2E5AA

Crystal structure of bovine lipoyltransferase in complex with lipoyl-amp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
343
structure length
329
Chain Sequence
GLILQSISNDVYHNLAVEDWIHDHMNLEGKPVLFLWRNSPTVVIGRHQNPWQECNLNLMREEGVKLARRRSGGGTVYHDMGNINLTFFTTKKKYDRMENLKLVVRALKAVHPHLDVQATKRFDLLLDGQFKISGTASKIGRNAAYHHCTLLCGTDGTFLSSLLKSPYQGIRSNATASTPALVKNLMEKDPTLTCEVVINAVATEYATSHQIDNHIHLINPTDETVFPGINSKAIELQTWEWIYGKTPKFSVDTSFTVLHSHVEIKVFIDVKNGRIEVCNIEAPDHWLPLEICDQLNSSLIGSKFSPIETTVDELHSKWNILCEKIKGIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of bovine Lipoyltransferase in complex with lipoyl-AMP
pubmed doi rcsb
source organism Bos taurus
molecule tags Ligase
molecule keywords Lipoyltransferase 1
total genus 108
structure length 329
sequence length 343
ec nomenclature ec 6.-.-.-:
pdb deposition date 2006-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2e5aA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e5aA01
2ZINA 4ZOHB 4P71A 4WJ4A 4YRMA 3PCOB 4HVCA 4YRSA 1SETA 3NRZB 1E1TA 4CH6A 4XTWA 4YYEA 1BIBA 2ZIOA 1GGMA 2ZR3A 5KNNA 1HXDA 4UP8A 4DQ2A 4UPAA 3PZCA 4OP0A 1FFUC 4DPGA 2W3SA 1HC7A 2P5IA 2ODRC 4H2XB 3REUA 1N62C 1L0WA 5G5GB 1RM6B 3NVYB 4P75A 2QHTA 4TQDA 1ZXIC 2E5AA 5C52B 4YDQA 3RIRA 1LYLA 1WQWA 3E9IA 1NJ2A 1H4QA 4TTVA 3UGQA 2CJAA 1JRPA 2IY5B 4L87A 4XTYA 3NS1B 2ZNIA 4O2DA 11ASA 2G4CA 1WU7A 4YROA 1H4SA 1YGBA 4P72C 4XU2A 4P73A 4XU1A 4CH3A 4H2XA 1NYQA 4YP0A 3HRKA 1Z7MA 4CS4A 3NVVB 2J3MA 3RUXA 4P74A 1JJCA 3IG2A 3A74A 3RL6A 4RQFA 3V7RA 1G5HA 2DQ0A 3HRDC 4YRPA 1NJ8A 2CIMA 3PCOA 4YCWA 3M4PA 2E3TA 3P8VA 1FO4A 2CGHA 1WLEA 2ZIMA 2QHVA 2IY5A 3G1ZA 3V8LA 4AH6A 2ZT5A 4YRKA 2ZT6A 2ZNJA 5E3IA 2QHSA 2P0LA 2E1HA 4CH5A 1ATIA 2RHSB 4EO4A 3TUPA 3RACA 3NENA 2PMEA 2RHSA 5ELNA 1E24A 3I7FA 3R07C 1E1OA 4XEMA 1IL2A 3BJUA 3UH0A 5K1PA 3AMZA 2EJ9A 4YRTA 3QO8A 3CMQA 2DXTA 2I4OA 3W3SA 3VQXA 4KQEA 2FYKA 4XU0A 3V8KA 5F5WA 3RKYA 2ZR2A 12ASA 1NJ6A 1ADYA 1WQ7A 4TVYA 3TEHA 1JJCB 4P3PA 3L4GB 3V7SA 2ZTGA 4YRFA 3SR6B 1X55A 4TVWA 2ZZFA 3QNEA 4XTZA 1PYSA 3V7CA 5HGQA 1EQRA 4H02A 4H2VA 3HXXA 4J15A 1QF6A 4PHCA 2RHQA 1EIYB 1JROA 3HXVA 4H2SA 4ZTZB 4XU3A 1EIYA 4Q6GA 1B70A 5C51B 3RKWA 3AN1A 3NVWB 2AMCA 4YRNA 3HRIA 2HNIA 4K88A 4XTXA 2ZXFA 2ZCEA 3A31A 4YREA 3TEGA 1H4TA 2I4MA 1YB3A 2AKWA 3EUB3 3EFRA 4WJ3M 2DU5A 2DTOA 1B7YA 3A5ZA 3VQYA 3MF1A 1SRYA 3ETRB 2EWNA 4H2WA 1B70B 4RQEA 3V8JA 1ASYA 1E22A 1KOGA 3LSSA 2I4NA 4H2YA 2RHQB 1V97A 3HFZB 3MF2A 1X54A 3REXA 1WNLA 4CS2A 2ALYB 3M4QA 4PG3A 1PYSB 3NETA 4P72A 2PMFA 4K87A 3IALA 1WYGA 3L2ZA 1NNHA 1N5WC 4RMFA 4HWSA 4P3NA 3VQVA 1ADJA 5C53B 4XTUA 3A5YA 1N61C 3OD1A 4H2TA 4YRCA 1T3QC 3HFVA 2E65A 3HTZA 5ELOA 1QE0A 2Q7EA 2E41A 2E10A 3ERRA 4ZTUB 4RDXA 1WYDA 3HY0A 1G51A 4HA8A 2DJZA 2QHUA 4YRJA 1VDVA 2XTIA 3R07A 1X56A 1H4VB 4YRIA 2E64A 4G85A 3VBBA 1C0AA 4BWAA 3LC0A 1NJ5A 2DQ3A 4TVAA 1SERA 3DSQA 4HWOA 1G5IA 1NYRA 3QO5A 2CJ9A 1SESA 4ZIBA 1N5XA 2DDZA 3UGTA 2DEQA 5G5HB 2ARSA 4YCUA 1B76A 4NCXA 1EVLA 2ZGWA 2C8MA 1BBUA 4HWRA 4H2UA 4P71C 2AKWB 2ARTA 2EL9A 3WQZA 1ASZA 4KR3A 1Z7NA 4EX5A 2DZ9A 2ZT8A 3QO7A 1FYFA 1YFRA 3A32A 3HY1A 4LNSA 4XTVA 4YPFA 1X01A 1BIAA 2ALYA 2W3RA 3QTCA 2XGTA 1EVKA 1EOVA 3HFZA 3NVZB 3FJPA 3A7RA 3E9HA 2I4LA 1B8AA 3NEMA 2EAYA 3P8YA 3KFUA 4K86A 3A7AA 2ARUA 4TWAA 2DTIA 3RKXA 2DVEA 3L4GA 4G84A 3NELA 4YRQA 3HXUA 1N63C 1N60C 1FFVC 1USYC 3AM9A 4P73C 2DU7A 2ZZEA 2J3LA 4CH4A 1NJ1A 3B9JB 4Q15A 3HXWA 3IKMB 4YRLA 4OLFA 4P3OA 4P74C 1SB3B 3P8TA 1VQZA 4CS3A 1BBWA 4YRRA 4X5OA 3LSQA 2Q7GA 3HXZA 4HWTA 4TVAB 1W66A 3VQWA 2EJGA 4WI1A 3UFGA 4WF2A 1KMMA 4YCVA 2W54A 3RGLA 2E3CA 1YFTA 3L1AA 2CJBA 1B7YB 2ODRD 3A7UA 1J5WA 4XEOA 3TEHB 1EFWA 2EJFA 3BFMA 3IKLA 3MEYA 1RIQA 2ZZGA 2ZT7A 3EFSA 2Q5IA 4KR2A 1WPYA 4BW9A 2DKGA 4P75C 2Q7HA 4UP7A 1HTTA 4YRGA 2AMCB 2C7IA 2W55A 3RF1A 2DZCA 2DTHA 1KMNA 1USYA 4TQFA 2DXUA 1YFSA 2Q5HA 4HWPA 1X2HA 4UP9A 4E51A 5K1XA 1FIQB 1N9WA 1X2GA 3HXYA 3ICAA
chains in the Genus database with same CATH superfamily
