2E5AA

Crystal structure of bovine lipoyltransferase in complex with lipoyl-amp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
343
structure length
329
Chain Sequence
GLILQSISNDVYHNLAVEDWIHDHMNLEGKPVLFLWRNSPTVVIGRHQNPWQECNLNLMREEGVKLARRRSGGGTVYHDMGNINLTFFTTKKKYDRMENLKLVVRALKAVHPHLDVQATKRFDLLLDGQFKISGTASKIGRNAAYHHCTLLCGTDGTFLSSLLKSPYQGIRSNATASTPALVKNLMEKDPTLTCEVVINAVATEYATSHQIDNHIHLINPTDETVFPGINSKAIELQTWEWIYGKTPKFSVDTSFTVLHSHVEIKVFIDVKNGRIEVCNIEAPDHWLPLEICDQLNSSLIGSKFSPIETTVDELHSKWNILCEKIKGIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoyltransferase 1
publication title Crystal structure of bovine Lipoyltransferase in complex with lipoyl-AMP
pubmed doi rcsb
source organism Bos taurus
molecule tags Ligase
total genus 108
structure length 329
sequence length 343
ec nomenclature ec 6.-.-.-:
pdb deposition date 2006-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2e5aA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e5aA01
1JROA 4YRCA 1VQZA 4OLFA 3HRKA 1GGMA 3DSQA 1BBUA 2IY5A 3UFGA 2AMCA 4YP0A 1WU7A 3AM9A 1ZXIC 1E1TA 4H2YA 2RHQB 1L0WA 4XU0A 2Q7HA 1N5XA 4H2XA 1SB3B 3MF2A 5F5WA 3A74A 2I4MA 3RKWA 3BFMA 3FJPA 4P3NA 4P74C 1LYLA 2RHQA 4AH6A 1B7YA 4UP9A 4L87A 1SESA 3EFRA 3SR6B 1C0AA 3NS1B 3MF1A 4HWTA 4CH6A 1KMMA 1FIQB 3HRDC 1QE0A 4BW9A 3NVWB 2E64A 4YDQA 11ASA 2CGHA 3WQZA 3E9IA 1H4VB 2CJ9A 2Q7GA 1NJ6A 1ADJA 4ZTZB 4J15A 1J5WA 4ZIBA 3REUA 2EAYA 2ZGWA 3HXXA 4KR2A 3E9HA 2PMEA 2ZZFA 4G85A 4P71A 3KFUA 1FO4A 4Q15A 3TEGA 3IKMB 4ZOHB 2C8MA 4CS4A 1YFTA 4CS2A 3RKYA 5E3IA 3AMZA 1B8AA 3NVYB 4XTYA 1NJ2A 3PCOB 4CS3A 1BIBA 1NNHA 3PZCA 3A5YA 2CIMA 4UP8A 3TEHA 5C51B 2ZZEA 4XEOA 2ZNJA 4TVAB 1WPYA 3NVVB 4YRMA 2C7IA 2ZIMA 2Q7EA 2DTHA 3PCOA 4CH5A 3IKLA 3V7CA 2RHSB 4YRNA 2DJZA 3R07A 1N63C 2ZR3A 3VQWA 4K86A 2AMCB 1X2HA 4H2WA 3A7RA 1B76A 1H4QA 2P0LA 4P73A 3REXA 1EQRA 3VQYA 4YYEA 3V8JA 3V7RA 4RDXA 3VQXA 1NJ1A 1BBWA 1FFVC 4YRIA 3A7AA 1SETA 4H2XB 1JRPA 3OD1A 2J3MA 3UGQA 4YRSA 1WQWA 4ZTUB 3A31A 1WQ7A 3W3SA 4WJ4A 1T3QC 4YCVA 1B7YB 2QHTA 2ZXFA 4TQFA 1E22A 1YB3A 3P8VA 4EO4A 1RIQA 2EWNA 5ELNA 4TVYA 2ARTA 2EL9A 4P72A 3HXZA 2E3CA 1Z7MA 2ZZGA 4YRGA 4YPFA 5HGQA 2ODRD 4XU2A 3EUB3 4OP0A 1X01A 3IALA 3RACA 3NENA 4XTVA 2E65A 3HY0A 2E1HA 4G84A 3HXYA 4YRJA 2W55A 1ATIA 1KOGA 3I7FA 4WI1A 1N60C 3ETRB 2QHVA 3P8TA 3QTCA 4DQ2A 3RUXA 2XTIA 3V8LA 1W66A 2Q5IA 2ZR2A 1G5IA 3LC0A 5C52B 1B70A 4CH4A 4P3OA 4UP7A 4P3PA 3RF1A 3TEHB 1N61C 4HWSA 3M4PA 1YGBA 2DU5A 1G51A 2W3RA 1JJCA 2XGTA 3RL6A 2E41A 2HNIA 1FFUC 2DXUA 4XU3A 3EFSA 4XU1A 4RQEA 4EX5A 3V8KA 1BIAA 1EVLA 1NJ5A 3HXWA 1PYSA 2J3LA 2ZCEA 4RMFA 4YREA 4XTUA 2ALYB 3RKXA 3HRIA 2ZINA 5KNNA 3L4GA 3UGTA 2ZT6A 4H02A 4TTVA 2ALYA 1EFWA 4H2UA 2E3TA 2DQ0A 3NEMA 2ZT5A 1E24A 1EVKA 3VBBA 4YRTA 4Q6GA 4XEMA 4XTXA 3HXVA 4P75A 3L1AA 1USYA 1NYRA 3AN1A 2EJGA 3BJUA 1WYGA 4RQFA 3HFZA 4H2SA 3NELA 3QNEA 2ZIOA 2I4LA 2DU7A 3NETA 2QHUA 4YRLA 4P71C 4YCWA 3B9JB 2FYKA 3MEYA 2ZTGA 4YRPA 1VDVA 4HA8A 2DEQA 4BWAA 3HY1A 4O2DA 3TUPA 2DQ3A 2ZT8A 4H2VA 4CH3A 4PHCA 1HC7A 1X56A 4NCXA 2ZNIA 3LSQA 4KR3A 2DXTA 1H4SA 2E5AA 3L2ZA 1HTTA 3A32A 1FYFA 1X2GA 3ICAA 2E10A 1WNLA 3QO5A 1HXDA 4YRQA 1EOVA 2PMFA 5C53B 2DKGA 4HWRA 3UH0A 3M4QA 4XTZA 4TWAA 4YROA 2Q5HA 4YRFA 1WYDA 2W54A 2AKWB 1EIYB 4YRRA 5K1XA 5K1PA 3R07C 3HTZA 1B70B 3LSSA 1N62C 4H2TA 2DVEA 4HWOA 1KMNA 1JJCB 4TQDA 4P73C 3VQVA 1N5WC 4XTWA 2AKWA 1EIYA 4YRKA 4P75C 2DZ9A 2CJAA 2DTOA 1USYC 4KQEA 1YFSA 1YFRA 2G4CA 4K87A 1PYSB 4HVCA 3HXUA 1N9WA 2DZCA 2ODRC 3ERRA 4DPGA 2EJ9A 4WJ3M 1X55A 3L4GB 2ZT7A 3HFVA 1ASYA 5G5HB 4LNSA 1WLEA 4P74A 3QO7A 4TVWA 3NRZB 4UPAA 3A7UA 1NJ8A 3A5ZA 1RM6B 2CJBA 3NVZB 2QHSA 12ASA 3RIRA 4P72C 2I4NA 5ELOA 2EJFA 1V97A 1H4TA 2P5IA 1QF6A 1IL2A 3P8YA 2ARSA 1Z7NA 4X5OA 1SRYA 1E1OA 2I4OA 2DTIA 3HFZB 3CMQA 3QO8A 5G5GB 1G5HA 4HWPA 3V7SA 4PG3A 1SERA 3IG2A 1NYQA 4WF2A 4TVAA 4E51A 2ARUA 3RGLA 3G1ZA 4K88A 2IY5B 2DDZA 1ADYA 1X54A 4YCUA 1ASZA 2W3SA 2RHSA
chains in the Genus database with same CATH superfamily
