2E5AA

Crystal structure of bovine lipoyltransferase in complex with lipoyl-amp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
343
structure length
329
Chain Sequence
GLILQSISNDVYHNLAVEDWIHDHMNLEGKPVLFLWRNSPTVVIGRHQNPWQECNLNLMREEGVKLARRRSGGGTVYHDMGNINLTFFTTKKKYDRMENLKLVVRALKAVHPHLDVQATKRFDLLLDGQFKISGTASKIGRNAAYHHCTLLCGTDGTFLSSLLKSPYQGIRSNATASTPALVKNLMEKDPTLTCEVVINAVATEYATSHQIDNHIHLINPTDETVFPGINSKAIELQTWEWIYGKTPKFSVDTSFTVLHSHVEIKVFIDVKNGRIEVCNIEAPDHWLPLEICDQLNSSLIGSKFSPIETTVDELHSKWNILCEKIKGIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of bovine Lipoyltransferase in complex with lipoyl-AMP
pubmed doi rcsb
source organism Bos taurus
molecule tags Ligase
molecule keywords Lipoyltransferase 1
total genus 108
structure length 329
sequence length 343
ec nomenclature ec 6.-.-.-:
pdb deposition date 2006-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2e5aA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e5aA01
1JJCA 5C52B 2DZ9A 1FO4A 1KOGA 4P74C 3REUA 2P5IA 4XU1A 2DXTA 3HXWA 1V97A 2DDZA 2P0LA 4LNSA 3RKXA 3EUB3 2E64A 3HFVA 3HRKA 1C0AA 12ASA 3PZCA 4KQEA 4CH4A 4G84A 4XEMA 3NETA 4P71C 2HNIA 1PYSA 1NYQA 2E5AA 3BFMA 2DTHA 2EJGA 1N9WA 2ZCEA 3G1ZA 5ELNA 4H2XB 1YFSA 3WQZA 1NJ2A 2CGHA 3B9JB 3R07C 4P71A 1EIYB 1BIAA 2J3LA 2I4MA 2EAYA 1J5WA 1H4TA 1SRYA 4H2SA 4TVWA 1KMNA 2QHTA 4BWAA 3HFZB 2E1HA 1BIBA 2QHVA 1KMMA 3R07A 4XTXA 1WYGA 5KNNA 3L4GA 3HRDC 1N63C 1EOVA 3V8KA 3I7FA 4YRJA 1ASYA 3VQXA 4P3PA 4YRSA 4K86A 3A32A 4RQFA 1JRPA 5E3IA 2DVEA 4TTVA 4CS4A 2W3RA 3TEHB 4X5OA 2ARSA 1SESA 3ICAA 1USYA 4H2XA 4YRCA 4TQFA 3V7CA 1BBWA 3BJUA 3HFZA 3E9IA 3RKWA 4XTUA 4KR3A 1Z7NA 2IY5A 1EIYA 1X54A 2ZZGA 2C7IA 3QO8A 2DJZA 4YPFA 1SERA 1IL2A 2ZR2A 1T3QC 4YRGA 3IG2A 3IALA 1L0WA 2J3MA 5C51B 4YCVA 4E51A 1WLEA 3A5YA 3VBBA 2EWNA 3ETRB 3NVVB 4YYEA 2AKWB 3RL6A 1WYDA 2Q7GA 4WJ4A 3P8VA 1B7YA 1ASZA 3AMZA 1YB3A 2Q5IA 3NRZB 2AMCB 3MF1A 4O2DA 4YRIA 2ZXFA 4PG3A 4AH6A 2CJAA 3L1AA 2ALYA 1N61C 3A74A 2ZNJA 1SETA 2ZR3A 2RHQB 4H2YA 3VQYA 4ZTUB 4KR2A 4P74A 3HXYA 2ZT6A 3P8YA 2EL9A 3E9HA 3NELA 3A5ZA 4YRKA 2DU5A 2CJ9A 1EVKA 4HVCA 3CMQA 3RKYA 4XTWA 1W66A 4H02A 2ZT5A 3RGLA 4XU0A 4YCWA 2I4NA 2W55A 2QHUA 4HWPA 1WNLA 1HXDA 4YRTA 2AKWA 4RQEA 4YREA 2DQ0A 4XTVA 2E41A 3UFGA 2XTIA 3LC0A 1QE0A 4HWRA 4OP0A 4WJ3M 4P72C 3HXUA 4YRRA 2W54A 1EVLA 3HY0A 4YRMA 4YDQA 1N62C 3MF2A 3UGQA 2DQ3A 4UP8A 2EJ9A 1NJ5A 2DXUA 1H4VB 1GGMA 1NJ6A 2DKGA 1X55A 3NVYB 2DZCA 1RIQA 1YFTA 1N5XA 3A31A 3QNEA 1B70A 4TVYA 1E22A 3L4GB 1JROA 2XGTA 2ZIOA 1YGBA 3DSQA 1H4SA 4H2TA 2Q7HA 1N60C 3NEMA 4P3OA 3IKLA 3RIRA 1FIQB 2ODRC 3A7AA 5HGQA 3V8LA 3EFSA 3SR6B 1VQZA 4UPAA 1ADYA 3TEHA 1FFUC 3HXZA 5G5GB 2CIMA 1ATIA 1E24A 4TQDA 4Q15A 2ARUA 1USYC 2FYKA 2QHSA 4HWOA 3VQVA 1JJCB 4YRFA 3NVWB 4EO4A 2C8MA 1WPYA 1G5IA 1FFVC 1RM6B 1X2GA 3PCOA 2Q7EA 3QO7A 2I4OA 1FYFA 3L2ZA 3V8JA 1PYSB 4CH3A 5K1XA 1E1OA 1B70B 2IY5B 3REXA 1VDVA 3IKMB 3VQWA 3TUPA 2RHSB 4WF2A 4HA8A 4RDXA 3LSSA 4TWAA 3NVZB 3AM9A 1BBUA 4XEOA 1B76A 4G85A 2ZGWA 1NJ1A 2ZNIA 3W3SA 1NJ8A 3KFUA 2I4LA 4L87A 4XU2A 5C53B 2ZZEA 3NS1B 3HTZA 1N5WC 2E3TA 2RHQA 4H2UA 1H4QA 1HTTA 4P75C 1X56A 3EFRA 4P73A 3RACA 4RMFA 5F5WA 4BW9A 1ZXIC 1B8AA 2RHSA 1NYRA 2ALYB 4P75A 3RF1A 5K1PA 4ZIBA 4YRNA 3UGTA 4CH5A 2ZT8A 2E3CA 4CS3A 4WI1A 1G51A 3AN1A 4J15A 4Q6GA 1WQWA 2DTOA 4YCUA 3ERRA 3TEGA 4K88A 2DU7A 1WQ7A 2DEQA 2DTIA 4OLFA 3A7RA 4YP0A 2G4CA 1LYLA 3MEYA 4UP9A 3V7RA 4YRLA 4ZOHB 4CS2A 3LSQA 2ARTA 1X2HA 1QF6A 4TVAB 2ZZFA 5G5HB 4PHCA 4XU3A 3RUXA 2EJFA 3OD1A 5ELOA 1G5HA 2PMEA 4H2WA 4CH6A 1SB3B 2ZT7A 4P72A 4HWTA 4HWSA 11ASA 4DPGA 3HRIA 3P8TA 3UH0A 2CJBA 2W3SA 3HXVA 1YFRA 3M4PA 3A7UA 1HC7A 3QO5A 3QTCA 4EX5A 1Z7MA 2PMFA 3V7SA 4H2VA 2ZIMA 3HY1A 1B7YB 2ZTGA 1NNHA 1ADJA 3M4QA 3NENA 4TVAA 4NCXA 2AMCA 4YROA 4ZTZB 1X01A 3FJPA 4XTYA 2E65A 4P73C 4DQ2A 4P3NA 1EFWA 2Q5HA 2ZINA 2ODRD 4XTZA 3PCOB 4YRQA 1WU7A 4UP7A 1EQRA 4YRPA 3HXXA 1E1TA 4K87A 2E10A
chains in the Genus database with same CATH superfamily
