2E5AA

Crystal structure of bovine lipoyltransferase in complex with lipoyl-amp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
343
structure length
329
Chain Sequence
GLILQSISNDVYHNLAVEDWIHDHMNLEGKPVLFLWRNSPTVVIGRHQNPWQECNLNLMREEGVKLARRRSGGGTVYHDMGNINLTFFTTKKKYDRMENLKLVVRALKAVHPHLDVQATKRFDLLLDGQFKISGTASKIGRNAAYHHCTLLCGTDGTFLSSLLKSPYQGIRSNATASTPALVKNLMEKDPTLTCEVVINAVATEYATSHQIDNHIHLINPTDETVFPGINSKAIELQTWEWIYGKTPKFSVDTSFTVLHSHVEIKVFIDVKNGRIEVCNIEAPDHWLPLEICDQLNSSLIGSKFSPIETTVDELHSKWNILCEKIKGIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoyltransferase 1
publication title Crystal structure of bovine Lipoyltransferase in complex with lipoyl-AMP
pubmed doi rcsb
source organism Bos taurus
molecule tags Ligase
total genus 108
structure length 329
sequence length 343
ec nomenclature ec 6.-.-.-:
pdb deposition date 2006-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2e5aA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e5aA01
3REXA 3TEGA 3NENA 1USYA 4TVAA 4TVYA 4YCUA 2EJGA 4YRLA 3L4GB 1ASZA 4Q15A 4H2YA 3UGQA 3HXVA 1GGMA 3L1AA 3A7UA 4HA8A 4RDXA 3V7SA 2DKGA 2EWNA 1ATIA 4P72A 3RIRA 2ZT7A 3NELA 3ETRB 1RIQA 1WQ7A 1G51A 1SRYA 3QO5A 1E1TA 5C53B 2ZR2A 4J15A 3P8VA 2E3CA 2ALYB 12ASA 1ADYA 2E1HA 3HXUA 1QF6A 3M4PA 4YYEA 2PMFA 4UPAA 1EVKA 1ASYA 1ZXIC 1BBWA 1T3QC 3VQVA 1NNHA 1EIYB 3AN1A 3A5YA 11ASA 4X5OA 4CS2A 5HGQA 4PG3A 2RHSA 4BWAA 5C51B 4L87A 1HTTA 4K88A 4YRTA 4RQEA 3V7CA 1VQZA 1HXDA 1YFTA 2ZNJA 3HFZA 3EFRA 3IG2A 4YREA 1B7YA 4H2TA 4DQ2A 4Q6GA 2DVEA 3V7RA 1SESA 3REUA 2ZIMA 1NJ1A 4NCXA 3R07C 5ELNA 1HC7A 2CJ9A 4HWOA 3PCOA 4CH6A 1FIQB 1WPYA 1QE0A 3BFMA 2AMCB 2IY5A 3LSSA 2PMEA 1SETA 2W3RA 2DTIA 4P74C 3AM9A 1J5WA 3HTZA 3RL6A 2CJAA 3HRIA 1X55A 4P75A 1H4VB 1E1OA 2ZNIA 4HWTA 3IKLA 4P3NA 4TVAB 3NVVB 1WNLA 2AKWA 4KQEA 2DTHA 4CS3A 2RHQA 3ERRA 3RKXA 3RKYA 2XTIA 4YRJA 3B9JB 4ZTUB 3QO8A 3V8KA 4XU1A 4HWPA 3NS1B 4YP0A 4K87A 1YB3A 3RUXA 1WYDA 4EO4A 4WJ4A 3NVWB 1NJ5A 1NYQA 3HRKA 1KOGA 2DZCA 1FFVC 4YRNA 4P71A 2DTOA 2E41A 4RQFA 1N63C 1JJCA 2E65A 2DU5A 4H2SA 4P73A 1B70A 1X54A 3MEYA 3UH0A 5G5GB 2DQ0A 4XEOA 2Q7GA 3MF2A 2RHSB 2EAYA 4XU0A 1B8AA 4ZIBA 2Q5IA 3QNEA 4OP0A 2ZINA 2Q7HA 1W66A 3HFZB 3I7FA 5C52B 2ZT8A 3NVYB 3LSQA 1H4TA 4H2WA 2ARSA 1SERA 2FYKA 1B7YB 1PYSA 2QHVA 4UP7A 1WYGA 1WQWA 4XTWA 1ADJA 5G5HB 4H02A 3A31A 3BJUA 2CIMA 3E9HA 3DSQA 3PCOB 2G4CA 3VQYA 4E51A 1X01A 2W55A 4YRMA 4OLFA 3QTCA 2IY5B 3L2ZA 4YDQA 1FFUC 1SB3B 1USYC 2DXTA 1LYLA 1VDVA 2ZT6A 2ODRC 3VBBA 2ZZGA 3NETA 2ODRD 3E9IA 4TQFA 2ZZFA 1EFWA 2QHSA 2ARUA 4YRGA 1YFSA 3A7AA 1BIAA 2P5IA 3A7RA 3HFVA 2AKWB 4P72C 2RHQB 1YGBA 3OD1A 5ELOA 3A74A 4YRKA 2DEQA 2ZTGA 2C8MA 2P0LA 4YRRA 4HWRA 4YRIA 1E22A 2C7IA 4XU3A 1BIBA 1NJ2A 4XTYA 5F5WA 2I4OA 2ZIOA 4TWAA 4CH4A 4H2UA 4K86A 2E64A 1RM6B 3TEHA 3RKWA 4CH5A 3IKMB 3HRDC 1WU7A 4YRCA 4TTVA 2Q7EA 1JJCB 4H2VA 3KFUA 1B70B 4YPFA 3P8YA 4P3PA 3VQXA 1JROA 2W3SA 2EJ9A 4XTVA 4ZOHB 3A32A 3HXZA 1NJ6A 4P3OA 4WI1A 5K1XA 4TQDA 1EOVA 2DDZA 3ICAA 4G84A 3NEMA 1X56A 4O2DA 1H4QA 2DXUA 1PYSB 3A5ZA 3HY0A 1IL2A 2Q5HA 1L0WA 3R07A 4CH3A 4EX5A 1YFRA 3RGLA 4YRFA 2ZGWA 4XU2A 3RF1A 4H2XA 2E3TA 4P75C 4AH6A 3VQWA 1N61C 4XTZA 5E3IA 3EFSA 1JRPA 4YRQA 3PZCA 3RACA 4RMFA 1Z7NA 4P74A 2ZCEA 2CGHA 3UGTA 3CMQA 3HXWA 1X2HA 4YCVA 1N5XA 4G85A 3L4GA 2I4NA 2QHUA 2DQ3A 2I4LA 1NYRA 2EJFA 1N9WA 3IALA 1FO4A 4BW9A 2ZZEA 2ZT5A 3LC0A 1B76A 1Z7MA 1G5IA 3SR6B 1H4SA 4UP9A 2DZ9A 4XTXA 1N60C 4PHCA 4YRPA 1N62C 2ALYA 2DJZA 4LNSA 2ZXFA 3V8LA 4DPGA 4P71C 3M4QA 3NRZB 3FJPA 1X2GA 1G5HA 2J3LA 4XTUA 1N5WC 1EIYA 3QO7A 2QHTA 2E10A 3TUPA 3TEHB 4P73C 3EUB3 2I4MA 3HXXA 4YROA 2W54A 3HY1A 4ZTZB 4UP8A 3V8JA 1KMMA 4KR3A 2ZR3A 4WF2A 2J3MA 4KR2A 2E5AA 2EL9A 1C0AA 4YRSA 4HVCA 1FYFA 5KNNA 1EVLA 4CS4A 3NVZB 3UFGA 1NJ8A 2CJBA 2XGTA 4XEMA 1EQRA 3WQZA 4TVWA 2AMCA 4YCWA 4WJ3M 2ARTA 1V97A 2DU7A 2HNIA 3MF1A 4HWSA 3AMZA 3P8TA 4H2XB 5K1PA 3HXYA 1E24A 1WLEA 1KMNA 3G1ZA 3W3SA 1BBUA
chains in the Genus database with same CATH superfamily