2ZINA 3N6HA 4ZOHB 4P71A 4WJ4A 2JK6A 3CGBA 4A35A 2EQ7A 3QFAA 4YRMA 3PCOB 3NZGA 3DGHA 2GGGA 1RVKA 3GY1A 3TTEA 4HVCA 4YRSA 2PS2A 4LVIA 2PMQA 1SETA 3NRZB 3ES8A 1E1TA 4CH6A 1GESA 4XTWA 2GGJA 1BIBA 4YYEA 4ZCWA 2ZIOA 1GGMA 5FS7A 2ZR3A 3T8QA 5KNNA 1HXDA 4UP8A 3MQZA 4DQ2A 4UPAA 2PTYA 1JPMA 3PZCA 4OP0A 3P93A 1FFUC 3DG7A 1EBDA 3DFHA 3BSMA 4DPGA 2W3SA 1HC7A 1ONFA 2QVHA 3FYYA 2P5IA 2WOWA 2ODRC 3R0UA 4M0XA 3SN0A 4H2XB 4ADWA 3UXKA 4EWJA 3REUA 3DEQA 3DG6A 3DJJA 3URHA 4MGGA 1N62C 3N4FA 5G5GB 1GRTA 1RM6B 3NVYB 3RR1A 1SJBA 2POZA 1L0WA 3IJIA 4IP4A 4P75A 1GERA 1JCTA 1ZXIC 2P8CA 3DH9A 3OW1A 3QFBA 5FS6A 2QHTA 2E5AA 5C52B 4YDQA 4YWSA 2HXUA 3RIRA 2ZZ0A 1LYLA 2PSNA 1MRAA 2V6OA 3L8KA 1NJ2A 3DK9A 1WQWA 2X8CA 1OEPA 3E9IA 4TTVA 4EQRA 3R1ZA 1H4QA 3UGQA 2CJAA 1JRPA 1NHQA 3U9IA 2IY5B 3DK4A 3II4A 3P3BA 2OZTA 1TYTA 2V3AA 3CGCA 1ZY8A 3UJFA 4DN1A 3NS1B 4L87A 4XTYA 2ZNIA 4O2DA 1F3PA 1KCZA 3H7VA 11ASA 4NEWA 2X99A 4FDCB 4BURA 2G4CA 1WU7A 3N6JA 4GR1A 3FG2P 4GYPC 1NPXA 4YROA 1H4SA 4H4QA 1DNCA 1GRAA 3TOYA 2HXTA 5FS9A 1BZLA 3NXLA 1YGBA 1ZDLA 4P72C 3I6TA 4XU2A 4P73A 4XU1A 2OLAA 2X50A 4CH3A 4H2XA 2GSHA 1NYQA 3CXOA 4K8GA 4YP0A 3HRKA 4Z17A 4TQDA 2ONEA 1Z7MA 1ONEA 4CS4A 3NVVB 2J3MA 4Z1YA 3RUXA 3VC6A 4P74A 2QDDA 1TYPA 5FJTA 5ELNA 1R0MA 1JJCA 3IG2A 3V4BA 3VDGA 3A74A 3PWIA 1LPFA 3RL6A 1F8WA 4RQFA 2GR0A 3EKGA 1YEYA 4K8DA 1FEBA 5FMHA 3V7RA 4MKSA 1G5HA 2DQ0A 2MNRA 3HRDC 4YRPA 4KPRA 1ECQA 3O0HA 4E5TA 3U4FA 1NJ8A 2CIMA 3TJ4A 2OZ3A 4H4UA 3KUMA 3ZLFA 3PCOA 4YCWA 2P3ZA 1GEUA 3M4PA 2E3TA 4EMJA 4HPNA 3P8VA 3FJ4A 1FO4A 2CGHA 1WLEA 4FX9A 2ZIMA 2QHVA 2IY5A 3G1ZA 3MZNA 2OO6A 3V8LA 4AH6A 2ZT5A 4YRKA 3JVAA 5JCLA 4K2SA 2ZT6A 2ZNJA 5E3IA 2NQLA 2OQYA 4ROPA 2QHSA 2PGWA 2P0LA 2E1HA 4CH5A 1ATIA 2RHSB 4EO4A 4LVMA 4H4ZA 4H4TA 3NENA 2PMEA 2RHSA 3RACA 2CFYA 4JHMA 1E24A 2GRTA 2MUCA 3VCNA 1E9IA 3R07C 3I7FA 3R0KA 1E1OA 4XEMA 2HZGA 1IL2A 3BJUA 3IC9A 3UH0A 5K1PA 2GL5A 3PFRA 1TKKA 3AMZA 4HNCA 2EJ9A 4YRTA 2YVGA 5JCNA 3H8AA 3QO8A 3CMQA 2DXTA 1GRGA 2I4OA 3JW7A 5IDZA 3W3SA 5JCIA 3VQXA 3H4KA 4KQEA 2FYKA 3SN1A 5JCMA 1JPDX 3CYJA 4H4RA 4E4FA 4XU0A 3V8KA 5F5WA 2GR3A 3RKYA 1TZZA 2R9ZA 2F5ZA 2GR2A 2ZR2A 12ASA 4EM4A 3JZUA 1NJ6A 5FS8A 1ADYA 3MQTA 1WQ7A 4TVYA 2GH5A 3TEHA 2XGZA 2RDXA 1JJCB 4P3PA 4H4PA 2WPCA 3L4GB 3V7SA 2ZTGA 4YRFA 1DTNA 4IT1A 3SR6B 1X55A 4TVWA 2ZZFA 3QNEA 4XTZA 4IP5A 3MWCA 4LIIA 3ZVHA 1KN0A 1PYSA 3V7CA 2PPGA 5HGQA 1EQRA 4H02A 1JEHA 4JN8A 4H2VA 1XANA 1WUEA 3TCSA 3HXXA 4J15A 4X2PA 2HNEA 4HCLA 5GRTA 1QF6A 4PHCA 2RHQA 1EIYB 4IHCA 2XH2A 1JROA 3HXVA 4H2SA 4ZTZB 5EBKA 3GD4A 4XU3A 2A8EA 5EU9A 3R10A 4EM3A 4H4XA 1EIYA 2AKZA 3MKCA 4Q6GA 2HQMA 1B70A 3HPFA 1F9CA 5C51B 3RKWA 3AN1A 3NVWB 2AMCA 4YRNA 1EBHA 3HRIA 2X8HA 1V59A 3ZVHB 3FV9A 2HNIA 4K88A 2XSXA 1ZMDA 4XTXA 1SJDA 2ZXFA 2ZCEA 2BC1A 2PTWA 4FP1A 3S47A 3A31A 3VA8A 1XDIA 2WOIA 3GO2A 4YREA 5JCKA 3RCYA 3VFCA 3DESA 3TEGA 1GRBA 1H4TA 3NO1A 3UCDA 4G7FA 4ZA0A 2OFJA 2I4MA 1YB3A 2AKWA 3EUB3 3EFRA 4GRTA 4WJ3M 2DU5A 2DTOA 4FI4A 1B7YA 3A5ZA 3DGZA 3B97A 3NFUA 4GIRA 3UJSA 3MF1A 3VQYA 1D7YA 2PGEA 2OQHA 3ETRB 1SRYA 4JN7A 2EWNA 4H2WA 3TUPA 1IYXA 4J3ZA 1B70B 4J57A 3RO6A 3H70A 3V8JA 3UJEA 4RQEA 1ASYA 1E22A 1KD0A 1MO9A 2ZZCA 1BQGA 3CK5A 5BOFA 1KOGA 3LSSA 5FJRA 3IJQA 2I4NA 1Q1WA 2RHQB 4H2YA 1V97A 3HFZB 3MF2A 2A8XA 1X54A 3REXA 1XS2A 3QKEA 1WNLA 1EC9A 4CS2A 1NHSA 2ALYB 3CGEA 3M4QA 4PG3A 4JDRA 1PYSB 4H19A 3NETA 3SJNA 4KWSA 3IJLA 6ENLA 2PMFA 4P72A 3CXBA 3D46A 4GISA 4K87A 3IALA 1WYGA 3EANA 2OVLA 3L2ZA 1NNHA 3FXGA 4DXKA 1N5WC 3DFYA 2PTXA 4RMFA 4HWSA 3TWAA 2PTZA 4P3NA 2PP1A 4KT2A 2YVJA 3VQVA 4YWOA 5ENLA 3V5CA 1GXFA 1ADJA 2I5QA 2GGIA 5C53B 1GETA 1M6IA 2GGEA 1TE6A 2NPXA 4XTUA 3EAOA 2W0HA 3GRSA 1N61C 3A5YA 1EC8A 3OD1A 4H2TA 2P0IA 4YRCA 4LVLA 4F4RA 1T3QC 3HFVA 2E65A 4HCHA 3SQPA 3HTZA 3SSZA 2FYMA 3Q45A 5ELOA 2AL1A 1AOGA 1QE0A 2Q7EA 2E41A 2E10A 2YQUA 3ERRA 4ZTUB 2YVFA 4RDXA 1WYDA 3DK8A 3HY0A 1GV4A 1G51A 4HA8A 2XH7A 5KVIA 2EQ8A 1W6TA 4M6UA 4EMIA 2DJZA 2QHUA 4YRJA 4A6GA 3OTRA 1VDVA 2XTIA 3R07A 1ELSA 2QQ6A 1X56A 3CB3A 3QN3A 1H4VB 3CT2A 3PK7A 4YRIA 2DW6A 3DIPA 2E64A 4G85A 3VBBA 1C0AA 3ZLHA 4BWAA 2EQ9A 3LC0A 1NJ5A 4KPLA 2DQ3A 4ENLA 4TVAA 1SERA 3DSQA 1WUFA 3RRAA 2BCPA 4HWOA 4H4SA 1G5IA 1NYRA 2QDEA 3QO5A 2V3BA 4J1OA 2CJ9A 1KKRA 3OP2A 3V3WA 5KVHA 2OZ8A 1SESA 3L5OA 