTWA 1NYQA 5K1XA 2E3CA 1WU7A 3VQYA 3PCOA 3UH0A 4TQFA 4HT4A 2ALYB 3REXA 1PYSA 4P3NA 1FYFA 4X5OA 1QF6A 2I4OA 3L2ZA 1X2HA 2DTIA 4PG3A 4G85A 4YCVA 3UGQA 2Q5IA 3RIRA 3PZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 12AS A;  3V7S A;  2E64 A;  4YRN A;  1ASZ A;  2DEQ A;  1Z7M A;  3A7A A;  2AKW A;  4Q6G A;  4ZIB A;  3RL6 A;  1WQ7 A;  1YFT A;  1NJ1 A;  4RMF A;  2PMF A;  2E1H A;  4TWA A;  3E9H A;  2RHQ B;  1RIQ A;  4P75 A;  1N5W C;  2Q7H A;  5KNN A;  2HNI A;  2XGT A;  3VQV A;  4PHC A;  1B7Y A;  1SET A;  1USY A;  3EUB 3;  3V7R A;  1X01 A;  1N60 C;  1G5H A;  3I7F A;  2DXU A;  4WJ4 A;  1BBU A;  2ZZG A;  4P74 A;  3HXX A;  1X56 A;  1EVL A;  4J15 A;  3W3S A;  2ZT8 A;  2ART A;  4XEO A;  1WYD A;  3ETR B;  2RHS A;  4XTZ A;  3BJU A;  4P3P A;  3TEH B;  2QHT A;  3P8V A;  1X55 A;  3V8L A;  2EL9 A;  4YRR A;  4HA8 A;  1N62 C;  4ZOH B;  1NJ5 A;  3HY1 A;  11AS A;  4H02 A;  3A7R A;  2DVE A;  3A5Y A;  3VBB A;  4CH6 A;  1EFW A;  4WF2 A;  1B8A A;  4TVY A;  2EJF A;  1H4T A;  3MF2 A;  3HXZ A;  2AMC A;  2QHU A;  1Z7N A;  4K88 A;  4TVA A;  3LC0 A;  1ASY A;  2ZT5 A;  4P73 C;  3HFZ A;  2ARS A;  2DZ9 A;  2ZZF A;  3IKL A;  3RF1 A;  2ODR D;  1YFS A;  4L87 A;  1B76 A;  4P3O A;  3OD1 A;  1JJC B;  4KR2 A;  4YRJ A;  4CH4 A;  1FFV C;  2ZGW A;  2W55 A;  2I4L A;  4CH3 A;  1EIY A;  3P8T A;  3RGL A;  3AMZ A;  2P5I A;  1YGB A;  2QHV A;  4YRC A;  3ICA A;  5C53 B;  3HRK A;  3UGT A;  3RKW A;  3V7C A;  2ALY A;  2DU7 A;  1H4S A;  1L0W A;  4P71 A;  4YRO A;  1NNH A;  3DSQ A;  3HXW A;  3P8Y A;  4H2X B;  1B70 B;  3ERR A;  4XEM A;  2EAY A;  4EX5 A;  5C51 B;  1E22 A;  3PCO B;  4HWR A;  3LSQ A;  4YRL A;  1ADY A;  3NVV B;  1GGM A;  1H4V B;  1G5I A;  4CS4 A;  3HY0 A;  4EO4 A;  4O2D A;  1N9W A;  2IY5 B;  4XTV A;  1C0A A;  1X2G A;  2CJA A;  4H2S A;  3TUP A;  4H2V A;  1SER A;  2ZIN A;  1FFU C;  2DKG A;  4WJ3 M;  1WYG A;  2W3S A;  4DQ2 A;  1JRO A;  1VDV A;  4P72 A;  4UP8 A;  1BIB A;  4P75 C;  4XU3 A;  1SB3 B;  3QO5 A;  3MEY A;  4H2W A;  5ELN A;  2ZZE A;  3BFM A;  4CH5 A;  1EOV A;  3TEH A;  1USY C;  2E65 A;  1B7Y B;  1NJ6 A;  1X54 A;  1N61 C;  1IL2 A;  2E3T A;  3RAC A;  4UP7 A;  3A7U A;  3A74 A;  1NJ2 A;  3LSS A;  2ZT6 A;  4P74 C;  4AH6 A;  4HWP A;  1WNL A;  2ZXF A;  3V8J A;  1N63 C;  5G5G B;  2CGH A;  4Q15 A;  4P73 A;  2Q7E A;  3QO7 A;  2ZNI A;  4YRG A;  4HWS A;  3RUX A;  2ZTG A;  4YP0 A;  3QTC A;  1E24 A;  1ZXI C;  4KQE