3REXA 3TEGA 3NENA 3DESA 1USYA 4TVAA 2AAQA 1ONEA 4KPRA 3D9XA 4IL2A 3DG7A 4TVYA 5FJPA 2WP6A 1GETA 5BOEA 4YCUA 2EJGA 1ECQA 4KEMA 2POZA 2AL2A 4YRLA 3L4GB 1ASZA 2GR3A 4DWDA 4Q15A 4H2YA 3RNMA 5U1OA 2X50A 3V5CA 3UGQA 4YWOA 2ZZCA 2PMQA 3IK4A 3HXVA 1GGMA 3L1AA 1JOAA 3GRTA 3U4FA 3A7UA 1ZDLA 4JQ9A 3JVAA 1MDRA 5JCKA 2XGZA 4HA8A 4RDXA 3V7SA 2DKGA 3UJRA 2EWNA 1ATIA 2X8HA 3OP2A 1MOKA 2F5ZA 3T4WA 1JDFA 2ZT7A 3NELA 4P72A 2WBAA 3RIRA 2YQUA 3ETRB 1ZK7A 4H4VA 1RIQA 1WQ7A 1G51A 3PWGA 1SRYA 1DXLA 4G8TA 1K4QA 4MGGA 4F4RA 1E1TA 3QO5A 5C53B 2I5QA 2ZR2A 2PU0A 3IC9A 4J15A 3P8VA 2GH5A 2E3CA 4JDRA 3UGVA 2ALYB 3DK9A 3H8AA 12ASA 2WPEA 4FX9A 4IT1A 3U9IA 1ADYA 2E1HA 3HXUA 3M4PA 3VC6A 3MQZA 4YYEA 1QF6A 4NEWA 2PMFA 4UPAA 2PTZA 1LVLA 1EVKA 1ZXIC 3TW9A 1ASYA 2QDEA 4H4SA 3UCDA 3DK8A 3Q6JA 4DN1A 1BBWA 4HT4A 1T3QC 1W6TA 2HQMA 3MKCA 3VQVA 3OW1A 1ZMCA 4J3ZA 2NVKX 1NNHA 1EIYB 3AN1A 4EM4A 3A5YA 3H7VA 11ASA 7ENLA 2FYMA 3T6CA 4X5OA 3SN4A 4CS2A 3PFRA 5HGQA 1GESA 4E5TA 3JZUA 2RHSA 4PG3A 5KVHA 4BWAA 5C51B 4L87A 2GDQA 1HTTA 1SJDA 4K88A 4YRTA 1Q1RA 4RQEA 2GL5A 2AL1A 3V7CA 1F9CA 3QLDA 1VQZA 4IL0A 1HXDA 1YFTA 2ZNJA 3HFZA 3GRSA 4LVKA 3VC5A 3T8QA 3URHA 3EFRA 3IG2A 4YREA 1B7YA 1FHVA 3OC4A 3RITA 3RRAA 1XHCA 4APNA 4H2TA 1JPMA 4DQ2A 4Q6GA 2A8XA 3ZLGA 2DVEA 1SESA 3V7RA 1BKHA 3OPSA 3REUA 3EF6A 2ZIMA 1NJ1A 1MO9A 2QJJA 1NHQA 4NCXA 5FJUA 3R07C 5ELNA 1MUCA 3VCCA 2AKMA 1HC7A 2CJ9A 4HWOA 3TJ4A 3PCOA 3MSYA 1TZZA 4J57A 3TWBA 1GXFA 4CH6A 1FIQB 1XANA 1WPYA 2DW7A 3P3BA 1QE0A 3BFMA 2C3CA 5FMHA 4GYPA 2AMCB 1TKKA 1MNSA 2PP0A 3LADA 5EBKA 2IY5A 4H83A 3LSSA 1DNCA 2PMEA 1SETA 2W3RA 2DTIA 4P74C 3NXLA 2EQ6A 3AM9A 1H2IA 4X2PA 1J5WA 1SJCA 3VDGA 3UJFA 2PS2A 3HTZA 3RL6A 2CJAA 3HRIA 1X55A 4P75A 4IP5A 4BV6A 1H4VB 1H6VA 2OG9A 3L5OA 3SBFA 1E1OA 4HWTA 3FV9A 3RGTA 3IKLA 3P93A 2HZGA 2OPJA 4P3NA 2J3NA 3SN0A 4TVAB 3NVVB 2OZTA 3DK4A 3PWIA 3R25A 2XH7A 4E6MA 3TOYA 2BCPA 2WPCA 4GRTA 5J04A 1WNLA 1YQZA 2AKWA 4KQEA 2DTHA 4CS3A 2AL2B 2RHQA 4KPLA 2HXUA 3ERRA 3RKXA 1BWCA 3RKYA 3UCCA 3MZNA 3DFYA 4H1ZA 2X8CA 2OLAA 2XTIA 4GMEA 4YRJA 2C3DA 3B9JB 4ZTUB 2GRTA 3QO8A 1D7YA 4A35A 3GD6A 3V8KA 4H4RA 4XU1A 3EAOA 4HWPA 1EBDA 3NS1B 2XH4A 4YP0A 3DDMA 1GRHA 4K87A 4GGBA 1KD0A 1YB3A 3RUXA 2OZ8A 1WYDA 4EO4A 1S7MA 2OFJA 4WJ4A 2OX4A 3TQPA 3NVWB 4E4FA 1NJ5A 1NYQA 3HRKA 1KOGA 3UXKA 1FFVC 2DZCA 4YRNA 1JCTA 2WOVA 3CYJA 4P71A 4H4QA 3S5SA 4K7ZA 2DTOA 2E41A 4RQFA 1N63C 3OZMA 1JJCA 2BC0A 2E65A 2TPRA 2DU5A 4H2SA 1STZA 4P73A 1B70A 1X54A 1XDIA 2PCEA 3MEYA 3KLJA 3UH0A 1BBUA 5G5GB 2V3BA 2PP3A 2DQ0A 5FJOA 3DJGX 2Q7GA 3MF2A 4XEOA 2PTWA 3RCYA 2EAYA 2RHSB 1B8AA 4XU0A 4ZIBA 1SJBA 3N6HA 2Q5IA 3QNEA 1KCZA 4OP0A 2ZINA 2R9ZA 2Q7HA 1W66A 3HFZB 3I7FA 5C52B 1GERA 2ZT8A 3NVYB 3LSQA 1H4TA 4YWSA 4H2WA 2ARSA 1SERA 2FYKA 3FXGA 1B7YB 2WOWA 1PYSA 2QHVA 4UP7A 3DERA 1EBGA 3GY1A 4LVMA 3ES8A 2WP5A 3SJNA 1WYGA 1WQWA 5JCMA 4XTWA 4ADWA 2PP1A 3DIPA 2HNEA 3JW7A 2X99A 5G5HB 1ADJA 2XSXA 4H02A 3S47A 1MDLA 3DG3A 1PDYA 3A31A 3P0WA 4G7FA 2CIMA 3BJUA 3DSQA 1BQGA 3E9HA 3EKGA 5GRTA 3PCOB 5JRBA 4K1WA 2YAUA 2ZZ0A 3DGZA 1AOGA 1WUFA 3FCPA 2G4CA 3VQYA 4E51A 1X01A 2W55A 1WUEA 4YRMA 2QAEA 4OLFA 3TTEA 3QTCA 2IY5B 4GR1A 5FS8A 3V5FA 3L2ZA 4GISA 4EQRA 3STPA 2V3AA 3CGCA 4EWJA 3LXDA 4J1OA 4YDQA 1FFUC 1SB3B 4BURA 1FEAA 1USYC 2DXTA 1LYLA 3VCNA 4HN8A 1VDVA 1BZLA 3N4EA 2ZT6A 4LVIA 2FKPA 2OQHA 1EC7A 2OQYA 6ENLA 1KKRA 2ODRC 3VBBA 3OZYA 2PODA 2ZZGA 3NETA 2ODRD 3R1ZA 4K8GA 3E9IA 4JHMA 3THUA 4TQFA 2ZZFA 1EFWA 3PK7A 1NDAA 4A3RA 2QHSA 1JPDX 3NZGA 3SQPA 1NELA 4EMJA 1ONFA 2ARUA 1YFSA 2WOIA 3CK5A 3A7AA 4YRGA 2XH2A 5U25A 4GGHA 3DFHA 1BIAA 2P5IA 3A7RA 2CFYA 3HFVA 4DNAA 4EQXA 2AKWB 5ENLA 3EANA 3PG6A 2PTXA 4P72C 3H12A 2RHQB 5KVIA 1YGBA 3OD1A 1P43A 1PDZA 4KT2A 4DHGA 1EC8A 5ELOA 3A74A 4YRKA 4E8GA 3ZVHA 1XS2A 1KN0A 2GQWA 2DEQA 2ZTGA 3DEQA 1MRAA 3R0UA 4FI4A 2C8MA 4H4UA 3BSMA 4EQWA 2P0LA 4YRRA 4EMIA 4HWRA 5JCLA 4A6GA 1E9IA 1E22A 1FHUA 4DXKA 2C7IA 4YRIA 2OO6A 2X8GA 4XU3A 1GRBA 2ZNIA 2RABA 5ER0A 1BIBA 1NJ2A 4XTYA 3UXLA 3KUMA 5F5WA 3IJIA 2I4OA 4HCDA 4HCLA 2P88A 2GR1A 2ZIOA 1L8PA 4TWAA 4CH4A 4NEVA 4H2UA 4K86A 3CXBA 4GIRA 2E64A 1RM6B 5FS9A 4EM3A 3OTRA 3TEHA 1GREA 4H2HA 5FS7A 2QVHA 3UJ2A 3HPFA 3RKWA 4CH5A 4LIIA 4HPNA 3IKMB 3HRDC 4EQSA 3DJJA 1WU7A 4YRCA 4H4XA 4M6UA 4H4TA 4FDCB 4TTVA 