2OZ3A 1JJCA 3GRSA 5C52B 4DYEA 2EQ7A 2WBAA 1FO4A 2DZ9A 1NHRA 4ADWA 4P74C 1KOGA 2OQHA 2OO6A 4LIIA 2GRTA 3REUA 2P5IA 4XU1A 2X99A 2DXTA 3HXWA 1NPXA 1V97A 3P3BA 2DDZA 2NPXA 2P0LA 3GD3A 3VA8A 4LNSA 3RKXA 1ELSA 2FKPA 3EUB3 2E64A 3HFVA 3HRKA 12ASA 3R11A 3PZCA 2OFJA 4KQEA 4CH4A 4YWSA 4G84A 2AL1A 3D9XA 4XEMA 4H4QA 3NETA 4P71C 3FYYA 1PYSA 1Q1WA 5FJPA 2QQ6A 2HNIA 3RGTA 1NYQA 2E5AA 1XPYA 1FHVA 2GR1A 3H8AA 2A8EA 3BFMA 5FJRA 4E6MA 2DTHA 2EJGA 3N4EA 2AKMA 3CGEA 1N9WA 2ZCEA 4A6GA 2NVKX 1XDIA 4LVKA 2QGYA 1PDZA 2PU0A 2QJJA 3IJLA 1ONEA 2P88A 5U25A 3SQSA 3G1ZA 5ELNA 4H2XB 3I4KA 1PDYA 3MWCA 4Z1YA 3CXOA 3T6CA 1YFSA 3WQZA 1NJ2A 2ZADA 5JCMA 2GL5A 2F5ZA 4HCDA 2CGHA 3B9JB 3R07C 4EMWA 5FJTA 3RITA 4P71A 1EIYB 4A35A 1BIAA 2J3LA 2PP0A 2OZTA 3R10A 2I4MA 4H4YA 4K1WA 2EAYA 2I5QA 2WPCA 1J5WA 3CGBA 5FMHA 1H4TA 1SRYA 4GGHA 4TVWA 1KMNA 2QHTA 4H2SA 1DNCA 3DFHA 4BWAA 5JCIA 3URHA 2MUCA 3HFZB 1Q1RA 2PODA 1BIBA 2E1HA 3NFUA 2QHVA 2ONEA 1KMMA 3R07A 4XTXA 1WYGA 3PK7A 1JDFA 2YQUA 4H2HA 4H50A 3SSZA 3VDGA 5KNNA 3L4GA 3HRDC 4EMJA 4MGGA 1N63C 2PTXA 3LADA 4GMEA 4K8DA 1EOVA 3V8KA 2QJMA 4BV6A 3I7FA 4DXKA 1TZZA 3P93A 3MKCA 4KEMA 4YRJA 3VQXA 4P3PA 1ASYA 4YRSA 2V3BA 4K86A 3A32A 4E8GA 4RQFA 1JRPA 4GR1A 5E3IA 2DVEA 3VFCA 4TTVA 3UJFA 4CS4A 2PS2A 2W3RA 3TEHB 4M52A 1R0MA 4FX9A 3Q45A 2ARSA 4X5OA 4LVIA 3MSYA 1SESA 2BC1A 2P8CA 2DW6A 3ICAA 1NHSA 1USYA 4H2XA 4YRCA 4TQFA 3UXKA 5EU9A 4KT2A 3V7CA 3TWBA 2GR3A 3NO1A 4DN1A 3CT2A 1BBWA 5BOFA 2GGEA 3BJUA 3P0WA 3HFZA 2RABA 3UCCA 3E9IA 3RKWA 5JCNA 3DGHA 3SN0A 4XTUA 1EBDA 4JQ9A 4IP5A 4KR3A 1Z7NA 1SJBA 2IY5A 1EIYA 1X54A 2ZZGA 3H12A 3N6JA 3V5FA 2C7IA 4DWDA 4DNAA 3QO8A 2DJZA 3MY9A 3TWAA 4YPFA 1SERA 1BQGA 3K1GA 1IL2A 2ZR2A 1T3QC 1FEBA 3IG2A 4YRGA 3IALA 1L0WA 2J3MA 5C51B 4FP1A 4YCVA 4E51A 4J1OA 4H4XA 1YQZA 1WLEA 4J3ZA 2XSXA 4GGBA 4H4SA 1M6IA 4GYPA 3SBFA 3U9IA 3A5YA 1NHQA 3VBBA 3MUCA 3II4A 1F8WA 5U1OA 3Q4DA 4NEVA 2EWNA 3ETRB 3NVVB 4YYEA 2AKWB 1JOAA 1YEYA 5KVIA 3RL6A 3ZLGA 1WYDA 2Q7GA 3EF6A 4WJ4A 5KVHA 1B7YA 3KLJA 3P8VA 1ASZA 4JDRA 2HNEA 3AMZA 2EQ6A 1YB3A 2Q5IA 5TR3A 4A3RA 3NRZB 2AMCB 4GISA 3MF1A 4O2DA 4YRIA 1DXLA 2ZXFA 4K7ZA 5JRBA 4MKSA 4PG3A 4AH6A 3QLDA 2HZGA 2CJAA 4K2SA 3L1AA 2ALYA 3OC4A 1N61C 4H4PA 3A74A 2ZNJA 1MO9A 2WPEA 3VCNA 1SETA 2ZR3A 3O0HA 3V4BA 1FECA 1ECQA 3V5CA 1BKHA 1ZY8A 2RHQB 4H2YA 3VQYA 3SQPA 4ZTUB 4KR2A 1WUFA 4P74A 3HXYA 1S7MA 4GIRA 5BOEA 1MNSA 1ZX9A 2QDDA 3RRAA 2PP1A 2ZT6A 3UJRA 3ZLFA 4HPNA 3P8YA 2V3AA 1OEPA 1GRHA 3DDMA 2EL9A 3E9HA 3NELA 1KN0A 3SN4A 3A5ZA 4YRKA 2DU5A 4ZA0A 2CJ9A 2BC0A 1EVKA 4HVCA 2C3CA 3MQZA 3CMQA 1GRBA 3ES7A 3RKYA 1GESA 3QFAA 4FDCB 1ZMDA 1W66A 2ZT5A 4H02A 4XTWA 1GEUA 3RGLA 1GETA 5JCKA 3QN3A 4XU0A 4YCWA 2XGZA 1RVKA 2OX4A 3H4KA 5FS9A 2NS6A 2I4NA 2W55A 4HYRA 4E4FA 3DG7A 2QHUA 2QVHA 4J56A 1WNLA 4HWPA 1HXDA 3R1ZA 3FVDA 2PPGA 1XANA 3L8KA 1XS2A 1TE6A 2QJNA 4J57A 4YRTA 2AKWA 4G8TA 4H83A 4RQEA 2RDXA 2X50A 4YREA 4BURA 2DQ0A 4XTVA 2WP5A 1NHPA 2E41A 3UFGA 2XTIA 3S5SA 3LC0A 1QE0A 4ROPA 4HWRA 4OP0A 4WJ3M 4NEWA 1EBHA 1AOGA 4P72C 3HXUA 4YRRA 2W54A 1GXFA 2WP6A 1EVLA 1TKKA 3DGBA 3HY0A 4YRMA 4H4ZA 1N62C 2PTWA 4HCLA 4YDQA 3MF2A 3UGQA 2W0HA 1D7YA 2DQ3A 2WPFA 3V3WA 2OVLA 4EQXA 3DG6A 2EJ9A 4UP8A 1NJ5A 3IC9A 2DXUA 1H4VB 3GC2A 1GGMA 1NJ6A 2DKGA 1X55A 4LA1A 3NVYB 2DZCA 3GD6A 3ZVHB 1RIQA 1YFTA 3QKEA 1N5XA 1DTNA 4GFIA 3A31A 3QNEA 1B70A 2ZZBA 2P0IA 3QFBA 4TVYA 1E22A 3I6EA 3L4GB 1JROA 5J04A 4HCHA 3OZMA 2XGTA 4EM4A 2ZIOA 2CDUA 1YGBA 3DSQA 1H4SA 4IT1A 1MOKA 1NELA 2O56A 4H2TA 2Q7HA 2GGIA 4M6UA 1N60C 4APNA 3NEMA 3LB8A 4P3OA 3IKLA 3RIRA 2PP3A 1FIQB 2ODRC 3CGCA 3A7AA 4FI4A 5HGQA 3NZGA 3V8LA 3EFSA 4LVMA 3SR6B 1GSNA 3FXGA 2AL2B 1VQZA 2GGJA 1ADYA 4UPAA 3TEHA 1FFUC 3DJJA 5G5GB 3HXZA 2CIMA 3TOYA 4E5TA 1ATIA 3JZUA 2PMQA 1MDLA 2GGHA 1E24A 4TQDA 1EC7A 3VC6A 2ARUA 1USYC 2FYKA 4H4VA 1TYPA 3H70A 4Q15A 3R25A 2PU1A 5FS8A 1GERA 2QHSA 3ZVHA 4HWOA 3VQVA 1EC8A 3FV9A 3UJSA 5FJUA 4M0XA 3TW9A 1JJCB 2ZC8A 4KWSA 4YRFA 3CXBA 4Z17A 3NVWB 2QDEA 4EO4A 2C8MA 1WPYA 1G5IA 1FFVC 3NXLA 1RM6B 2PA6A 1X2GA 2X8GA 3PWGA 2R9ZA 3RR1A 3PCOA 2P3ZA 2GQWA 3FG2P 3FJ4A 2Q7EA 5FS7A 3QO7A 2I4OA 3DESA 1FYFA 1ZKQA 2GH5A 3N4FA 3L2ZA 3V8JA 3CK5A 3EKGA 1LVLA 2ZZCA 2OPJA 3DFYA 3FCPA 3TCSA 1PYSB 3B97A 1F9CA 1H6VA 3DK4A 1E1OA 3MZNA 2HQMA 4CH3A 2XH2A 1B70B 5K1XA 2IY5B 