A;  4E51 A;  4YDQ A;  3IAL A;  2E41 A;  3MF1 A;  4H2Y A;  2J3M A;  3HTZ A;  3QNE A;  2DU5 A;  3A5Z A;  4KR3 A;  1E1O A;  2AMC B;  2CIM A;  3L4G A;  1YFR A;  2EJ9 A;  3HFZ B;  3NS1 B;  3R07 A;  2E10 A;  3AN1 A;  2FYK A;  4DPG A;  1G51 A;  4YRP A;  2PME A;  3UFG A;  2W3R A;  1BIA A;  2ZIM A;  4XTU A;  2C7I A;  4HWT A;  1N5X A;  4XTX A;  5G5H B;  4YRM A;  4K86 A;  1WLE A;  3KFU A;  4CS2 A;  2DXT A;  4H2X A;  4TVW A;  3E9I A;  4K87 A;  3QO8 A;  1T3Q C;  3NVW B;  4NCX A;  3HFV A;  4XU0 A;  5C52 B;  4ZTU B;  2DDZ A;  3CMQ A;  2RHQ A;  4RQF A;  1SES A;  3SR6 B;  2ZR2 A;  2ZR3 A;  4YCU A;  4BWA A;  2IY5 A;  4P71 C;  3NVY B;  1PYS B;  1VQZ A;  1SRY A;  3FJP A;  1EVK A;  4H2U A;  1E1T A;  1LYL A;  1RM6 B;  1ADJ A;  3A31 A;  2Q7G A;  3NET A;  2ARU A;  1FIQ B;  3WQZ A;  5E3I A;  1H4Q A;  3NVZ B;  3M4P A;  4YRS A;  4OLF A;  2AKW B;  3HXV A;  1KOG A;  4CS3 A;  4XU2 A;  4YRI A;  2QHS A;  2I4N A;  3B9J B;  3NEL A;  2EWN A;  3VQW A;  4YYE A;  4TQD A;  4YRT A;  1V97 A;  2I4M A;  5K1P A;  1W66 A;  3NRZ B;  1KMN A;  2ZCE A;  3RKX A;  2ODR C;  2DQ0 A;  1YB3 A;  3HRD C;  2ZT7 A;  4LNS A;  3VQX A;  4P72 C;  2J3L A;  2G4C A;  2ZIO A;  4XU1 A;  2DJZ A;  1J5W A;  1HXD A;  2W54 A;  4YRQ A;  2DZC A;  2XTI A;  3IKM B;  3TEG A;  1HC7 A;  3HRI A;  1NYR A;  4YCW A;  3NEN A;  2RHS B;  2DQ3 A;  2CJ9 A;  3EFR A;  4WI1 A;  4UP9 A;  1ATI A;  4BW9 A;  3REU A;  3RKY A;  4YPF A;  1EQR A;  3AM9 A;  3A32 A;  3NEM A;  5ELO A;  2DTO A;  1BBW A;  2DTH A;  4ZTZ B;  2C8M A;  4OP0 A;  4RQE A;  1JJC A;  4UPA A;  3HXU A;  1QE0 A;  3L1A A;  4YRE A;  4TVA B;  2ZNJ A;  3IG2 A;  3HXY A;  1WQW A;  2EJG A;  4H2T A;  3M4Q A;  4RDX A;  1HTT A;  2Q5H A;  4HVC A;  4TTV A;  4XTY A;  3V8K A;  5HGQ A;  4YRF A;  1KMM A;  2E5A A;  5F5W A;  1FO4 A;  1NJ8 A;  4YRK A;  1WPY A;  3G1Z A;  1JRP A;  3EFS A;  4G84 A;  3L4G B;  1EIY B;  3R07 C;  1B70 A;  4HWO A;  2CJB A;  2P0L A;  4XTW A;  1NYQ A;  5K1X A;  2E3C A;  1WU7 A;  3VQY A;  3PCO A;  3UH0 A;  4TQF A;  2ALY B;  3REX A;  1PYS A;  4P3N A;  1FYF A;  4X5O A;  1QF6 A;  2I4O A;  3L2Z A;  1X2H A;  2DTI A;  4PG3 A;  4G85 A;  4YCV A;  3UGQ A;  2Q5I A;  3RIR A;  3PZC A; 
#chains in the Genus database with same CATH topology