3ZLFA 2Q7EA 1JJCB 1F8WA 3CXOA 3MQTA 2MNRA 4H2VA 5TR3A 2W0HA 4K2SA 3SSZA 1M6IA 3KFUA 3FVDA 1ELSA 1B70B 2EQ9A 3N6JA 4ZCWA 4YPFA 2O56A 3T9PA 3P8YA 4P3PA 2ZADA 3VQXA 1EBHA 2W3SA 1JROA 1ZKQA 2GGEA 3CGEA 2QJMA 2EJ9A 4ZOHB 4XTVA 1V59A 3A32A 3HXZA 4KWSA 1NJ6A 4P3OA 4WI1A 3TJIA 4TQDA 3MWCA 1EOVA 3LB8A 2DDZA 5K1XA 4HNLA 2QGYA 3ICAA 4G84A 3CAWA 2JK6A 3IJQA 2P8CA 2PGWA 3NEMA 1GRTA 3H4KA 4LA1A 3TWAA 2RDXA 1X56A 2P3ZA 1P48A 4O2DA 1H4QA 2DXUA 1PYSB 1GRGA 3O0HA 4GFIA 1OJTA 3V4BA 2NS6A 3A5ZA 3HY0A 1IL2A 1TYPA 2PTYA 3CT2A 3D47A 3MY9A 3UJEA 4GYPC 2Q5HA 1L0WA 3R07A 3CGBA 1YEYA 5FJTA 4CH3A 1ZX9A 4EX5A 1YFRA 2EQ8A 3NO1A 5JCNA 1GSNA 2ZZBA 4MKSA 1R0MA 3H70A 3RGLA 4YRFA 2ZGWA 2PA6A 4XU2A 1DTNA 3RF1A 3ES7A 4H2XA 2E3TA 3MUCA 4P75C 4AH6A 3VQWA 3R0KA 1N61C 3DGHA 3UJSA 4XTZA 3EFSA 1JRPA 4YRQA 5E3IA 3W3SA 2PU1A 3PZCA 3QKEA 3RACA 4RMFA 1Z7NA 4P74A 4ENLA 2ZCEA 2CGHA 2QDDA 4E4UA 3UGTA 3CMQA 3SQSA 2MUCA 1F3PA 1R6WA 2ONEA 2XH0A 3HXWA 4FP1A 4H50A 1X2HA 2CHRA 3I4KA 4YCVA 1N5XA 4K8DA 4G85A 2GGIA 3L4GA 2GR2A 2QQ6A 1LPFA 3QPEA 2I4NA 2QHUA 4J56A 2PGEA 2P0IA 2WPFA 4Z17A 2CDUA 2DQ3A 1FEBA 2I4LA 1NYRA 2EJFA 1N9WA 3IALA 1FO4A 3DGBA 3L8KA 4BW9A 2ZZEA 3Q4DA 3R11A 1FECA 2DW6A 4JN7A 1XPYA 2GGHA 4HCHA 5BOFA 2ZT5A 3LC0A 2P8BA 3VA8A 4H4WA 1NPXA 4HYRA 1B76A 1Z7MA 2GSHA 3ZVHB 1G5IA 3SR6B 4H4YA 1H4SA 3II4A 4UP9A 2DZ9A 4XTXA 1N60C 1NHRA 3DG6A 3SN1A 2GR0A 2OKTA 1N62C 2ALYA 4PHCA 4YRPA 3ZVIA 2DJZA 1EC9A 1TYTA 2PPGA 2OZ3A 4LNSA 3CGDA 4M0XA 2ZXFA 3IJLA 3V8LA 5EU9A 4DPGA 1NHSA 3V3WA 4H4PA 3N4FA 2PSNA 3M4QA 4P71C 2ZC8A 3NRZB 2OVLA 1GV4A 3FJPA 1X2GA 1G5HA 2J3LA 4LVLA 2YVGA 4XTUA 2GGGA 2EQ7A 4Z1YA 1N5WC 4JN8A 3QO7A 1EIYA 2QHTA 3D46A 2E10A 3TUPA 3FJ4A 3TEHB 4P73C 1GEUA 4IZGA 1SJAA 4HNCA 3EUB3 4IP4A 5FS6A 2I4MA 3I6TA 2HXTA 3GC2A 3HXXA 3CB3A 4YROA 2YVFA 3I6EA 5JCIA 4EMWA 2W54A 4ROPA 3NFUA 3HY1A 3ENLA 2V6OA 4H4ZA 3FYYA 3RO6A 4ZTZB 4UP8A 3V8JA 3GD4A 1KMMA 1JEHA 4KR3A 2ZR3A 4WF2A 4ZA0A 2YVJA 2J3MA 4DYEA 4DX3A 1GRAA 4KR2A 2E5AA 3VFCA 5IDZA 3TCSA 2EL9A 1C0AA 4YRSA 4IHCA 2A8EA 1FYFA 4HVCA 5KNNA 1EVLA 2GGJA 3QN3A 1GRFA 4CS4A 1Q1WA 1RVKA 3Q45A 3NVZB 3UFGA 1NJ8A 3RR1A 2NQLA 2CJBA 2XGTA 3K1GA 4XEMA 1EQRA 3WQZA 4MMWA 3GO2A 4M52A 5FJRA 1OEPA 1NHPA 3QTPA 3ZLHA 3B97A 4TVWA 2AMCA 2QJNA 2AKZA 3HW2A 4YCWA 4WJ3M 3QFAA 2ARTA 1V97A 3BOXA 4H19A 2DU7A 2HNIA 3MF1A 1KKOA 1ZMDA 3GD3A 4HWSA 3AMZA 3FG2P 4LVJA 3BJSA 2NPXA 1NU5A 3P8TA 1ZY8A 4H2XB 3QFBA 5K1PA 1E24A 1WLEA 3HXYA 1KMNA 3G1ZA 2BC1A 1TE6A 3EEZA 3DH9A 3R10A 1IYXA
chains in the Genus database with same CATH topology
3REXA 3TEGA 3NENA 1USYA 4TVAA 4TVYA 4YCUA 2EJGA 4YRLA 3L4GB 1ASZA 4Q15A 4H2YA 3UGQA 3HXVA 1GGMA 3L1AA 3A7UA 4HA8A 4RDXA 3V7SA 2DKGA 2EWNA 1ATIA 4P72A 3RIRA 2ZT7A 3NELA 3ETRB 1RIQA 1WQ7A 1G51A 1SRYA 3QO5A 1E1TA 5C53B 2ZR2A 4J15A 3P8VA 2E3CA 2ALYB 12ASA 1ADYA 2E1HA 3HXUA 1QF6A 3MQZA 3M4PA 4YYEA 2PMFA 4UPAA 1EVKA 1ASYA 1ZXIC 1BBWA 4HT4A 1T3QC 3VQVA 1NNHA 1EIYB 3AN1A 3A5YA 11ASA 4X5OA 4CS2A 5HGQA 4PG3A 2RHSA 4BWAA 5C51B 4L87A 1HTTA 4K88A 4YRTA 4RQEA 3V7CA 1VQZA 1HXDA 1YFTA 2ZNJA 3HFZA 4LVKA 3EFRA 3IG2A 4YREA 1B7YA 4H2TA 4DQ2A 4Q6GA 2DVEA 3V7RA 1SESA 3REUA 2ZIMA 1NJ1A 4NCXA 3R07C 5ELNA 1HC7A 2CJ9A 4HWOA 3PCOA 4CH6A 1FIQB 1WPYA 1QE0A 3BFMA 2AMCB 2IY5A 3LSSA 2PMEA 1SETA 2W3RA 2DTIA 4P74C 3AM9A 1J5WA 3HTZA 3RL6A 2CJAA 3HRIA 1X55A 4P75A 1H4VB 1E1OA 2ZNIA 4HWTA 3IKLA 4P3NA 4TVAB 3NVVB 1WNLA 2AKWA 4KQEA 2DTHA 4CS3A 2RHQA 3ERRA 3RKXA 3RKYA 2XTIA 4YRJA 3B9JB 4ZTUB 3QO8A 3V8KA 4XU1A 4HWPA 3NS1B 4YP0A 4K87A 1YB3A 3RUXA 1WYDA 4EO4A 4WJ4A 3NVWB 1NJ5A 1NYQA 3HRKA 1KOGA 2DZCA 1FFVC 4YRNA 4P71A 2DTOA 2E41A 4RQFA 1N63C 1JJCA 2E65A 2DU5A 4H2SA 4P73A 1B70A 1X54A 3MEYA 3UH0A 5G5GB 2DQ0A 4XEOA 2Q7GA 3MF2A 2RHSB 2EAYA 4XU0A 1B8AA 4ZIBA 2Q5IA 3QNEA 4OP0A 2ZINA 2Q7HA 1W66A 3HFZB 3I7FA 5C52B 2ZT8A 3NVYB 3LSQA 1H4TA 4H2WA 2ARSA 1SERA 2FYKA 1B7YB 1PYSA 2QHVA 4UP7A 4LVMA 1WYGA 1WQWA 4XTWA 1ADJA 5G5HB 4H02A 3A31A 3BJUA 2CIMA 3E9HA 3DSQA 3PCOB 2G4CA 3VQYA 4E51A 1X01A 2W55A 4YRMA 4OLFA 3QTCA 2IY5B 3L2ZA 4YDQA 1FFUC 1SB3B 1USYC 2DXTA 1LYLA 1VDVA 4LVIA 2ZT6A 2ODRC 3VBBA 2ZZGA 3NETA 2ODRD 3E9IA 4TQFA 2ZZFA 