2E5JA

Solution structure of rna binding domain in methenyltetrahydrofolate synthetase domain containing
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
97
structure length
97
Chain Sequence
b'GSSGSSGPGSPPGEGAPLAADVYVGNLPRDARVSDLKRALRELGSVPLRLTWQGPRRRAFLHYPDSAAAQQAVSCLQGLRLGTDTLRVALARQQRDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Methenyltetrahydrofolate synthetase domain containing
publication title Solution structure of RNA binding domain in Methenyltetrahydrofolate synthetase domain containing
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 13
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2e5jA01
1N88A 2MQNA 3CULA 5EN1A 2BZ2A 2MKSA 2DNYA 2CQ3A 2XSFA 1JMTA 4C0OC 1ZH5A 2EVZA 3K0JA 2KVIA 3N9UC 4LMZA 4WF9Q 3FEYB 1JJ2R 1KOHA 3MUTP 5HO4A 1SJQA 3VALA 3ZZYA 1VQ6S 2MB0B 3NNHA 1U6BA 2MXYA 3I55S 1FJCA 2J0QD 3H2UB 1VQ9S 2KRRA 2DIVA 2GO9A 3D2WA 1WEZA 4QU7A 2DB1A 1Q7YT 2JWNA 3EGZA 2LXUA 3HI9A 1WF0A 1X4BA 2MKKA 3G8SA 2XNQA 1U2FA 2B0GA 5DDQC 1H2UX 2RS8A 3VAMA 5BJRA 5HL7Q 2X1FA 1VC6A 2UP1A 2N82B 1VQ7S 4UY8T 2DNNA 1WG4A 2RS2A 2YTCA 3PIOQ 2YH0A 2DGQA 1X5TA 2ZJQQ 2M9KA 1X5OA 2CQ2A 2EK6A 3P3DA 1URNA 2DO4A 1WI8A 2MQQA 3UCUP 1X0FA 2SXLA 1YTYA 3MD1A 2MKCA 3DXBA 2AYMA 1YHQS 2ADCA 1X4AA 5GAGU 3BS9A 1OWXA 2DGOA 2JVOA 5LJ5Y 2ERRA 4PRFA 3VAHA 4UQTA 3R1HA 2MYFA 2LXIA 1X5SA 1K9MT 2CQ1A 5IM0B 3TYTA 4CH1A 4ZKAA 1R8HA 3BO4A 2E44A 1YJ9S 2OIHA 2I38A 3UD4P 1N54B 5DM6Q 4YUDA 3CXCR 1G2EA 4WKRA 2U1AA 2RQ4A 3S7RA 1A7GE 3Q2SC 2KM8C 3CCQS 3CC7S 3UE2A 3UCGA 2DNLA 1FJEB 2KG0A 2CQCA 3NNAA 3BO2A 5CA5A 5CXTA 1VBZA 1M5PC 2OTLS 1S72S 4LJMA 1KOOA 2CPDA 2EK1A 2KXHA 1FO1A 2FC9A 2M0GB 3JB9k 3MOJB 4W90B 2MSTA 5GAEU 3BEGB 1FHTA 3FEXB 3CCES 3CCSS 2KH9A 2DGSA 5IM0A 5MLCV 1FXLA 1SJ4P 2V94A 1KD1T 2X1BA 1F9FA 3VAJA 1U1PA 2ZJPQ 3J7ZT 4C4WA 2HGLA 1WWHA 2MZRA 4RU2A 4ERDA 2KRBA 1D9AA 2MPUA 4C7QA 2N3OA 1W2BR 2CPHA 2MZQA 2CQDA 3G4SS 2FC8A 1H6KX 1SJFA 2DNQA 3CC2S 3U1MA 1KQSR 1JJHA 3TO8A 1Q86T 3VAIA 1OIAA 2DNKA 3DLLQ 4CIOA 2M8DB 2D9OA 2E5JA 3S6EA 1VQ5S 2OSRA 3Q2TC 2LQ5A 2I2YA 2MQPA 4IO9Q 1M5KC 1UFWA 5LXRA 1WG5A 4TU9A 1FNXH 4BS2A 1CVJA 5FJ4A 3I56S 2QA4S 2FPHX 2MJNA 3UD3P 2VODA 3CMAS 4WCEQ 1NU4A 2J76E 4IUFA 2RNEA 1VQ4S 1X5PA 2KU7A 1DZ5A 1WTBA 5DDOC 2CPJA 4YOEA 2ADBA 4Y00A 1L3KA 2MZJA 2J8AA 2OSQA 5GVQA 2AYBA 2XB2D 2HVZA 2RT3A 2CQBA 2LA6A 2CQIA 3G71S 2DISA 4EGLA 2MZTA 1ZZFA 3US5A 2MZSA 4FXVA 5GMKa 4TU8A 3HHNB 1YIJS 2N7CA 2DGTA 1PO6A 2MY8A 3H2VE 2M88A 1KC8T 1R8PA 2HGMA 1SJ3P 1VQOS 4OZ0A 1H2TZ 2CPXA 4LIRA 1XN9A 4FXWA 4QQBA 5GAHU 1VQNS 1WG1A 2LEAA 2CQHA 1UP1A 2E5HA 2NLWA 3P6YC 3S01A 5CYJA 3RW6A 1X4DA 1IQTA 4F26A 2LCWA 2L41A 2XS7A 2DH8A 1QVFR 1K73T 2MKHA 3R27A 3EGNA 4P6QA 1K8AT 1VQKS 1WHYA 1WHWA 5LSOA 2JRSA 1HD1A 2CQ4A 3IRWP 2A3JA 