 12AS A;  3V7S A;  4EQR A;  2E64 A;  4HCD A;  4YRN A;  1ASZ A;  2DEQ A;  2NPX A;  4H4Y A;  2V6O A;  4H1Z A;  1Z7M A;  3A7A A;  3CK5 A;  3DJG X;  2AKW A;  4Q6G A;  1H6V A;  4ZIB A;  3GY1 A;  1WQ7 A;  3DJJ A;  1YFT A;  1NJ1 A;  4RMF A;  3RL6 A;  3RGT A;  3EEZ A;  3UJ2 A;  2PMF A;  2GH5 A;  2E1H A;  5FS7 A;  1DTN A;  4TWA A;  3E9H A;  4EMJ A;  2RHQ B;  1RIQ A;  3DG7 A;  3SQS A;  4P75 A;  1N5W C;  1XS2 A;  3QLD A;  2Q7H A;  2YAU A;  5KNN A;  2QQ6 A;  2JK6 A;  2HNI A;  5ENL A;  2XGT A;  4FI4 A;  3GRS A;  5JCI A;  4PHC A;  1B7Y A;  3VQV A;  2EQ7 A;  2OZ3 A;  2A8E A;  3N6H A;  1SET A;  2XGZ A;  1USY A;  1FEA A;  4LA1 A;  4ADW A;  3EUB 3;  1NEL A;  2P0I A;  3V7R A;  1X01 A;  4LVL A;  1N60 C;  3RCY A;  2OFJ A;  1G5H A;  1NHS A;  3I7F A;  4H4U A;  3NO1 A;  4EWJ A;  1TYT A;  2DXU A;  1EC7 A;  2XH4 A;  5JCN A;  4WJ4 A;  2RAB A;  1MOK A;  1BBU A;  2I5Q A;  3ZLF A;  3ENL A;  5JCL A;  2X99 A;  2ZZG A;  2TPR A;  3HXX A;  2PSN A;  4P74 A;  2NS6 A;  4GRT A;  1X56 A;  3VDG A;  1EVL A;  3R0U A;  3SBF A;  4J15 A;  3W3S A;  4K1W A;  2ART A;  2ZT8 A;  1PDY A;  2GR3 A;  4ZCW A;  4XEO A;  1WYD A;  2OLA A;  4EMW A;  3ETR B;  2RHS A;  2OZT A;  4H4V A;  1F8W A;  4XTZ A;  1JPM A;  3BJU A;  4P3P A;  2PU1 A;  2HQM A;  3TEH B;  2QHT A;  3FG2 P;  2GR0 A;  3P8V A;  3RNM A;  2ZZC A;  1X55 A;  3V8L A;  3SSZ A;  2XH2 A;  2OVL A;  4FDC B;  2GGJ A;  1R6W A;  2EL9 A;  3THU A;  3DFH A;  4YRR A;  3TTE A;  2NVK X;  4HA8 A;  1N62 C;  4ZOH B;  4ROP A;  1ZK7 A;  2A8X A;  1NJ5 A;  1S7M A;  3HY1 A;  11AS A;  5TR3 A;  1EBG A;  4IT1 A;  3ES8 A;  1DNC A;  3A7R A;  3KLJ A;  3RO6 A;  4H02 A;  4KWS A;  4H4Z A;  2DVE A;  3A5Y A;  3VBB A;  2PCE A;  1XAN A;  4WF2 A;  4CH6 A;  1EFW A;  1B8A A;  3MQT A;  4TVY A;  2EJF A;  1H4T A;  3MF2 A;  3HXZ A;  2AMC A;  4GGH A;  3K1G A;  3P0W A;  2QHU A;  1OEP A;  4DWD A;  1XDI A;  3TWA A;  1Z7N A;  4K88 A;  4TVA A;  3LC0 A;  1ASY A;  1KKR A;  3TJI A;  2ZT5 A;  4P73 C;  1GRT A;  4FX9 A;  3N4E A;  3DIP A;  2POZ A;  2ARS A;  3HFZ A;  3CXB A;  2OX4 A;  2DZ9 A;  3ZLG A;  5KVI A;  7ENL A;  3DGZ A;  4EM3 A;  2EQ8 A;  2ZZF A;  3IKL A;  3RF1 A;  2AAQ A;  2ODR D;  1L8P A;  1YFS A;  4L87 A;  3IC9 A;  1Q1R A;  2PGE A;  2QJJ A;  3IJL A;  2YVF A;  3ZVI A;  1B76 A;  3OD1 A;  1JJC B;  4P3O A;  4KR2 A;  4LVJ A;  3FJ4 A;  4GIR A;  4YRJ A;  1JDF A;  4F4R A;  2V3A A;  4CH4 A;  1FFV C;  2FYM A;  1EC9 A;  4H4W A;  2ZGW A;  2W55 A;  3P93 A;  2I4L A;  3NEM A;  4CH3 A;  1EIY A;  3Q4D A;  4GFI A;  4DNA A;  4LVK A;  2OQH A;  3B97 A;  3TWB A;  3P8T A;  3RGL A;  4BUR A;  