4HYRA 3VCCA 3SBFA 3GD6A 3P0WA 3ENLA 4IZGA 2C3DA 1H6VA 3MY9A 3CAWA 1N5XA 4ZIBA 2PU0A 2DDZA 3SQSA 3UGTA 3UGVA 2DEQA 4H4YA 5G5HB 2ARSA 1MDRA 1MUCA 1PDZA 4YCUA 1B76A 4E4UA 4HNLA 4EQWA 4NCXA 3RITA 1EVLA 2ZGWA 2OG9A 3BOXA 1NHPA 2RABA 4E8GA 1BBUA 2C8MA 4H2UA 4HWRA 4P71C 2WOVA 2AKWB 2ARTA 2EL9A 4IL0A 4EMWA 3BJSA 3WQZA 1ASZA 4KR3A 1Z7NA 4EX5A 2DZ9A 2EQ6A 3UCCA 2ZT8A 1STZA 3KLJA 4H4WA 1MOKA 3ES7A 5FJUA 3QO7A 4DX3A 4EQXA 3N4EA 3Q6JA 7ENLA 2FKPA 1BWCA 1FYFA 3UJ2A 3OC4A 3THUA 1YFRA 3A32A 3HY1A 4LNSA 1FECA 4XTVA 4YPFA 4GGBA 1X01A 1BIAA 5BOEA 5ER0A 2ALYA 2W3RA 2QJNA 1MDLA 2BC0A 2C3CA 1NU5A 4BV6A 4E6MA 2XGTA 3QTCA 2YAUA 4EQSA 1BKHA 4HCDA 1EVKA 1EOVA 3HFZA 3DDMA 3NVZB 2PP3A 3FJPA 4MMWA 3A7RA 2XH0A 1GREA 3E9HA 4APNA 2I4LA 2GDQA 4DNAA 1B8AA 3NEMA 1L8PA 3T6CA 3GC2A 2EAYA 3STPA 2GQWA 3P8YA 3DJGX 2WPEA 3OZMA 3DG3A 1GRHA 4K86A 3KFUA 3A7AA 3I6EA 5U1OA 2ARUA 4TWAA 5FJPA 3TJIA 1P43A 2DTIA 3H12A 3QLDA 4H50A 3LADA 1GRFA 3DERA 3RKXA 2DVEA 3L4GA 4G84A 3NELA 2AL2B 4M52A 3R25A 4YRQA 3PWGA 1JOAA 4LVJA 1JDFA 3D47A 2OKTA 3QPEA 5FJOA 3HXUA 1N63C 3FCPA 1N60C 1FFVC 1USYC 3AM9A 4H1ZA 1ZX9A 2AAQA 2NS6A 4P73C 1LVLA 3S5SA 1OJTA 2CHRA 2O56A 2DU7A 3TQPA 2OPJA 2ZZEA 2J3LA 4CH4A 4NEVA 3PG6A 1NJ1A 3Q4DA 3B9JB 5TR3A 1K4QA 1KKOA 4Q15A 3GD3A 3VC5A 3T9PA 3TW9A 4IL2A 1XHCA 4GYPA 3UXLA 2OX4A 2PP0A 3HXWA 1XPYA 2QGYA 2QJJA 2J3NA 3OZYA 3IKMB 4YRLA 5JRBA 3RGTA 3HW2A 2PODA 4J56A 3K1GA 3LXDA 4OLFA 4P3OA 4P74C 1SB3B 3P8TA 1VQZA 4JQ9A 1FEAA 4CS3A 2DW7A 1R6WA 1BBWA 1P48A 1FHVA 4X5OA 4YRRA 3D9XA 2ZZBA 1PDYA 3LSQA 3QTPA 2Q7GA 2WPFA 4H2HA 3HXZA 4HWTA 3GRTA 4TVAB 1W66A 3VQWA 1Q1RA 2EJGA 3DGBA 4WI1A 3ZVIA 3UFGA 4WF2A 3I4KA 1SJAA 2QAEA 1EBGA 1KMMA 4YCVA 3FVDA 3MUCA 2X8GA 4DHGA 2W54A 4DYEA 2E3CA 1ZKQA 3R11A 4A3RA 1YFTA 3LB8A 3RGLA 1H2IA 4G8TA 3UJRA 2GGHA 2CJBA 3L1AA 1B7YB 3T4WA 2ODRD 1YQZA 2QJMA 3MSYA 4GGHA 1GSNA 3A7UA 4H4VA 1J5WA 4XEOA 3TEHB 1EFWA 2PCEA 2ZADA 2EJFA 1NDAA 1ZK7A 4KEMA 2WP5A 2P8BA 4K1WA 3BFMA 3SN4A 2AL2A 1MNSA 2NVKX 3ZLGA 3IKLA 1SJCA 4K7ZA 1RIQA 2CDUA 2ZZGA 3MEYA 1DXLA 2ZT7A 2WP6A 3EFSA 1FHUA 2XH4A 2Q5IA 4KR2A 1WPYA 4BW9A 2DKGA 4GMEA 3V5FA 2Q7HA 4P75C 4UP7A 1HTTA 4YRGA 2AMCB 2C7IA 4H83A 3RNMA 2W55A 3RF1A 4LVKA 5U25A 2DZCA 3CGDA 1S7MA 2PU1A 3IK4A 2DTHA 3OPSA 1KMNA 5J04A 1USYA 2WBAA 4LA1A 2DXUA 1ZMCA 1YFSA 2Q5HA 4TQFA 4HWPA 1X2HA 3EF6A 4UP9A 1EC7A 2TPRA 1NELA 2PA6A 4HT4A 3TWBA 4E51A 4GFIA 5K1XA 1NHRA 2GR1A 1FIQB 4DWDA 1X2GA 1N9WA 3HXYA 3ICAA 2AKMA 4HN8A 3EEZA 2ZC8A 2P88A
chains in the Genus database with same CATH topology
2ZINA 4ZOHB 4P71A 4WJ4A 4YRMA 3PCOB 4HVCA 4YRSA 4LVIA 1SETA 3NRZB 1E1TA 4CH6A 4XTWA 4YYEA 1BIBA 2ZIOA 1GGMA 2ZR3A 5KNNA 1HXDA 4UP8A 3MQZA 4DQ2A 4UPAA 3PZCA 4OP0A 1FFUC 4DPGA 2W3SA 1HC7A 2P5IA 2ODRC 4H2XB 3REUA 1N62C 1L0WA 5G5GB 1RM6B 3NVYB 4P75A 2QHTA 4TQDA 1ZXIC 2E5AA 5C52B 4YDQA 3RIRA 1LYLA 1WQWA 3E9IA 1NJ2A 1H4QA 4TTVA 3UGQA 2CJAA 1JRPA 2IY5B 4L87A 4XTYA 3NS1B 2ZNIA 4O2DA 11ASA 2G4CA 1WU7A 4YROA 1H4SA 1YGBA 4P72C 4XU2A 4P73A 4XU1A 4CH3A 4H2XA 1NYQA 4YP0A 3HRKA 1Z7MA 4CS4A 3NVVB 2J3MA 3RUXA 4P74A 1JJCA 3IG2A 3A74A 3RL6A 4RQFA 3V7RA 1G5HA 2DQ0A 3HRDC 4YRPA 1NJ8A 2CIMA 3PCOA 4YCWA 3M4PA 2E3TA 3P8VA 1FO4A 2CGHA 1WLEA 2ZIMA 2QHVA 2IY5A 3G1ZA 3V8LA 4AH6A 2ZT5A 4YRKA 2ZT6A 2ZNJA 5E3IA 2QHSA 2P0LA 2E1HA 4CH5A 1ATIA 2RHSB 4EO4A 4LVMA 3RACA 3TUPA 3NENA 2PMEA 2RHSA 5ELNA 1E24A 3I7FA 3R07C 1E1OA 4XEMA 1IL2A 3BJUA 3UH0A 5K1PA 3AMZA 2EJ9A 4YRTA 3QO8A 3CMQA 2DXTA 2I4OA 3W3SA 3VQXA 4KQEA 2FYKA 4XU0A 3V8KA 5F5WA 3RKYA 2ZR2A 12ASA 1NJ6A 1ADYA 1WQ7A 4TVYA 3TEHA 1JJCB 4P3PA 3L4GB 3V7SA 2ZTGA 4YRFA 3SR6B 1X55A 4TVWA 2ZZFA 3QNEA 4XTZA 1PYSA 3V7CA 5HGQA 1EQRA 4H02A 4H2VA 3HXXA 4J15A 1QF6A 4PHCA 2RHQA 1EIYB 1JROA 3HXVA 4H2SA 4ZTZB 4XU3A 2A8EA 1EIYA 4Q6GA 1B70A 5C51B 3RKWA 3AN1A 3NVWB 2AMCA 4YRNA 3HRIA 2HNIA 4K88A 4XTXA 2ZXFA 2ZCEA 3A31A 4YREA 3TEGA 1H4TA 2I4MA 1YB3A 2AKWA 3EUB3 3EFRA 4WJ3M 2DU5A 2DTOA 1B7YA 3A5ZA 3VQYA 3MF1A 1SRYA 3ETRB 2EWNA 4H2WA 1B70B 4RQEA 3V8JA 1ASYA 1E22A 1KOGA 3LSSA 2I4NA 4H2YA 2RHQB 1V97A 3HFZB 3MF2A 1X54A 3REXA 1WNLA 4CS2A 2ALYB 3M4QA 4PG3A 1PYSB 3NETA 4P72A 2PMFA 4K87A 3IALA 