1VBXA 2MKJA 1WF1A 2RU3A 2L9WA 2M7SA 3B4MA 5ITHA 1DHMA 4ED5A 1UW4A 2HZCA 3CCVS 5IFMA 3CCUS 2DIUA 2G4BA 1X4CA 3CCLS 3LQVA 1P1TA 4CQ1A 4Z2XA 2D3OR 2QFJA 3MUMP 2LECA 2LKZA 1WEYA 2G1DA 2N3LA 1NO8A 5D78A 3NNCA 2K3KA 1VQPS 4PKDB 2VONA 1U1OA 2M52A 3LPYA 1OO0B 1X4EA 1BY9A 3VAGA 5IQQA 2XNRA 2MQMA 5LJ3Y 2DGUA 5GADU 3IWNC 2AYGA 2PEHA 3G9CA 1O0PA 3P5TL 4W92B 4J5OA 2CPZA 1OPIA 1U1NA 3MXHP 3R1LA 3G8TA 1UAWA 3VF0B 4WFAQ 5JVGQ 3UCZP 1VC0A 3CPWR 4V19X 2VOOA 1DRZA 2XS5A 3CMES 2J0SD 1HD0A 1JJ4A 2LA4A 1N52B 2BOPA 2JVRA 2KFYA 3G6ES 2DHAA 1H2VZ 3CD6S 1U6FA 2DHSA 2PE8A 2CQPA 1U1MA 2M4MA 3RW7A 3EX7B 2DGWA 3V4MA 2FY1A 3SMZA 2DHGA 3MURP 2OJ3A 2VOPA 2F3JA 1X4FA 2DNPA 1D8ZA 4IOAQ 4IOCQ 3G96A 2DH9A 2RVJA 4TLQA 1WELA 2DNZA 4QPTA 3NS5A 3OW2R 1X4HA 2MJUA 1DBDA 4WIIA 1WF2A 2D9PA 4TU7A 1YJWS 3TP2A 1A9NB 4A8XA 2DITA 2G0CA 2L08A 2RUGA 2M2BA 2CPEA 2JX2A 2E5IA 2LEBA 1Q81T 4QU6A 4F25A 1FT8A 2DGXA 2YWKA 1N8RT 2E5GA 1VQ8S 2KT5A 2AYEA 2DH7A 2DO0A 1U1KA 2KI2A 1M90T 1M5VC 1ZZNA 1X4GA 1VQMS 2OTJS 1WHXA 2GHPA 2NZ4A 3CUNA 2KXFA 3NS6A 2MY7A 3ULHA 1HL6A 2CQ0A 1Q82T 5D77A 3MI7X 2WBRA 2MQLA 2MMYA 4U67Q 3BO3A 1RKJA 4OZ1A 1YJNS 2DNMA 2M70A 3U1LA 2CPFA 2XS2A 4F02A 1YWXA 3MD3A 3L3CA 1P27B 3VAFA 1U1RA 1FJ7A 4PR6A 4Y0FA 2QEXS 2LMIA 2MZ1A 2KM8B 5DM7Q 1S79A 1VBYA 2FHOB 1WHVA 3CTRA 3CCRS 2MQOA 1U1LA 1WEXA 1PGZA 2X1GA 2LYVA 2MSSA 3UWTA 3SXLA 2DNOA 1WI6A 2DNGA 2Q79A 1AUDA 4WFBQ 3CCMS 2CQGA 1QVGR 5H1SV 4WFNQ 2RQCA 1SJRA 3P49B 3MDFA 2X1AA 3THPA 2DK2A 2DNHA 1U1QA 2MGZB 3NMRA 1SXLA 2DNRA 1HA1A 5LXYA 1YI2S 2F9JA 2CPIA 2KN4A 3SDEB 2DGVA 2K8GA 3MUVP 1RK8A 2RRBA 2MKIA 3ZZZA 2M8HA 2CPYA 2RRAA 3PIPQ 3CF5Q 5LSLA 3CC4S 1VC5A 3J7YU 2KYXA 2AD9A 2F9DA 1M1KT 1B7FA 1NJIT 3THTA 3CCJS 2KHCA 2O3DA 2U2FA 2KG1A 2KXNB 2CJKA 2HGNA 1M5OC 2YKAA 1QM9A 2MGZA 5DDPC 3S8SA 5DETA 5DDRC 5JVHQ 4CH0S 2MHNA 1YITS 2HYIB 3B4DA 2DHXA 3SDEA 2ZJRQ 4YB1P 1VQLS 4M5DB 2YH1A 3VAKA
chains in the Genus database with same CATH superfamily
2YBVA 3WHIA 5IWAF 3D54A 4M5HA 4GC7A 2H5JB 2IYIA 3KG0A 4KH0B 3LP1B 3TVYA 1VQ9S 4DUYF 1RACB 1FFGB 2FZKB 2NUHA 1FNOA 2IAJA 4YMEA 2J6SA 1VQ7S 2UUAF 1FRXA 5HP1B 1IXKA 4DR3F 2QLWA 3GIRA 2Y8WA 3DGPA 5B0BA 3JSRA 4LVOP 4XDDA 3IRXA 3O1LA 4ZJOA 3UCUP 1RTHA 4IG0A 3CDEA 2RF2B 1HNIA 2NSBA 3KXDA 4OV1A 2BE2A 2E29A 4CTAA 2RKIB 3K89A 3AA8A 2C2MB 4B9LA 1WC0A 1A6LA 3LP2A 3KLFA 3KDNA 1RBLA 2YX7A 2HVEA 3QGGA 4QIVA 4CYUA 4DQPA 1Q79A 3SV4A 1S72S 2DBBA 1WSVA 1KOOA 1XBWA 4ECQA 1RHKB 5CD4H 3SSQA 1KD1T 2ZJPQ 3J7ZT 3OL6A 2CRLA 4C7QA 2FTRA 2CPHA 4FYWB 4C8YA 4UF4A 5KFRA 3HVTB 1SC4B 2K7JA 3JS9A 3TO8A 1Q86T 2BDPA 2D9OA 3MMCB 4JI0F 4X64J 2HQ3A 2QMXA 3U27A 3R6GB 1F3FA 4GKJF 4M5MA 1GH8A 3FKBA 1VQ4S 2YQ1A 1WOPA 5KG6A 3K59A 2OPPA 1LFWA 1NBEB 1TKXA 3VR1A 2J8AA 4ES2A 1R0AB 1ZYQA 5I3UB 2GQQA 3DM2B 1CJTB 