1EFWA 2QHSA 2ARUA 4YRGA 1YFSA 3A7AA 1BIAA 2P5IA 3A7RA 3HFVA 2AKWB 4P72C 2RHQB 1YGBA 3OD1A 5ELOA 3A74A 4YRKA 2DEQA 2ZTGA 2C8MA 2P0LA 4YRRA 4HWRA 4YRIA 1E22A 2C7IA 4XU3A 1BIBA 1NJ2A 4XTYA 5F5WA 2I4OA 2ZIOA 4TWAA 4CH4A 4H2UA 4K86A 2E64A 1RM6B 3TEHA 3RKWA 4CH5A 3IKMB 3HRDC 1WU7A 4YRCA 4TTVA 2Q7EA 1JJCB 4H2VA 3KFUA 1B70B 4YPFA 3P8YA 4P3PA 3VQXA 1JROA 2W3SA 2EJ9A 4XTVA 4ZOHB 3A32A 3HXZA 1NJ6A 4P3OA 4WI1A 5K1XA 4TQDA 1EOVA 2DDZA 3ICAA 4G84A 3NEMA 1X56A 4O2DA 1H4QA 2DXUA 1PYSB 2NS6A 3A5ZA 3HY0A 1IL2A 2Q5HA 1L0WA 3R07A 4CH3A 4EX5A 1YFRA 3RGLA 4YRFA 2ZGWA 4XU2A 3RF1A 4H2XA 2E3TA 4P75C 4AH6A 3VQWA 1N61C 4XTZA 5E3IA 3EFSA 1JRPA 4YRQA 3PZCA 3RACA 4RMFA 1Z7NA 4P74A 2ZCEA 2CGHA 3UGTA 3CMQA 3HXWA 1X2HA 4YCVA 1N5XA 4G85A 3L4GA 2I4NA 2QHUA 2DQ3A 2I4LA 1NYRA 2EJFA 1N9WA 3IALA 1FO4A 4BW9A 2ZZEA 2ZT5A 3LC0A 1B76A 1Z7MA 1G5IA 3SR6B 1H4SA 4UP9A 2DZ9A 4XTXA 1N60C 4PHCA 4YRPA 1N62C 2ALYA 2DJZA 4LNSA 2ZXFA 3V8LA 4DPGA 4P71C 3M4QA 3NRZB 3FJPA 1X2GA 1G5HA 2J3LA 4LVLA 4XTUA 1N5WC 1EIYA 3QO7A 2QHTA 2E10A 3TUPA 3TEHB 4P73C 3EUB3 2I4MA 3HXXA 4YROA 2W54A 3HY1A 4ZTZB 4UP8A 3V8JA 1KMMA 4KR3A 2ZR3A 4WF2A 2J3MA 4KR2A 2E5AA 2EL9A 1C0AA 4YRSA 2A8EA 1FYFA 4HVCA 5KNNA 1EVLA 4CS4A 3NVZB 3UFGA 1NJ8A 2CJBA 2XGTA 4XEMA 1EQRA 3WQZA 4TVWA 2AMCA 4YCWA 4WJ3M 2ARTA 1V97A 2DU7A 2HNIA 3MF1A 4HWSA 3AMZA 4LVJA 3P8TA 4H2XB 5K1PA 3HXYA 1E24A 1WLEA 1KMNA 3G1ZA 3W3SA 1BBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REX A;  3TEG A;  3NEN A;  1USY A;  4TVA A;  4TVY A;  4YCU A;  2EJG A;  4YRL A;  3L4G B;  1ASZ A;  4Q15 A;  4H2Y A;  3UGQ A;  3HXV A;  1GGM A;  3L1A A;  3A7U A;  4HA8 A;  4RDX A;  3V7S A;  2DKG A;  2EWN A;  1ATI A;  4P72 A;  3RIR A;  2ZT7 A;  3NEL A;  3ETR B;  1RIQ A;  1WQ7 A;  1G51 A;  1SRY A;  3QO5 A;  1E1T A;  5C53 B;  2ZR2 A;  4J15 A;  3P8V A;  2E3C A;  2ALY B;  12AS A;  1ADY A;  2E1H A;  3HXU A;  1QF6 A;  3M4P A;  4YYE A;  2PMF A;  4UPA A;  1EVK A;  1ASY A;  1ZXI C;  1BBW A;  1T3Q C;  3VQV A;  1NNH A;  1EIY B;  3AN1 A;  3A5Y A;  11AS A;  4X5O A;  4CS2 A;  5HGQ A;  4PG3 A;  2RHS A;  4BWA A;  5C51 B;  4L87 A;  1HTT A;  4K88 A;  4YRT A;  4RQE A;  3V7C A;  1VQZ A;  1HXD A;  1YFT A;  2ZNJ A;  3HFZ A;  3EFR A;  3IG2 A;  4YRE A;  1B7Y A;  4H2T A;  4DQ2 A;  4Q6G A;  2DVE A;  3V7R A;  1SES A;  3REU A;  2ZIM A;  1NJ1 A;  4NCX A;  3R07 C;  5ELN A;  1HC7 A;  2CJ9 A;  4HWO A;  3PCO A;  4CH6 A;  1FIQ B;  1WPY A;  1QE0 A;  3BFM A;  2AMC B;  2IY5 A;  3LSS A;  2PME A;  1SET A;  2W3R A;  2DTI A;  4P74 C;  3AM9 A;  1J5W A;  3HTZ A;  3RL6 A;  2CJA A;  3HRI A;  1X55 A;  4P75 A;  1H4V B;  1E1O A;  2ZNI A;  4HWT A;  3IKL A;  4P3N A;  4TVA B;  3NVV B;  1WNL A;  2AKW A;  4KQE A;  2DTH A;  4CS3 A;  2RHQ A;  3ERR A;  3RKX A;  3RKY A;  2XTI A;  4YRJ A;  3B9J B;  4ZTU B;  3QO8 A;  3V8K A;  4XU1 A;  4HWP A;  3NS1 B;  4YP0 A;  4K87 A;  1YB3 A;  3RUX A;  1WYD A;  4EO4 A;  4WJ4 A;  3NVW B;  1NJ5 A;  1NYQ A;  3HRK A;  1KOG A;  2DZC A;  1FFV C;  4YRN A;  4P71 A;  2DTO A;  2E41 A;  4RQF A;  1N63 C;  1JJC A;  2E65 A;  2DU5 A;  4H2S A;  4P73 A;  1B70 A;  1X54 A;  3MEY A;  3UH0 A;  5G5G B;  2DQ0 A;  4XEO A;  2Q7G A;  3MF2 A;  2RHS B;  2EAY A;  4XU0 A;  1B8A A;  4ZIB A;  2Q5I A;  3QNE A;  4OP0 A;  2ZIN A;  2Q7H A;  1W66 A;  3HFZ B;  3I7F A;  5C52 B;  2ZT8 A;  3NVY B;  3LSQ A;  1H4T A;  4H2W A;  2ARS A;  1SER A;  2FYK A;  1B7Y B;  1PYS A;  2QHV A;  4UP7 A;  1WYG A;  1WQW A;  4XTW A;  1ADJ A;  5G5H B;  4H02 A;  3A31 A;  3BJU A;  2CIM A;  3E9H A;  3DSQ A;  3PCO B;  2G4C A;  3VQY A;  4E51 A;  1X01 A;  2W55 A;  4YRM A;  4OLF A;  3QTC A;  2IY5 B;  3L2Z A;  4YDQ A;  1FFU C;  1SB3 B;  1USY C;  2DXT A;  1LYL A;  1VDV A;  2ZT6 A;  2ODR C;  3VBB A;  2ZZG A;  3NET A;  2ODR D;  3E9I A;  4TQF A;  2ZZF A;  1EFW A;  2QHS A;  2ARU A;  4YRG A;  1YFS A;  3A7A A;  1BIA A;  2P5I A;  3A7R A;  3HFV A;  2AKW B;  4P72 C;  2RHQ B;  1YGB A;  3OD1 A;  5ELO A;  3A74 A;  4YRK A;  2DEQ A;  2ZTG A;  2C8M A;  2P0L A;  4YRR A;  4HWR A;  4YRI A;  1E22 A;  2C7I A;  4XU3 A;  1BIB A;  1NJ2 A;  4XTY A;  5F5W A;  2I4O A;  2ZIO A;  4TWA A;  4CH4 A;  4H2U A;  