1WYGA 3L2ZA 1NNHA 1N5WC 4RMFA 4HWSA 4P3NA 3VQVA 1ADJA 5C53B 4XTUA 3A5YA 1N61C 3OD1A 4H2TA 4LVLA 4YRCA 1T3QC 3HFVA 2E65A 3HTZA 5ELOA 1QE0A 2Q7EA 2E41A 2E10A 3ERRA 4ZTUB 4RDXA 1WYDA 3HY0A 1G51A 4HA8A 2DJZA 2QHUA 4YRJA 1VDVA 2XTIA 3R07A 1X56A 1H4VB 4YRIA 2E64A 4G85A 3VBBA 1C0AA 4BWAA 3LC0A 1NJ5A 2DQ3A 4TVAA 1SERA 3DSQA 4HWOA 1G5IA 1NYRA 3QO5A 2CJ9A 1SESA 4ZIBA 1N5XA 2DDZA 3UGTA 2DEQA 5G5HB 2ARSA 4YCUA 1B76A 4NCXA 1EVLA 2ZGWA 2C8MA 1BBUA 4HWRA 4H2UA 4P71C 2AKWB 2ARTA 2EL9A 3WQZA 1ASZA 4KR3A 1Z7NA 4EX5A 2DZ9A 2ZT8A 3QO7A 1FYFA 1YFRA 3A32A 3HY1A 4LNSA 4XTVA 4YPFA 1X01A 1BIAA 2ALYA 2W3RA 3QTCA 2XGTA 1EVKA 1EOVA 3HFZA 3NVZB 3FJPA 3A7RA 3E9HA 2I4LA 1B8AA 3NEMA 2EAYA 3P8YA 3KFUA 4K86A 3A7AA 2ARUA 4TWAA 2DTIA 3RKXA 2DVEA 3L4GA 4G84A 3NELA 4YRQA 4LVJA 3HXUA 1N63C 1N60C 1FFVC 1USYC 3AM9A 2NS6A 4P73C 2DU7A 2ZZEA 2J3LA 4CH4A 1NJ1A 3B9JB 4Q15A 3HXWA 3IKMB 4YRLA 4OLFA 4P3OA 4P74C 1SB3B 3P8TA 1VQZA 4CS3A 1BBWA 4YRRA 4X5OA 3LSQA 2Q7GA 3HXZA 4HWTA 4TVAB 1W66A 3VQWA 2EJGA 4WI1A 3UFGA 4WF2A 1KMMA 4YCVA 2W54A 3RGLA 2E3CA 1YFTA 3L1AA 2CJBA 1B7YB 2ODRD 3A7UA 1J5WA 4XEOA 3TEHB 1EFWA 2EJFA 3BFMA 3IKLA 3MEYA 1RIQA 2ZZGA 2ZT7A 3EFSA 2Q5IA 4KR2A 1WPYA 4BW9A 2DKGA 4P75C 2Q7HA 4UP7A 1HTTA 4YRGA 2AMCB 2C7IA 2W55A 3RF1A 4LVKA 2DZCA 2DTHA 1KMNA 1USYA 4TQFA 2DXUA 1YFSA 2Q5HA 4HWPA 1X2HA 4UP9A 4HT4A 4E51A 5K1XA 1FIQB 1N9WA 1X2GA 3HXYA 3ICAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZIN A;  4ZOH B;  4P71 A;  4WJ4 A;  4YRM A;  3PCO B;  4HVC A;  4YRS A;  1SET A;  3NRZ B;  1E1T A;  4CH6 A;  4XTW A;  4YYE A;  1BIB A;  2ZIO A;  1GGM A;  2ZR3 A;  5KNN A;  1HXD A;  4UP8 A;  4DQ2 A;  4UPA A;  3PZC A;  4OP0 A;  1FFU C;  4DPG A;  2W3S A;  1HC7 A;  2P5I A;  2ODR C;  4H2X B;  3REU A;  1N62 C;  1L0W A;  5G5G B;  1RM6 B;  3NVY B;  4P75 A;  2QHT A;  4TQD A;  1ZXI C;  2E5A A;  5C52 B;  4YDQ A;  3RIR A;  1LYL A;  1WQW A;  3E9I A;  1NJ2 A;  1H4Q A;  4TTV A;  3UGQ A;  2CJA A;  1JRP A;  2IY5 B;  4L87 A;  4XTY A;  3NS1 B;  2ZNI A;  4O2D A;  11AS A;  2G4C A;  1WU7 A;  4YRO A;  1H4S A;  1YGB A;  4P72 C;  4XU2 A;  4P73 A;  4XU1 A;  4CH3 A;  4H2X A;  1NYQ A;  4YP0 A;  3HRK A;  1Z7M A;  4CS4 A;  3NVV B;  2J3M A;  3RUX A;  4P74 A;  1JJC A;  3IG2 A;  3A74 A;  3RL6 A;  4RQF A;  3V7R A;  1G5H A;  2DQ0 A;  3HRD C;  4YRP A;  1NJ8 A;  2CIM A;  3PCO A;  4YCW A;  3M4P A;  2E3T A;  3P8V A;  1FO4 A;  2CGH A;  1WLE A;  2ZIM A;  2QHV A;  2IY5 A;  3G1Z A;  3V8L A;  4AH6 A;  2ZT5 A;  4YRK A;  2ZT6 A;  2ZNJ A;  5E3I A;  2QHS A;  2P0L A;  2E1H A;  4CH5 A;  1ATI A;  2RHS B;  4EO4 A;  3TUP A;  3RAC A;  3NEN A;  2PME A;  2RHS A;  5ELN A;  1E24 A;  3I7F A;  3R07 C;  1E1O A;  4XEM A;  1IL2 A;  3BJU A;  3UH0 A;  5K1P A;  3AMZ A;  2EJ9 A;  4YRT A;  3QO8 A;  3CMQ A;  2DXT A;  2I4O A;  3W3S A;  3VQX A;  4KQE A;  2FYK A;  4XU0 A;  3V8K A;  5F5W A;  3RKY A;  2ZR2 A;  12AS A;  1NJ6 A;  1ADY A;  1WQ7 A;  4TVY A;  3TEH A;  1JJC B;  4P3P A;  3L4G B;  3V7S A;  2ZTG A;  4YRF A;  3SR6 B;  1X55 A;  4TVW A;  2ZZF A;  3QNE A;  4XTZ A;  1PYS A;  3V7C A;  5HGQ A;  1EQR A;  4H02 A;  4H2V A;  3HXX A;  4J15 A;  1QF6 A;  4PHC A;  2RHQ A;  1EIY B;  1JRO A;  3HXV A;  4H2S A;  4ZTZ B;  4XU3 A;  1EIY A;  4Q6G A;  1B70 A;  5C51 B;  3RKW A;  3AN1 A;  3NVW B;  2AMC A;  4YRN A;  3HRI A;  2HNI A;  4K88 A;  4XTX A;  2ZXF A;  2ZCE A;  3A31 A;  4YRE A;  3TEG A;  1H4T A;  2I4M A;  1YB3 A;  2AKW A;  3EUB 3;  3EFR A;  4WJ3 M;  2DU5 A;  2DTO A;  1B7Y A;  3A5Z A;  3VQY A;  3MF1 A;  1SRY A;  3ETR B;  2EWN A;  4H2W A;  1B70 B;  4RQE A;  3V8J A;  1ASY A;  1E22 A;  1KOG A;  3LSS A;  2I4N A;  4H2Y A;  2RHQ B;  1V97 A;  3HFZ B;  3MF2 A;  1X54 A;  3REX A;  1WNL A;  4CS2 A;  2ALY B;  3M4Q A;  4PG3 A;  1PYS B;  3NET A;  4P72 A;  2PMF A;  4K87 A;  3IAL A;  1WYG A;  3L2Z A;  1NNH A;  1N5W C;  4RMF A;  4HWS A;  4P3N A;  3VQV A;  1ADJ A;  5C53 B;  4XTU A;  3A5Y A;  1N61 C;  3OD1 A;  4H2T A;  4YRC A;  1T3Q C;  3HFV A;  2E65 A;  3HTZ A;  5ELO A;  1QE0 A;  2Q7E A;  2E41 A;  2E10 A;  3ERR A;  4ZTU B;  4RDX A;  1WYD A;  3HY0 A;  1G51 A;  4HA8 A;  2DJZ A;  2QHU A;  4YRJ A;  