5D4PA 4JI4F 1W2IA 1TELA 1REVA 2W9CA 1R8PA 2A1BA 3UI3A 1KP6A 3U7JA 4QQBA 3WZ0A 1WG1A 2CQHA 2DCUB 1RWOB 4ELVA 3S01A 4OYMA 4NLYA 3ZZ0A 4U96A 4YHHF 3DRSB 5J2MA 3AQPA 3B78A 1T03A 3HFVA 1RTIB 1UETA 1FD8A 2J0XA 2A3JA 3UD5A 4CM2A 2QSWA 5KT2A 3CDAA 1S1UB 4LRDA 3CCUS 2C2ZB 3ETOA 4USJC 1ZPVA 4CQ1A 4Z2XA 3S1TA 2ZBCA 1NO8A 4P52A 3ZTOA 1SJ1A 4BDPA 1Y3JA 4BBYA 4C98A 4YDDB 2HQDA 1JXLA 2XNRA 1IR0A 2F8MA 4K5RA 2AYGA 2R7SA 3ADAC 5K8MA 1S6PB 3G8TA 4CO5A 5K8PA 4LF7F 1XQIA 3LAMA 3W2VB 1FK9B 1FRIA 1HPZA 3IFEA 5B0EA 2ZVSA 1X4FA 5KTQA 4E98A 3LH2S 4TNOA 1JK9B 3TANA 3M32A 4R25A 5EWGA 3DCAA 3J81Y 1N8RT 3GIIA 4LFAJ 1ZZNA 1B99A 2DEJA 2DYAA 3OSNA 2CQ0A 3FBEA 4CLUA 1RKJA 5CAAA 3J7YI 1PCAA 3J81j 2XS2A 4QW8A 2UXCJ 3L3CA 3HZEA 2ILZA 1P27B 2HKEA 2MZ1A 1IBLJ 2KM8B 3V6JA 3TZZA 3PCOB 1AUDA 4FF2A 3LOUA 4WFBQ 3CCMS 5IC6B 2DD8S 2D1CA 4O44B 1L3TA 2VF3A 2LDIA 5DJBA 3GFXA 1S97A 3PV8A 3TAMB 5C2CA 3NGSA 3DMJA 1HWLA 1N34F 2YPZA 2EWHA 1KVKA 1DTQB 1R8BA 3F41A 1L3UA 2FVPA 3PFEA 1T02A 5A8RA 1J5EJ 4J90A 5EWFA 1QUPA 1FTRA 1YDLA 4OV6A 2FGOA 3SDEA 1EETA 1N4LA 3NL0A 1XERA 2XSFA 1JMTA 4NLDA 4MT1A 5HVGA 4RL1A 3KK2B 1VR6A 3FEYB 3CO0P 5I3QA 1S9FA 5KFHA 3AXKA 1YLXA 4FNIA 2MLXA 2XEXA 1N5VA 3T5KA 4DPWA 2M5YA 2VASA 2XMKA 4U7UD 2MKKA 1RYRA 1RSCA 2OAUA 3OR2B 1VQSA 5DDQC 4ID8A 5HL7Q 2UP1A 5HJXA 3PO4A 3EZ5A 1O51A 2DGQA 3C16A 1LW2B 2HNDB 4PG7A 3M8WA 2GJ2A 2YQ0A 3DLGA 3M8ZA 5ETPA 1R8CA 2M3DA 4PWDA 5FD1A 4DR4F 4X4TA 3I5BA 2FVSA 4RNOA 1YRUA 3EVOA 1S4EA 3TNVA 4ED8A 2GJFA 3GE9A 5CQGA 4OX7A 1DLOA 3BO4A 1SC1B 2VKZG 4EFAC 3CXCR 2ZDPA 1UVMA 3GP9A 2YQ3A 4P72A 3IM8A 3MR5A 2G1HA 3ENQA 2YNHA 2ZH7A 3NNAA 1IR2A 4QBUA 1HHQA 2FLNA 4MKYA 4PUOB 4ED2A 2QX0A 4AFFA 5SUHA 1Q8BA 2Z4PA 3CE8A 3AY0A 2GCFA 5E2QA 4I6YA 3JTPA 1F60B 1EKRA 3FSYA 1OYDA 5J2QB 2YNIB 4M5KA 2OKQA 1G6BA 4DSEA 1NPKA 1ZAVA 1U2CA 2GGPA 2AQ4A 1FNXH 2H5EA 5C24B 4B3SJ 5FJ4A 2RQKA 2MJNA 3NCRA 4H4KC 4PG5A 1ZAXA 3OFFA 2IC3B 2KU7A 2LQBA 4QIWD 2V50A 2RT3A 4D3HA 4DCPB 4PG6A 3US5A 4FXVA 4A48A 2F4VJ 1T95A 5F8LA 1LOUA 1RWKB 1CJKA 2J5AA 3HVAA 4RWWA 5HVFA 2GAGC 2KFNA 4O0NA 1N5YB 4AXJA 2LEAA 2ZDOA 4JP8A 1NKCA 3MWBA 1FTCA 1MG7A 2EBEA 1Y10A 4EU0A 3I96A 2ZVIA 1WHWA 3NEKA 1FA0A 2YKMA 2R7VA 2B3TB 4HDGA 2VG5B 2XCPA 1FESA 3D6MB 1NJXA 4RX6A 2RDIA 2AW0A 3EPIA 1PC4A 5L8RC 1U09A 1BC6A 1S1TA 4JI5J 2XMVA 2B4PA 2YNGA 2HQFA 1FJGJ 4HDHA 1N56A 3LALA 2MTLA 2ABYA 3Q8SB 2GMJA 3GMGA 3V5RA 2RMLA 3J80Y 3K17A 3MAAA 4O4GB 3N5FA 2IDEA 1VIOA 1N33J 4J9KA 1OS5A 3SMZA 3MM5B 5EX0A 2DNZA 4NYZA 4GVBB 1TMJA 1X4HA 4OFZA 2BJDA 5BXIA 4OI4A 1FWLA 2V2VA 2VD3A 2CPEA 4QU6A 4I2QA 3SBMA 4H4KA 3HX9A 3L7PA 5HSPA 3QRQA 2DH7A 4IO1A 3C8YA 1M90T 1A0OB 2NXEA 1QE1B 5KOWA 2QT7A 1JKHA 3VTIA 5KT7A 4CT9A 4NOHA 2HRTA 2RE1A 3MD3A 3J7A1 3BQ0A 5E3QA 1QAXA 4IFYB 1FKAF 1S7HA 2NS1B 1YZ6A 