4K86 A;  2E64 A;  1RM6 B;  3TEH A;  3RKW A;  4CH5 A;  3IKM B;  3HRD C;  1WU7 A;  4YRC A;  4TTV A;  2Q7E A;  1JJC B;  4H2V A;  3KFU A;  1B70 B;  4YPF A;  3P8Y A;  4P3P A;  3VQX A;  1JRO A;  2W3S A;  2EJ9 A;  4XTV A;  4ZOH B;  3A32 A;  3HXZ A;  1NJ6 A;  4P3O A;  4WI1 A;  5K1X A;  4TQD A;  1EOV A;  2DDZ A;  3ICA A;  4G84 A;  3NEM A;  1X56 A;  4O2D A;  1H4Q A;  2DXU A;  1PYS B;  3A5Z A;  3HY0 A;  1IL2 A;  2Q5H A;  1L0W A;  3R07 A;  4CH3 A;  4EX5 A;  1YFR A;  3RGL A;  4YRF A;  2ZGW A;  4XU2 A;  3RF1 A;  4H2X A;  2E3T A;  4P75 C;  4AH6 A;  3VQW A;  1N61 C;  4XTZ A;  5E3I A;  3EFS A;  1JRP A;  4YRQ A;  3PZC A;  3RAC A;  4RMF A;  1Z7N A;  4P74 A;  2ZCE A;  2CGH A;  3UGT A;  3CMQ A;  3HXW A;  1X2H A;  4YCV A;  1N5X A;  4G85 A;  3L4G A;  2I4N A;  2QHU A;  2DQ3 A;  2I4L A;  1NYR A;  2EJF A;  1N9W A;  3IAL A;  1FO4 A;  4BW9 A;  2ZZE A;  2ZT5 A;  3LC0 A;  1B76 A;  1Z7M A;  1G5I A;  3SR6 B;  1H4S A;  4UP9 A;  2DZ9 A;  4XTX A;  1N60 C;  4PHC A;  4YRP A;  1N62 C;  2ALY A;  2DJZ A;  4LNS A;  2ZXF A;  3V8L A;  4DPG A;  4P71 C;  3M4Q A;  3NRZ B;  3FJP A;  1X2G A;  1G5H A;  2J3L A;  4XTU A;  1N5W C;  1EIY A;  3QO7 A;  2QHT A;  2E10 A;  3TUP A;  3TEH B;  4P73 C;  3EUB 3;  2I4M A;  3HXX A;  4YRO A;  2W54 A;  3HY1 A;  4ZTZ B;  4UP8 A;  3V8J A;  1KMM A;  4KR3 A;  2ZR3 A;  4WF2 A;  2J3M A;  4KR2 A;  2E5A A;  2EL9 A;  1C0A A;  4YRS A;  4HVC A;  1FYF A;  5KNN A;  1EVL A;  4CS4 A;  3NVZ B;  3UFG A;  1NJ8 A;  2CJB A;  2XGT A;  4XEM A;  1EQR A;  3WQZ A;  4TVW A;  2AMC A;  4YCW A;  4WJ3 M;  2ART A;  1V97 A;  2DU7 A;  2HNI A;  3MF1 A;  4HWS A;  3AMZ A;  3P8T A;  4H2X B;  5K1P A;  3HXY A;  1E24 A;  1WLE A;  1KMN A;  3G1Z A;  3W3S A;  1BBU A; 
#chains in the Genus database with same CATH topology
 3REX A;  3TEG A;  3NEN A;  3DES A;  1USY A;  4TVA A;  2AAQ A;  1ONE A;  4KPR A;  3D9X A;  4IL2 A;  3DG7 A;  4TVY A;  5FJP A;  2WP6 A;  1GET A;  5BOE A;  4YCU A;  2EJG A;  1ECQ A;  4KEM A;  2POZ A;  2AL2 A;  4YRL A;  3L4G B;  1ASZ A;  2GR3 A;  4DWD A;  4Q15 A;  4H2Y A;  3RNM A;  5U1O A;  2X50 A;  3V5C A;  3UGQ A;  4YWO A;  2ZZC A;  2PMQ A;  3IK4 A;  3HXV A;  1GGM A;  3L1A A;  1JOA A;  3GRT A;  3U4F A;  3A7U A;  1ZDL A;  4JQ9 A;  3JVA A;  1MDR A;  5JCK A;  2XGZ A;  4HA8 A;  4RDX A;  3V7S A;  2DKG A;  3UJR A;  2EWN A;  1ATI A;  2X8H A;  3OP2 A;  1MOK A;  2F5Z A;  3T4W A;  1JDF A;  2ZT7 A;  3NEL A;  4P72 A;  2WBA A;  3RIR A;  2YQU A;  3ETR B;  1ZK7 A;  4H4V A;  1RIQ A;  1WQ7 A;  1G51 A;  3PWG A;  1SRY A;  1DXL A;  4G8T A;  1K4Q A;  4MGG A;  4F4R A;  1E1T A;  3QO5 A;  5C53 B;  2I5Q A;  2ZR2 A;  2PU0 A;  3IC9 A;  4J15 A;  3P8V A;  2GH5 A;  2E3C A;  4JDR A;  3UGV A;  2ALY B;  3DK9 A;  3H8A A;  12AS A;  2WPE A;  4FX9 A;  4IT1 A;  3U9I A;  1ADY A;  2E1H A;  3HXU A;  3M4P A;  3VC6 A;  3MQZ A;  4YYE A;  1QF6 A;  4NEW A;  2PMF A;  4UPA A;  2PTZ A;  1LVL A;  1EVK A;  1ZXI C;  3TW9 A;  1ASY A;  2QDE A;  4H4S A;  3UCD A;  3DK8 A;  3Q6J A;  4DN1 A;  1BBW A;  4HT4 A;  1T3Q C;  1W6T A;  2HQM A;  3MKC A;  3VQV A;  3OW1 A;  1ZMC A;  4J3Z A;  2NVK X;  1NNH A;  1EIY B;  3AN1 A;  4EM4 A;  3A5Y A;  3H7V A;  11AS A;  7ENL A;  2FYM A;  3T6C A;  4X5O A;  3SN4 A;  4CS2 A;  3PFR A;  5HGQ A;  1GES A;  4E5T A;  3JZU A;  2RHS A;  4PG3 A;  5KVH A;  4BWA A;  5C51 B;  4L87 A;  2GDQ A;  1HTT A;  1SJD A;  4K88 A;  4YRT A;  1Q1R A;  4RQE A;  2GL5 A;  2AL1 A;  3V7C A;  1F9C A;  3QLD A;  1VQZ A;  4IL0 A;  1HXD A;  1YFT A;  2ZNJ A;  3HFZ A;  3GRS A;  4LVK A;  3VC5 A;  3T8Q A;  3URH A;  3EFR A;  3IG2 A;  4YRE A;  1B7Y A;  1FHV A;  3OC4 A;  3RIT A;  3RRA A;  1XHC A;  4APN A;  4H2T A;  1JPM A;  4DQ2 A;  4Q6G A;  2A8X A;  3ZLG A;  2DVE A;  1SES A;  3V7R A;  1BKH A;  3OPS A;  3REU A;  3EF6 A;  2ZIM A;  1NJ1 A;  1MO9 A;  2QJJ A;  1NHQ A;  4NCX A;  5FJU A;  3R07 C;  5ELN A;  1MUC A;  3VCC A;  2AKM A;  1HC7 A;  2CJ9 A;  4HWO A;  3TJ4 A;  3PCO A;  3MSY A;  1TZZ A;  4J57 A;  3TWB A;  1GXF A;  4CH6 A;  1FIQ B;  1XAN A;  1WPY A;  2DW7 A;  3P3B A;  1QE0 A;  3BFM A;  2C3C A;  5FMH A;  4GYP A;  2AMC B;  1TKK A;  1MNS A;  2PP0 A;  3LAD A;  