1VDV A;  2XTI A;  3R07 A;  1X56 A;  1H4V B;  4YRI A;  2E64 A;  4G85 A;  3VBB A;  1C0A A;  4BWA A;  3LC0 A;  1NJ5 A;  2DQ3 A;  4TVA A;  1SER A;  3DSQ A;  4HWO A;  1G5I A;  1NYR A;  3QO5 A;  2CJ9 A;  1SES A;  4ZIB A;  1N5X A;  2DDZ A;  3UGT A;  2DEQ A;  5G5H B;  2ARS A;  4YCU A;  1B76 A;  4NCX A;  1EVL A;  2ZGW A;  2C8M A;  1BBU A;  4HWR A;  4H2U A;  4P71 C;  2AKW B;  2ART A;  2EL9 A;  3WQZ A;  1ASZ A;  4KR3 A;  1Z7N A;  4EX5 A;  2DZ9 A;  2ZT8 A;  3QO7 A;  1FYF A;  1YFR A;  3A32 A;  3HY1 A;  4LNS A;  4XTV A;  4YPF A;  1X01 A;  1BIA A;  2ALY A;  2W3R A;  3QTC A;  2XGT A;  1EVK A;  1EOV A;  3HFZ A;  3NVZ B;  3FJP A;  3A7R A;  3E9H A;  2I4L A;  1B8A A;  3NEM A;  2EAY A;  3P8Y A;  3KFU A;  4K86 A;  3A7A A;  2ARU A;  4TWA A;  2DTI A;  3RKX A;  2DVE A;  3L4G A;  4G84 A;  3NEL A;  4YRQ A;  3HXU A;  1N63 C;  1N60 C;  1FFV C;  1USY C;  3AM9 A;  4P73 C;  2DU7 A;  2ZZE A;  2J3L A;  4CH4 A;  1NJ1 A;  3B9J B;  4Q15 A;  3HXW A;  3IKM B;  4YRL A;  4OLF A;  4P3O A;  4P74 C;  1SB3 B;  3P8T A;  1VQZ A;  4CS3 A;  1BBW A;  4YRR A;  4X5O A;  3LSQ A;  2Q7G A;  3HXZ A;  4HWT A;  4TVA B;  1W66 A;  3VQW A;  2EJG A;  4WI1 A;  3UFG A;  4WF2 A;  1KMM A;  4YCV A;  2W54 A;  3RGL A;  2E3C A;  1YFT A;  3L1A A;  2CJB A;  1B7Y B;  2ODR D;  3A7U A;  1J5W A;  4XEO A;  3TEH B;  1EFW A;  2EJF A;  3BFM A;  3IKL A;  3MEY A;  1RIQ A;  2ZZG A;  2ZT7 A;  3EFS A;  2Q5I A;  4KR2 A;  1WPY A;  4BW9 A;  2DKG A;  4P75 C;  2Q7H A;  4UP7 A;  1HTT A;  4YRG A;  2AMC B;  2C7I A;  2W55 A;  3RF1 A;  2DZC A;  2DTH A;  1KMN A;  1USY A;  4TQF A;  2DXU A;  1YFS A;  2Q5H A;  4HWP A;  1X2H A;  4UP9 A;  4E51 A;  5K1X A;  1FIQ B;  1N9W A;  1X2G A;  3HXY A;  3ICA A; 
#chains in the Genus database with same CATH topology
 2ZIN A;  3N6H A;  4ZOH B;  4P71 A;  4WJ4 A;  2JK6 A;  3CGB A;  4A35 A;  2EQ7 A;  3QFA A;  4YRM A;  3PCO B;  3NZG A;  3DGH A;  2GGG A;  1RVK A;  3GY1 A;  3TTE A;  4HVC A;  4YRS A;  2PS2 A;  4LVI A;  2PMQ A;  1SET A;  3NRZ B;  3ES8 A;  1E1T A;  4CH6 A;  1GES A;  4XTW A;  2GGJ A;  1BIB A;  4YYE A;  4ZCW A;  2ZIO A;  1GGM A;  5FS7 A;  2ZR3 A;  3T8Q A;  5KNN A;  1HXD A;  4UP8 A;  3MQZ A;  4DQ2 A;  4UPA A;  2PTY A;  1JPM A;  3PZC A;  4OP0 A;  3P93 A;  1FFU C;  3DG7 A;  1EBD A;  3DFH A;  3BSM A;  4DPG A;  2W3S A;  1HC7 A;  1ONF A;  2QVH A;  3FYY A;  2P5I A;  2WOW A;  2ODR C;  3R0U A;  4M0X A;  3SN0 A;  4H2X B;  4ADW A;  3UXK A;  4EWJ A;  3REU A;  3DEQ A;  3DG6 A;  3DJJ A;  3URH A;  4MGG A;  1N62 C;  3N4F A;  5G5G B;  1GRT A;  1RM6 B;  3NVY B;  3RR1 A;  1SJB A;  2POZ A;  1L0W A;  3IJI A;  4IP4 A;  4P75 A;  1GER A;  1JCT A;  1ZXI C;  2P8C A;  3DH9 A;  3OW1 A;  3QFB A;  5FS6 A;  2QHT A;  2E5A A;  5C52 B;  4YDQ A;  4YWS A;  2HXU A;  3RIR A;  2ZZ0 A;  1LYL A;  2PSN A;  1MRA A;  2V6O A;  3L8K A;  1NJ2 A;  3DK9 A;  1WQW A;  2X8C A;  1OEP A;  3E9I A;  4TTV A;  4EQR A;  3R1Z A;  1H4Q A;  3UGQ A;  2CJA A;  1JRP A;  1NHQ A;  3U9I A;  2IY5 B;  3DK4 A;  3II4 A;  3P3B A;  2OZT A;  1TYT A;  2V3A A;  3CGC A;  1ZY8 A;  3UJF A;  4DN1 A;  3NS1 B;  4L87 A;  4XTY A;  2ZNI A;  4O2D A;  1F3P A;  1KCZ A;  3H7V A;  11AS A;  4NEW A;  2X99 A;  4FDC B;  4BUR A;  2G4C A;  1WU7 A;  3N6J A;  4GR1 A;  3FG2 P;  4GYP C;  1NPX A;  4YRO A;  1H4S A;  4H4Q A;  1DNC A;  1GRA A;  3TOY A;  2HXT A;  5FS9 A;  1BZL A;  3NXL A;  1YGB A;  1ZDL A;  4P72 C;  3I6T A;  4XU2 A;  4P73 A;  4XU1 A;  2OLA A;  2X50 A;  4CH3 A;  4H2X A;  2GSH A;  1NYQ A;  3CXO A;  4K8G A;  4YP0 A;  3HRK A;  4Z17 A;  4TQD A;  2ONE A;  1Z7M A;  1ONE A;  4CS4 A;  3NVV B;  2J3M A;  4Z1Y A;  3RUX A;  3VC6 A;  4P74 A;  2QDD A;  1TYP A;  5FJT A;  5ELN A;  1R0M A;  1JJC A;  3IG2 A;  3V4B A;  3VDG A;  3A74 A;  3PWI A;  1LPF A;  3RL6 A;  1F8W A;  4RQF A;  2GR0 A;  3EKG A;  1YEY A;  4K8D A;  1FEB A;  5FMH A;  3V7R A;  4MKS A;  1G5H A;  2DQ0 A;  2MNR A;  3HRD C;  4YRP A;  4KPR A;  1ECQ A;  3O0H A;  4E5T A;  3U4F A;  1NJ8 A;  2CIM A;  3TJ4 A;  2OZ3 A;  4H4U A;  3KUM A;  3ZLF A;  3PCO A;  4YCW A;  2P3Z A;  1GEU A;  3M4P A;  2E3T A;  4EMJ A;  4HPN A;  3P8V A;  3FJ4 A;  1FO4 A;  2CGH A;  