1JROA 4YRCA 1VQZA 4OLFA 3DH9A 3STPA 3HRKA 1GGMA 2AAQA 1TZZA 5EU9A 2ONEA 2GR1A 3DSQA 3H7VA 1BBUA 2YAUA 2OO6A 2IY5A 3UFGA 1KN0A 2AMCA 4YP0A 2GL5A 1WU7A 3AM9A 1ZXIC 1DTNA 2DW7A 3GC2A 4ADWA 1E1TA 3OW1A 3R25A 3P93A 2BCPA 2I5QA 2QDDA 4A3RA 4K1WA 4H2YA 2RHQB 4GR1A 4H1ZA 5JCMA 1L0WA 3OP2A 4XU0A 2XH7A 1N5XA 2Q7HA 4H2XA 1SB3B 4LVKA 4JDRA 2F5ZA 2QAEA 1KCZA 2ZZ0A 4FX9A 3MF2A 2XH4A 3A74A 5F5WA 1GSNA 2I4MA 3RKWA 3IJQA 3BFMA 3FJPA 4P3NA 1LYLA 4P74C 1NHQA 4LVMA 1SJCA 1KKRA 2GRTA 4H4TA 3S5SA 1EC9A 3T9PA 4EMWA 2RHQA 4AH6A 3FJ4A 2CDUA 1B7YA 1EBGA 4UP9A 4L87A 2WPEA 1SESA 2QJMA 3R10A 3U4FA 3EFRA 3SR6B 1C0AA 1JDFA 4DX3A 3TQPA 3NZGA 3UJ2A 3NS1B 3MF1A 2CFYA 2X99A 4HWTA 1GRAA 1ZMCA 1ASZA 1ZX9A 4HCDA 1FEAA 1PDYA 4CH6A 4GFIA 3EKGA 1KMMA 2BC0A 1FIQB 3CGBA 3FCPA 3HRDC 4J57A 1QE0A 5ENLA 4BW9A 3PFRA 1WUEA 3NVWB 4LVJA 2PODA 3URHA 2E64A 1JPMA 4YDQA 2PPGA 11ASA 2CGHA 4GGBA 3WQZA 4APNA 3E9IA 1H4VB 2CJ9A 2Q7GA 1NJ6A 1NELA 1ADJA 4Z1YA 4HNLA 4DN1A 3P0WA 4J15A 4ZTZB 1L8PA 1J5WA 4ZIBA 3REUA 4KT2A 2QVHA 2A8EA 2EAYA 2ZGWA 3FG2P 3HXXA 3H70A 2AL1A 4KR2A 3E9HA 2PMEA 4EQWA 3ZLHA 2ZZFA 4HT4A 4G85A 4P71A 3DFYA 3KFUA 3MSYA 3DFHA 3CXOA 1FO4A 3FVDA 3L5OA 1TE6A 3OC4A 4Q15A 4H19A 1YEYA 3DG7A 3OZYA 3OZMA 4LA1A 3TEGA 3IKMB 4JQ9A 2ZC8A 4JN7A 2A8XA 3CXBA 4ZOHB 2HNEA 2C8MA 2ZZCA 2OZTA 2QQ6A 4CS4A 1YFTA 1LPFA 4GIRA 2YVJA 4CS2A 3TOYA 3RKYA 1KKOA 5FS7A 5E3IA 3GD3A 4GISA 4ZCWA 3AMZA 2V3BA 1B8AA 4J3ZA 3EEZA 3NVYB 4XTYA 1SJAA 1NJ2A 3PCOB 2YVFA 4CS3A 1BIBA 3KUMA 1NNHA 3PZCA 3RR1A 4G8TA 3A5YA 2CIMA 4UP8A 3TEHA 2NS6A 1ONEA 1NHRA 3HW2A 1FHUA 2V6OA 1MO9A 5C51B 3R11A 5FJOA 2ZZEA 5KVIA 4XEOA 3DK9A 2ZNJA 3VC6A 4TVAB 1P43A 3NVVB 1WPYA 1W6TA 3DK4A 3R0KA 2C7IA 4YRMA 2GGGA 2PCEA 2ZIMA 1PDZA 2Q7EA 3FXGA 2DTHA 4FDCB 3PCOA 1SJBA 3PWGA 3II4A 2XGZA 1IYXA 3RNMA 2GGIA 3IKLA 4CH5A 3V7CA 1GRGA 3TWBA 2RABA 2RHSB 4YRNA 1ZK7A 4MMWA 2DJZA 1R6WA 2AL2A 3R07A 1F9CA 1ZKQA 1N63C 2ZR3A 4HCLA 3VQWA 4K86A 4LVLA 2AMCB 3P3BA 1X2HA 2OFJA 4H2WA 3A7RA 1BZLA 1BKHA 4IP4A 1B76A 4JHMA 2P0LA 1H4QA 4P73A 4YWSA 3REXA 4EMIA 1EQRA 3VQYA 3V8JA 3V7RA 1JOAA 3EAOA 2OZ3A 4YYEA 4RDXA 3PK7A 3VQXA 1NJ1A 1BBWA 2FKPA 1FFVC 1FHVA 4YRIA 3R1ZA 4MGGA 5EBKA 3UJEA 3A7AA 1SETA 4NEVA 3UJFA 4H4UA 4H2XB 4H83A 2OZ8A 4IL2A 1JRPA 3OD1A 3UGVA 4K7ZA 2J3MA 3UGQA 4YRSA 1WQWA 4ZTUB 3EF6A 3A31A 1WQ7A 2PP0A 3ZVHA 3THUA 4BV6A 3W3SA 1H2IA 2P88A 4WJ4A 1T3QC 4YCVA 1B7YB 2QHTA 3V4BA 2QDEA 1E22A 3FV9A 1Q1RA 3MZNA 2ZXFA 4KWSA 4TQFA 1YB3A 7ENLA 5JCKA 3P8VA 4EO4A 1RIQA 2GQWA 2EWNA 5ELNA 3I6EA 2QJNA 3V5CA 2OLAA 1JEHA 3DGBA 2OQHA 3V5FA 4HPNA 1MOKA 4TVYA 3BSMA 2ARTA 3DERA 1GRBA 3SN4A 3N6HA 3CK5A 4P72A 4H4YA 2PA6A 4IL0A 3HXZA 2E3CA 1Z7MA 2RDXA 3RCYA 2ZZGA 4YRGA 4YPFA 5HGQA 4H50A 2ODRD 2EQ9A 2CHRA 4XU2A 2POZA 3EUB3 1X01A 4OP0A 3IALA 3RACA 4ENLA 3NENA 4XTVA 2E65A 3HY0A 2WP5A 2C3DA 1GV4A 3UCDA 3UXKA 6ENLA 2OPJA 3KLJA 2E1HA 3HXYA 1GRFA 4G84A 2GSHA 4E4UA 4YRJA 1XS2A 2W55A 3CT2A 3IK4A 2GGEA 3PWIA 1ATIA 1KOGA 2PP3A 2X8HA 3I7FA 4WI1A 1GRHA 3CYJA 3JZUA 1N60C 2FYMA 2PTWA 3ETRB 4DYEA 3QLDA 3D46A 5KVHA 4F4RA 1GEUA 2QHVA 1D7YA 2PP1A 3P8TA 2NQLA 3DDMA 1ELSA 3CB3A 3UJSA 3QTCA 3N4EA 3ENLA 3JW7A 3RUXA 4DQ2A 4EQXA 2EQ8A 3DGHA 2XTIA 2WOVA 3V8LA 4EQSA 1W66A 2Q5IA 3A5ZA 2HQMA 5J04A 3RRAA 2ZR2A 2CJAA 4HYRA 1G5IA 3R0UA 3LC0A 5C52B 3QFAA 1B70A 4CH4A 1NHSA 4GMEA 4P3OA 2YVGA 4UP7A 4P3PA 3RF1A 3TEHB 1N61C 3V3WA 1EBHA 1TYTA 3DGZA 1YGBA 2RHSA 3M4PA 4J56A 4HWSA 2DU5A 2R9ZA 2OQYA 2GGJA 4ROPA 1G51A 2W3RA 1FEBA 3I4KA 1FECA 5JCLA 1JJCA 2XGTA 1MDRA 2XH0A 2E41A 3RL6A 3VFCA 2HNIA 2O56A 3MWCA 4EMJA 2NVKX 1FFUC 2DXUA 3VA8A 4XU3A 3EFSA 4XU1A 3L8KA 3BJSA 4H4PA 4RQEA 2QJJA 4EX5A 3V8KA 1BIAA 5BOFA 1EVLA 1NJ5A 1XPYA 3CGEA 3HXWA 1PYSA 2J3LA 1NU5A 2ZCEA 4BURA 4RMFA 2MUCA 4YREA 4XTUA 2ALYB 3RKXA 2C3CA 2WBAA 3Q4DA 2ZINA 3HRIA 2AL2B 2P3ZA 1ZDLA 2PMQA 5KNNA 4H4QA 4HN8A 3NFUA 5FJUA 3L4GA 1EC8A 1EC7A 4EM4A 3N6JA 3EANA 3K1GA 3UGTA 2ZT6A 4FP1A 5FS9A 4H02A 4TTVA 3UXLA 2ALYA 2HZGA 3VC5A 1EFWA 4H2UA 2E3TA 5JCNA 5JRBA 4EM3A 2P8CA 2PU1A 4GYPA 2DQ0A 3NEMA 2ZT5A 1JPDX 3DK8A 1AOGA 2J3NA 1E24A 1EVKA 3VBBA 2GH5A 4YRTA 1MUCA 4M52A 4Q6GA 1K4QA 1MDLA 4XEMA 3RITA 3TJIA 1ONFA 4XTXA 3HXVA 2P8BA 3ZVHB 5IDZA 4P75A 3LXDA 3L1AA 1DXLA 5ER0A 3IJIA 3Q6JA 4HCHA 3TWAA 1NYRA 1USYA 1TKKA 4EQRA 1XHCA 