4DR7J 3SIPB 3CMQA 4ZITA 2F1FA 2RSQA 2DY9A 3IG1A 4AL5A 4OZLA 4DSKA 2X1AA 3R5JB 3CJTA 2VFRA 4A46A 5LXYA 1T11A 2RU9A 4WK3A 4A8QA 3DOMB 2NXUA 4TY8B 3FC9A 2GNKA 3EJMA 5AT1B 1HQEA 3ZTSA 2KXNB 2CJKA 4RZRA 2YKAA 4LF4J 3MCMA 2QMUB 3L7UA 3KJVB 1BUXA 4DXLA 3ZC4A 4ZA1A 4DV5F 1NRKA 1TVRA 4NZ6A 3O5TB 3K0JA 3P45B 4QZVB 3N9UC 3FCVA 3MUTP 2FJBB 4M63A 3BDEA 3ET6A 3VALA 3UNGC 5I3PA 1KQGB 2V68A 4OYZA 4CDIA 3BDPA 2JEIA 1WNEA 2BRKA 2JWNA 2AP6A 3NWRA 1VJQA 3W1YC 2JLGA 3VAMA 4UY8T 2DNNA 3BYPA 4FYXB 1XEZA 5F8JA 3EICA 1EAYC 1KVJA 2EEYA 4LR7A 4EK2A 4F0MA 2P6TA 1GXLA 3MR3A 1YRTA 3W60A 3T9NA 3OHAA 4DN9A 2XWYA 2R7TA 2YWWA 4HHHA 5HP1A 4CH1A 4ZVTB 1YJ9S 2EC2A 2MKYA 1ICEB 4TQSA 4WKRA 3AJ2A 3EZOA 4ZP6A 1FJEB 2PI4A 1RI7A 1D09B 2RF2A 4DFMA 2CJ9A 4RUCA 2EK1A 4ZPTR 1YJ7A 2RKIA 4ZPVR 5GAEU 1RWXB 4O3QA 4RLEA 2HHHJ 2QLJB 1LWFA 4DFPA 1FEEA 3GCXP 4OX9J 2CJAA 1IKVB 1I94J 1BMQB 4K4SA 2OFGX 1FWPA 2O01C 1V5VA 4V1Ak 4KHPJ 4OQJA 1HMVB 2ZWPA 4F04B 1KBRA 1LWXA 2M8DB 1ZPWX 3JQKA 3S6EA 4HT7A 4QYRA 2BKOA 3KUHA 3I56S 2AT1B 1CJUB 4LSLB 3H90A 4OZJA 3WIVA 4KR0B 1DZ5A 1NK9A 4B9SA 4YY3F 1NHVA 2XB2D 2W1BA 4RWXA 3D1HA 5DLFA 2UUBJ 4IOBA 3LO3A 1QAYA 2OUGA 2PI5A 3PEJA 1K1SA 3VZHA 5G0RA 4LIRA 3OJUA 2E9ZA 3SCKE 3C6TB 5GAHU 3IO1A 8AT1B 1MWQA 1IQTA 4P6QA 3DM2A 1WHYA 3IAS9 2JRSA 1TL7B 3M7VA 3R2DJ 2MKJA 4QCLA 1UL3A 2W2OP 3W9JA 2B9XA 1ZA1B 2WBMA 4PXEA 4K2JA 4JV0A 2CWKA 5D78A 4NXMJ 4FDFA 2F8HA 4MFBB 3B6BA 3DRSA 1BY9A 4JI7J 3GG1A 2FDNA 4ED6A 1KEKA 1JXEA 4J5OA 5T7LB 4I1TA 2LFVA 4C9DA 2JZ5A 4Z7CA 1TZ0A 3IAM9 2W2MP 1IJEB 4NEYA 1VIXA 2WK4A 5GAHI 3G6ES 3CD6S 3QRRA 2V8VA 1NUEA 3LP0B 4LF8J 1OQ6A 3R5GA 3KHRA 3R9LA 3DHWC 1IKWB 5HJYA 4LF5J 1LXNA 4JYAJ 2UVVA 3QMQA 3LF0A 3DU6A 3TJ9A 3W2VA 1FK9A 4M5DA 1NSKL 4P74A 5BR8F 1HFEL 5IV4A 2EFPA 5DG9A 3D1OA 2AV5A 1PAEX 4NZ0A 4OYPA 5F9NA 2HSEB 4KHMA 3N6MA 3W5XA 2QLBB 4O3RA 5RUBA 2JDJA 4KQZA 4WIQA 1RA6A 4URGA 4LRFA 5H1SV 1RBOB 1T8EA 2ZH4A 2IA0A 3I82A 4O3PA 4LQ3A 2Z58B 4QW9A 2IVYA 2W9BB 1IKYB 3HJFA 2IHR1 3AAWB 1VK3A 2W7AA 3M9MB 1O5JA 4ID5B 4MIBA 2RRBA 1IUJA 4RW9A 5I42B 2E66A 3R8YA 1XNRF 1XNQJ 4I6WA 2V0NA 2LQ8A 3QSIA 4AD6A 4LFCJ 4CLWA 2E1CA 4O44A 5HAOA 4HLBA 5EDWA 5DG7A 1SB6A 4B3RF 3TAMA 1UEVA 3MGJA 1AUSL 4AQYF 1ZH5A 2P9GA 3IN5A 4WFZA 1REGX 4CNZA 1R8AA 4I64A 2AHOB 2MXYA 2W4DA 1TKTA 2W4CA 4LFBJ 3MR2A 4PZVA 2BV3A 3RRHA 1UTAA 3NY0A 2WVEA 4DF4A 3QIDA 3ONQA 1Y00A 2I6WA 3A4TA 1CS4A 3DRRB 3KK2A 4J9UE 1B70B 1RWVB 4TYBA 3PIOQ 3R7BB 2HFOA 4QJVA 3P3DA 1RGVA 2J9CA 1YTYA 5D3GB 4IDKB 1WC4A 5ETQA 1P8GA 5LJ5Y 2VU5A 1QJHA 3QSYB 3CCTA 3A8JA 3UD4P 1P9YA 4DCJB 1H72C 3X1LB 3MAHA 3RU0A 2GVZA 4DR5J 4ZDNA 5KFTA 2J9DE 4DL2A 4DWIA 1LWEB 5D0RA 3AOCA 2IIHA 2WSFC 3H4BA 2RDDA 2VIHA 1WWHA 3UDLA 4FYDA 2KRBA 3KMSA 3QT7A 3PJ9A 4E8UA 4NLUA 3C15A 4ZHRA 4PQUB 4L6V3 3W9IA 