1WLE A;  4FX9 A;  2ZIM A;  2QHV A;  2IY5 A;  3G1Z A;  3MZN A;  2OO6 A;  3V8L A;  4AH6 A;  2ZT5 A;  4YRK A;  3JVA A;  5JCL A;  4K2S A;  2ZT6 A;  2ZNJ A;  5E3I A;  2NQL A;  2OQY A;  4ROP A;  2QHS A;  2PGW A;  2P0L A;  2E1H A;  4CH5 A;  1ATI A;  2RHS B;  4EO4 A;  4LVM A;  4H4Z A;  4H4T A;  3NEN A;  2PME A;  2RHS A;  3RAC A;  2CFY A;  4JHM A;  1E24 A;  2GRT A;  2MUC A;  3VCN A;  1E9I A;  3R07 C;  3I7F A;  3R0K A;  1E1O A;  4XEM A;  2HZG A;  1IL2 A;  3BJU A;  3IC9 A;  3UH0 A;  5K1P A;  2GL5 A;  3PFR A;  1TKK A;  3AMZ A;  4HNC A;  2EJ9 A;  4YRT A;  2YVG A;  5JCN A;  3H8A A;  3QO8 A;  3CMQ A;  2DXT A;  1GRG A;  2I4O A;  3JW7 A;  5IDZ A;  3W3S A;  5JCI A;  3VQX A;  3H4K A;  4KQE A;  2FYK A;  3SN1 A;  5JCM A;  1JPD X;  3CYJ A;  4H4R A;  4E4F A;  4XU0 A;  3V8K A;  5F5W A;  2GR3 A;  3RKY A;  1TZZ A;  2R9Z A;  2F5Z A;  2GR2 A;  2ZR2 A;  12AS A;  4EM4 A;  3JZU A;  1NJ6 A;  5FS8 A;  1ADY A;  3MQT A;  1WQ7 A;  4TVY A;  2GH5 A;  3TEH A;  2XGZ A;  2RDX A;  1JJC B;  4P3P A;  4H4P A;  2WPC A;  3L4G B;  3V7S A;  2ZTG A;  4YRF A;  1DTN A;  4IT1 A;  3SR6 B;  1X55 A;  4TVW A;  2ZZF A;  3QNE A;  4XTZ A;  4IP5 A;  3MWC A;  4LII A;  3ZVH A;  1KN0 A;  1PYS A;  3V7C A;  2PPG A;  5HGQ A;  1EQR A;  4H02 A;  1JEH A;  4JN8 A;  4H2V A;  1XAN A;  1WUE A;  3TCS A;  3HXX A;  4J15 A;  4X2P A;  2HNE A;  4HCL A;  5GRT A;  1QF6 A;  4PHC A;  2RHQ A;  1EIY B;  4IHC A;  2XH2 A;  1JRO A;  3HXV A;  4H2S A;  4ZTZ B;  5EBK A;  3GD4 A;  4XU3 A;  2A8E A;  5EU9 A;  3R10 A;  4EM3 A;  4H4X A;  1EIY A;  2AKZ A;  3MKC A;  4Q6G A;  2HQM A;  1B70 A;  3HPF A;  1F9C A;  5C51 B;  3RKW A;  3AN1 A;  3NVW B;  2AMC A;  4YRN A;  1EBH A;  3HRI A;  2X8H A;  1V59 A;  3ZVH B;  3FV9 A;  2HNI A;  4K88 A;  2XSX A;  1ZMD A;  4XTX A;  1SJD A;  2ZXF A;  2ZCE A;  2BC1 A;  2PTW A;  4FP1 A;  3S47 A;  3A31 A;  3VA8 A;  1XDI A;  2WOI A;  3GO2 A;  4YRE A;  5JCK A;  3RCY A;  3VFC A;  3DES A;  3TEG A;  1GRB A;  1H4T A;  3NO1 A;  3UCD A;  4G7F A;  4ZA0 A;  2OFJ A;  2I4M A;  1YB3 A;  2AKW A;  3EUB 3;  3EFR A;  4GRT A;  4WJ3 M;  2DU5 A;  2DTO A;  4FI4 A;  1B7Y A;  3A5Z A;  3DGZ A;  3B97 A;  3NFU A;  4GIR A;  3UJS A;  3MF1 A;  3VQY A;  1D7Y A;  2PGE A;  2OQH A;  3ETR B;  1SRY A;  4JN7 A;  2EWN A;  4H2W A;  3TUP A;  1IYX A;  4J3Z A;  1B70 B;  4J57 A;  3RO6 A;  3H70 A;  3V8J A;  3UJE A;  4RQE A;  1ASY A;  1E22 A;  1KD0 A;  1MO9 A;  2ZZC A;  1BQG A;  3CK5 A;  5BOF A;  1KOG A;  3LSS A;  5FJR A;  3IJQ A;  2I4N A;  1Q1W A;  2RHQ B;  4H2Y A;  1V97 A;  3HFZ B;  3MF2 A;  2A8X A;  1X54 A;  3REX A;  1XS2 A;  3QKE A;  1WNL A;  1EC9 A;  4CS2 A;  1NHS A;  2ALY B;  3CGE A;  3M4Q A;  4PG3 A;  4JDR A;  1PYS B;  4H19 A;  3NET A;  3SJN A;  4KWS A;  3IJL A;  6ENL A;  2PMF A;  4P72 A;  3CXB A;  3D46 A;  4GIS A;  4K87 A;  3IAL A;  1WYG A;  3EAN A;  2OVL A;  3L2Z A;  1NNH A;  3FXG A;  4DXK A;  1N5W C;  3DFY A;  2PTX A;  4RMF A;  4HWS A;  3TWA A;  2PTZ A;  4P3N A;  2PP1 A;  4KT2 A;  2YVJ A;  3VQV A;  4YWO A;  5ENL A;  3V5C A;  1GXF A;  1ADJ A;  2I5Q A;  2GGI A;  5C53 B;  1GET A;  1M6I A;  2GGE A;  1TE6 A;  2NPX A;  4XTU A;  3EAO A;  2W0H A;  3GRS A;  1N61 C;  3A5Y A;  1EC8 A;  3OD1 A;  4H2T A;  2P0I A;  4YRC A;  4LVL A;  4F4R A;  1T3Q C;  3HFV A;  2E65 A;  4HCH A;  3SQP A;  3HTZ A;  3SSZ A;  2FYM A;  3Q45 A;  5ELO A;  2AL1 A;  1AOG A;  1QE0 A;  2Q7E A;  2E41 A;  2E10 A;  2YQU A;  3ERR A;  4ZTU B;  2YVF A;  4RDX A;  1WYD A;  3DK8 A;  3HY0 A;  1GV4 A;  1G51 A;  4HA8 A;  2XH7 A;  5KVI A;  2EQ8 A;  1W6T A;  4M6U A;  4EMI A;  2DJZ A;  2QHU A;  4YRJ A;  4A6G A;  3OTR A;  1VDV A;  2XTI A;  3R07 A;  1ELS A;  2QQ6 A;  1X56 A;  3CB3 A;  3QN3 A;  1H4V B;  3CT2 A;  3PK7 A;  4YRI A;  2DW6 A;  3DIP A;  2E64 A;  4G85 A;  3VBB A;  1C0A A;  3ZLH A;  4BWA A;  2EQ9 A;  3LC0 A;  1NJ5 A;  4KPL A;  2DQ3 A;  4ENL A;  4TVA A;  1SER A;  3DSQ A;  1WUF A;  3RRA A;  2BCP A;  4HWO A;  4H4S A;  1G5I A;  1NYR A;  2QDE A;  3QO5 A;  2V3B A;  4J1O A;  2CJ9 A;  1KKR A;  3OP2 A;  3V3W A;  5KVH A;  2OZ8 A;  1SES A;  3L5O A;  4HYR A;  3VCC A;  3SBF A;  3GD6 A;  3P0W A;  3ENL A;  4IZG A;  