3AN1A 5FS8A 2OVLA 3GY1A 2EJGA 3BJUA 1WYGA 5U1OA 4KPLA 3GD4A 3D9XA 1E9IA 3HFZA 4RQFA 1GETA 2X8CA 4H2SA 1ZY8A 3NELA 3QNEA 4E8GA 2GR0A 2ZIOA 4MKSA 2I4LA 3LB8A 3ES8A 3O0HA 3SQPA 2DU7A 2QHUA 3NETA 3BOXA 4IHCA 4M6UA 2PSNA 1H6VA 3VCCA 4YRLA 4P71C 4DHGA 4YCWA 3B9JB 1MNSA 2FYKA 3T6CA 3MEYA 3GRTA 2ZTGA 3MKCA 1VDVA 4YRPA 3SBFA 5FJRA 4HA8A 2DEQA 3SQSA 4BWAA 2V3AA 3HY1A 5FS6A 1OJTA 4O2DA 2DQ3A 2ZT8A 4H2VA 4CH3A 3NXLA 4PHCA 3TUPA 4KEMA 4KPRA 3S47A 1HC7A 1X56A 4M0XA 4NCXA 3DJGX 4GRTA 1BQGA 3LSQA 2ZNIA 2DW6A 4KR3A 1RVKA 4A6GA 2DXTA 1H4SA 2GR3A 2PTXA 4K8GA 2E5AA 3L2ZA 3MY9A 1HTTA 3JVAA 3A32A 1FYFA 1X2GA 4NEWA 3ICAA 2E10A 2QGYA 1WNLA 2PS2A 3QO5A 4IP5A 1BWCA 4LVIA 5GRTA 4E5TA 3DESA 1HXDA 4YRQA 2TPRA 5JCIA 1EOVA 3ZVIA 4DNAA 3SN1A 2PMFA 5C53B 2DKGA 4HWRA 3ES7A 3UH0A 4HNCA 3M4QA 4XTZA 1GESA 1NHPA 5FJTA 3HPFA 3N4FA 4TWAA 2GGHA 4K8DA 4J1OA 4FI4A 4YROA 5U25A 3RGTA 2Q5HA 3Q45A 3QKEA 3RO6A 1WYDA 1NDAA 2W54A 4YRFA 1ECQA 3DG3A 1YQZA 3OPSA 2AKWB 3ZLFA 1EIYB 4YRRA 3TW9A 5K1XA 5K1PA 2X50A 3R07C 1B70B 3HTZA 3VDGA 3LSSA 2AKZA 2OG9A 1MRAA 2PTYA 1N62C 4IZGA 4ZA0A 4GYPC 2PU0A 1NPXA 4H2TA 3DEQA 1R0MA 2DVEA 4Z17A 4HWOA 2MNRA 1KMNA 1JJCB 5FJPA 4TQDA 4P73C 2ZZBA 1N5WC 2XH2A 3DJJA 4YWOA 4XTWA 2AKWA 3VQVA 1EIYA 3H4KA 4YRKA 2X8GA 3PG6A 3OTRA 3CAWA 4P75C 1M6IA 2DZ9A 3MQTA 3DG6A 3CGCA 3VCNA 2PGWA 1USYC 2HXUA 4H2HA 3T4WA 3U9IA 2DTOA 4KQEA 3D47A 1YFSA 1YFRA 1EBDA 2G4CA 2PTZA 2GDQA 3H12A 4JN8A 1PYSB 4K87A 4HVCA 2P0IA 3SSZA 3HXUA 5BOEA 1N9WA 3T8QA 3TCSA 2YQUA 3UCCA 2DZCA 1JCTA 4G7FA 2WPCA 1Q1WA 2ODRC 4LIIA 2W0HA 3ERRA 4DPGA 2EJ9A 4WJ3M 4GGHA 2PGEA 1X55A 3L4GB 1GERA 2GR2A 2AKMA 2WPFA 1V59A 5FMHA 2ZT7A 3HFVA 1ASYA 5G5HB 3B97A 1WLEA 4LNSA 4P74A 4H4VA 3QO7A 4TVWA 1GXFA 2JK6A 3NRZB 1P48A 3UJRA 4UPAA 3A7UA 5TR3A 3ZLGA 1NJ8A 1RM6B 2CJBA 4H4XA 3NVZB 1F3PA 3SJNA 1S7MA 1SJDA 3DIPA 3I6TA 12ASA 2QHSA 1ZMDA 3RIRA 1KD0A 4H4WA 3TTEA 1GRTA 4K2SA 3MUCA 4E6MA 3QN3A 2I4NA 4P72C 5ELOA 1XANA 3IC9A 2HXTA 2OX4A 2EJFA 1V97A 4IT1A 1H4TA 2XSXA 2P5IA 4DXKA 1QF6A 1IL2A 3P8YA 2ARSA 1LVLA 1Z7NA 3SN0A 3IJLA 1WUFA 4X5OA 1SRYA 4X2PA 1E1OA 3FYYA 1TYPA 2OKTA 2WOWA 1OEPA 3GD6A 3H8AA 3LADA 3QPEA 4A35A 2I4OA 2DTIA 1XDIA 3NO1A 3CMQA 2WOIA 5G5GB 4EWJA 3HFZB 3QO8A 1G5HA 2NPXA 4DWDA 4HWPA 4PG3A 3V7SA 1SERA 3CGDA 4E4FA 3IG2A 1NYQA 1F8WA 2EQ6A 4WF2A 1STZA 4H4ZA 1GREA 3QTPA 4TVAA 4H4SA 3MQZA 2ARUA 3RGLA 4E51A 3G1ZA 3TJ4A 3GRSA 4K88A 3QFBA 2IY5B 2DDZA 2WP6A 1ADYA 1X54A 4YCUA 2EQ7A 3GO2A 4H4RA 2ZADA 2BC1A 1DNCA 2W3SA 2EL9A
chains in the Genus database with same CATH topology
1JROA 4YRCA 1VQZA 4OLFA 3HRKA 1GGMA 3DSQA 1BBUA 2IY5A 3UFGA 2AMCA 4YP0A 1WU7A 3AM9A 1ZXIC 1E1TA 4H2YA 2RHQB 1L0WA 4XU0A 2Q7HA 1N5XA 4H2XA 1SB3B 4LVKA 3MF2A 5F5WA 3A74A 2I4MA 3RKWA 3BFMA 3FJPA 4P3NA 4P74C 1LYLA 4LVMA 2RHQA 4AH6A 1B7YA 4UP9A 4L87A 1SESA 3EFRA 3SR6B 1C0AA 3NS1B 3MF1A 4HWTA 4CH6A 1KMMA 1FIQB 3HRDC 1QE0A 4BW9A 4LVJA 3NVWB 2E64A 4YDQA 11ASA 2CGHA 3WQZA 3E9IA 1H4VB 2CJ9A 2Q7GA 1NJ6A 1ADJA 4ZTZB 4J15A 1J5WA 4ZIBA 3REUA 2A8EA 2EAYA 2ZGWA 3HXXA 4KR2A 3E9HA 2PMEA 2ZZFA 4HT4A 4G85A 4P71A 3KFUA 1FO4A 4Q15A 3TEGA 3IKMB 4ZOHB 2C8MA 4CS4A 1YFTA 4CS2A 3RKYA 5E3IA 3AMZA 1B8AA 3NVYB 4XTYA 1NJ2A 3PCOB 4CS3A 1BIBA 1NNHA 3PZCA 3A5YA 2CIMA 4UP8A 3TEHA 2NS6A 5C51B 2ZZEA 4XEOA 2ZNJA 4TVAB 1WPYA 3NVVB 4YRMA 2C7IA 2ZIMA 2Q7EA 2DTHA 3PCOA 4CH5A 3IKLA 3V7CA 2RHSB 4YRNA 2DJZA 3R07A 1N63C 2ZR3A 3VQWA 4K86A 4LVLA 2AMCB 1X2HA 4H2WA 3A7RA 1B76A 1H4QA 2P0LA 4P73A 3REXA 1EQRA 3VQYA 4YYEA 3V8JA 3V7RA 4RDXA 3VQXA 1NJ1A 1BBWA 1FFVC 4YRIA 3A7AA 1SETA 4H2XB 1JRPA 3OD1A 2J3MA 3UGQA 4YRSA 1WQWA 4ZTUB 3A31A 1WQ7A 3W3SA 4WJ4A 1T3QC 4YCVA 1B7YB 2QHTA 2ZXFA 4TQFA 1E22A 1YB3A 3P8VA 4EO4A 1RIQA 2EWNA 5ELNA 4TVYA 2ARTA 2EL9A 4P72A 3HXZA 2E3CA 1Z7MA 2ZZGA 4YRGA 4YPFA 5HGQA 2ODRD 4XU2A 3EUB3 1X01A 4OP0A 3IALA 3RACA 3NENA 4XTVA 2E65A 3HY0A 2E1HA 4G84A 3HXYA 4YRJA 2W55A 1ATIA 1KOGA 3I7FA 4WI1A 1N60C 3ETRB 2QHVA 3P8TA 3QTCA 4DQ2A 3RUXA 2XTIA 3V8LA 1W66A 2Q5IA 2ZR2A 1G5IA 3LC0A 5C52B 1B70A 4CH4A 4P3OA 4UP7A 4P3PA 3RF1A 3TEHB 1N61C 4HWSA 3M4PA 1YGBA 2DU5A 1G51A 2W3RA 1JJCA 2XGTA 3RL6A 2E41A 2HNIA 1FFUC 2DXUA 