3DEQA 4K8GA 1E1TA 3REXA 1R6WA 2AL2A 3ENLA 1VDVA 2J3NA 3U4FA 3IK4A 3IKMB 3VQWA 2RHSB 3TUPA 4WF2A 1BWCA 2OQYA 3PFRA 4HA8A 3T8QA 3LSSA 2A8XA 4EWJA 2FYMA 4RDXA 2EQ9A 1GRFA 4TWAA 2YAUA 1IYXA 3LXDA 3NVZB 2HXUA 3GY1A 3OPSA 3AM9A 1BBUA 4XEOA 1B76A 1WUEA 3UJEA 3L5OA 1KKOA 6ENLA 4G85A 2ZGWA 3TQPA 2XH4A 1NJ1A 2PGWA 2ZNIA 3SN1A 3W3SA 1NJ8A 1SJDA 3KFUA 2I4LA 4L87A 1ZK7A 2CFYA 2WOIA 1E9IA 4XU2A 3JW7A 3OTRA 3HPFA 4EQSA 1STZA 2PSNA 5C53B 4G7FA 1P43A 4JN8A 3OW1A 2ZZEA 1JCTA 2OZ8A 3NS1B 3HTZA 1N5WC 2E3TA 2XH7A 3JVAA 5FS6A 2RHQA 4H2UA 1H4QA 1HTTA 4F4RA 2AAQA 4P75C 1X56A 2X8CA 4GYPC 3EFRA 4P73A 4GRTA 3UJ2A 3RACA 2HXTA 3DERA 4HN8A 2PTYA 1ONFA 4LVLA 4RMFA 1SJCA 2P8BA 3TJ4A 2YVGA 3UCDA 5F5WA 4BW9A 1NDAA 4HT4A 4DHGA 1ZXIC 1TYTA 5FJOA 1LPFA 3UGVA 1B8AA 1NYRA 2ALYB 2RHSA 4P75A 3RF1A 1EC9A 1W6TA 2GR0A 4IZGA 4JHMA 5K1PA 1MDRA 4ZIBA 2OKTA 2NQLA 3RO6A 3GO2A 3D47A 3THUA 4YRNA 3UGTA 4CH5A 2ZT8A 3D46A 2E3CA 3HW2A 1GRAA 3IJQA 4WI1A 4CS3A 2QAEA 3EANA 4EQWA 1G51A 4H1ZA 3AN1A 4J15A 1FHUA 1KKRA 2POZA 4Q6GA 2CHRA 1WQWA 4H4TA 4JN7A 2MNRA 2DTOA 2GR2A 1C0AA 3RCYA 2AKZA 4YCUA 1MUCA 1ZDLA 3N6HA 3ERRA 3UXLA 3TEGA 4HNLA 4K88A 2DU7A 1WQ7A 3ES8A 1H2IA 2DEQA 1BZLA 2OLAA 4KPLA 4MMWA 7ENLA 2DTIA 4OLFA 1P48A 2YVFA 3PG6A 1GREA 1NU5A 3A7RA 2PTZA 3OP2A 1KD0A 4X2PA 3CAWA 3DG3A 3SJNA 2C3DA 4DX3A 1LYLA 2G4CA 5ER0A 3MEYA 4UP9A 3V7RA 1FEAA 1SJAA 3EEZA 4YRLA 2WOVA 3TJIA 1JEHA 3STPA 4ZOHB 4YWOA 4CS2A 1GRGA 3LSQA 4HNCA 4EQRA 2ARTA 1X2HA 1MRAA 3R0UA 4TVAB 3CYJA 1F3PA 5G5HB 2ZZFA 4PHCA 1QF6A 1EBGA 4XU3A 3RUXA 2EJFA 3OD1A 2GGGA 5ELOA 3RNMA 2PCEA 1V59A 1G5HA 2PMEA 3QPEA 4H2WA 1ZMCA 1KCZA 3EAOA 4CH6A 1SB3B 2ZT7A 4P72A 4HWTA 5EBKA 4HWSA 11ASA 3T9PA 4DPGA 3DJGX 2X8HA 3ZVIA 3HRIA 4KPRA 3P8TA 3UH0A 2CJBA 2W3SA 3HXVA 1JPDX 3VC5A 1YFRA 2DW7A 3CB3A 3DIPA 2EQ8A 2TPRA 4IP4A 2YVJA 3DGZA 1K4QA 3MQTA 3M4PA 3A7UA 1HC7A 3VCCA 2V6OA 3QO5A 4H4WA 3QTCA 4YP0A 2BCPA 4IL2A 4EX5A 1GV4A 2PGEA 1Z7MA 3IJIA 2XH0A 3BSMA 3ZLHA 2PMFA 4H2VA 3V7SA 2ZIMA 5GRTA 3HY1A 3BJSA 3KUMA 1GRTA 2WOWA 1B7YB 2ZTGA 2JK6A 1OJTA 2ZZ0A 4H19A 3DK8A 1NNHA 5JCLA 3T4WA 1ADJA 3M4QA 3H7VA 3NENA 4TVAA 1JPMA 3PWIA 4NCXA 2AMCA 3TTEA 3DK9A 3OZYA 3S47A 3R0KA 4YROA 4ZTZB 1X01A 3FJPA 4XTYA 1L8PA 5ENLA 3I6TA 2E65A 4P73C 4DQ2A 4LVJA 4EMIA 4ZCWA 4P3NA 3GRTA 1EFWA 2Q5HA 2ZINA 4E4UA 4H4RA 2GSHA 4ENLA 2ODRD 4H4UA 4XTZA 3BOXA 4IL0A 3PCOB 4IHCA 2GDQA 4YRQA 1WU7A 3CGDA 1XHCA 3DH9A 4UP7A 3Q6JA 1EQRA 4YRPA 3HXXA 3QTPA 3GD4A 5IDZA 4EM3A 2OG9A 4K87A 2E10A
chains in the Genus database with same CATH topology
1JJCA 5C52B 2DZ9A 1FO4A 1KOGA 4P74C 3REUA 2P5IA 4XU1A 2DXTA 3HXWA 1V97A 2DDZA 2P0LA 4LNSA 3RKXA 3EUB3 2E64A 3HFVA 3HRKA 1C0AA 12ASA 3PZCA 4KQEA 4CH4A 4G84A 4XEMA 3NETA 4P71C 2HNIA 1PYSA 1NYQA 2E5AA 2A8EA 3BFMA 2DTHA 2EJGA 1N9WA 2ZCEA 4LVKA 3G1ZA 5ELNA 4H2XB 1YFSA 3WQZA 1NJ2A 2CGHA 3B9JB 3R07C 4P71A 1EIYB 1BIAA 2J3LA 2I4MA 2EAYA 1J5WA 1H4TA 1SRYA 4H2SA 4TVWA 1KMNA 2QHTA 4BWAA 3HFZB 2E1HA 1BIBA 2QHVA 1KMMA 3R07A 4XTXA 1WYGA 5KNNA 3L4GA 3HRDC 1N63C 1EOVA 3V8KA 3I7FA 4YRJA 1ASYA 3VQXA 4P3PA 4YRSA 4K86A 3A32A 4RQFA 1JRPA 5E3IA 2DVEA 4TTVA 4CS4A 2W3RA 3TEHB 4X5OA 4LVIA 2ARSA 1SESA 3ICAA 1USYA 4H2XA 4YRCA 4TQFA 3V7CA 1BBWA 3BJUA 3HFZA 3E9IA 3RKWA 4XTUA 4KR3A 1Z7NA 2IY5A 1EIYA 1X54A 2ZZGA 2C7IA 3QO8A 2DJZA 4YPFA 1SERA 1IL2A 2ZR2A 1T3QC 4YRGA 3IG2A 3IALA 1L0WA 2J3MA 5C51B 4YCVA 4E51A 1WLEA 3A5YA 3VBBA 2EWNA 3ETRB 3NVVB 4YYEA 2AKWB 3RL6A 1WYDA 2Q7GA 4WJ4A 3P8VA 1B7YA 1ASZA 3AMZA 1YB3A 2Q5IA 3NRZB 2AMCB 3MF1A 4O2DA 4YRIA 2ZXFA 4PG3A 4AH6A 2CJAA 3L1AA 2ALYA 1N61C 3A74A 2ZNJA 1SETA 2ZR3A 2RHQB 4H2YA 3VQYA 4ZTUB 4KR2A 4P74A 3HXYA 2ZT6A 3P8YA 2EL9A 3E9HA 3NELA 3A5ZA 4YRKA 2DU5A 2CJ9A 1EVKA 4HVCA 3MQZA 3CMQA 3RKYA 4XTWA 1W66A 4H02A 2ZT5A 3RGLA 4XU0A 4YCWA 2NS6A 2I4NA 2W55A 2QHUA 4HWPA 1WNLA 1HXDA 4YRTA 2AKWA 4RQEA 4YREA 2DQ0A 4XTVA 2E41A 3UFGA 2XTIA 3LC0A 1QE0A 4HWRA 4OP0A 4WJ3M 4P72C 3HXUA 4YRRA 2W54A 1EVLA 3HY0A 4YRMA 4YDQA 1N62C 3MF2A 3UGQA 2DQ3A 4UP8A 2EJ9A 1NJ5A 2DXUA 1H4VB 1GGMA 1NJ6A 2DKGA 1X55A 3NVYB 2DZCA 1RIQA 1YFTA 1N5XA 3A31A 3QNEA 1B70A 4TVYA 1E22A 3L4GB 1JROA 2XGTA 2ZIOA 1YGBA 3DSQA 