3SQP A;  3PFR A;  3AMZ A;  2P5I A;  4MMW A;  3H70 A;  1YGB A;  2AL2 B;  2WOW A;  2QHV A;  4IHC A;  4YRC A;  3ICA A;  5C53 B;  2HXT A;  3N6J A;  3O0H A;  3HRK A;  3UGT A;  1XHC A;  3RKW A;  2PS2 A;  2ALY A;  3V7C A;  2PTW A;  2P3Z A;  2DU7 A;  1SJA A;  1H4S A;  2WPC A;  1BQG A;  3BJS A;  2OG9 A;  3DK9 A;  3CAW A;  3CGD A;  3DK4 A;  3NXL A;  1L0W A;  3R1Z A;  2ZC8 A;  4P71 A;  5FS9 A;  4YRO A;  4JN8 A;  2C3D A;  4K7Z A;  1NNH A;  3DSQ A;  3HXW A;  1GSN A;  3U4F A;  4BV6 A;  3MQZ A;  3P8Y A;  4H2X B;  1SJC A;  1B70 B;  1W6T A;  4GGB A;  4GIS A;  2MNR A;  4M0X A;  5BOF A;  3ERR A;  3V4B A;  4XEM A;  5JCM A;  2EAY A;  1GEU A;  1GER A;  4ZA0 A;  3QFB A;  1E22 A;  4EX5 A;  3PCO B;  4HWR A;  5C51 B;  4J57 A;  3MZN A;  3LSQ A;  1PDZ A;  1GRA A;  4YRL A;  1ADY A;  4EQW A;  3NVV B;  1GGM A;  1H4V B;  3STP A;  1G5I A;  4CS4 A;  4E4F A;  3HY0 A;  4EO4 A;  4O2D A;  1N9W A;  1MDL A;  2GSH A;  4H4Q A;  2IY5 B;  5FJU A;  2PGW A;  4XTV A;  3MWC A;  3V5F A;  1NHQ A;  3Q6J A;  2O56 A;  1C0A A;  1FHU A;  1X2G A;  4H4R A;  2CJA A;  4H2S A;  4E4U A;  4LVI A;  3TUP A;  4H2V A;  1SER A;  2ZIN A;  2XH7 A;  1FFU C;  3GD6 A;  2DKG A;  2V3B A;  4WJ3 M;  1WYG A;  2W3S A;  1BZL A;  3DFY A;  4KPR A;  4DQ2 A;  1JRO A;  1VDV A;  2GGE A;  1MDR A;  3GRT A;  4P72 A;  2WPE A;  3MSY A;  4JN7 A;  3CYJ A;  4UP8 A;  1NDA A;  1BIB A;  4P75 C;  5JCK A;  4XU3 A;  1SB3 B;  3QO5 A;  3MEY A;  2PTY A;  3TOY A;  4H2W A;  4K2S A;  5ELN A;  4KPL A;  1JPD X;  2ZZE A;  3BFM A;  4CH5 A;  2X50 A;  4E6M A;  4A3R A;  1EOV A;  3TEH A;  1USY C;  2E65 A;  1B7Y B;  1NJ6 A;  4Z1Y A;  1X54 A;  1N61 C;  1BKH A;  3IJQ A;  4E8G A;  1IL2 A;  3R25 A;  2E3T A;  3RAC A;  4UP7 A;  3A7U A;  3A74 A;  2HXU A;  3DDM A;  2YVG A;  1NJ2 A;  3LSS A;  2OZ8 A;  2ZT6 A;  2CDU A;  2ONE A;  3H7V A;  3SN4 A;  3VA8 A;  4P74 C;  4DYE A;  2EQ9 A;  4AH6 A;  3H12 A;  3PK7 A;  3ZVH A;  5ER0 A;  1LPF A;  2QDE A;  4H2H A;  2PP3 A;  2GDQ A;  1V59 A;  4G84 A;  4HWP A;  3UJF A;  4K8D A;  5EBK A;  1WNL A;  1XPY A;  2ZXF A;  2BC1 A;  3V8J A;  1N63 C;  5G5G B;  1DXL A;  2PMQ A;  2CGH A;  4Q15 A;  1Q1W A;  3KUM A;  3OTR A;  3QO7 A;  4P73 A;  2Q7E A;  2ZNI A;  4YRG A;  3S47 A;  4HWS A;  1MO9 A;  5U1O A;  4A35 A;  3RUX A;  3RIT A;  5U25 A;  2ZTG A;  1TZZ A;  3GD4 A;  4NEW A;  3UJS A;  4YP0 A;  1P48 A;  3QTC A;  2QVH A;  3II4 A;  1E24 A;  3L5O A;  1LVL A;  1NPX