4XU3A 3EFSA 4XU1A 4RQEA 4EX5A 3V8KA 1BIAA 1EVLA 1NJ5A 3HXWA 1PYSA 2J3LA 2ZCEA 4RMFA 4YREA 4XTUA 2ALYB 3RKXA 3HRIA 2ZINA 5KNNA 3L4GA 3UGTA 2ZT6A 4H02A 4TTVA 2ALYA 1EFWA 4H2UA 2E3TA 2DQ0A 3NEMA 2ZT5A 1E24A 1EVKA 3VBBA 4YRTA 4Q6GA 4XEMA 4XTXA 3HXVA 4P75A 3L1AA 1USYA 1NYRA 3AN1A 2EJGA 3BJUA 1WYGA 4RQFA 3HFZA 4H2SA 3NELA 3QNEA 2ZIOA 2I4LA 2DU7A 3NETA 2QHUA 4YRLA 4P71C 4YCWA 3B9JB 2FYKA 3MEYA 2ZTGA 4YRPA 1VDVA 4HA8A 2DEQA 4BWAA 3HY1A 4O2DA 3TUPA 2DQ3A 2ZT8A 4H2VA 4CH3A 4PHCA 1HC7A 1X56A 4NCXA 2ZNIA 3LSQA 4KR3A 2DXTA 1H4SA 2E5AA 3L2ZA 1HTTA 3A32A 1FYFA 1X2GA 3ICAA 2E10A 1WNLA 3QO5A 4LVIA 1HXDA 4YRQA 1EOVA 2PMFA 5C53B 2DKGA 4HWRA 3UH0A 3M4QA 4XTZA 4TWAA 4YROA 2Q5HA 4YRFA 1WYDA 2W54A 2AKWB 1EIYB 4YRRA 5K1XA 5K1PA 3R07C 3HTZA 1B70B 3LSSA 1N62C 4H2TA 2DVEA 4HWOA 1KMNA 1JJCB 4TQDA 4P73C 3VQVA 1N5WC 4XTWA 2AKWA 1EIYA 4YRKA 4P75C 2DZ9A 2CJAA 2DTOA 1USYC 4KQEA 1YFSA 1YFRA 2G4CA 4K87A 1PYSB 4HVCA 3HXUA 1N9WA 2DZCA 2ODRC 3ERRA 4DPGA 2EJ9A 4WJ3M 1X55A 3L4GB 2ZT7A 3HFVA 1ASYA 5G5HB 4LNSA 1WLEA 4P74A 3QO7A 4TVWA 3NRZB 4UPAA 3A7UA 1NJ8A 3A5ZA 1RM6B 2CJBA 3NVZB 2QHSA 12ASA 3RIRA 4P72C 2I4NA 5ELOA 2EJFA 1V97A 1H4TA 2P5IA 1QF6A 1IL2A 3P8YA 2ARSA 1Z7NA 4X5OA 1SRYA 1E1OA 2I4OA 2DTIA 3HFZB 3CMQA 3QO8A 5G5GB 1G5HA 4HWPA 3V7SA 4PG3A 1SERA 3IG2A 1NYQA 4WF2A 4TVAA 3MQZA 2ARUA 3RGLA 4E51A 3G1ZA 4K88A 2IY5B 2DDZA 1ADYA 1X54A 4YCUA 1ASZA 2W3SA 2RHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRO A;  4YRC A;  1VQZ A;  4OLF A;  3HRK A;  1GGM A;  3DSQ A;  1BBU A;  2IY5 A;  3UFG A;  2AMC A;  4YP0 A;  1WU7 A;  3AM9 A;  1ZXI C;  1E1T A;  4H2Y A;  2RHQ B;  1L0W A;  4XU0 A;  2Q7H A;  1N5X A;  4H2X A;  1SB3 B;  3MF2 A;  5F5W A;  3A74 A;  2I4M A;  3RKW A;  3BFM A;  3FJP A;  4P3N A;  4P74 C;  1LYL A;  2RHQ A;  4AH6 A;  1B7Y A;  4UP9 A;  4L87 A;  1SES A;  3EFR A;  3SR6 B;  1C0A A;  3NS1 B;  3MF1 A;  4HWT A;  4CH6 A;  1KMM A;  1FIQ B;  3HRD C;  1QE0 A;  4BW9 A;  3NVW B;  2E64 A;  4YDQ A;  11AS A;  2CGH A;  3WQZ A;  3E9I A;  1H4V B;  2CJ9 A;  2Q7G A;  1NJ6 A;  1ADJ A;  4ZTZ B;  4J15 A;  1J5W A;  4ZIB A;  3REU A;  2EAY A;  2ZGW A;  3HXX A;  4KR2 A;  3E9H A;  2PME A;  2ZZF A;  4G85 A;  4P71 A;  3KFU A;  1FO4 A;  4Q15 A;  3TEG A;  3IKM B;  4ZOH B;  2C8M A;  4CS4 A;  1YFT A;  4CS2 A;  3RKY A;  5E3I A;  3AMZ A;  1B8A A;  3NVY B;  4XTY A;  1NJ2 A;  3PCO B;  4CS3 A;  1BIB A;  1NNH A;  3PZC A;  3A5Y A;  2CIM A;  4UP8 A;  3TEH A;  5C51 B;  2ZZE A;  4XEO A;  2ZNJ A;  4TVA B;  1WPY A;  3NVV B;  4YRM A;  2C7I A;  2ZIM A;  2Q7E A;  2DTH A;  3PCO A;  4CH5 A;  3IKL A;  3V7C A;  2RHS B;  4YRN A;  2DJZ A;  3R07 A;  1N63 C;  2ZR3 A;  3VQW A;  4K86 A;  2AMC B;  1X2H A;  4H2W A;  3A7R A;  1B76 A;  1H4Q A;  2P0L A;  4P73 A;  3REX A;  1EQR A;  3VQY A;  4YYE A;  3V8J A;  3V7R A;  4RDX A;  3VQX A;  1NJ1 A;  1BBW A;  1FFV C;  4YRI A;  3A7A A;  1SET A;  4H2X B;  1JRP A;  3OD1 A;  2J3M A;  3UGQ A;  4YRS A;  1WQW A;  4ZTU B;  3A31 A;  1WQ7 A;  3W3S A;  4WJ4 A;  1T3Q C;  4YCV A;  1B7Y B;  2QHT A;  2ZXF A;  4TQF A;  1E22 A;  1YB3 A;  3P8V A;  4EO4 A;  1RIQ A;  2EWN A;  5ELN A;  4TVY A;  2ART A;  2EL9 A;  4P72 A;  3HXZ A;  2E3C A;  1Z7M A;  2ZZG A;  4YRG A;  4YPF A;  5HGQ A;  2ODR D;  4XU2 A;  3EUB 3;  4OP0 A;  1X01 A;  3IAL A;  3RAC A;  3NEN A;  4XTV A;  2E65 A;  3HY0 A;  2E1H A;  4G84 A;  3HXY A;  4YRJ A;  2W55 A;  1ATI A;  1KOG A;  3I7F A;  4WI1 A;  1N60 C;  3ETR B;  2QHV A;  3P8T A;  3QTC A;  4DQ2 A;  3RUX A;  2XTI A;  3V8L A;  1W66 A;  2Q5I A;  2ZR2 A;  1G5I A;  3LC0 A;  5C52 B;  1B70 A;  4CH4 A;  4P3O A;  4UP7 A;  4P3P A;  3RF1 A;  3TEH B;  1N61 C;  4HWS A;  3M4P A;  1YGB A;  2DU5 A;  1G51 A;  2W3R A;  1JJC A;  2XGT A;  3RL6 A;  2E41 A;  2HNI A;  1FFU C;  2DXU A;  4XU3 A;  3EFS A;  4XU1 A;  4RQE A;  4EX5 A;  3V8K A;  1BIA A;  1EVL A;  1NJ5 A;  3HXW A;  1PYS A;  2J3L A;  2ZCE A;  4RMF A;  4YRE A;  4XTU A;  2ALY B;  3RKX A;  3HRI A;  2ZIN A;  5KNN A;  3L4G A;  3UGT A;  2ZT6 A;  4H02 A;  4TTV A;  2ALY A;  1EFW A;  4H2U A;  2E3T A;  2DQ0 A;  3NEM A;  2ZT5 A;  1E24 A;  1EVK A;  3VBB A;  4YRT A;  4Q6G A;  4XEM A;  