1H4SA 4H2TA 2Q7HA 1N60C 3NEMA 4P3OA 3IKLA 3RIRA 1FIQB 2ODRC 3A7AA 5HGQA 3V8LA 3EFSA 4LVMA 3SR6B 1VQZA 4UPAA 1ADYA 3TEHA 1FFUC 3HXZA 5G5GB 2CIMA 1ATIA 1E24A 4TQDA 4Q15A 2ARUA 1USYC 2FYKA 2QHSA 4HWOA 3VQVA 1JJCB 4YRFA 3NVWB 4EO4A 2C8MA 1WPYA 1G5IA 1FFVC 1RM6B 1X2GA 3PCOA 2Q7EA 3QO7A 2I4OA 1FYFA 3L2ZA 3V8JA 1PYSB 4CH3A 5K1XA 1E1OA 1B70B 2IY5B 3REXA 1VDVA 3IKMB 3VQWA 3TUPA 2RHSB 4WF2A 4HA8A 4RDXA 3LSSA 4TWAA 3NVZB 3AM9A 1BBUA 4XEOA 1B76A 4G85A 2ZGWA 1NJ1A 2ZNIA 3W3SA 1NJ8A 3KFUA 2I4LA 4L87A 4XU2A 5C53B 2ZZEA 3NS1B 3HTZA 1N5WC 2E3TA 2RHQA 4H2UA 1H4QA 1HTTA 4P75C 1X56A 3EFRA 4P73A 3RACA 4LVLA 4RMFA 4HT4A 5F5WA 4BW9A 1ZXIC 1B8AA 2RHSA 1NYRA 2ALYB 4P75A 3RF1A 5K1PA 4ZIBA 4YRNA 3UGTA 4CH5A 2ZT8A 2E3CA 4CS3A 4WI1A 1G51A 3AN1A 4J15A 4Q6GA 1WQWA 2DTOA 4YCUA 3ERRA 3TEGA 4K88A 2DU7A 1WQ7A 2DEQA 2DTIA 4OLFA 3A7RA 4YP0A 2G4CA 1LYLA 3MEYA 4UP9A 3V7RA 4YRLA 4ZOHB 4CS2A 3LSQA 2ARTA 1X2HA 1QF6A 4TVAB 2ZZFA 5G5HB 4PHCA 4XU3A 3RUXA 2EJFA 3OD1A 5ELOA 1G5HA 2PMEA 4H2WA 4CH6A 1SB3B 2ZT7A 4P72A 4HWTA 4HWSA 11ASA 4DPGA 3HRIA 3P8TA 3UH0A 2CJBA 2W3SA 3HXVA 1YFRA 3M4PA 3A7UA 1HC7A 3QO5A 3QTCA 4EX5A 1Z7MA 2PMFA 3V7SA 4H2VA 2ZIMA 3HY1A 1B7YB 2ZTGA 1NNHA 1ADJA 3M4QA 3NENA 4TVAA 4NCXA 2AMCA 4YROA 4ZTZB 1X01A 3FJPA 4XTYA 2E65A 4P73C 4DQ2A 4LVJA 4P3NA 1EFWA 2Q5HA 2ZINA 2ODRD 4XTZA 3PCOB 4YRQA 1WU7A 4UP7A 1EQRA 4YRPA 3HXXA 1E1TA 4K87A 2E10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJC A;  5C52 B;  2DZ9 A;  1FO4 A;  1KOG A;  4P74 C;  3REU A;  2P5I A;  4XU1 A;  2DXT A;  3HXW A;  1V97 A;  2DDZ A;  2P0L A;  4LNS A;  3RKX A;  3EUB 3;  2E64 A;  3HFV A;  3HRK A;  1C0A A;  12AS A;  3PZC A;  4KQE A;  4CH4 A;  4G84 A;  4XEM A;  3NET A;  4P71 C;  2HNI A;  1PYS A;  1NYQ A;  2E5A A;  3BFM A;  2DTH A;  2EJG A;  1N9W A;  2ZCE A;  3G1Z A;  5ELN A;  4H2X B;  1YFS A;  3WQZ A;  1NJ2 A;  2CGH A;  3B9J B;  3R07 C;  4P71 A;  1EIY B;  1BIA A;  2J3L A;  2I4M A;  2EAY A;  1J5W A;  1H4T A;  1SRY A;  4H2S A;  4TVW A;  1KMN A;  2QHT A;  4BWA A;  3HFZ B;  2E1H A;  1BIB A;  2QHV A;  1KMM A;  3R07 A;  4XTX A;  1WYG A;  5KNN A;  3L4G A;  3HRD C;  1N63 C;  1EOV A;  3V8K A;  3I7F A;  4YRJ A;  1ASY A;  3VQX A;  4P3P A;  4YRS A;  4K86 A;  3A32 A;  4RQF A;  1JRP A;  5E3I A;  2DVE A;  4TTV A;  4CS4 A;  2W3R A;  3TEH B;  4X5O A;  2ARS A;  1SES A;  3ICA A;  1USY A;  4H2X A;  4YRC A;  4TQF A;  3V7C A;  1BBW A;  3BJU A;  3HFZ A;  3E9I A;  3RKW A;  4XTU A;  4KR3 A;  1Z7N A;  2IY5 A;  1EIY A;  1X54 A;  2ZZG A;  2C7I A;  3QO8 A;  2DJZ A;  4YPF A;  1SER A;  1IL2 A;  2ZR2 A;  1T3Q C;  4YRG A;  3IG2 A;  3IAL A;  1L0W A;  2J3M A;  5C51 B;  4YCV A;  4E51 A;  1WLE A;  3A5Y A;  3VBB A;  2EWN A;  3ETR B;  3NVV B;  4YYE A;  2AKW B;  3RL6 A;  1WYD A;  2Q7G A;  4WJ4 A;  3P8V A;  1B7Y A;  1ASZ A;  3AMZ A;  1YB3 A;  2Q5I A;  3NRZ B;  2AMC B;  3MF1 A;  4O2D A;  4YRI A;  2ZXF A;  4PG3 A;  4AH6 A;  2CJA A;  3L1A A;  2ALY A;  1N61 C;  3A74 A;  2ZNJ A;  1SET A;  2ZR3 A;  2RHQ B;  4H2Y A;  3VQY A;  4ZTU B;  4KR2 A;  4P74 A;  3HXY A;  2ZT6 A;  3P8Y A;  2EL9 A;  3E9H A;  3NEL A;  3A5Z A;  4YRK A;  2DU5 A;  2CJ9 A;  1EVK A;  4HVC A;  3CMQ A;  3RKY A;  4XTW A;  1W66 A;  4H02 A;  2ZT5 A;  3RGL A;  4XU0 A;  4YCW A;  2I4N A;  2W55 A;  2QHU A;  4HWP A;  1WNL A;  1HXD A;  4YRT A;  2AKW A;  4RQE A;  4YRE A;  2DQ0 A;  4XTV A;  2E41 A;  3UFG A;  2XTI A;  3LC0 A;  1QE0 A;  4HWR A;  4OP0 A;  4WJ3 M;  4P72 C;  3HXU A;  4YRR A;  2W54 A;  1EVL A;  3HY0 A;  4YRM A;  4YDQ A;  1N62 C;  3MF2 A;  3UGQ A;  2DQ3 A;  4UP8 A;  2EJ9 A;  1NJ5 A;  2DXU A;  1H4V B;  1GGM A;  1NJ6 A;  2DKG A;  1X55 A;  3NVY B;  2DZC A;  1RIQ A;  1YFT A;  1N5X A;  3A31 A;  3QNE A;  1B70 A;  4TVY A;  1E22 A;  3L4G B;  1JRO A;  2XGT A;  2ZIO A;  1YGB A;  3DSQ A;  1H4S A;  4H2T A;  2Q7H A;  1N60 C;  3NEM A;  4P3O A;  3IKL A;  3RIR A;  1FIQ B;  2ODR C;  3A7A A;  5HGQ A;  3V8L A;  3EFS A;  3SR6 B;  1VQZ A;  4UPA A;  1ADY A;  3TEH A;  1FFU C;  3HXZ A;  5G5G B;  2CIM A;  1ATI A;  1E24 A;  4TQD A;  4Q15 A;  2ARU A;  1USY C;  2FYK A;  2QHS A;  4HWO A;  3VQV A;  1JJC B;  4YRF A;  3NVW B;  