1F2HA 5HN0A 4KTQA 4PUOA 3SCLE 3A3NB 3ENVA 4JI3J 2OD4A 3IA0A 3CMAS 4J9QA 4WTYA 2ZOGA 3C6UB 4N77A 1Y5NB 5J2QA 4Y00A 1RAGB 2YNIA 1VMBA 2JL9A 2AYBA 2OHDA 4L74A 2O5DA 1PC5A 3KFWX 3OT9A 4YB6A 4WXWA 2UXBF 5C24A 4B17A 3CDBA 3Q0AA 1KN6A 4CCHA 4JI1J 1UP1A 4OZ3A 3RW6A 3MM9A 4F26A 1Y5IB 3QGIA 5K14A 3JTOA 3ZZTA 1GFWB 3FFIB 4C0HA 2FVRA 2R7RA 4W4MA 2BQUA 4BC9A 4ZP8A 1JXVA 1HNVA 4M5NA 2QFIA 4F7VA 3GIKA 3SSSA 1N5YA 4N76A 5B09A 1NH7A 2IM0A 2PIIA 4F8RA 3NNCA 2K3KA 5E3PA 3H8YA 2VONA 1RWUA 4LF2A 2MQMA 3SQGA 3M8RA 5HQLA 1RTDB 3DRXA 4CO1A 5E7OB 1RDRA 2QLFB 5C7PA 3U1NA 3KG4A 1PJ6A 3PYGA 1HD0A 4ZCLA 2BOPA 1WORA 5DQGA 4KSEB 2PO4A 3DRYA 3I5AA 2MEWA 2FY1A 3I0RB 2OJ3A 1HNZJ 3Q83A 2Z2YB 4JV1A 1SUQA 1VRQC 3FCHA 1RTZA 3G96A 4K0KJ 2DH9A 4QPTA 2QGFB 1B7YB 1S1XA 4ZN1A 4JI6J 3KK1B 2G0CA 2L08A 2RUGA 4ILLA 3P8BB 4CLTA 1ZA2B 2WAQD 4OZ5A 4RBUA 2KI2A 3WIUA 4DPUA 4DL3A 4NRTA 2IPOB 1UJ5A 3EMTA 5KG5A 3K8VA 2D74B 3NS6A 3MM5A 4R8UA 2WBRA 2CJBA 2PD1A 4GVBA 4P7VA 2M70A 1YJNS 4DDFA 1NSAA 5F9LA 4HR2A 1FI4A 2JNJA 4NEZA 2FJWA 4PR6A 3KWMA 1S79A 2CUYA 3CCRS 3M6UA 4DUZJ 8ATCB 2LYVA 3BN7A 3UWTA 1YBAA 2W8LA 2DNGA 1X9MA 3LA0A 4DV7J 4ZVRB 1NB7A 2GV1A 2IVFB 4G1QB 2ZM6J 2DGVA 4IFYA 1CEZA 2MKIA 1SL2A 2HMIB 2R7XA 1VBKA 1LWCB 2DXFA 3MM8B 1EARA 1R3NA 1TTHB 1Q5VA 1NK5A 2U2FA 1N5SA 2C3MA 3S8SA 4FBTA 1TR0A 4PYAA 2HYIB 1NCLA 1RT6A 1MWYA 4RKUC 3VAKA 3CO9A 4DOZA 1UKUA 4ETZA 4TY8A 1JLBA 1IBKF 5J2PB 3LPEA 4QYZK 4GVLA 4BLGA 3VVUA 1C1BB 4K59A 1U6BA 1CQMA 2R7QA 2GO9A 1MU2B 2QJ3A 3I4HX 2GAHC 4R0JA 3AXMA 1GQEA 1WF0A 2NYIA 3KJNB 4M5LA 1KVIA 4UOFA 1H2UX 3JSBA 3OQ2A 1DARA 1T3OA 3JYTB 1X8DA 1X5TA 4H4MA 1CULB 3DLHA 3MMBB 4UUWA 3BF4A 5HQMA 3D3CJ 2WB4A 5GAGU 2AZ1A 3JSMB 1U0HB 3BSNA 3BJYA 1LW0A 2G0JA 3VQTA 1WC3A 1Q8KA 3RBDA 4IR1A 5DM6Q 4F50A 3MHYA 4QOTA 3OXGA 3GCWP 3OR1B 1Y0HA 4DL5A 3FQLA 3G86A 5ETNA 2HK3A 3HHLC 3DXSX 5F8HA 4DV4J 4KV8B 1D9FA 4LF9J 4LRBA 2OEJA 1NZAA 3MR6A 1S59A 2FZCB 4WFXA 4FN5A 3ZNJ1 1UWBB 5GAGI 2QYGA 4OJHA 4EBCA 4NI2A 2ZUGA 3DI6B 5A0YB 2W4PA 5HBMA 2VG6B 1CVJA 3T41A 1Q7LB 3DFEA 2VODA 1QDUB 1IKVA 1WC5A 3GV7B 1R0CB 4RU9A 2OPQB 1S1VB 3F73A 4ZPWR 1HMVA 4K4TA 2FQQB 1H7WA 2B4UA 2MZTA 3OXLA 3W5ZA 1RAOA 3R97A 3LWMA 2L9DA 2K1RB 2V4JB 4LSLA 4OHWA 3PYDA 4N56A 1TL1B 4QR1A 4ZS6A 2L41A 3DLKB 2VBYA 4DLGA 5KOXA 1QAJA 2R2SA 3TVKA 1PYOB 1RAJA 2L3MA 2OPSB 3UO0A 2CQ4A 3CJ3A 1WF1A 4U8YA 1X7VA 2HHXA 1DQAA 3ELHA 4DUTA 2CNNB 3C6TA 2VHGA 4EZ6A 3DOKA 3E2EA 4CLSA 4ZMMA 1RT3A 1AROP 1FKPA 4GKKJ 1U1OA 2VBZA 5IQQA 4DL6A 5IV3A 3BGFA 5C25A 5KG3A 1JJCB 3HHLA 1SI9A 2IM3A 2E5LJ 3QLHB 3KTQA 3UCZP 2YKQA 4X64F 1S0OA 2DHAA 2XMMA 2CQPA 2DGWA 4V19J 1WOOA 5IXUA 4Q0BA 3FQKA 2GO8A 1YJRA 5T7LA 4QWDA 2BRLA 3D28A 2YPYA 4ECRA 3V6KA 2ASYA 4UOGA 2J9EA 2LEBA 1B3TA 2DGXA 2D41A 2I1RA 5LMUJ 4ZLLA 2VV5A 3T6BA 