4XTX A;  3HXV A;  4P75 A;  3L1A A;  1USY A;  1NYR A;  3AN1 A;  2EJG A;  3BJU A;  1WYG A;  4RQF A;  3HFZ A;  4H2S A;  3NEL A;  3QNE A;  2ZIO A;  2I4L A;  2DU7 A;  3NET A;  2QHU A;  4YRL A;  4P71 C;  4YCW A;  3B9J B;  2FYK A;  3MEY A;  2ZTG A;  4YRP A;  1VDV A;  4HA8 A;  2DEQ A;  4BWA A;  3HY1 A;  4O2D A;  3TUP A;  2DQ3 A;  2ZT8 A;  4H2V A;  4CH3 A;  4PHC A;  1HC7 A;  1X56 A;  4NCX A;  2ZNI A;  3LSQ A;  4KR3 A;  2DXT A;  1H4S A;  2E5A A;  3L2Z A;  1HTT A;  3A32 A;  1FYF A;  1X2G A;  3ICA A;  2E10 A;  1WNL A;  3QO5 A;  1HXD A;  4YRQ A;  1EOV A;  2PMF A;  5C53 B;  2DKG A;  4HWR A;  3UH0 A;  3M4Q A;  4XTZ A;  4TWA A;  4YRO A;  2Q5H A;  4YRF A;  1WYD A;  2W54 A;  2AKW B;  1EIY B;  4YRR A;  5K1X A;  5K1P A;  3R07 C;  3HTZ A;  1B70 B;  3LSS A;  1N62 C;  4H2T A;  2DVE A;  4HWO A;  1KMN A;  1JJC B;  4TQD A;  4P73 C;  3VQV A;  1N5W C;  4XTW A;  2AKW A;  1EIY A;  4YRK A;  4P75 C;  2DZ9 A;  2CJA A;  2DTO A;  1USY C;  4KQE A;  1YFS A;  1YFR A;  2G4C A;  4K87 A;  1PYS B;  4HVC A;  3HXU A;  1N9W A;  2DZC A;  2ODR C;  3ERR A;  4DPG A;  2EJ9 A;  4WJ3 M;  1X55 A;  3L4G B;  2ZT7 A;  3HFV A;  1ASY A;  5G5H B;  4LNS A;  1WLE A;  4P74 A;  3QO7 A;  4TVW A;  3NRZ B;  4UPA A;  3A7U A;  1NJ8 A;  3A5Z A;  1RM6 B;  2CJB A;  3NVZ B;  2QHS A;  12AS A;  3RIR A;  4P72 C;  2I4N A;  5ELO A;  2EJF A;  1V97 A;  1H4T A;  2P5I A;  1QF6 A;  1IL2 A;  3P8Y A;  2ARS A;  1Z7N A;  4X5O A;  1SRY A;  1E1O A;  2I4O A;  2DTI A;  3HFZ B;  3CMQ A;  3QO8 A;  5G5G B;  1G5H A;  4HWP A;  3V7S A;  4PG3 A;  1SER A;  3IG2 A;  1NYQ A;  4WF2 A;  4TVA A;  4E51 A;  2ARU A;  3RGL A;  3G1Z A;  4K88 A;  2IY5 B;  2DDZ A;  1ADY A;  1X54 A;  4YCU A;  1ASZ A;  2W3S A;  2RHS A; 
#chains in the Genus database with same CATH topology
 1JRO A;  4YRC A;  1VQZ A;  4OLF A;  3DH9 A;  3STP A;  3HRK A;  1GGM A;  2AAQ A;  1TZZ A;  5EU9 A;  2ONE A;  2GR1 A;  3DSQ A;  3H7V A;  1BBU A;  2YAU A;  2OO6 A;  2IY5 A;  3UFG A;  1KN0 A;  2AMC A;  4YP0 A;  2GL5 A;  1WU7 A;  3AM9 A;  1ZXI C;  1DTN A;  2DW7 A;  3GC2 A;  4ADW A;  1E1T A;  3OW1 A;  3R25 A;  3P93 A;  2BCP A;  2I5Q A;  2QDD A;  4A3R A;  4K1W A;  4H2Y A;  2RHQ B;  4GR1 A;  4H1Z A;  5JCM A;  1L0W A;  3OP2 A;  4XU0 A;  2XH7 A;  1N5X A;  2Q7H A;  4H2X A;  1SB3 B;  4LVK A;  4JDR A;  2F5Z A;  2QAE A;  1KCZ A;  2ZZ0 A;  4FX9 A;  3MF2 A;  2XH4 A;  3A74 A;  5F5W A;  1GSN A;  2I4M A;  3RKW A;  3IJQ A;  3BFM A;  3FJP A;  4P3N A;  1LYL A;  4P74 C;  1NHQ A;  4LVM A;  1SJC A;  1KKR A;  2GRT A;  4H4T A;  3S5S A;  1EC9 A;  3T9P A;  4EMW A;  2RHQ A;  4AH6 A;  3FJ4 A;  2CDU A;  1B7Y A;  1EBG A;  4UP9 A;  4L87 A;  2WPE A;  1SES A;  2QJM A;  3R10 A;  3U4F A;  3EFR A;  3SR6 B;  1C0A A;  1JDF A;  4DX3 A;  3TQP A;  3NZG A;  3UJ2 A;  3NS1 B;  3MF1 A;  2CFY A;  2X99 A;  4HWT A;  1GRA A;  1ZMC A;  1ASZ A;  1ZX9 A;  4HCD A;  1FEA A;  1PDY A;  4CH6 A;  4GFI A;  3EKG A;  1KMM A;  2BC0 A;  1FIQ B;  3CGB A;  3FCP A;  3HRD C;  4J57 A;  1QE0 A;  5ENL A;  4BW9 A;  3PFR A;  1WUE A;  3NVW B;  4LVJ A;  2POD A;  3URH A;  2E64 A;  1JPM A;  4YDQ A;  2PPG A;  11AS A;  2CGH A;  4GGB A;  3WQZ A;  4APN A;  3E9I A;  1H4V B;  2CJ9 A;  2Q7G A;  1NJ6 A;  1NEL A;  1ADJ A;  4Z1Y A;  4HNL A;  4DN1 A;  3P0W A;  4J15 A;  4ZTZ B;  1L8P A;  1J5W A;  4ZIB A;  3REU A;  4KT2 A;  2QVH A;  2A8E A;  2EAY A;  2ZGW A;  3FG2 P;  3HXX A;  3H70 A;  2AL1 A;  4KR2 A;  3E9H A;  2PME A;  4EQW A;  3ZLH A;  2ZZF A;  4HT4 A;  4G85 A;  4P71 A;  3DFY A;  3KFU A;  3MSY A;  3DFH A;  3CXO A;  1FO4 A;  3FVD A;  3L5O A;  1TE6 A;  3OC4 A;  4Q15 A;  4H19 A;  1YEY A;  3DG7 A;  3OZY A;  3OZM A;  4LA1 A;  3TEG A;  3IKM B;  4JQ9 A;  2ZC8 A;  4JN7 A;  2A8X A;  3CXB A;  4ZOH B;  2HNE A;  2C8M A;  2ZZC A;  2OZT A;  2QQ6 A;  4CS4 A;  1YFT A;  1LPF A;  4GIR A;  2YVJ A;  4CS2 A;  3TOY A;  3RKY A;  1KKO A;  5FS7 A;  5E3I A;  3GD3 A;  4GIS A;  4ZCW A;  3AMZ A;  2V3B A;  1B8A A;  4J3Z A;  3EEZ A;  3NVY B;  4XTY A;  1SJA A;  1NJ2 A;  3PCO B;  2YVF A;  4CS3 A;  1BIB A;  3KUM A;  1NNH A;  3PZC A;  3RR1 A;  4G8T A;  3A5Y A;  2CIM A;  4UP8 A;  3TEH A;  2NS6 A;  1ONE A;  