A;  2W0H A;  3LB8 A;  4G7F A;  3UCC A;  1ZXI C;  4KQE A;  4E51 A;  3V3W A;  1GET A;  4YDQ A;  4HNC A;  3IAL A;  2E41 A;  3MF1 A;  4H2Y A;  2J3M A;  3HTZ A;  3QNE A;  2WP6 A;  3R0K A;  5GRT A;  5FJT A;  2DU5 A;  1GV4 A;  3DH9 A;  3UJE A;  2GQW A;  3A5Z A;  4KR3 A;  1E1O A;  3JVA A;  1ZMC A;  2AMC B;  4GYP A;  2CIM A;  4J1O A;  1ECQ A;  1SJB A;  3VC5 A;  3TQP A;  1EC8 A;  5FJR A;  4M6U A;  4FP1 A;  1YFR A;  1KKO A;  3L4G A;  4H50 A;  2EJ9 A;  4EMI A;  3HFZ B;  1ZY8 A;  2CFY A;  2EQ6 A;  2AL2 A;  3NS1 B;  3R07 A;  1TYP A;  4DN1 A;  3CB3 A;  2OKT A;  3I6T A;  2E10 A;  3AN1 A;  2FYK A;  4DPG A;  3MKC A;  4EM4 A;  3MY9 A;  1G51 A;  4YRP A;  1R0M A;  4H4P A;  2PP0 A;  3S5S A;  3VC6 A;  3IJI A;  4DHG A;  2PME A;  3UFG A;  2W3R A;  4IL2 A;  2HZG A;  1BIA A;  2J3N A;  2ZIM A;  4A6G A;  2PP1 A;  4XTU A;  3TJ4 A;  2C7I A;  4HWT A;  1N5X A;  3D46 A;  2GR2 A;  4XTX A;  5G5H B;  1ZMD A;  3ZLH A;  3OZM A;  1WLE A;  1FEB A;  4K86 A;  4CS2 A;  2XSX A;  4YRM A;  3KFU A;  2DXT A;  4H4X A;  4H2X A;  4TVW A;  3E9I A;  3MUC A;  2AKZ A;  1SJD A;  2WOI A;  2X8H A;  2ZZ0 A;  3L8K A;  5FJP A;  1GRH A;  3T4W A;  4K87 A;  1D7Y A;  3QO8 A;  1FEC A;  3DEQ A;  1T3Q C;  3NVW B;  4NCX A;  3OZY A;  2PTZ A;  3N4F A;  3HFV A;  4XU0 A;  3RRA A;  5C52 B;  3UXK A;  2RDX A;  2MUC A;  4ZTU B;  2GRT A;  2DDZ A;  1F9C A;  4YWS A;  2GL5 A;  3T9P A;  3CMQ A;  2RHQ A;  3U9I A;  4RQF A;  1SES A;  3SR6 B;  3UCD A;  4M52 A;  1GES A;  1ONF A;  2ZR2 A;  2ZR3 A;  1KCZ A;  3PWG A;  1KN0 A;  3DGH A;  4YCU A;  5EU9 A;  4BWA A;  4DXK A;  4P71 C;  3CGB A;  2IY5 A;  3NVY B;  1ONE A;  1PYS B;  3JZU A;  1VQZ A;  3SN1 A;  1SRY A;  4H83 A;  3FJP A;  1EVK A;  2XH0 A;  4H2U A;  3D47 A;  3PG6 A;  4GME A;  1E1T A;  1MRA A;  3DES A;  3HPF A;  3DGB A;  1LYL A;  3UGV A;  1RM6 B;  1ADJ A;  5FMH A;  4X2P A;  4GR1 A;  1ZKQ A;  3A31 A;  3I4K A;  5BOE A;  2POD A;  2PTX A;  3H4K A;  2Q7G A;  3NET A;  2ARU A;  3FYY A;  4IP4 A;  4HCH A;  4IL0 A;  1FIQ B;  1NHP A;  3WQZ A;  5E3I A;  3QPE A;  3NVZ B;  4MKS A;  3M4P A;  1H4Q A;  1TE6 A;  4YRS A;  2NQL A;  4OLF A;  2AKW B;  3HXV A;  1KOG A;  1WUF A;  4CS3 A;  4HYR A;  4XU2 A;  2GGG A;  1STZ A;  5IDZ A;  4NEV A;  2QHS A;  4YRI A;  1EBD A;  3SN0 A;  2I4N A;  3B9J B;  2PPG A;  3NEL A;  2EWN A;  3VQW A;  1E9I A;  1ELS A;  3FV9 A;  4YYE A;  1FHV A;  4TQD A;  4YRT A;  1V97 A;  2I4M A;  5K1P A;  4EQS