2C3D A;  1H6V A;  3MY9 A;  3CAW A;  1N5X A;  4ZIB A;  2PU0 A;  2DDZ A;  3SQS A;  3UGT A;  3UGV A;  2DEQ A;  4H4Y A;  5G5H B;  2ARS A;  1MDR A;  1MUC A;  1PDZ A;  4YCU A;  1B76 A;  4E4U A;  4HNL A;  4EQW A;  4NCX A;  3RIT A;  1EVL A;  2ZGW A;  2OG9 A;  3BOX A;  1NHP A;  2RAB A;  4E8G A;  1BBU A;  2C8M A;  4H2U A;  4HWR A;  4P71 C;  2WOV A;  2AKW B;  2ART A;  2EL9 A;  4IL0 A;  4EMW A;  3BJS A;  3WQZ A;  1ASZ A;  4KR3 A;  1Z7N A;  4EX5 A;  2DZ9 A;  2EQ6 A;  3UCC A;  2ZT8 A;  1STZ A;  3KLJ A;  4H4W A;  1MOK A;  3ES7 A;  5FJU A;  3QO7 A;  4DX3 A;  4EQX A;  3N4E A;  3Q6J A;  7ENL A;  2FKP A;  1BWC A;  1FYF A;  3UJ2 A;  3OC4 A;  3THU A;  1YFR A;  3A32 A;  3HY1 A;  4LNS A;  1FEC A;  4XTV A;  4YPF A;  4GGB A;  1X01 A;  1BIA A;  5BOE A;  5ER0 A;  2ALY A;  2W3R A;  2QJN A;  1MDL A;  2BC0 A;  2C3C A;  1NU5 A;  4BV6 A;  4E6M A;  2XGT A;  3QTC A;  2YAU A;  4EQS A;  1BKH A;  4HCD A;  1EVK A;  1EOV A;  3HFZ A;  3DDM A;  3NVZ B;  2PP3 A;  3FJP A;  4MMW A;  3A7R A;  2XH0 A;  1GRE A;  3E9H A;  4APN A;  2I4L A;  2GDQ A;  4DNA A;  1B8A A;  3NEM A;  1L8P A;  3T6C A;  3GC2 A;  2EAY A;  3STP A;  2GQW A;  3P8Y A;  3DJG X;  2WPE A;  3OZM A;  3DG3 A;  1GRH A;  4K86 A;  3KFU A;  3A7A A;  3I6E A;  5U1O A;  2ARU A;  4TWA A;  5FJP A;  3TJI A;  1P43 A;  2DTI A;  3H12 A;  3QLD A;  4H50 A;  3LAD A;  1GRF A;  3DER A;  3RKX A;  2DVE A;  3L4G A;  4G84 A;  3NEL A;  2AL2 B;  4M52 A;  3R25 A;  4YRQ A;  3PWG A;  1JOA A;  4LVJ A;  1JDF A;  3D47 A;  2OKT A;  3QPE A;  5FJO A;  3HXU A;  1N63 C;  3FCP A;  1N60 C;  1FFV C;  1USY C;  3AM9 A;  4H1Z A;  1ZX9 A;  2AAQ A;  2NS6 A;  4P73 C;  1LVL A;  3S5S A;  1OJT A;  2CHR A;  2O56 A;  2DU7 A;  3TQP A;  2OPJ A;  2ZZE A;  2J3L A;  4CH4 A;  4NEV A;  3PG6 A;  1NJ1 A;  3Q4D A;  3B9J B;  5TR3 A;  1K4Q A;  1KKO A;  4Q15 A;  3GD3 A;  3VC5 A;  3T9P A;  3TW9 A;  4IL2 A;  1XHC A;  4GYP A;  3UXL A;  2OX4 A;  2PP0 A;  3HXW A;  1XPY A;  2QGY A;  2QJJ A;  2J3N A;  3OZY A;  3IKM B;  4YRL A;  5JRB A;  3RGT A;  3HW2 A;  2POD A;  4J56 A;  3K1G A;  3LXD A;  4OLF A;  4P3O A;  4P74 C;  1SB3 B;  3P8T A;  1VQZ A;  4JQ9 A;  1FEA A;  4CS3 A;  2DW7 A;  1R6W A;  1BBW A;  1P48 A;  1FHV A;  4X5O A;  4YRR A;  3D9X A;  2ZZB A;  1PDY A;  3LSQ A;  3QTP A;  2Q7G A;  2WPF A;  4H2H A;  3HXZ A;  4HWT A;  3GRT A;  4TVA B;  1W66 A;  3VQW A;  1Q1R A;  2EJG A;  3DGB A;  4WI1 A;  3ZVI A;  3UFG A;  4WF2 A;  3I4K A;  1SJA A;  2QAE A;  1EBG A;  1KMM A;  4YCV A;  3FVD A;  3MUC A;  2X8G A;  4DHG A;  2W54 A;  4DYE A;  2E3C A;  1ZKQ A;  3R11 A;  4A3R A;  1YFT A;  3LB8 A;  3RGL A;  1H2I A;  4G8T A;  3UJR A;  2GGH A;  2CJB A;  3L1A A;  1B7Y B;  3T4W A;  2ODR D;  1YQZ A;  2QJM A;  3MSY A;  4GGH A;  1GSN A;  3A7U A;  4H4V A;  1J5W A;  4XEO A;  3TEH B;  1EFW A;  2PCE A;  2ZAD A;  2EJF A;  1NDA A;  1ZK7 A;  4KEM A;  2WP5 A;  2P8B A;  4K1W A;  3BFM A;  3SN4 A;  2AL2 A;  1MNS A;  2NVK X;  3ZLG A;  3IKL A;  1SJC A;  4K7Z A;  1RIQ A;  2CDU A;  2ZZG A;  3MEY A;  1DXL A;  2ZT7 A;  2WP6 A;  3EFS A;  1FHU A;  2XH4 A;  2Q5I A;  4KR2 A;  1WPY A;  4BW9 A;  2DKG A;  4GME A;  3V5F A;  2Q7H A;  4P75 C;  4UP7 A;  1HTT A;  4YRG A;  2AMC B;  2C7I A;  4H83 A;  3RNM A;  2W55 A;  3RF1 A;  4LVK A;  5U25 A;  2DZC A;  3CGD A;  1S7M A;  2PU1 A;  3IK4 A;  2DTH A;  3OPS A;  1KMN A;  5J04 A;  1USY A;  2WBA A;  4LA1 A;  2DXU A;  1ZMC A;  1YFS A;  2Q5H A;  4TQF A;  4HWP A;  1X2H A;  3EF6 A;  4UP9 A;  1EC7 A;  2TPR A;  1NEL A;  2PA6 A;  4HT4 A;  3TWB A;  4E51 A;  4GFI A;  5K1X A;  1NHR A;  2GR1 A;  1FIQ B;  4DWD A;  1X2G A;  1N9W A;  3HXY A;  3ICA A;  2AKM A;  4HN8 A;  3EEZ A;  2ZC8 A;  2P88 A; 
#chains in the Genus database with same CATH homology