4EO4 A;  2C8M A;  1WPY A;  1G5I A;  1FFV C;  1RM6 B;  1X2G A;  3PCO A;  2Q7E A;  3QO7 A;  2I4O A;  1FYF A;  3L2Z A;  3V8J A;  1PYS B;  4CH3 A;  5K1X A;  1E1O A;  1B70 B;  2IY5 B;  3REX A;  1VDV A;  3IKM B;  3VQW A;  3TUP A;  2RHS B;  4WF2 A;  4HA8 A;  4RDX A;  3LSS A;  4TWA A;  3NVZ B;  3AM9 A;  1BBU A;  4XEO A;  1B76 A;  4G85 A;  2ZGW A;  1NJ1 A;  2ZNI A;  3W3S A;  1NJ8 A;  3KFU A;  2I4L A;  4L87 A;  4XU2 A;  5C53 B;  2ZZE A;  3NS1 B;  3HTZ A;  1N5W C;  2E3T A;  2RHQ A;  4H2U A;  1H4Q A;  1HTT A;  4P75 C;  1X56 A;  3EFR A;  4P73 A;  3RAC A;  4RMF A;  5F5W A;  4BW9 A;  1ZXI C;  1B8A A;  2RHS A;  1NYR A;  2ALY B;  4P75 A;  3RF1 A;  5K1P A;  4ZIB A;  4YRN A;  3UGT A;  4CH5 A;  2ZT8 A;  2E3C A;  4CS3 A;  4WI1 A;  1G51 A;  3AN1 A;  4J15 A;  4Q6G A;  1WQW A;  2DTO A;  4YCU A;  3ERR A;  3TEG A;  4K88 A;  2DU7 A;  1WQ7 A;  2DEQ A;  2DTI A;  4OLF A;  3A7R A;  4YP0 A;  2G4C A;  1LYL A;  3MEY A;  4UP9 A;  3V7R A;  4YRL A;  4ZOH B;  4CS2 A;  3LSQ A;  2ART A;  1X2H A;  1QF6 A;  4TVA B;  2ZZF A;  5G5H B;  4PHC A;  4XU3 A;  3RUX A;  2EJF A;  3OD1 A;  5ELO A;  1G5H A;  2PME A;  4H2W A;  4CH6 A;  1SB3 B;  2ZT7 A;  4P72 A;  4HWT A;  4HWS A;  11AS A;  4DPG A;  3HRI A;  3P8T A;  3UH0 A;  2CJB A;  2W3S A;  3HXV A;  1YFR A;  3M4P A;  3A7U A;  1HC7 A;  3QO5 A;  3QTC A;  4EX5 A;  1Z7M A;  2PMF A;  3V7S A;  4H2V A;  2ZIM A;  3HY1 A;  1B7Y B;  2ZTG A;  1NNH A;  1ADJ A;  3M4Q A;  3NEN A;  4TVA A;  4NCX A;  2AMC A;  4YRO A;  4ZTZ B;  1X01 A;  3FJP A;  4XTY A;  2E65 A;  4P73 C;  4DQ2 A;  4P3N A;  1EFW A;  2Q5H A;  2ZIN A;  2ODR D;  4XTZ A;  3PCO B;  4YRQ A;  1WU7 A;  4UP7 A;  1EQR A;  4YRP A;  3HXX A;  1E1T A;  4K87 A;  2E10 A; 
#chains in the Genus database with same CATH topology
 2OZ3 A;  1JJC A;  3GRS A;  5C52 B;  4DYE A;  2EQ7 A;  2WBA A;  1FO4 A;  2DZ9 A;  1NHR A;  4ADW A;  4P74 C;  1KOG A;  2OQH A;  2OO6 A;  4LII A;  2GRT A;  3REU A;  2P5I A;  4XU1 A;  2X99 A;  2DXT A;  3HXW A;  1NPX A;  1V97 A;  3P3B A;  2DDZ A;  2NPX A;  2P0L A;  3GD3 A;  3VA8 A;  4LNS A;  3RKX A;  1ELS A;  2FKP A;  3EUB 3;  2E64 A;  3HFV A;  3HRK A;  12AS A;  3R11 A;  3PZC A;  2OFJ A;  4KQE A;  4CH4 A;  4YWS A;  4G84 A;  2AL1 A;  3D9X A;  4XEM A;  4H4Q A;  3NET A;  4P71 C;  3FYY A;  1PYS A;  1Q1W A;  5FJP A;  2QQ6 A;  2HNI A;  3RGT A;  1NYQ A;  2E5A A;  1XPY A;  1FHV A;  2GR1 A;  3H8A A;  2A8E A;  3BFM A;  5FJR A;  4E6M A;  2DTH A;  2EJG A;  3N4E A;  2AKM A;  3CGE A;  1N9W A;  2ZCE A;  4A6G A;  2NVK X;  1XDI A;  4LVK A;  2QGY A;  1PDZ A;  2PU0 A;  2QJJ A;  3IJL A;  1ONE A;  2P88 A;  5U25 A;  3SQS A;  3G1Z A;  5ELN A;  4H2X B;  3I4K A;  1PDY A;  3MWC A;  4Z1Y A;  3CXO A;  3T6C A;  1YFS A;  3WQZ A;  1NJ2 A;  2ZAD A;  5JCM A;  2GL5 A;  2F5Z A;  4HCD A;  2CGH A;  3B9J B;  3R07 C;  4EMW A;  5FJT A;  3RIT A;  4P71 A;  1EIY B;  4A35 A;  1BIA A;  2J3L A;  2PP0 A;  2OZT A;  3R10 A;  2I4M A;  4H4Y A;  4K1W A;  2EAY A;  2I5Q A;  2WPC A;  1J5W A;  3CGB A;  5FMH A;  1H4T A;  1SRY A;  4GGH A;  4TVW A;  1KMN A;  2QHT A;  4H2S A;  1DNC A;  3DFH A;  4BWA A;  5JCI A;  3URH A;  2MUC A;  3HFZ B;  1Q1R A;  2POD A;  1BIB A;  2E1H A;  3NFU A;  2QHV A;  2ONE A;  1KMM A;  3R07 A;  4XTX A;  1WYG A;  3PK7 A;  1JDF A;  2YQU A;  4H2H A;  4H50 A;  3SSZ A;  3VDG A;  5KNN A;  3L4G A;  3HRD C;  4EMJ A;  4MGG A;  1N63 C;  2PTX A;  3LAD A;  4GME A;  4K8D A;  1EOV A;  3V8K A;  2QJM A;  4BV6 A;  3I7F A;  4DXK A;  1TZZ A;  3P93 A;  3MKC A;  4KEM A;  4YRJ A;  3VQX A;  4P3P A;  1ASY A;  4YRS A;  2V3B A;  4K86 A;  3A32 A;  4E8G A;  4RQF A;  1JRP A;  4GR1 A;  5E3I A;  2DVE A;  3VFC A;  4TTV A;  3UJF A;  4CS4 A;  2PS2 A;  2W3R A;  3TEH B;  4M52 A;  1R0M A;  4FX9 A;  3Q45 A;  2ARS A;  4X5O A;  4LVI A;  3MSY A;  1SES A;  2BC1 A;  2P8C A;  2DW6 A;  3ICA A;  1NHS A;  1USY A;  4H2X A;  4YRC A;  4TQF A;  3UXK A;  5EU9 A;  4KT2 A;  3V7C A;  3TWB A;  2GR3 A;  3NO1 A;  4DN1 A;  3CT2 A;  1BBW A;  5BOF A;  2GGE A;  3BJU A;  3P0W A;  3HFZ A;  2RAB A;  3UCC A;  3E9I A;  3RKW A;  5JCN A;  3DGH A;  3SN0 A;  4XTU A;  1EBD A;  4JQ9 A;  4IP5 A;  4KR3 A;  