5EBK A;  2IY5 A;  4H83 A;  3LSS A;  1DNC A;  2PME A;  1SET A;  2W3R A;  2DTI A;  4P74 C;  3NXL A;  2EQ6 A;  3AM9 A;  1H2I A;  4X2P A;  1J5W A;  1SJC A;  3VDG A;  3UJF A;  2PS2 A;  3HTZ A;  3RL6 A;  2CJA A;  3HRI A;  1X55 A;  4P75 A;  4IP5 A;  4BV6 A;  1H4V B;  1H6V A;  2OG9 A;  3L5O A;  3SBF A;  1E1O A;  4HWT A;  3FV9 A;  3RGT A;  3IKL A;  3P93 A;  2HZG A;  2OPJ A;  4P3N A;  2J3N A;  3SN0 A;  4TVA B;  3NVV B;  2OZT A;  3DK4 A;  3PWI A;  3R25 A;  2XH7 A;  4E6M A;  3TOY A;  2BCP A;  2WPC A;  4GRT A;  5J04 A;  1WNL A;  1YQZ A;  2AKW A;  4KQE A;  2DTH A;  4CS3 A;  2AL2 B;  2RHQ A;  4KPL A;  2HXU A;  3ERR A;  3RKX A;  1BWC A;  3RKY A;  3UCC A;  3MZN A;  3DFY A;  4H1Z A;  2X8C A;  2OLA A;  2XTI A;  4GME A;  4YRJ A;  2C3D A;  3B9J B;  4ZTU B;  2GRT A;  3QO8 A;  1D7Y A;  4A35 A;  3GD6 A;  3V8K A;  4H4R A;  4XU1 A;  3EAO A;  4HWP A;  1EBD A;  3NS1 B;  2XH4 A;  4YP0 A;  3DDM A;  1GRH A;  4K87 A;  4GGB A;  1KD0 A;  1YB3 A;  3RUX A;  2OZ8 A;  1WYD A;  4EO4 A;  1S7M A;  2OFJ A;  4WJ4 A;  2OX4 A;  3TQP A;  3NVW B;  4E4F A;  1NJ5 A;  1NYQ A;  3HRK A;  1KOG A;  3UXK A;  1FFV C;  2DZC A;  4YRN A;  1JCT A;  2WOV A;  3CYJ A;  4P71 A;  4H4Q A;  3S5S A;  4K7Z A;  2DTO A;  2E41 A;  4RQF A;  1N63 C;  3OZM A;  1JJC A;  2BC0 A;  2E65 A;  2TPR A;  2DU5 A;  4H2S A;  1STZ A;  4P73 A;  1B70 A;  1X54 A;  1XDI A;  2PCE A;  3MEY A;  3KLJ A;  3UH0 A;  1BBU A;  5G5G B;  2V3B A;  2PP3 A;  2DQ0 A;  5FJO A;  3DJG X;  2Q7G A;  3MF2 A;  4XEO A;  2PTW A;  3RCY A;  2EAY A;  2RHS B;  1B8A A;  4XU0 A;  4ZIB A;  1SJB A;  3N6H A;  2Q5I A;  3QNE A;  1KCZ A;  4OP0 A;  2ZIN A;  2R9Z A;  2Q7H A;  1W66 A;  3HFZ B;  3I7F A;  5C52 B;  1GER A;  2ZT8 A;  3NVY B;  3LSQ A;  1H4T A;  4YWS A;  4H2W A;  2ARS A;  1SER A;  2FYK A;  3FXG A;  1B7Y B;  2WOW A;  1PYS A;  2QHV A;  4UP7 A;  3DER A;  1EBG A;  3GY1 A;  4LVM A;  3ES8 A;  2WP5 A;  3SJN A;  1WYG A;  1WQW A;  5JCM A;  4XTW A;  4ADW A;  2PP1 A;  3DIP A;  2HNE A;  3JW7 A;  2X99 A;  5G5H B;  1ADJ A;  2XSX A;  4H02 A;  3S47 A;  1MDL A;  3DG3 A;  1PDY A;  3A31 A;  3P0W A;  4G7F A;  2CIM A;  3BJU A;  3DSQ A;  1BQG A;  3E9H A;  3EKG A;  5GRT A;  3PCO B;  5JRB A;  4K1W A;  2YAU A;  2ZZ0 A;  3DGZ A;  1AOG A;  1WUF A;  3FCP A;  2G4C A;  3VQY A;  4E51 A;  1X01 A;  2W55 A;  1WUE A;  4YRM A;  2QAE A;  4OLF A;  3TTE A;  3QTC A;  2IY5 B;  4GR1 A;  5FS8 A;  3V5F A;  3L2Z A;  4GIS A;  4EQR A;  3STP A;  2V3A A;  3CGC A;  4EWJ A;  3LXD A;  4J1O A;  4YDQ A;  1FFU C;  1SB3 B;  4BUR A;  1FEA A;  1USY C;  2DXT A;  1LYL A;  3VCN A;  4HN8 A;  1VDV A;  1BZL A;  3N4E A;  2ZT6 A;  4LVI A;  2FKP A;  2OQH A;  1EC7 A;  2OQY A;  6ENL A;  1KKR A;  2ODR C;  3VBB A;  3OZY A;  2POD A;  2ZZG A;  3NET A;  2ODR D;  3R1Z A;  4K8G A;  3E9I A;  4JHM A;  3THU A;  4TQF A;  2ZZF A;  1EFW A;  3PK7 A;  1NDA A;  4A3R A;  2QHS A;  1JPD X;  3NZG A;  3SQP A;  1NEL A;  4EMJ A;  1ONF A;  2ARU A;  1YFS A;  2WOI A;  3CK5 A;  3A7A A;  4YRG A;  2XH2 A;  5U25 A;  4GGH A;  3DFH A;  1BIA A;  2P5I A;  3A7R A;  2CFY A;  3HFV A;  4DNA A;  4EQX A;  2AKW B;  5ENL A;  3EAN A;  3PG6 A;  2PTX A;  4P72 C;  3H12 A;  2RHQ B;  5KVI A;  1YGB A;  3OD1 A;  1P43 A;  1PDZ A;  4KT2 A;  4DHG A;  1EC8 A;  5ELO A;  3A74 A;  4YRK A;  4E8G A;  3ZVH A;  1XS2 A;  1KN0 A;  2GQW A;  2DEQ A;  2ZTG A;  3DEQ A;  1MRA A;  3R0U A;  4FI4 A;  2C8M A;  4H4U A;  3BSM A;  4EQW A;  2P0L A;  4YRR A;  4EMI A;  4HWR A;  5JCL A;  4A6G A;  1E9I A;  1E22 A;  1FHU A;  4DXK A;  2C7I A;  4YRI A;  2OO6 A;  2X8G A;  4XU3 A;  1GRB A;  2ZNI A;  2RAB A;  5ER0 A;  1BIB A;  1NJ2 A;  4XTY A;  3UXL A;  3KUM A;  5F5W A;  3IJI A;  2I4O A;  4HCD A;  4HCL A;  2P88 A;  2GR1 A;  2ZIO A;  1L8P A;  4TWA A;  4CH4 A;  4NEV A;  4H2U A;  4K86 A;  3CXB A;  4GIR A;  2E64 A;  1RM6 B;  5FS9 A;  4EM3 A;  3OTR A;  3TEH A;  1GRE A;  4H2H A;  5FS7 A;  2QVH A;  3UJ2 A;  3HPF A;  3RKW A;  4CH5 A;  4LII A;  4HPN A;  3IKM B;  3HRD C;  4EQS A;  3DJJ A;  1WU7 A;  4YRC A;  4H4X A;  4M6U A;  4H4T A;  4FDC B;  4TTV A;  3ZLF A;  2Q7E A;  1JJC B;  1F8W A;  3CXO A;  3MQT A;  2MNR A;  4H2V A;  5TR3 