 2ZIN A;  4ZOH B;  4P71 A;  4WJ4 A;  4YRM A;  3PCO B;  4HVC A;  4YRS A;  4LVI A;  1SET A;  3NRZ B;  1E1T A;  4CH6 A;  4XTW A;  4YYE A;  1BIB A;  2ZIO A;  1GGM A;  2ZR3 A;  5KNN A;  1HXD A;  4UP8 A;  3MQZ A;  4DQ2 A;  4UPA A;  3PZC A;  4OP0 A;  1FFU C;  4DPG A;  2W3S A;  1HC7 A;  2P5I A;  2ODR C;  4H2X B;  3REU A;  1N62 C;  1L0W A;  5G5G B;  1RM6 B;  3NVY B;  4P75 A;  2QHT A;  4TQD A;  1ZXI C;  2E5A A;  5C52 B;  4YDQ A;  3RIR A;  1LYL A;  1WQW A;  3E9I A;  1NJ2 A;  1H4Q A;  4TTV A;  3UGQ A;  2CJA A;  1JRP A;  2IY5 B;  4L87 A;  4XTY A;  3NS1 B;  2ZNI A;  4O2D A;  11AS A;  2G4C A;  1WU7 A;  4YRO A;  1H4S A;  1YGB A;  4P72 C;  4XU2 A;  4P73 A;  4XU1 A;  4CH3 A;  4H2X A;  1NYQ A;  4YP0 A;  3HRK A;  1Z7M A;  4CS4 A;  3NVV B;  2J3M A;  3RUX A;  4P74 A;  1JJC A;  3IG2 A;  3A74 A;  3RL6 A;  4RQF A;  3V7R A;  1G5H A;  2DQ0 A;  3HRD C;  4YRP A;  1NJ8 A;  2CIM A;  3PCO A;  4YCW A;  3M4P A;  2E3T A;  3P8V A;  1FO4 A;  2CGH A;  1WLE A;  2ZIM A;  2QHV A;  2IY5 A;  3G1Z A;  3V8L A;  4AH6 A;  2ZT5 A;  4YRK A;  2ZT6 A;  2ZNJ A;  5E3I A;  2QHS A;  2P0L A;  2E1H A;  4CH5 A;  1ATI A;  2RHS B;  4EO4 A;  4LVM A;  3RAC A;  3TUP A;  3NEN A;  2PME A;  2RHS A;  5ELN A;  1E24 A;  3I7F A;  3R07 C;  1E1O A;  4XEM A;  1IL2 A;  3BJU A;  3UH0 A;  5K1P A;  3AMZ A;  2EJ9 A;  4YRT A;  3QO8 A;  3CMQ A;  2DXT A;  2I4O A;  3W3S A;  3VQX A;  4KQE A;  2FYK A;  4XU0 A;  3V8K A;  5F5W A;  3RKY A;  2ZR2 A;  12AS A;  1NJ6 A;  1ADY A;  1WQ7 A;  4TVY A;  3TEH A;  1JJC B;  4P3P A;  3L4G B;  3V7S A;  2ZTG A;  4YRF A;  3SR6 B;  1X55 A;  4TVW A;  2ZZF A;  3QNE A;  4XTZ A;  1PYS A;  3V7C A;  5HGQ A;  1EQR A;  4H02 A;  4H2V A;  3HXX A;  4J15 A;  1QF6 A;  4PHC A;  2RHQ A;  1EIY B;  1JRO A;  3HXV A;  4H2S A;  4ZTZ B;  4XU3 A;  2A8E A;  1EIY A;  4Q6G A;  1B70 A;  5C51 B;  3RKW A;  3AN1 A;  3NVW B;  2AMC A;  4YRN A;  3HRI A;  2HNI A;  4K88 A;  4XTX A;  2ZXF A;  2ZCE A;  3A31 A;  4YRE A;  3TEG A;  1H4T A;  2I4M A;  1YB3 A;  2AKW A;  3EUB 3;  3EFR A;  4WJ3 M;  2DU5 A;  2DTO A;  1B7Y A;  3A5Z A;  3VQY A;  3MF1 A;  1SRY A;  3ETR B;  2EWN A;  4H2W A;  1B70 B;  4RQE A;  3V8J A;  1ASY A;  1E22 A;  1KOG A;  3LSS A;  2I4N A;  4H2Y A;  2RHQ B;  1V97 A;  3HFZ B;  3MF2 A;  1X54 A;  3REX A;  1WNL A;  4CS2 A;  2ALY B;  3M4Q A;  4PG3 A;  1PYS B;  3NET A;  4P72 A;  2PMF A;  4K87 A;  3IAL A;  1WYG A;  3L2Z A;  1NNH A;  1N5W C;  4RMF A;  4HWS A;  4P3N A;  3VQV A;  1ADJ A;  5C53 B;  4XTU A;  3A5Y A;  1N61 C;  3OD1 A;  4H2T A;  4LVL A;  4YRC A;  1T3Q C;  3HFV A;  2E65 A;  3HTZ A;  5ELO A;  1QE0 A;  2Q7E A;  2E41 A;  2E10 A;  3ERR A;  4ZTU B;  4RDX A;  1WYD A;  3HY0 A;  1G51 A;  4HA8 A;  2DJZ A;  2QHU A;  4YRJ A;  1VDV A;  2XTI A;  3R07 A;  1X56 A;  1H4V B;  4YRI A;  2E64 A;  4G85 A;  3VBB A;  1C0A A;  4BWA A;  3LC0 A;  1NJ5 A;  2DQ3 A;  4TVA A;  1SER A;  3DSQ A;  4HWO A;  1G5I A;  1NYR A;  3QO5 A;  2CJ9 A;  1SES A;  4ZIB A;  1N5X A;  2DDZ A;  3UGT A;  2DEQ A;  5G5H B;  2ARS A;  4YCU A;  1B76 A;  4NCX A;  1EVL A;  2ZGW A;  2C8M A;  1BBU A;  4HWR A;  4H2U A;  4P71 C;  2AKW B;  2ART A;  2EL9 A;  3WQZ A;  1ASZ A;  4KR3 A;  1Z7N A;  4EX5 A;  2DZ9 A;  2ZT8 A;  3QO7 A;  1FYF A;  1YFR A;  3A32 A;  3HY1 A;  4LNS A;  4XTV A;  4YPF A;  1X01 A;  1BIA A;  2ALY A;  2W3R A;  3QTC A;  2XGT A;  1EVK A;  1EOV A;  3HFZ A;  3NVZ B;  3FJP A;  3A7R A;  3E9H A;  2I4L A;  1B8A A;  3NEM A;  2EAY A;  3P8Y A;  3KFU A;  4K86 A;  3A7A A;  2ARU A;  4TWA A;  2DTI A;  3RKX A;  2DVE A;  3L4G A;  4G84 A;  3NEL A;  4YRQ A;  4LVJ A;  3HXU A;  1N63 C;  1N60 C;  1FFV C;  1USY C;  3AM9 A;  2NS6 A;  4P73 C;  2DU7 A;  2ZZE A;  2J3L A;  4CH4 A;  1NJ1 A;  3B9J B;  4Q15 A;  3HXW A;  3IKM B;  4YRL A;  4OLF A;  4P3O A;  4P74 C;  1SB3 B;  3P8T A;  1VQZ A;  4CS3 A;  1BBW A;  4YRR A;  4X5O A;  3LSQ A;  2Q7G A;  3HXZ A;  4HWT A;  4TVA B;  1W66 A;  3VQW A;  2EJG A;  4WI1 A;  3UFG A;  4WF2 A;  1KMM A;  4YCV A;  2W54 A;  3RGL A;  2E3C A;  1YFT A;  3L1A A;  2CJB A;  1B7Y B;  2ODR D;  3A7U A;  1J5W A;  4XEO A;  3TEH B;  1EFW A;  2EJF A;  3BFM A;  3IKL A;  3MEY A;  1RIQ A;  2ZZG A;  2ZT7 A;  3EFS A;  2Q5I A;  4KR2 A;  1WPY A;  4BW9 A;  2DKG A;  4P75 C;  2Q7H A;  4UP7 A;  1HTT A;  4YRG A;  2AMC B;  2C7I A;  2W55 A;  3RF1 A;  4LVK A;  2DZC A;  2DTH A;  1KMN A;  1USY A;  4TQF A;  2DXU A;  1YFS A;  2Q5H A;  4HWP A;  1X2H A;  4UP9 A;  4HT4 A;  4E51 A;  5K1X A;  1FIQ B;  1N9W A;  1X2G A;  3HXY A;  3ICA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...