1Z7N A;  1SJB A;  2IY5 A;  1EIY A;  1X54 A;  2ZZG A;  3H12 A;  3N6J A;  3V5F A;  2C7I A;  4DWD A;  4DNA A;  3QO8 A;  2DJZ A;  3MY9 A;  3TWA A;  4YPF A;  1SER A;  1BQG A;  3K1G A;  1IL2 A;  2ZR2 A;  1T3Q C;  1FEB A;  3IG2 A;  4YRG A;  3IAL A;  1L0W A;  2J3M A;  5C51 B;  4FP1 A;  4YCV A;  4E51 A;  4J1O A;  4H4X A;  1YQZ A;  1WLE A;  4J3Z A;  2XSX A;  4GGB A;  4H4S A;  1M6I A;  4GYP A;  3SBF A;  3U9I A;  3A5Y A;  1NHQ A;  3VBB A;  3MUC A;  3II4 A;  1F8W A;  5U1O A;  3Q4D A;  4NEV A;  2EWN A;  3ETR B;  3NVV B;  4YYE A;  2AKW B;  1JOA A;  1YEY A;  5KVI A;  3RL6 A;  3ZLG A;  1WYD A;  2Q7G A;  3EF6 A;  4WJ4 A;  5KVH A;  1B7Y A;  3KLJ A;  3P8V A;  1ASZ A;  4JDR A;  2HNE A;  3AMZ A;  2EQ6 A;  1YB3 A;  2Q5I A;  5TR3 A;  4A3R A;  3NRZ B;  2AMC B;  4GIS A;  3MF1 A;  4O2D A;  4YRI A;  1DXL A;  2ZXF A;  4K7Z A;  5JRB A;  4MKS A;  4PG3 A;  4AH6 A;  3QLD A;  2HZG A;  2CJA A;  4K2S A;  3L1A A;  2ALY A;  3OC4 A;  1N61 C;  4H4P A;  3A74 A;  2ZNJ A;  1MO9 A;  2WPE A;  3VCN A;  1SET A;  2ZR3 A;  3O0H A;  3V4B A;  1FEC A;  1ECQ A;  3V5C A;  1BKH A;  1ZY8 A;  2RHQ B;  4H2Y A;  3VQY A;  3SQP A;  4ZTU B;  4KR2 A;  1WUF A;  4P74 A;  3HXY A;  1S7M A;  4GIR A;  5BOE A;  1MNS A;  1ZX9 A;  2QDD A;  3RRA A;  2PP1 A;  2ZT6 A;  3UJR A;  3ZLF A;  4HPN A;  3P8Y A;  2V3A A;  1OEP A;  1GRH A;  3DDM A;  2EL9 A;  3E9H A;  3NEL A;  1KN0 A;  3SN4 A;  3A5Z A;  4YRK A;  2DU5 A;  4ZA0 A;  2CJ9 A;  2BC0 A;  1EVK A;  4HVC A;  2C3C A;  3MQZ A;  3CMQ A;  1GRB A;  3ES7 A;  3RKY A;  1GES A;  3QFA A;  4FDC B;  1ZMD A;  1W66 A;  2ZT5 A;  4H02 A;  4XTW A;  1GEU A;  3RGL A;  1GET A;  5JCK A;  3QN3 A;  4XU0 A;  4YCW A;  2XGZ A;  1RVK A;  2OX4 A;  3H4K A;  5FS9 A;  2NS6 A;  2I4N A;  2W55 A;  4HYR A;  4E4F A;  3DG7 A;  2QHU A;  2QVH A;  4J56 A;  1WNL A;  4HWP A;  1HXD A;  3R1Z A;  3FVD A;  2PPG A;  1XAN A;  3L8K A;  1XS2 A;  1TE6 A;  2QJN A;  4J57 A;  4YRT A;  2AKW A;  4G8T A;  4H83 A;  4RQE A;  2RDX A;  2X50 A;  4YRE A;  4BUR A;  2DQ0 A;  4XTV A;  2WP5 A;  1NHP A;  2E41 A;  3UFG A;  2XTI A;  3S5S A;  3LC0 A;  1QE0 A;  4ROP A;  4HWR A;  4OP0 A;  4WJ3 M;  4NEW A;  1EBH A;  1AOG A;  4P72 C;  3HXU A;  4YRR A;  2W54 A;  1GXF A;  2WP6 A;  1EVL A;  1TKK A;  3DGB A;  3HY0 A;  4YRM A;  4H4Z A;  1N62 C;  2PTW A;  4HCL A;  4YDQ A;  3MF2 A;  3UGQ A;  2W0H A;  1D7Y A;  2DQ3 A;  2WPF A;  3V3W A;  2OVL A;  4EQX A;  3DG6 A;  2EJ9 A;  4UP8 A;  1NJ5 A;  3IC9 A;  2DXU A;  1H4V B;  3GC2 A;  1GGM A;  1NJ6 A;  2DKG A;  1X55 A;  4LA1 A;  3NVY B;  2DZC A;  3GD6 A;  3ZVH B;  1RIQ A;  1YFT A;  3QKE A;  1N5X A;  1DTN A;  4GFI A;  3A31 A;  3QNE A;  1B70 A;  2ZZB A;  2P0I A;  3QFB A;  4TVY A;  1E22 A;  3I6E A;  3L4G B;  1JRO A;  5J04 A;  4HCH A;  3OZM A;  2XGT A;  4EM4 A;  2ZIO A;  2CDU A;  1YGB A;  3DSQ A;  1H4S A;  4IT1 A;  1MOK A;  1NEL A;  2O56 A;  4H2T A;  2Q7H A;  2GGI A;  4M6U A;  1N60 C;  4APN A;  3NEM A;  3LB8 A;  4P3O A;  3IKL A;  3RIR A;  2PP3 A;  1FIQ B;  2ODR C;  3CGC A;  3A7A A;  4FI4 A;  5HGQ A;  3NZG A;  3V8L A;  3EFS A;  4LVM A;  3SR6 B;  1GSN A;  3FXG A;  2AL2 B;  1VQZ A;  2GGJ A;  1ADY A;  4UPA A;  3TEH A;  1FFU C;  3DJJ A;  5G5G B;  3HXZ A;  2CIM A;  3TOY A;  4E5T A;  1ATI A;  3JZU A;  2PMQ A;  1MDL A;  2GGH A;  1E24 A;  4TQD A;  1EC7 A;  3VC6 A;  2ARU A;  1USY C;  2FYK A;  4H4V A;  1TYP A;  3H70 A;  4Q15 A;  3R25 A;  2PU1 A;  5FS8 A;  1GER A;  2QHS A;  3ZVH A;  4HWO A;  3VQV A;  1EC8 A;  3FV9 A;  3UJS A;  5FJU A;  4M0X A;  3TW9 A;  1JJC B;  2ZC8 A;  4KWS A;  4YRF A;  3CXB A;  4Z17 A;  3NVW B;  2QDE A;  4EO4 A;  2C8M A;  1WPY A;  1G5I A;  1FFV C;  3NXL A;  1RM6 B;  2PA6 A;  1X2G A;  2X8G A;  3PWG A;  2R9Z A;  3RR1 A;  3PCO A;  2P3Z A;  2GQW A;  3FG2 P;  3FJ4 A;  2Q7E A;  5FS7 A;  3QO7 A;  2I4O A;  3DES A;  1FYF A;  1ZKQ A;  2GH5 A;  3N4F A;  3L2Z A;  3V8J A;  3CK5 A;  3EKG A;  1LVL A;  2ZZC A;  2OPJ A;  3DFY A;  3FCP A;  3TCS A;  1PYS B;  3B97 A;  1F9C A;  1H6V A;  3DK4 A;  1E1O A;  3MZN A;  2HQM A;  4CH3 A;  2XH2 A;  1B70 B;  5K1X A;  2IY5 B;  3DEQ A;  4K8G A;  1E1T A;  3REX A;  1R6W A;  2AL2 A;  3ENL A;  