A;  2W0H A;  4K2S A;  3SSZ A;  1M6I A;  3KFU A;  3FVD A;  1ELS A;  1B70 B;  2EQ9 A;  3N6J A;  4ZCW A;  4YPF A;  2O56 A;  3T9P A;  3P8Y A;  4P3P A;  2ZAD A;  3VQX A;  1EBH A;  2W3S A;  1JRO A;  1ZKQ A;  2GGE A;  3CGE A;  2QJM A;  2EJ9 A;  4ZOH B;  4XTV A;  1V59 A;  3A32 A;  3HXZ A;  4KWS A;  1NJ6 A;  4P3O A;  4WI1 A;  3TJI A;  4TQD A;  3MWC A;  1EOV A;  3LB8 A;  2DDZ A;  5K1X A;  4HNL A;  2QGY A;  3ICA A;  4G84 A;  3CAW A;  2JK6 A;  3IJQ A;  2P8C A;  2PGW A;  3NEM A;  1GRT A;  3H4K A;  4LA1 A;  3TWA A;  2RDX A;  1X56 A;  2P3Z A;  1P48 A;  4O2D A;  1H4Q A;  2DXU A;  1PYS B;  1GRG A;  3O0H A;  4GFI A;  1OJT A;  3V4B A;  2NS6 A;  3A5Z A;  3HY0 A;  1IL2 A;  1TYP A;  2PTY A;  3CT2 A;  3D47 A;  3MY9 A;  3UJE A;  4GYP C;  2Q5H A;  1L0W A;  3R07 A;  3CGB A;  1YEY A;  5FJT A;  4CH3 A;  1ZX9 A;  4EX5 A;  1YFR A;  2EQ8 A;  3NO1 A;  5JCN A;  1GSN A;  2ZZB A;  4MKS A;  1R0M A;  3H70 A;  3RGL A;  4YRF A;  2ZGW A;  2PA6 A;  4XU2 A;  1DTN A;  3RF1 A;  3ES7 A;  4H2X A;  2E3T A;  3MUC A;  4P75 C;  4AH6 A;  3VQW A;  3R0K A;  1N61 C;  3DGH A;  3UJS A;  4XTZ A;  3EFS A;  1JRP A;  4YRQ A;  5E3I A;  3W3S A;  2PU1 A;  3PZC A;  3QKE A;  3RAC A;  4RMF A;  1Z7N A;  4P74 A;  4ENL A;  2ZCE A;  2CGH A;  2QDD A;  4E4U A;  3UGT A;  3CMQ A;  3SQS A;  2MUC A;  1F3P A;  1R6W A;  2ONE A;  2XH0 A;  3HXW A;  4FP1 A;  4H50 A;  1X2H A;  2CHR A;  3I4K A;  4YCV A;  1N5X A;  4K8D A;  4G85 A;  2GGI A;  3L4G A;  2GR2 A;  2QQ6 A;  1LPF A;  3QPE A;  2I4N A;  2QHU A;  4J56 A;  2PGE A;  2P0I A;  2WPF A;  4Z17 A;  2CDU A;  2DQ3 A;  1FEB A;  2I4L A;  1NYR A;  2EJF A;  1N9W A;  3IAL A;  1FO4 A;  3DGB A;  3L8K A;  4BW9 A;  2ZZE A;  3Q4D A;  3R11 A;  1FEC A;  2DW6 A;  4JN7 A;  1XPY A;  2GGH A;  4HCH A;  5BOF A;  2ZT5 A;  3LC0 A;  2P8B A;  3VA8 A;  4H4W A;  1NPX A;  4HYR A;  1B76 A;  1Z7M A;  2GSH A;  3ZVH B;  1G5I A;  3SR6 B;  4H4Y A;  1H4S A;  3II4 A;  4UP9 A;  2DZ9 A;  4XTX A;  1N60 C;  1NHR A;  3DG6 A;  3SN1 A;  2GR0 A;  2OKT A;  1N62 C;  2ALY A;  4PHC A;  4YRP A;  3ZVI A;  2DJZ A;  1EC9 A;  1TYT A;  2PPG A;  2OZ3 A;  4LNS A;  3CGD A;  4M0X A;  2ZXF A;  3IJL A;  3V8L A;  5EU9 A;  4DPG A;  1NHS A;  3V3W A;  4H4P A;  3N4F A;  2PSN A;  3M4Q A;  4P71 C;  2ZC8 A;  3NRZ B;  2OVL A;  1GV4 A;  3FJP A;  1X2G A;  1G5H A;  2J3L A;  4LVL A;  2YVG A;  4XTU A;  2GGG A;  2EQ7 A;  4Z1Y A;  1N5W C;  4JN8 A;  3QO7 A;  1EIY A;  2QHT A;  3D46 A;  2E10 A;  3TUP A;  3FJ4 A;  3TEH B;  4P73 C;  1GEU A;  4IZG A;  1SJA A;  4HNC A;  3EUB 3;  4IP4 A;  5FS6 A;  2I4M A;  3I6T A;  2HXT A;  3GC2 A;  3HXX A;  3CB3 A;  4YRO A;  2YVF A;  3I6E A;  5JCI A;  4EMW A;  2W54 A;  4ROP A;  3NFU A;  3HY1 A;  3ENL A;  2V6O A;  4H4Z A;  3FYY A;  3RO6 A;  4ZTZ B;  4UP8 A;  3V8J A;  3GD4 A;  1KMM A;  1JEH A;  4KR3 A;  2ZR3 A;  4WF2 A;  4ZA0 A;  2YVJ A;  2J3M A;  4DYE A;  4DX3 A;  1GRA A;  4KR2 A;  2E5A A;  3VFC A;  5IDZ A;  3TCS A;  2EL9 A;  1C0A A;  4YRS A;  4IHC A;  2A8E A;  1FYF A;  4HVC A;  5KNN A;  1EVL A;  2GGJ A;  3QN3 A;  1GRF A;  4CS4 A;  1Q1W A;  1RVK A;  3Q45 A;  3NVZ B;  3UFG A;  1NJ8 A;  3RR1 A;  2NQL A;  2CJB A;  2XGT A;  3K1G A;  4XEM A;  1EQR A;  3WQZ A;  4MMW A;  3GO2 A;  4M52 A;  5FJR A;  1OEP A;  1NHP A;  3QTP A;  3ZLH A;  3B97 A;  4TVW A;  2AMC A;  2QJN A;  2AKZ A;  3HW2 A;  4YCW A;  4WJ3 M;  3QFA A;  2ART A;  1V97 A;  3BOX A;  4H19 A;  2DU7 A;  2HNI A;  3MF1 A;  1KKO A;  1ZMD A;  3GD3 A;  4HWS A;  3AMZ A;  3FG2 P;  4LVJ A;  3BJS A;  2NPX A;  1NU5 A;  3P8T A;  1ZY8 A;  4H2X B;  3QFB A;  5K1P A;  1E24 A;  1WLE A;  3HXY A;  1KMN A;  3G1Z A;  2BC1 A;  1TE6 A;  3EEZ A;  3DH9 A;  3R10 A;  1IYX A; 
#chains in the Genus database with same CATH homology