A;  1W66 A;  3FXG A;  3NRZ B;  1KMN A;  2ZCE A;  4K8G A;  4J3Z A;  3FCP A;  3RKX A;  2WBA A;  3R11 A;  2DQ0 A;  2ODR C;  3HW2 A;  1K4Q A;  3HRD C;  3SJN A;  1YB3 A;  2ZT7 A;  2QJM A;  1IYX A;  3EF6 A;  5KVH A;  1RVK A;  4LNS A;  4J56 A;  3VQX A;  4P72 C;  2J3L A;  3NZG A;  3VFC A;  2G4C A;  2ZIO A;  2OO6 A;  4XU1 A;  4JQ9 A;  5FS8 A;  2DJZ A;  2YQU A;  4APN A;  1J5W A;  1HXD A;  3GD3 A;  2W54 A;  3GC2 A;  3V5C A;  4YRQ A;  4LVM A;  2DZC A;  2XTI A;  3UXL A;  2BC0 A;  4HCL A;  3IKM B;  3TEG A;  1HC7 A;  2DW6 A;  1NYR A;  3HRI A;  2AL1 A;  1KD0 A;  2PU0 A;  4YCW A;  4JDR A;  1GRG A;  3NEN A;  2RHS B;  2GGH A;  3Q45 A;  4HN8 A;  2CJ9 A;  2DQ3 A;  3EFR A;  4WI1 A;  1JOA A;  4UP9 A;  1ATI A;  3QFA A;  4BW9 A;  3OPS A;  3REU A;  3RKY A;  3BOX A;  1EBH A;  2BCP A;  2FKP A;  3IK4 A;  3LXD A;  2X8G A;  2HNE A;  4YPF A;  1EQR A;  3AM9 A;  1ZX9 A;  1GRE A;  3A32 A;  3BSM A;  2OPJ A;  4IZG A;  3TCS A;  4E5T A;  4ENL A;  1BBW A;  3PWI A;  2DTH A;  2DTO A;  5ELO A;  4ZTZ B;  1F3P A;  2GR1 A;  5FJO A;  2C8M A;  4OP0 A;  1NU5 A;  4Z17 A;  4RQE A;  3OP2 A;  1GRF A;  1JJC A;  4UPA A;  4DX3 A;  3URH A;  1AOG A;  1MUC A;  3HXU A;  3CXO A;  1QE0 A;  3UJR A;  3D9X A;  2ZZB A;  1M6I A;  3ZVH B;  3DK8 A;  3L1A A;  2AKM A;  3P3B A;  3CGC A;  3H8A A;  2QJN A;  2QDD A;  4YRE A;  2QAE A;  3LAD A;  3T8Q A;  3OC4 A;  4TVA B;  2ZNJ A;  3QN3 A;  3IG2 A;  3HXY A;  4H4T A;  2P88 A;  1WQW A;  2EJG A;  1YEY A;  4H2T A;  3VCC A;  2F5Z A;  3M4Q A;  4RDX A;  1HTT A;  2Q5H A;  4HVC A;  3EAN A;  2PA6 A;  4TTV A;  4XTY A;  3V8K A;  2YVJ A;  4YRF A;  5HGQ A;  1KMM A;  3DG6 A;  1ZDL A;  5FS6 A;  2CHR A;  4G8T A;  2E5A A;  5F5W A;  3FVD A;  3QTP A;  3CT2 A;  3JW7 A;  1NHR A;  4EQX A;  3DER A;  3T6C A;  5JRB A;  1FO4 A;  1NJ8 A;  2P8B A;  4H19 A;  5J04 A;  3CGE A;  4YRK A;  4GYP C;  3TW9 A;  1P43 A;  3QKE A;  1WPY A;  2WOV A;  3G1Z A;  1GXF A;  4LII A;  1JRP A;  4HNL A;  2OQY A;  2WP5 A;  4IP5 A;  4HPN A;  2QGY A;  1MNS A;  3NFU A;  4KT2 A;  3EFS A;  2C3C A;  3L4G B;  2ZAD A;  3OW1 A;  3R07 C;  1B70 A;  1EIY B;  3GO2 A;  2CJB A;  1OJT A;  3DG3 A;  4HWO A;  2P0L A;  4XTW A;  1NYQ A;  5K1X A;  2E3C A;  1GRB A;  2WPF A;  1WU7 A;  3PCO A;  3VQY A;  2GGI A;  1JCT A;  1H2I A;  3UH0 A;  6ENL A;  4TQF A;  4HT4 A;  3ES7 A;  4H4S A;  4KEM A;  3VCN A;  1BWC A;  2ALY B;  2R9Z A;  3REX A;  1JEH A;  1PYS A;  2DW7 A;  4P3N A;  4JHM A;  1YQZ A;  2X8C A;  4YWO A;  1FYF A;  3RR1 A;  3EAO A;  4X5O A;  2P8C A;  1WUE A;  1QF6 A;  2I4O A;  3L2Z A;  1X2H A;  2DTI A;  1TKK A;  4PG3 A;  4G85 A;  4YCV A;  3I6E A;  3UGQ A;  2Q5I A;  3EKG A;  3R10 A;  3RIR A;  3PZC A;  4MGG A; 