1VDV A;  2J3N A;  3U4F A;  3IK4 A;  3IKM B;  3VQW A;  2RHS B;  3TUP A;  4WF2 A;  1BWC A;  2OQY A;  3PFR A;  4HA8 A;  3T8Q A;  3LSS A;  2A8X A;  4EWJ A;  2FYM A;  4RDX A;  2EQ9 A;  1GRF A;  4TWA A;  2YAU A;  1IYX A;  3LXD A;  3NVZ B;  2HXU A;  3GY1 A;  3OPS A;  3AM9 A;  1BBU A;  4XEO A;  1B76 A;  1WUE A;  3UJE A;  3L5O A;  1KKO A;  6ENL A;  4G85 A;  2ZGW A;  3TQP A;  2XH4 A;  1NJ1 A;  2PGW A;  2ZNI A;  3SN1 A;  3W3S A;  1NJ8 A;  1SJD A;  3KFU A;  2I4L A;  4L87 A;  1ZK7 A;  2CFY A;  2WOI A;  1E9I A;  4XU2 A;  3JW7 A;  3OTR A;  3HPF A;  4EQS A;  1STZ A;  2PSN A;  5C53 B;  4G7F A;  1P43 A;  4JN8 A;  3OW1 A;  2ZZE A;  1JCT A;  2OZ8 A;  3NS1 B;  3HTZ A;  1N5W C;  2E3T A;  2XH7 A;  3JVA A;  5FS6 A;  2RHQ A;  4H2U A;  1H4Q A;  1HTT A;  4F4R A;  2AAQ A;  4P75 C;  1X56 A;  2X8C A;  4GYP C;  3EFR A;  4P73 A;  4GRT A;  3UJ2 A;  3RAC A;  2HXT A;  3DER A;  4HN8 A;  2PTY A;  1ONF A;  4LVL A;  4RMF A;  1SJC A;  2P8B A;  3TJ4 A;  2YVG A;  3UCD A;  5F5W A;  4BW9 A;  1NDA A;  4HT4 A;  4DHG A;  1ZXI C;  1TYT A;  5FJO A;  1LPF A;  3UGV A;  1B8A A;  1NYR A;  2ALY B;  2RHS A;  4P75 A;  3RF1 A;  1EC9 A;  1W6T A;  2GR0 A;  4IZG A;  4JHM A;  5K1P A;  1MDR A;  4ZIB A;  2OKT A;  2NQL A;  3RO6 A;  3GO2 A;  3D47 A;  3THU A;  4YRN A;  3UGT A;  4CH5 A;  2ZT8 A;  3D46 A;  2E3C A;  3HW2 A;  1GRA A;  3IJQ A;  4WI1 A;  4CS3 A;  2QAE A;  3EAN A;  4EQW A;  1G51 A;  4H1Z A;  3AN1 A;  4J15 A;  1FHU A;  1KKR A;  2POZ A;  4Q6G A;  2CHR A;  1WQW A;  4H4T A;  4JN7 A;  2MNR A;  2DTO A;  2GR2 A;  1C0A A;  3RCY A;  2AKZ A;  4YCU A;  1MUC A;  1ZDL A;  3N6H A;  3ERR A;  3UXL A;  3TEG A;  4HNL A;  4K88 A;  2DU7 A;  1WQ7 A;  3ES8 A;  1H2I A;  2DEQ A;  1BZL A;  2OLA A;  4KPL A;  4MMW A;  7ENL A;  2DTI A;  4OLF A;  1P48 A;  2YVF A;  3PG6 A;  1GRE A;  1NU5 A;  3A7R A;  2PTZ A;  3OP2 A;  1KD0 A;  4X2P A;  3CAW A;  3DG3 A;  3SJN A;  2C3D A;  4DX3 A;  1LYL A;  2G4C A;  5ER0 A;  3MEY A;  4UP9 A;  3V7R A;  1FEA A;  1SJA A;  3EEZ A;  4YRL A;  2WOV A;  3TJI A;  1JEH A;  3STP A;  4ZOH B;  4YWO A;  4CS2 A;  1GRG A;  3LSQ A;  4HNC A;  4EQR A;  2ART A;  1X2H A;  1MRA A;  3R0U A;  4TVA B;  3CYJ A;  1F3P A;  5G5H B;  2ZZF A;  4PHC A;  1QF6 A;  1EBG A;  4XU3 A;  3RUX A;  2EJF A;  3OD1 A;  2GGG A;  5ELO A;  3RNM A;  2PCE A;  1V59 A;  1G5H A;  2PME A;  3QPE A;  4H2W A;  1ZMC A;  1KCZ A;  3EAO A;  4CH6 A;  1SB3 B;  2ZT7 A;  4P72 A;  4HWT A;  5EBK A;  4HWS A;  11AS A;  3T9P A;  4DPG A;  3DJG X;  2X8H A;  3ZVI A;  3HRI A;  4KPR A;  3P8T A;  3UH0 A;  2CJB A;  2W3S A;  3HXV A;  1JPD X;  3VC5 A;  1YFR A;  2DW7 A;  3CB3 A;  3DIP A;  2EQ8 A;  2TPR A;  4IP4 A;  2YVJ A;  3DGZ A;  1K4Q A;  3MQT A;  3M4P A;  3A7U A;  1HC7 A;  3VCC A;  2V6O A;  3QO5 A;  4H4W A;  3QTC A;  4YP0 A;  2BCP A;  4IL2 A;  4EX5 A;  1GV4 A;  2PGE A;  1Z7M A;  3IJI A;  2XH0 A;  3BSM A;  3ZLH A;  2PMF A;  4H2V A;  3V7S A;  2ZIM A;  5GRT A;  3HY1 A;  3BJS A;  3KUM A;  1GRT A;  2WOW A;  1B7Y B;  2ZTG A;  2JK6 A;  1OJT A;  2ZZ0 A;  4H19 A;  3DK8 A;  1NNH A;  5JCL A;  3T4W A;  1ADJ A;  3M4Q A;  3H7V A;  3NEN A;  4TVA A;  1JPM A;  3PWI A;  4NCX A;  2AMC A;  3TTE A;  3DK9 A;  3OZY A;  3S47 A;  3R0K A;  4YRO A;  4ZTZ B;  1X01 A;  3FJP A;  4XTY A;  1L8P A;  5ENL A;  3I6T A;  2E65 A;  4P73 C;  4DQ2 A;  4LVJ A;  4EMI A;  4ZCW A;  4P3N A;  3GRT A;  1EFW A;  2Q5H A;  2ZIN A;  4E4U A;  4H4R A;  2GSH A;  4ENL A;  2ODR D;  4H4U A;  4XTZ A;  3BOX A;  4IL0 A;  3PCO B;  4IHC A;  2GDQ A;  4YRQ A;  1WU7 A;  3CGD A;  1XHC A;  3DH9 A;  4UP7 A;  3Q6J A;  1EQR A;  4YRP A;  3HXX A;  3QTP A;  3GD4 A;  5IDZ A;  4EM3 A;  2OG9 A;  4K87 A;  2E10 A; 
#chains in the Genus database with same CATH homology