3LP0A 1O8BA 3GG0A 3EGWB 1WHXA 3HXMA 3D0IE 4RNMA 3EXYA 2MY7A 3N5BA 2FJEB 3MI7X 1HWIA 4OZ1A 4HACA 1IKWA 3GIJA 1RJJA 3P96A 3D67A 1VRUB 3OL8A 1C4AA 1NDPA 2QEXS 3PG9A 3KG1A 4RW8A 1PG5B 3R2CJ 3UVJB 4C2MA 4ZCIA 1RWWB 1KQKA 1HNWJ 2ZFHA 4U7CA 4XDCA 1F6TA 3OD2A 1RU2A 4CZCA 4QIGA 5HLFB 4LSNB 3IXQA 3ZNUA 4CLLA 4ZVHA 2HBRB 2F9DA 1FDBA 2LP4A 5D4LA 2PEBA 9RUBA 2KG1A 3HHKA 1QM9A 4NXNJ 3K5OA 3ZXWA 4CH0S 3W3SA 2YKOA 2V67A 4NLPA 2J0SD 4B08A 4XO0A 2BJEA 1OY6A 4GMKA 3VGSA 1C4CA 2DNYA 2P6SA 4URSA 2XY6A 2XMWA 3PX4A 3OTBA 2VJUA 3TJAA 3QYYA 2G0IA 1U49A 2D3ZA 2CVIA 3EDRB 2XSJB 3GYGA 2XNQA 2H4WB 5FIIA 1IBLF 4LBHA 1R31A 2H1YA 5EX3A 2HVIA 2P8IA 4DR3J 2BM1A 4Q45A 1X0FA 3MD1A 1J2VA 4C11A 5H9EJ 2ADCA 3NMAA 4CO4A 5DS7A 3M1VB 3DRRA 1RTJA 1L3SA 2LXIA 1GK8A 1K9MT 4QIEA 3T9ZA 3TYTA 2VQEJ 2I38A 1F1BB 3PJXA 4G65A 5D3GA 3UE2A 4IDKA 2W2QP 2QIFA 3V6DB 1ACMB 2R3VA 2FC9A 1J5EF 4IFVA 4W90B 2V6AA 4WTOB 4K4VA 2K2PA 4ZVPB 2QTWA 4B9NA 5HMXA 2C3YA 1HBUB 3GJRB 2A6OA 3KLEB 1U25A 1W2BR 5LM7E 3ENWA 4WE1B 5E33A 3IP0A 4B9TA 4KFBA 4JBCA 4B3MJ 1DFDA 1OIAA 2C2NA 5D6GA 5A76A 2ZBQA 2H3EB 4Q8EA 2JLEA 1S1WA 7FD1A 1C0UA 3MEEB 3MM7B 1PSDA 2AMCB 1NU4A 4NASA 2J76E 4F4KA 1N36F 5EGYA 2IA6A 4OI0A 2HHTA 1Z2LA 4PQUA 3IWLA 3BBBA 2FVCA 3UDEA 5LL6d 1ZZFA 3UW1A 4X65J 3V81B 3TUIC 1RLDA 2DGTA 4L76A 2M88A 4USVA 2W01A 2XY5A 1NK8A 5CABA 2RILA 2ZH6A 1K1QA 3G82B 3C6UA 4X4UA 1Y3KA 2D69A 5L38A 3UR3C 5EWEA 4OYWA 5FDLA 2E9TA 1PJ7A 5LSOA 2Z57B 1VBXA 5G4DA 5ITHA 4OYOA 1IR1A 4NLTA 5KFAA 3H4DA 4CLYA 3MCOA 2YKNA 2HNYB 2OI2A 3NGTA 2W2NP 2BKPA 5LJ3Y 3PKYA 1O0PA 4NLGA 3R1LA 1UAWA 3VF0B 2FY8A 2VOOA 2F5GA 3RRGA 2KYZA 1FKOB 1JJ4A 3G8QA 2HEKA 1LEOA 3QQCD 3BPSP 3ZZPA 4JV5J 1VYAA 1HI1A 1WC1A 2AEMA 2DHGA 1RTDA 1MMNA 3BSOA 2XO6A 1FX4A 3KDOA 3H42A 2N7YA 1HR0J 3KNGA 4J9MA 1VHIA 5D8HB 2F4VF 1CC8A 2DITA 1TMMA 4F25A 2VPWB 1Z1ZA 2IVMA 5THWA 2HBYB 3EVMA 2GHPA 3I0RA 4HI1A 2QMWA 4DX6A 1Q82T 1NDLA 5LT5A 5J1NA 1GMVA 2NYHA 3KK1A 3BGLA 1H73A 2LMIA 4X66J 5ETVA 1NAQA 2E7VA 5HI7A 1NM2A 2MQOA 1WEXA 2MSSA 4FVMA 4QIFA 3W7BA 3NWGA 1WDTA 1RBAA 3MDFA 2HHSA 2XGQA 2HVHA 3AH6A 4X4OA 3NMRA 2N4CA 1SXLA 3OHBA 4JI5F 3PHTA 5A2QU 4RNFA 3MUVP 1FJGF 2IDLA 3GV8B 4JB8B 3FK4A 3FBBA 2KHCA 2JJ4D 1N33F 1M5HA 4G1QA 1GTHA 4RW7B 1CG2A 2LDYA 1I1GA 5E0OA 1N88A 4B3TJ 5B08A 2AF6A 4LRAA 2V9WA 4DL0C 1LWCA 3MM8A 3QJPA 4B9VA 4K4WA 3R7NB 2MB0B 3KLHB 2DKOB 4I7FB 1UZHA 4C3LA 1D3WA 2VPYB 4OYBA 1T3NA 2D3O1 3G8SA 4ILMA 1U2FA 2ZD1B 5ETTA 5F8IA 1NK7A 1SV5B 2V4QA 4ECVA 1SL0A 1FDDA 2YNFB 1WDDA 1KLMB 1WG4A 4F4AA 4ETXA 2I5JB 1C1BA 4DR7F 4RNNA 2JH3A 2MQQA 4UZCA 1SQEA 4USMA 1O6XA 4IRCA 2O1PA 3W2WB 4FPRA 2ERRA 4J9SA 3OVSA 4F0HA 2CQ1A 3LAKA 5BYQA 3JYTA 2HLTA 5KFVA 2ZBRA 1CULA 3O3LA 2WVFA 3MMBA 2Y1IA 4OHYA 1H0HB 2KG0A 4MMOA 1SC3B 1GEHA 3JSMA 2OTLS 1U0HA 