#chains in the Genus database with same CATH homology
 12AS A;  3V7S A;  2E64 A;  4YRN A;  1ASZ A;  2DEQ A;  1Z7M A;  3A7A A;  2AKW A;  4Q6G A;  4ZIB A;  3RL6 A;  1WQ7 A;  1YFT A;  1NJ1 A;  4RMF A;  2PMF A;  2E1H A;  4TWA A;  3E9H A;  2RHQ B;  1RIQ A;  4P75 A;  1N5W C;  2Q7H A;  5KNN A;  2HNI A;  2XGT A;  3VQV A;  4PHC A;  1B7Y A;  2A8E A;  1SET A;  1USY A;  3EUB 3;  3V7R A;  1X01 A;  4LVL A;  1N60 C;  1G5H A;  3I7F A;  2DXU A;  4WJ4 A;  1BBU A;  2ZZG A;  4P74 A;  3HXX A;  2NS6 A;  1X56 A;  1EVL A;  4J15 A;  3W3S A;  2ZT8 A;  2ART A;  4XEO A;  1WYD A;  3ETR B;  2RHS A;  4XTZ A;  3BJU A;  4P3P A;  3TEH B;  2QHT A;  3P8V A;  1X55 A;  3V8L A;  2EL9 A;  4YRR A;  4HA8 A;  1N62 C;  4ZOH B;  1NJ5 A;  3HY1 A;  11AS A;  4H02 A;  3A7R A;  2DVE A;  3A5Y A;  3VBB A;  4CH6 A;  1EFW A;  4WF2 A;  1B8A A;  4TVY A;  2EJF A;  1H4T A;  3MF2 A;  3HXZ A;  2AMC A;  2QHU A;  1Z7N A;  4K88 A;  4TVA A;  3LC0 A;  1ASY A;  2ZT5 A;  4P73 C;  3HFZ A;  2ARS A;  2DZ9 A;  2ZZF A;  3IKL A;  3RF1 A;  2ODR D;  1YFS A;  4L87 A;  1B76 A;  4P3O A;  3OD1 A;  1JJC B;  4KR2 A;  4LVJ A;  4YRJ A;  4CH4 A;  1FFV C;  2ZGW A;  2W55 A;  2I4L A;  4CH3 A;  1EIY A;  4LVK A;  3P8T A;  3RGL A;  3AMZ A;  2P5I A;  1YGB A;  2QHV A;  4YRC A;  3ICA A;  5C53 B;  3HRK A;  3UGT A;  3RKW A;  3V7C A;  2ALY A;  2DU7 A;  1H4S A;  1L0W A;  4P71 A;  4YRO A;  1NNH A;  3DSQ A;  3HXW A;  3P8Y A;  4H2X B;  3MQZ A;  1B70 B;  3ERR A;  4XEM A;  2EAY A;  4EX5 A;  5C51 B;  1E22 A;  3PCO B;  4HWR A;  3LSQ A;  4YRL A;  1ADY A;  3NVV B;  1GGM A;  1H4V B;  1G5I A;  4CS4 A;  3HY0 A;  4EO4 A;  4O2D A;  1N9W A;  2IY5 B;  4XTV A;  1C0A A;  1X2G A;  2CJA A;  4H2S A;  4LVI A;  3TUP A;  4H2V A;  1SER A;  2ZIN A;  1FFU C;  2DKG A;  4WJ3 M;  1WYG A;  2W3S A;  4DQ2 A;  1JRO A;  1VDV A;  4P72 A;  4UP8 A;  1BIB A;  4P75 C;  4XU3 A;  1SB3 B;  3QO5 A;  3MEY A;  4H2W A;  5ELN A;  2ZZE A;  3BFM A;  4CH5 A;  1EOV A;  3TEH A;  1USY C;  2E65 A;  1B7Y B;  1NJ6 A;  1X54 A;  1N61 C;  1IL2 A;  2E3T A;  3RAC A;  4UP7 A;  3A7U A;  3A74 A;  1NJ2 A;  3LSS A;  2ZT6 A;  4P74 C;  4AH6 A;  4HWP A;  1WNL A;  2ZXF A;  3V8J A;  