 1JJC A;  5C52 B;  2DZ9 A;  1FO4 A;  1KOG A;  4P74 C;  3REU A;  2P5I A;  4XU1 A;  2DXT A;  3HXW A;  1V97 A;  2DDZ A;  2P0L A;  4LNS A;  3RKX A;  3EUB 3;  2E64 A;  3HFV A;  3HRK A;  1C0A A;  12AS A;  3PZC A;  4KQE A;  4CH4 A;  4G84 A;  4XEM A;  3NET A;  4P71 C;  2HNI A;  1PYS A;  1NYQ A;  2E5A A;  2A8E A;  3BFM A;  2DTH A;  2EJG A;  1N9W A;  2ZCE A;  4LVK A;  3G1Z A;  5ELN A;  4H2X B;  1YFS A;  3WQZ A;  1NJ2 A;  2CGH A;  3B9J B;  3R07 C;  4P71 A;  1EIY B;  1BIA A;  2J3L A;  2I4M A;  2EAY A;  1J5W A;  1H4T A;  1SRY A;  4H2S A;  4TVW A;  1KMN A;  2QHT A;  4BWA A;  3HFZ B;  2E1H A;  1BIB A;  2QHV A;  1KMM A;  3R07 A;  4XTX A;  1WYG A;  5KNN A;  3L4G A;  3HRD C;  1N63 C;  1EOV A;  3V8K A;  3I7F A;  4YRJ A;  1ASY A;  3VQX A;  4P3P A;  4YRS A;  4K86 A;  3A32 A;  4RQF A;  1JRP A;  5E3I A;  2DVE A;  4TTV A;  4CS4 A;  2W3R A;  3TEH B;  4X5O A;  4LVI A;  2ARS A;  1SES A;  3ICA A;  1USY A;  4H2X A;  4YRC A;  4TQF A;  3V7C A;  1BBW A;  3BJU A;  3HFZ A;  3E9I A;  3RKW A;  4XTU A;  4KR3 A;  1Z7N A;  2IY5 A;  1EIY A;  1X54 A;  2ZZG A;  2C7I A;  3QO8 A;  2DJZ A;  4YPF A;  1SER A;  1IL2 A;  2ZR2 A;  1T3Q C;  4YRG A;  3IG2 A;  3IAL A;  1L0W A;  2J3M A;  5C51 B;  4YCV A;  4E51 A;  1WLE A;  3A5Y A;  3VBB A;  2EWN A;  3ETR B;  3NVV B;  4YYE A;  2AKW B;  3RL6 A;  1WYD A;  2Q7G A;  4WJ4 A;  3P8V A;  1B7Y A;  1ASZ A;  3AMZ A;  1YB3 A;  2Q5I A;  3NRZ B;  2AMC B;  3MF1 A;  4O2D A;  4YRI A;  2ZXF A;  4PG3 A;  4AH6 A;  2CJA A;  3L1A A;  2ALY A;  1N61 C;  3A74 A;  2ZNJ A;  1SET A;  2ZR3 A;  2RHQ B;  4H2Y A;  3VQY A;  4ZTU B;  4KR2 A;  4P74 A;  3HXY A;  2ZT6 A;  3P8Y A;  2EL9 A;  3E9H A;  3NEL A;  3A5Z A;  4YRK A;  2DU5 A;  2CJ9 A;  1EVK A;  4HVC A;  3MQZ A;  3CMQ A;  3RKY A;  4XTW A;  1W66 A;  4H02 A;  2ZT5 A;  3RGL A;  4XU0 A;  4YCW A;  2NS6 A;  2I4N A;  2W55 A;  2QHU A;  4HWP A;  1WNL A;  1HXD A;  4YRT A;  2AKW A;  4RQE A;  4YRE A;  2DQ0 A;  4XTV A;  2E41 A;  3UFG A;  2XTI A;  3LC0 A;  1QE0 A;  4HWR A;  4OP0 A;  4WJ3 M;  4P72 C;  3HXU A;  4YRR A;  2W54 A;  1EVL A;  3HY0 A;  4YRM A;  4YDQ A;  1N62 C;  3MF2 A;  3UGQ A;  2DQ3 A;  4UP8 A;  2EJ9 A;  1NJ5 A;  2DXU A;  1H4V B;  1GGM A;  1NJ6 A;  2DKG A;  1X55 A;  3NVY B;  2DZC A;  1RIQ A;  1YFT A;  1N5X A;  3A31 A;  3QNE A;  1B70 A;  4TVY A;  1E22 A;  3L4G B;  1JRO A;  2XGT A;  2ZIO A;  1YGB A;  3DSQ A;  1H4S A;  4H2T A;  2Q7H A;  1N60 C;  3NEM A;  4P3O A;  3IKL A;  3RIR A;  1FIQ B;  2ODR C;  3A7A A;  5HGQ A;  3V8L A;  3EFS A;  4LVM A;  3SR6 B;  1VQZ A;  4UPA A;  1ADY A;  3TEH A;  1FFU C;  3HXZ A;  5G5G B;  2CIM A;  1ATI A;  1E24 A;  4TQD A;  4Q15 A;  2ARU A;  1USY C;  2FYK A;  2QHS A;  4HWO A;  3VQV A;  1JJC B;  4YRF A;  3NVW B;  4EO4 A;  2C8M A;  1WPY A;  1G5I A;  1FFV C;  1RM6 B;  1X2G A;  3PCO A;  2Q7E A;  3QO7 A;  2I4O A;  1FYF A;  3L2Z A;  3V8J A;  1PYS B;  4CH3 A;  5K1X A;  1E1O A;  1B70 B;  2IY5 B;  3REX A;  1VDV A;  3IKM B;  3VQW A;  3TUP A;  2RHS B;  4WF2 A;  4HA8 A;  4RDX A;  3LSS A;  4TWA A;  3NVZ B;  3AM9 A;  1BBU A;  4XEO A;  1B76 A;  4G85 A;  2ZGW A;  1NJ1 A;  2ZNI A;  3W3S A;  1NJ8 A;  3KFU A;  2I4L A;  4L87 A;  4XU2 A;  5C53 B;  2ZZE A;  3NS1 B;  3HTZ A;  1N5W C;  2E3T A;  2RHQ A;  4H2U A;  1H4Q A;  1HTT A;  4P75 C;  1X56 A;  3EFR A;  4P73 A;  3RAC A;  4LVL A;  4RMF A;  4HT4 A;  5F5W A;  4BW9 A;  1ZXI C;  1B8A A;  2RHS A;  1NYR A;  2ALY B;  4P75 A;  3RF1 A;  5K1P A;  4ZIB A;  4YRN A;  3UGT A;  4CH5 A;  2ZT8 A;  2E3C A;  4CS3 A;  4WI1 A;  1G51 A;  3AN1 A;  4J15 A;  4Q6G A;  1WQW A;  2DTO A;  4YCU A;  3ERR A;  3TEG A;  4K88 A;  2DU7 A;  1WQ7 A;  2DEQ A;  2DTI A;  4OLF A;  3A7R A;  4YP0 A;  2G4C A;  1LYL A;  3MEY A;  4UP9 A;  3V7R A;  4YRL A;  4ZOH B;  4CS2 A;  3LSQ A;  2ART A;  1X2H A;  1QF6 A;  4TVA B;  2ZZF A;  5G5H B;  4PHC A;  4XU3 A;  3RUX A;  2EJF A;  3OD1 A;  5ELO A;  1G5H A;  2PME A;  4H2W A;  4CH6 A;  1SB3 B;  2ZT7 A;  4P72 A;  4HWT A;  4HWS A;  11AS A;  4DPG A;  3HRI A;  3P8T A;  3UH0 A;  2CJB A;  2W3S A;  3HXV A;  1YFR A;  3M4P A;  3A7U A;  1HC7 A;  3QO5 A;  3QTC A;  4EX5 A;  1Z7M A;  2PMF A;  3V7S A;  4H2V A;  2ZIM A;  3HY1 A;  1B7Y B;  2ZTG A;  1NNH A;  1ADJ A;  3M4Q A;  3NEN A;  4TVA A;  4NCX A;  2AMC A;  4YRO A;  4ZTZ B;  1X01 A;  3FJP A;  4XTY A;  2E65 A;  4P73 C;  4DQ2 A;  4LVJ A;  4P3N A;  1EFW A;  2Q5H A;  2ZIN A;  2ODR D;  4XTZ A;  3PCO B;  4YRQ A;  1WU7 A;  4UP7 A;  1EQR A;  4YRP A;  3HXX A;  1E1T A;  4K87 A;  2E10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...