1NHR A;  3HW2 A;  1FHU A;  2V6O A;  1MO9 A;  5C51 B;  3R11 A;  5FJO A;  2ZZE A;  5KVI A;  4XEO A;  3DK9 A;  2ZNJ A;  3VC6 A;  4TVA B;  1P43 A;  3NVV B;  1WPY A;  1W6T A;  3DK4 A;  3R0K A;  2C7I A;  4YRM A;  2GGG A;  2PCE A;  2ZIM A;  1PDZ A;  2Q7E A;  3FXG A;  2DTH A;  4FDC B;  3PCO A;  1SJB A;  3PWG A;  3II4 A;  2XGZ A;  1IYX A;  3RNM A;  2GGI A;  3IKL A;  4CH5 A;  3V7C A;  1GRG A;  3TWB A;  2RAB A;  2RHS B;  4YRN A;  1ZK7 A;  4MMW A;  2DJZ A;  1R6W A;  2AL2 A;  3R07 A;  1F9C A;  1ZKQ A;  1N63 C;  2ZR3 A;  4HCL A;  3VQW A;  4K86 A;  4LVL A;  2AMC B;  3P3B A;  1X2H A;  2OFJ A;  4H2W A;  3A7R A;  1BZL A;  1BKH A;  4IP4 A;  1B76 A;  4JHM A;  2P0L A;  1H4Q A;  4P73 A;  4YWS A;  3REX A;  4EMI A;  1EQR A;  3VQY A;  3V8J A;  3V7R A;  1JOA A;  3EAO A;  2OZ3 A;  4YYE A;  4RDX A;  3PK7 A;  3VQX A;  1NJ1 A;  1BBW A;  2FKP A;  1FFV C;  1FHV A;  4YRI A;  3R1Z A;  4MGG A;  5EBK A;  3UJE A;  3A7A A;  1SET A;  4NEV A;  3UJF A;  4H4U A;  4H2X B;  4H83 A;  2OZ8 A;  4IL2 A;  1JRP A;  3OD1 A;  3UGV A;  4K7Z A;  2J3M A;  3UGQ A;  4YRS A;  1WQW A;  4ZTU B;  3EF6 A;  3A31 A;  1WQ7 A;  2PP0 A;  3ZVH A;  3THU A;  4BV6 A;  3W3S A;  1H2I A;  2P88 A;  4WJ4 A;  1T3Q C;  4YCV A;  1B7Y B;  2QHT A;  3V4B A;  2QDE A;  1E22 A;  3FV9 A;  1Q1R A;  3MZN A;  2ZXF A;  4KWS A;  4TQF A;  1YB3 A;  7ENL A;  5JCK A;  3P8V A;  4EO4 A;  1RIQ A;  2GQW A;  2EWN A;  5ELN A;  3I6E A;  2QJN A;  3V5C A;  2OLA A;  1JEH A;  3DGB A;  2OQH A;  3V5F A;  4HPN A;  1MOK A;  4TVY A;  3BSM A;  2ART A;  3DER A;  1GRB A;  3SN4 A;  3N6H A;  3CK5 A;  4P72 A;  4H4Y A;  2PA6 A;  4IL0 A;  3HXZ A;  2E3C A;  1Z7M A;  2RDX A;  3RCY A;  2ZZG A;  4YRG A;  4YPF A;  5HGQ A;  4H50 A;  2ODR D;  2EQ9 A;  2CHR A;  4XU2 A;  2POZ A;  3EUB 3;  1X01 A;  4OP0 A;  3IAL A;  3RAC A;  4ENL A;  3NEN A;  4XTV A;  2E65 A;  3HY0 A;  2WP5 A;  2C3D A;  1GV4 A;  3UCD A;  3UXK A;  6ENL A;  2OPJ A;  3KLJ A;  2E1H A;  3HXY A;  1GRF A;  4G84 A;  2GSH A;  4E4U A;  4YRJ A;  1XS2 A;  2W55 A;  3CT2 A;  3IK4 A;  2GGE A;  3PWI A;  1ATI A;  1KOG A;  2PP3 A;  2X8H A;  3I7F A;  4WI1 A;  1GRH A;  3CYJ A;  3JZU A;  1N60 C;  2FYM A;  2PTW A;  3ETR B;  4DYE A;  3QLD A;  3D46 A;  5KVH A;  4F4R A;  1GEU A;  2QHV A;  1D7Y A;  2PP1 A;  3P8T A;  2NQL A;  3DDM A;  1ELS A;  3CB3 A;  3UJS A;  3QTC A;  3N4E A;  3ENL A;  3JW7 A;  3RUX A;  4DQ2 A;  4EQX A;  2EQ8 A;  3DGH A;  2XTI A;  2WOV A;  3V8L A;  4EQS A;  1W66 A;  2Q5I A;  3A5Z A;  2HQM A;  5J04 A;  3RRA A;  2ZR2 A;  2CJA A;  4HYR A;  1G5I A;  3R0U A;  3LC0 A;  5C52 B;  3QFA A;  1B70 A;  4CH4 A;  1NHS A;  4GME A;  4P3O A;  2YVG A;  4UP7 A;  4P3P A;  3RF1 A;  3TEH B;  1N61 C;  3V3W A;  1EBH A;  1TYT A;  3DGZ A;  1YGB A;  2RHS A;  3M4P A;  4J56 A;  4HWS A;  2DU5 A;  2R9Z A;  2OQY A;  2GGJ A;  4ROP A;  1G51 A;  2W3R A;  1FEB A;  3I4K A;  1FEC A;  5JCL A;  1JJC A;  2XGT A;  1MDR A;  2XH0 A;  2E41 A;  3RL6 A;  3VFC A;  2HNI A;  2O56 A;  3MWC A;  4EMJ A;  2NVK X;  1FFU C;  2DXU A;  3VA8 A;  4XU3 A;  3EFS A;  4XU1 A;  3L8K A;  3BJS A;  4H4P A;  4RQE A;  2QJJ A;  4EX5 A;  3V8K A;  1BIA A;  5BOF A;  1EVL A;  1NJ5 A;  1XPY A;  3CGE A;  3HXW A;  1PYS A;  2J3L A;  1NU5 A;  2ZCE A;  4BUR A;  4RMF A;  2MUC A;  4YRE A;  4XTU A;  2ALY B;  3RKX A;  2C3C A;  2WBA A;  3Q4D A;  2ZIN A;  3HRI A;  2AL2 B;  2P3Z A;  1ZDL A;  2PMQ A;  5KNN A;  4H4Q A;  4HN8 A;  3NFU A;  5FJU A;  3L4G A;  1EC8 A;  1EC7 A;  4EM4 A;  3N6J A;  3EAN A;  3K1G A;  3UGT A;  2ZT6 A;  4FP1 A;  5FS9 A;  4H02 A;  4TTV A;  3UXL A;  2ALY A;  2HZG A;  3VC5 A;  1EFW A;  4H2U A;  2E3T A;  5JCN A;  5JRB A;  4EM3 A;  2P8C A;  2PU1 A;  4GYP A;  2DQ0 A;  3NEM A;  2ZT5 A;  1JPD X;  3DK8 A;  1AOG A;  2J3N A;  1E24 A;  1EVK A;  3VBB A;  2GH5 A;  4YRT A;  1MUC A;  4M52 A;  4Q6G A;  1K4Q A;  1MDL A;  4XEM A;  3RIT A;  3TJI A;  1ONF A;  4XTX A;  3HXV A;  2P8B A;  3ZVH B;  5IDZ A;  4P75 A;  3LXD A;  3L1A A;  1DXL A;  5ER0 A;  3IJI A;  3Q6J A;  4HCH A;  3TWA A;  1NYR A;  1USY A;  1TKK A;  4EQR A;  1XHC A;  3AN1 A;  5FS8 A;  2OVL A;  3GY1 A;  2EJG A;  3BJU A;  1WYG A;  5U1O A;  4KPL