3H7HB 1HWJA 4LF4F 5J2NB 4X62J 2KH9A 1OY9A 2V94A 2GZOA 4OMFG 2HGLA 3AD9C 5IS2A 1XC9A 1UMJA 4DFKA 1XR5A 3SQOP 3G4SS 4MKVA 3CC2S 3OR1A 3HJVA 5HROA 3AD8C 2N4DA 3OFEA 4RW4B 3Q8YA 1FEHA 2WONB 3CDWA 3DLLQ 1RP5A 2GC8A 2E5JA 3E01B 3Q2TC 2LQ5A 4MYTA 2GJIA 4KV8A 4ZIVA 5GMDA 1C1CB 1TL3B 1Q53A 2QA4S 5LSRA 3UD3P 3MM6B 3M6WA 2B8QA 4C8LA 4DG1B 3LTOA 3PVXA 5KT6A 1UWBA 2E7WA 4UZBA 2ZHOA 2ZC3A 3KJQB 4TU8A 3R5AA 4DV3J 5A0YA 2FUG9 2VG6A 1KC8T 1EX8A 2WOMA 4OZ0A 1JLAB 3G87A 3G6VA 4ANDA 4HHUA 3L09A 1XN9A 2XMTA 4NLWA 4KT0C 1NMEB 2B9WA 3C66A 2A10A 1UPPA 2UVUA 3HP6A 3QT8A 1RAFB 2L9WA 2M7SA 2K1RA 3M2VA 3F44A 1RZMA 4ANCA 4OI2A 1X4CA 2HHHF 1P1TA 5CH7B 2UUCF 1WEYA 4DCOB 1I94F 3MZIA 1RT5A 1YBTA 4U9RA 2V9KA 3BH7B 3D6HB 1APSA 4H4OB 2XHWA 2DGUA 3IWNC 3Q23A 1DTTA 4KHPF 1Q78A 3RZAA 1S5ZA 2LQJA 4YEAA 1TFWA 4DEZA 4WFAQ 5H9FK 2XTJP 1AB8A 1S4FA 1OYEA 3V6HA 2AJ0A 4PXDA 3LW5C 5DO2A 3ILJA 3HDSA 1QTNB 1W26A 1D8ZA 2ZITA 1N0VC 2CA9A 4G6VB 3TP2A 2UUBF 2IJRA 1TUVA 4Y2KA 2VG7A 1FNMA 3LGMA 2DO0A 2EG2A 1Q1KA 2NZ4A 1QSLA 1T9VA 3OUYA 5D77A 2MQLA 3BO3A 1RT2B 3O8WA 1PBAA 2HRUA 2KKHA 3M2RB 1B0VA 1U1LA 1PGZA 3GJTB 5IT0A 3QGHA 3ICLA 4C8MA 5CCMA 3QJJA 3L95X 3D6TB 1VRUA 3RAXA 2Y0SD 2ZZTA 4JI7F 1FRHA 1RT7B 3UVJA 3CJSA 2IM2A 3W8GA 3MR7A 4X4PA 5KFYA 1UVLA 4C8OA 2XCAA 5M2RA 3A13A 7FDRA 4MK9A 1U24A 2P9CA 1EP4A 3Q89A 5DDPC 2IRUA 5AE3A 1YITS 2AEJA 4LF8F 3RR8A 1N32J 3CCWA 3NOCA 3OW2R 1H74A 5L1KA 4LF5F 3PJWA 4WWSA 4JYAF 4J9OA 5HO4A 3FNNA 3HD1A 4F4WA 3LUYA 5F8MA 1W25A 5HMYA 4R5PB 5KT3A 2EKYA 4KE5A 4OX8A 2J0QD 2KRRA 2DIVA 3P4UB 2EFGA 3UDCA 3J7Z5 2X3GA 4Y2IA 3IBCB 3T1YJ 3W61A 4OJ3A 2HNZA 3QAEA 4OJ1A 3QWUA 3TA2A 3MTJA 4OJGA 4I56A 3MPUB 4U6PA 4CWBA 4OLPA 2EK6A 4MKBA 2EFVA 4J9PA 1RB0A 4ECYA 2XULA 3D7SB 2BMBA 4DF8A 2VA3A 1PJ5A 1DJ0A 3HK2A 3R1HA 2QV6A 1YGYA 3OSPA 2E1RA 5IM0B 2W8KA 1PIEA 1SPBP 3M8QA 1XNQF 2C2EA 2HPUA 4DX7A 4Y34A 5D15A 2RJZA 3PW2A 3NCPA 3C3LA 3BEGB 5A6PA 1SJ4P 3BSAA 1RLCL 3NXZA 1U4BA 2XZTB 4ELTA 1JLGB 4I2PB 1U47A 2MDAA 3N79A 4RBVA 5C5JA 1XMQJ 4GRSA 1R7IA 4MJKA 1KQSR 4DU7A 3H5UA 4Q5VA 2CDQA 3OTOJ 2LVWA 3VAIA 1S12A 4LFBF 5KFEA 2XWXA 1HQUB 4CH7A 2PGCA 2ROEA 2CWXA 3NG8A 1UEKA 3I6PA 1HBUA 1KFDA 3C14A 1ZTTA 2COLA 3KLEA 1RTHB 2RNEA 1ZBTA 4WE1A 2FLLA 2XZWA 2BE2B 3I0SB 5KFWA 1TK5A 2NCKL 1T9XA 3FMBA 1E6YA 5JJBA 5KFJA 1HBNA 2XYHB 5DG8A 2Q1LA 3GYNA 2HGMA 2QA2A 1SJ3P 1BE4A 2CPXA 5EHHA 3DRPA 4P7TA 5KT4A 3N4WA 3HVWA 4OZNA 2E5HA 2ZE2A 3QIPA 2XS7A 3RYLA 3H98A 1TL5A 3BGUA 3QT5A 2YWHA 4LIWA 6AT1B 1PILA 3IRWP 3B4MA 1DHMA 2ALYB 3VZIA 1WD6A 4DQRA 3G82A 1NZ8A 3DDNA 1SKWA 2ROPA 4FBUA 2M52A 5HK4A 3SYZA 1HBOA 1UWAA 4MK7A 3NCQA 2PEHA 5AE1A 2V8GA 4PABA 1F5CA 2OPPB 2RRNA 1TKXB 4CLZA 2DJWA 2ZKUA 4JI3F 2M4MA 3V4MA 1REVB 2GHVC 5B0CA 3M8SA 3MCSA 3CJKA 2BEFA 1CJVA 4B3OB 1NDKA 1BWVA 