 3REX A;  3TEG A;  3NEN A;  1USY A;  4TVA A;  4TVY A;  4YCU A;  2EJG A;  4YRL A;  3L4G B;  1ASZ A;  4Q15 A;  4H2Y A;  3UGQ A;  3HXV A;  1GGM A;  3L1A A;  3A7U A;  4HA8 A;  4RDX A;  3V7S A;  2DKG A;  2EWN A;  1ATI A;  4P72 A;  3RIR A;  2ZT7 A;  3NEL A;  3ETR B;  1RIQ A;  1WQ7 A;  1G51 A;  1SRY A;  3QO5 A;  1E1T A;  5C53 B;  2ZR2 A;  4J15 A;  3P8V A;  2E3C A;  2ALY B;  12AS A;  1ADY A;  2E1H A;  3HXU A;  1QF6 A;  3MQZ A;  3M4P A;  4YYE A;  2PMF A;  4UPA A;  1EVK A;  1ASY A;  1ZXI C;  1BBW A;  4HT4 A;  1T3Q C;  3VQV A;  1NNH A;  1EIY B;  3AN1 A;  3A5Y A;  11AS A;  4X5O A;  4CS2 A;  5HGQ A;  4PG3 A;  2RHS A;  4BWA A;  5C51 B;  4L87 A;  1HTT A;  4K88 A;  4YRT A;  4RQE A;  3V7C A;  1VQZ A;  1HXD A;  1YFT A;  2ZNJ A;  3HFZ A;  4LVK A;  3EFR A;  3IG2 A;  4YRE A;  1B7Y A;  4H2T A;  4DQ2 A;  4Q6G A;  2DVE A;  3V7R A;  1SES A;  3REU A;  2ZIM A;  1NJ1 A;  4NCX A;  3R07 C;  5ELN A;  1HC7 A;  2CJ9 A;  4HWO A;  3PCO A;  4CH6 A;  1FIQ B;  1WPY A;  1QE0 A;  3BFM A;  2AMC B;  2IY5 A;  3LSS A;  2PME A;  1SET A;  2W3R A;  2DTI A;  4P74 C;  3AM9 A;  1J5W A;  3HTZ A;  3RL6 A;  2CJA A;  3HRI A;  1X55 A;  4P75 A;  1H4V B;  1E1O A;  2ZNI A;  4HWT A;  3IKL A;  4P3N A;  4TVA B;  3NVV B;  1WNL A;  2AKW A;  4KQE A;  2DTH A;  4CS3 A;  2RHQ A;  3ERR A;  3RKX A;  3RKY A;  2XTI A;  4YRJ A;  3B9J B;  4ZTU B;  3QO8 A;  3V8K A;  4XU1 A;  4HWP A;  3NS1 B;  4YP0 A;  4K87 A;  1YB3 A;  3RUX A;  1WYD A;  4EO4 A;  4WJ4 A;  3NVW B;  1NJ5 A;  1NYQ A;  3HRK A;  1KOG A;  2DZC A;  1FFV C;  4YRN A;  4P71 A;  2DTO A;  2E41 A;  4RQF A;  1N63 C;  1JJC A;  2E65 A;  2DU5 A;  4H2S A;  4P73 A;  1B70 A;  1X54 A;  3MEY A;  3UH0 A;  5G5G B;  2DQ0 A;  4XEO A;  2Q7G A;  3MF2 A;  2RHS B;  2EAY A;  4XU0 A;  1B8A A;  4ZIB A;  2Q5I A;  3QNE A;  4OP0 A;  2ZIN A;  2Q7H A;  1W66 A;  3HFZ B;  3I7F A;  5C52 B;  2ZT8 A;  3NVY B;  3LSQ A;  1H4T A;  4H2W A;  2ARS A;  1SER A;  2FYK A;  1B7Y B;  1PYS A;  2QHV A;  4UP7 A;  4LVM A;  1WYG A;  1WQW A;  4XTW A;  1ADJ A;  5G5H B;  4H02 A;  3A31 A;  3BJU A;  2CIM A;  3E9H A;  3DSQ A;  3PCO B;  2G4C A;  3VQY A;  4E51 A;  1X01 A;  2W55 A;  4YRM A;  4OLF A;  3QTC A;  2IY5 B;  3L2Z A;  4YDQ A;  1FFU C;  1SB3 B;  1USY C;  2DXT A;  1LYL A;  1VDV A;  4LVI A;  2ZT6 A;  2ODR C;  3VBB A;  2ZZG A;  3NET A;  2ODR D;  3E9I A;  4TQF A;  2ZZF A;  1EFW A;  2QHS A;  2ARU A;  4YRG A;  1YFS A;  3A7A A;  1BIA A;  2P5I A;  3A7R A;  3HFV A;  2AKW B;  4P72 C;  2RHQ B;  1YGB A;  3OD1 A;  5ELO A;  3A74 A;  4YRK A;  2DEQ A;  2ZTG A;  2C8M A;  2P0L A;  4YRR A;  4HWR A;  4YRI A;  1E22 A;  2C7I A;  4XU3 A;  1BIB A;  1NJ2 A;  4XTY A;  5F5W A;  2I4O A;  2ZIO A;  4TWA A;  4CH4 A;  4H2U A;  4K86 A;  2E64 A;  1RM6 B;  3TEH A;  3RKW A;  4CH5 A;  3IKM B;  3HRD C;  1WU7 A;  4YRC A;  4TTV A;  2Q7E A;  1JJC B;  4H2V A;  3KFU A;  1B70 B;  4YPF A;  3P8Y A;  4P3P A;  3VQX A;  1JRO A;  2W3S A;  2EJ9 A;  4XTV A;  4ZOH B;  3A32 A;  3HXZ A;  1NJ6 A;  4P3O A;  4WI1 A;  5K1X A;  4TQD A;  1EOV A;  2DDZ A;  3ICA A;  4G84 A;  3NEM A;  1X56 A;  4O2D A;  1H4Q A;  2DXU A;  1PYS B;  2NS6 A;  3A5Z A;  3HY0 A;  1IL2 A;  2Q5H A;  1L0W A;  3R07 A;  4CH3 A;  4EX5 A;  1YFR A;  3RGL A;  4YRF A;  2ZGW A;  4XU2 A;  3RF1 A;  4H2X A;  2E3T A;  4P75 C;  4AH6 A;  3VQW A;  1N61 C;  4XTZ A;  5E3I A;  3EFS A;  1JRP A;  4YRQ A;  3PZC A;  3RAC A;  4RMF A;  1Z7N A;  4P74 A;  2ZCE A;  2CGH A;  3UGT A;  3CMQ A;  3HXW A;  1X2H A;  4YCV A;  1N5X A;  4G85 A;  3L4G A;  2I4N A;  2QHU A;  2DQ3 A;  2I4L A;  1NYR A;  2EJF A;  1N9W A;  3IAL A;  1FO4 A;  4BW9 A;  2ZZE A;  2ZT5 A;  3LC0 A;  1B76 A;  1Z7M A;  1G5I A;  3SR6 B;  1H4S A;  4UP9 A;  2DZ9 A;  4XTX A;  1N60 C;  4PHC A;  4YRP A;  1N62 C;  2ALY A;  2DJZ A;  4LNS A;  2ZXF A;  3V8L A;  4DPG A;  4P71 C;  3M4Q A;  3NRZ B;  3FJP A;  1X2G A;  1G5H A;  2J3L A;  4LVL A;  4XTU A;  1N5W C;  1EIY A;  3QO7 A;  2QHT A;  2E10 A;  3TUP A;  3TEH B;  4P73 C;  3EUB 3;  2I4M A;  3HXX A;  4YRO A;  2W54 A;  3HY1 A;  4ZTZ B;  4UP8 A;  3V8J A;  1KMM A;  4KR3 A;  2ZR3 A;  4WF2 A;  2J3M A;  4KR2 A;  2E5A A;  2EL9 A;  1C0A A;  4YRS A;  2A8E A;  1FYF A;  4HVC A;  5KNN A;  1EVL A;  4CS4 A;  3NVZ B;  3UFG A;  1NJ8 A;  2CJB A;  2XGT A;  4XEM A;  1EQR A;  3WQZ A;  4TVW A;  2AMC A;  4YCW A;  4WJ3 M;  2ART A;  1V97 A;  2DU7 A;  2HNI A;  3MF1 A;  4HWS A;  3AMZ A;  4LVJ A;  3P8T A;  4H2X B;  5K1P A;  3HXY A;  1E24 A;  1WLE A;  1KMN A;  3G1Z A;  3W3S A;  1BBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...