A;  3GD4 A;  3D9X A;  1E9I A;  3HFZ A;  4RQF A;  1GET A;  2X8C A;  4H2S A;  1ZY8 A;  3NEL A;  3QNE A;  4E8G A;  2GR0 A;  2ZIO A;  4MKS A;  2I4L A;  3LB8 A;  3ES8 A;  3O0H A;  3SQP A;  2DU7 A;  2QHU A;  3NET A;  3BOX A;  4IHC A;  4M6U A;  2PSN A;  1H6V A;  3VCC A;  4YRL A;  4P71 C;  4DHG A;  4YCW A;  3B9J B;  1MNS A;  2FYK A;  3T6C A;  3MEY A;  3GRT A;  2ZTG A;  3MKC A;  1VDV A;  4YRP A;  3SBF A;  5FJR A;  4HA8 A;  2DEQ A;  3SQS A;  4BWA A;  2V3A A;  3HY1 A;  5FS6 A;  1OJT A;  4O2D A;  2DQ3 A;  2ZT8 A;  4H2V A;  4CH3 A;  3NXL A;  4PHC A;  3TUP A;  4KEM A;  4KPR A;  3S47 A;  1HC7 A;  1X56 A;  4M0X A;  4NCX A;  3DJG X;  4GRT A;  1BQG A;  3LSQ A;  2ZNI A;  2DW6 A;  4KR3 A;  1RVK A;  4A6G A;  2DXT A;  1H4S A;  2GR3 A;  2PTX A;  4K8G A;  2E5A A;  3L2Z A;  3MY9 A;  1HTT A;  3JVA A;  3A32 A;  1FYF A;  1X2G A;  4NEW A;  3ICA A;  2E10 A;  2QGY A;  1WNL A;  2PS2 A;  3QO5 A;  4IP5 A;  1BWC A;  4LVI A;  5GRT A;  4E5T A;  3DES A;  1HXD A;  4YRQ A;  2TPR A;  5JCI A;  1EOV A;  3ZVI A;  4DNA A;  3SN1 A;  2PMF A;  5C53 B;  2DKG A;  4HWR A;  3ES7 A;  3UH0 A;  4HNC A;  3M4Q A;  4XTZ A;  1GES A;  1NHP A;  5FJT A;  3HPF A;  3N4F A;  4TWA A;  2GGH A;  4K8D A;  4J1O A;  4FI4 A;  4YRO A;  5U25 A;  3RGT A;  2Q5H A;  3Q45 A;  3QKE A;  3RO6 A;  1WYD A;  1NDA A;  2W54 A;  4YRF A;  1ECQ A;  3DG3 A;  1YQZ A;  3OPS A;  2AKW B;  3ZLF A;  1EIY B;  4YRR A;  3TW9 A;  5K1X A;  5K1P A;  2X50 A;  3R07 C;  1B70 B;  3HTZ A;  3VDG A;  3LSS A;  2AKZ A;  2OG9 A;  1MRA A;  2PTY A;  1N62 C;  4IZG A;  4ZA0 A;  4GYP C;  2PU0 A;  1NPX A;  4H2T A;  3DEQ A;  1R0M A;  2DVE A;  4Z17 A;  4HWO A;  2MNR A;  1KMN A;  1JJC B;  5FJP A;  4TQD A;  4P73 C;  2ZZB A;  1N5W C;  2XH2 A;  3DJJ A;  4YWO A;  4XTW A;  2AKW A;  3VQV A;  1EIY A;  3H4K A;  4YRK A;  2X8G A;  3PG6 A;  3OTR A;  3CAW A;  4P75 C;  1M6I A;  2DZ9 A;  3MQT A;  3DG6 A;  3CGC A;  3VCN A;  2PGW A;  1USY C;  2HXU A;  4H2H A;  3T4W A;  3U9I A;  2DTO A;  4KQE A;  3D47 A;  1YFS A;  1YFR A;  1EBD A;  2G4C A;  2PTZ A;  2GDQ A;  3H12 A;  4JN8 A;  1PYS B;  4K87 A;  4HVC A;  2P0I A;  3SSZ A;  3HXU A;  5BOE A;  1N9W A;  3T8Q A;  3TCS A;  2YQU A;  3UCC A;  2DZC A;  1JCT A;  4G7F A;  2WPC A;  1Q1W A;  2ODR C;  4LII A;  2W0H A;  3ERR A;  4DPG A;  2EJ9 A;  4WJ3 M;  4GGH A;  2PGE A;  1X55 A;  3L4G B;  1GER A;  2GR2 A;  2AKM A;  2WPF A;  1V59 A;  5FMH A;  2ZT7 A;  3HFV A;  1ASY A;  5G5H B;  3B97 A;  1WLE A;  4LNS A;  4P74 A;  4H4V A;  3QO7 A;  4TVW A;  1GXF A;  2JK6 A;  3NRZ B;  1P48 A;  3UJR A;  4UPA A;  3A7U A;  5TR3 A;  3ZLG A;  1NJ8 A;  1RM6 B;  2CJB A;  4H4X A;  3NVZ B;  1F3P A;  3SJN A;  1S7M A;  1SJD A;  3DIP A;  3I6T A;  12AS A;  2QHS A;  1ZMD A;  3RIR A;  1KD0 A;  4H4W A;  3TTE A;  1GRT A;  4K2S A;  3MUC A;  4E6M A;  3QN3 A;  2I4N A;  4P72 C;  5ELO A;  1XAN A;  3IC9 A;  2HXT A;  2OX4 A;  2EJF A;  1V97 A;  4IT1 A;  1H4T A;  2XSX A;  2P5I A;  4DXK A;  1QF6 A;  1IL2 A;  3P8Y A;  2ARS A;  1LVL A;  1Z7N A;  3SN0 A;  3IJL A;  1WUF A;  4X5O A;  1SRY A;  4X2P A;  1E1O A;  3FYY A;  1TYP A;  2OKT A;  2WOW A;  1OEP A;  3GD6 A;  3H8A A;  3LAD A;  3QPE A;  4A35 A;  2I4O A;  2DTI A;  1XDI A;  3NO1 A;  3CMQ A;  2WOI A;  5G5G B;  4EWJ A;  3HFZ B;  3QO8 A;  1G5H A;  2NPX A;  4DWD A;  4HWP A;  4PG3 A;  3V7S A;  1SER A;  3CGD A;  4E4F A;  3IG2 A;  1NYQ A;  1F8W A;  2EQ6 A;  4WF2 A;  1STZ A;  4H4Z A;  1GRE A;  3QTP A;  4TVA A;  4H4S A;  3MQZ A;  2ARU A;  3RGL A;  4E51 A;  3G1Z A;  3TJ4 A;  3GRS A;  4K88 A;  3QFB A;  2IY5 B;  2DDZ A;  2WP6 A;  1ADY A;  1X54 A;  4YCU A;  2EQ7 A;  3GO2 A;  4H4R A;  2ZAD A;  2BC1 A;  1DNC A;  2W3S A;  2EL9 A; 
#chains in the Genus database with same CATH homology