1N63 C;  5G5G B;  2CGH A;  4Q15 A;  4P73 A;  2Q7E A;  3QO7 A;  2ZNI A;  4YRG A;  4HWS A;  3RUX A;  2ZTG A;  4YP0 A;  3QTC A;  1E24 A;  1ZXI C;  4KQE A;  4E51 A;  4YDQ A;  3IAL A;  2E41 A;  3MF1 A;  4H2Y A;  2J3M A;  3HTZ A;  3QNE A;  2DU5 A;  3A5Z A;  4KR3 A;  1E1O A;  2AMC B;  2CIM A;  3L4G A;  1YFR A;  2EJ9 A;  3HFZ B;  3NS1 B;  3R07 A;  2E10 A;  3AN1 A;  2FYK A;  4DPG A;  1G51 A;  4YRP A;  2PME A;  3UFG A;  2W3R A;  1BIA A;  2ZIM A;  4XTU A;  2C7I A;  4HWT A;  1N5X A;  4XTX A;  5G5H B;  4YRM A;  4K86 A;  1WLE A;  3KFU A;  4CS2 A;  2DXT A;  4H2X A;  4TVW A;  3E9I A;  4K87 A;  3QO8 A;  1T3Q C;  3NVW B;  4NCX A;  3HFV A;  4XU0 A;  5C52 B;  4ZTU B;  2DDZ A;  3CMQ A;  2RHQ A;  4RQF A;  1SES A;  3SR6 B;  2ZR2 A;  2ZR3 A;  4YCU A;  4BWA A;  2IY5 A;  4P71 C;  3NVY B;  1PYS B;  1VQZ A;  1SRY A;  3FJP A;  1EVK A;  4H2U A;  1E1T A;  1LYL A;  1RM6 B;  1ADJ A;  3A31 A;  2Q7G A;  3NET A;  2ARU A;  1FIQ B;  3WQZ A;  5E3I A;  1H4Q A;  3NVZ B;  3M4P A;  4YRS A;  4OLF A;  2AKW B;  3HXV A;  1KOG A;  4CS3 A;  4XU2 A;  4YRI A;  2QHS A;  2I4N A;  3B9J B;  3NEL A;  2EWN A;  3VQW A;  4YYE A;  4TQD A;  4YRT A;  1V97 A;  2I4M A;  5K1P A;  1W66 A;  3NRZ B;  1KMN A;  2ZCE A;  3RKX A;  2ODR C;  2DQ0 A;  1YB3 A;  3HRD C;  2ZT7 A;  4LNS A;  3VQX A;  4P72 C;  2J3L A;  2G4C A;  2ZIO A;  4XU1 A;  2DJZ A;  1J5W A;  1HXD A;  2W54 A;  4YRQ A;  4LVM A;  2DZC A;  2XTI A;  3IKM B;  3TEG A;  1HC7 A;  3HRI A;  1NYR A;  4YCW A;  3NEN A;  2RHS B;  2DQ3 A;  2CJ9 A;  3EFR A;  4WI1 A;  4UP9 A;  1ATI A;  4BW9 A;  3REU A;  3RKY A;  4YPF A;  1EQR A;  3AM9 A;  3A32 A;  3NEM A;  5ELO A;  2DTO A;  1BBW A;  2DTH A;  4ZTZ B;  2C8M A;  4OP0 A;  4RQE A;  1JJC A;  4UPA A;  3HXU A;  1QE0 A;  3L1A A;  4YRE A;  4TVA B;  2ZNJ A;  3IG2 A;  3HXY A;  1WQW A;  2EJG A;  4H2T A;  3M4Q A;  4RDX A;  1HTT A;  2Q5H A;  4HVC A;  4TTV A;  4XTY A;  3V8K A;  5HGQ A;  4YRF A;  1KMM A;  2E5A A;  5F5W A;  1FO4 A;  1NJ8 A;  4YRK A;  1WPY A;  3G1Z A;  1JRP A;  3EFS A;  4G84 A;  3L4G B;  1EIY B;  3R07 C;  1B70 A;  4HWO A;  2CJB A;  2P0L A;  4XTW A;  1NYQ A;  5K1X A;  2E3C A;  1WU7 A;  3VQY A;  3PCO A;  3UH0 A;  4TQF A;  4HT4 A;  2ALY B;  3REX A;  1PYS A;  4P3N A;  1FYF A;  4X5O A;  1QF6 A;  2I4O A;  3L2Z A;  1X2H A;  2DTI A;  4PG3 A;  4G85 A;  4YCV A;  3UGQ A;  2Q5I A;  3RIR A;  3PZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...