 1JRO A;  4YRC A;  1VQZ A;  4OLF A;  3HRK A;  1GGM A;  3DSQ A;  1BBU A;  2IY5 A;  3UFG A;  2AMC A;  4YP0 A;  1WU7 A;  3AM9 A;  1ZXI C;  1E1T A;  4H2Y A;  2RHQ B;  1L0W A;  4XU0 A;  2Q7H A;  1N5X A;  4H2X A;  1SB3 B;  4LVK A;  3MF2 A;  5F5W A;  3A74 A;  2I4M A;  3RKW A;  3BFM A;  3FJP A;  4P3N A;  4P74 C;  1LYL A;  4LVM A;  2RHQ A;  4AH6 A;  1B7Y A;  4UP9 A;  4L87 A;  1SES A;  3EFR A;  3SR6 B;  1C0A A;  3NS1 B;  3MF1 A;  4HWT A;  4CH6 A;  1KMM A;  1FIQ B;  3HRD C;  1QE0 A;  4BW9 A;  4LVJ A;  3NVW B;  2E64 A;  4YDQ A;  11AS A;  2CGH A;  3WQZ A;  3E9I A;  1H4V B;  2CJ9 A;  2Q7G A;  1NJ6 A;  1ADJ A;  4ZTZ B;  4J15 A;  1J5W A;  4ZIB A;  3REU A;  2A8E A;  2EAY A;  2ZGW A;  3HXX A;  4KR2 A;  3E9H A;  2PME A;  2ZZF A;  4HT4 A;  4G85 A;  4P71 A;  3KFU A;  1FO4 A;  4Q15 A;  3TEG A;  3IKM B;  4ZOH B;  2C8M A;  4CS4 A;  1YFT A;  4CS2 A;  3RKY A;  5E3I A;  3AMZ A;  1B8A A;  3NVY B;  4XTY A;  1NJ2 A;  3PCO B;  4CS3 A;  1BIB A;  1NNH A;  3PZC A;  3A5Y A;  2CIM A;  4UP8 A;  3TEH A;  2NS6 A;  5C51 B;  2ZZE A;  4XEO A;  2ZNJ A;  4TVA B;  1WPY A;  3NVV B;  4YRM A;  2C7I A;  2ZIM A;  2Q7E A;  2DTH A;  3PCO A;  4CH5 A;  3IKL A;  3V7C A;  2RHS B;  4YRN A;  2DJZ A;  3R07 A;  1N63 C;  2ZR3 A;  3VQW A;  4K86 A;  4LVL A;  2AMC B;  1X2H A;  4H2W A;  3A7R A;  1B76 A;  1H4Q A;  2P0L A;  4P73 A;  3REX A;  1EQR A;  3VQY A;  4YYE A;  3V8J A;  3V7R A;  4RDX A;  3VQX A;  1NJ1 A;  1BBW A;  1FFV C;  4YRI A;  3A7A A;  1SET A;  4H2X B;  1JRP A;  3OD1 A;  2J3M A;  3UGQ A;  4YRS A;  1WQW A;  4ZTU B;  3A31 A;  1WQ7 A;  3W3S A;  4WJ4 A;  1T3Q C;  4YCV A;  1B7Y B;  2QHT A;  2ZXF A;  4TQF A;  1E22 A;  1YB3 A;  3P8V A;  4EO4 A;  1RIQ A;  2EWN A;  5ELN A;  4TVY A;  2ART A;  2EL9 A;  4P72 A;  3HXZ A;  2E3C A;  1Z7M A;  2ZZG A;  4YRG A;  4YPF A;  5HGQ A;  2ODR D;  4XU2 A;  3EUB 3;  1X01 A;  4OP0 A;  3IAL A;  3RAC A;  3NEN A;  4XTV A;  2E65 A;  3HY0 A;  2E1H A;  4G84 A;  3HXY A;  4YRJ A;  2W55 A;  1ATI A;  1KOG A;  3I7F A;  4WI1 A;  1N60 C;  3ETR B;  2QHV A;  3P8T A;  3QTC A;  4DQ2 A;  3RUX A;  2XTI A;  3V8L A;  1W66 A;  2Q5I A;  2ZR2 A;  1G5I A;  3LC0 A;  5C52 B;  1B70 A;  4CH4 A;  4P3O A;  4UP7 A;  4P3P A;  3RF1 A;  3TEH B;  1N61 C;  4HWS A;  3M4P A;  1YGB A;  2DU5 A;  1G51 A;  2W3R A;  1JJC A;  2XGT A;  3RL6 A;  2E41 A;  2HNI A;  1FFU C;  2DXU A;  4XU3 A;  3EFS A;  4XU1 A;  4RQE A;  4EX5 A;  3V8K A;  1BIA A;  1EVL A;  1NJ5 A;  3HXW A;  1PYS A;  2J3L A;  2ZCE A;  4RMF A;  4YRE A;  4XTU A;  2ALY B;  3RKX A;  3HRI A;  2ZIN A;  5KNN A;  3L4G A;  3UGT A;  2ZT6 A;  4H02 A;  4TTV A;  2ALY A;  1EFW A;  4H2U A;  2E3T A;  2DQ0 A;  3NEM A;  2ZT5 A;  1E24 A;  1EVK A;  3VBB A;  4YRT A;  4Q6G A;  4XEM A;  4XTX A;  3HXV A;  4P75 A;  3L1A A;  1USY A;  1NYR A;  3AN1 A;  2EJG A;  3BJU A;  1WYG A;  4RQF A;  3HFZ A;  4H2S A;  3NEL A;  3QNE A;  2ZIO A;  2I4L A;  2DU7 A;  3NET A;  2QHU A;  4YRL A;  4P71 C;  4YCW A;  3B9J B;  2FYK A;  3MEY A;  2ZTG A;  4YRP A;  1VDV A;  4HA8 A;  2DEQ A;  4BWA A;  3HY1 A;  4O2D A;  3TUP A;  2DQ3 A;  2ZT8 A;  4H2V A;  4CH3 A;  4PHC A;  1HC7 A;  1X56 A;  4NCX A;  2ZNI A;  3LSQ A;  4KR3 A;  2DXT A;  1H4S A;  2E5A A;  3L2Z A;  1HTT A;  3A32 A;  1FYF A;  1X2G A;  3ICA A;  2E10 A;  1WNL A;  3QO5 A;  4LVI A;  1HXD A;  4YRQ A;  1EOV A;  2PMF A;  5C53 B;  2DKG A;  4HWR A;  3UH0 A;  3M4Q A;  4XTZ A;  4TWA A;  4YRO A;  2Q5H A;  4YRF A;  1WYD A;  2W54 A;  2AKW B;  1EIY B;  4YRR A;  5K1X A;  5K1P A;  3R07 C;  3HTZ A;  1B70 B;  3LSS A;  1N62 C;  4H2T A;  2DVE A;  4HWO A;  1KMN A;  1JJC B;  4TQD A;  4P73 C;  3VQV A;  1N5W C;  4XTW A;  2AKW A;  1EIY A;  4YRK A;  4P75 C;  2DZ9 A;  2CJA A;  2DTO A;  1USY C;  4KQE A;  1YFS A;  1YFR A;  2G4C A;  4K87 A;  1PYS B;  4HVC A;  3HXU A;  1N9W A;  2DZC A;  2ODR C;  3ERR A;  4DPG A;  2EJ9 A;  4WJ3 M;  1X55 A;  3L4G B;  2ZT7 A;  3HFV A;  1ASY A;  5G5H B;  4LNS A;  1WLE A;  4P74 A;  3QO7 A;  4TVW A;  3NRZ B;  4UPA A;  3A7U A;  1NJ8 A;  3A5Z A;  1RM6 B;  2CJB A;  3NVZ B;  2QHS A;  12AS A;  3RIR A;  4P72 C;  2I4N A;  5ELO A;  2EJF A;  1V97 A;  1H4T A;  2P5I A;  1QF6 A;  1IL2 A;  3P8Y A;  2ARS A;  1Z7N A;  4X5O A;  1SRY A;  1E1O A;  2I4O A;  2DTI A;  3HFZ B;  3CMQ A;  3QO8 A;  5G5G B;  1G5H A;  4HWP A;  3V7S A;  4PG3 A;  1SER A;  3IG2 A;  1NYQ A;  4WF2 A;  4TVA A;  3MQZ A;  2ARU A;  3RGL A;  4E51 A;  3G1Z A;  4K88 A;  2IY5 B;  2DDZ A;  1ADY A;  1X54 A;  4YCU A;  1ASZ A;  2W3S A;  2RHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...