4K2XA 3I31A 4C8NA 5J2MB 2E5GA 4P75A 2KT5A 3CJQA 4DV0J 1U1KA 4IRDA 4C6AA 4UT4A 2Q3PA 4JI1F 3PO5A 4U67Q 4YR0A 5BR8J 1Q8LA 4PCQA 4F02A 2F4FA 2BANB 2J8SA 1U1RA 4Y0FA 1Z2ZA 4K8RA 3T19A 2DNOA 5B7WA 2VJVA 2Q79A 1VLOA 4DLEA 1BQMA 1QVGR 4WFNQ 2ZOFA 4RBTA 2DNHA 2WB1D 4J9RA 3FBCA 4X4VA 2CDRB 1WACA 2CPIA 4AUKA 1RABB 1S77D 2K8GA 4CP5A 5LSLA 2GMHA 4H54A 4CO3A 1X0PA 3ZZRA 3M8PB 2AD9A 1XNRJ 1VRTB 3CCJS 4P9SA 1U48A 2YY3A 5JVHQ 1VISA 2KT2A 2QL5B 1S9EB 1HNZF 4WBFA 4KO0A 4K0KF 1JLEB 2HHPA 4YB1P 1VGYA 3CULA 3NOGA 4B3RJ 4LMZA 4JI6F 1SH3A 2PA3A 1ULRA 4JI2F 2H5IB 1H98A 1SIWB 3OL7A 4WYLA 1NKBA 4KYZA 3N6NA 3OLBA 4RW7A 2MLYA 2QA1A 4F4XA 3ENAA 4WKYA 3CJ5A 3RBEA 3MMJA 2W25A 1QUVA 2POKA 2OMLA 3HULA 3RRKA 4ZPAA 1AXQA 2X1FA 5A8KA 4FP9A 4L72B 1FDNA 4RW6B 3I9V9 1RWPB 5KG1A 1DY3A 4DUZF 3MFHA 3EM1A 3KLHA 3FEZA 4O3OA 2ZNZA 2IJNA 1RYSA 4DV7F 1SV5A 2JVOA 2ZM6F 5KFCA 1QD1A 3VAHA 4UQTA 2V4RA 5DZ6A 3BKTA 3CGIA 1Q0NA 1U0SA 1X5SA 2OD6A 2YNFA 3FRZA 4HTJA 1KLMA 3KNAA 2VUGA 3BPDA 4YUDA 1QTMA 1TUGB 1FRJA 1EETB 4KPCA 4S0MA 4C0BA 4EI2A 3CC7S 2FJDB 4ZP9A 3W2WA 4B9MA 1ZM3A 3PDNA 4AYBD 4Y2CA 2G2OA 2BJ3A 3GFYA 3VAJA 1S48A 1SKRA 2DXDA 3ISZA 4NLQA 2G13A 1SJFA 4YB7A 1IWAA 3L4BC 2OGUA 3BQ2A 1XMOJ 4DS4A 3BGRB 5J2NA 2BR0A 3C16B 3D1QA 1WG5A 2CZVC 2QA4G 3DLGB 3E51A 2HFZA 1VK8A 2EC0A 2JHEA 2F7VA 1RXOB 1TL4A 4DPOA 4B9UA 4RW4A 1K47A 1SQGA 2OSQA 3GZ7A 4U7UK 1TKDA 2WONA 3E01A 4YQWA 1KDNA 2UVRA 3D5MA 4ZJLA 2MY8A 3TJ8A 1FFWB 3Q8VA 3MM6A 3QPIA 1NB2A 2YNHB 1GT8A 2H9ZA 4FXWA 4WP9A 4DG1A 5EUHA 3T6JA 2L48A 1ZTWA 1ZM4A 1F0XA 3GONA 2OELA 5D4OA 1RT4B 2QL7B 4USWA 3FGVA 1RAIB 4ZN3A 5HVHA 4NCAA 1HD1A 3SFUA 3QFHA 4EBEA 5IC4B 3OV7A 2RU3A 2ZKTA 3H2LA 4DV4F 3Q86A 2D3OR 2LKZA 2R9LA 2P2CB 2CZ9A 1HI8A 4C8KA 4MKAA 2GGPB 2EI5A 1OO0B 3W65A 1WSRA 1RA7A 2BQRA 3AA9A 3FBFA 1X9SA 5KT5A 3HFZB 3NKYA 1T9YA 1V5IB 4K4UA 5C2GA 4TVAB 1KONA 2DHHA 3SCJE 1VC0A 2HAIA 2JVRA 5F0UA 5D0GA 1JLQA 3RW7A 4N8NA 4J9VA 1GTEA 1Y9OA 4UUXA 1MSWD 2XYPB 1WF2A 2D9PA 1Q8IA 5IT9U 2PMHA 4ICLA 3QJLA 5K8OA 2M2BA 3TQEA 2E5IA 3DOLB 3CIMA 3IR6B 1VQ8S 4KHRA 1BD6A 3MEDB 3TARA 1EHWA 3T3FA 4FF1A 2IY5B 3QRPA 2YKMB 2RIJA 1S76D 4RUBA 3KMQA 2MMYA 3K2YA 2XC9A 2DNMA 3BBFA 4JV2A 3MMAB 1MMDA 1YWXA 1BLUA 4ES1A 3LP1A 3MPWA 1FJ7A 4DV2J 3GFZA 4NLOA 5ETSA 2QE5A 4A8KA 2ZH5A 4QR0A 4OI6A 6FDRA 2BYCA 3GJSB 3WBZA 2HLUA 4UW2A 1U7LA 3TEHB 2DK2A 4MIWA 3M2UB 4UY85 2DNRA 4YP3A 2F9JA 3M2RA 2H51B 2E5LF 2CPYA 4TXSA 3PIPQ 2HK2A 4AT1B 4RJVA 5BYRA 2YXLA 1HBMB 4YS2A 4G1IA 3Q8UA 3NGDA 4TN2A 3GFHA 1X9WA 2KL8A 2EG1A 2C3UA 5IZHA 5DGAA 4ENOA 2DR7A 4I2QB 5DETA 4Y6IA 2MHNA 4ZVFA 2DHXA 3TAQA 5SZTA 4DJBA 2ZJRQ 3EZUA 3GLJA 2V69A 4J37A 4DQSA 2MKSA 4N8OA 2CQ3A 5LMNJ 4WF9Q 3GV5B 1KOHA 1S0VA 3F56A 2R42A 2UV8A 1JNZB 3I87A 1YX2A 1UVIA 2J7WA 1WEZA 1RHMB 2DB1A 4N5SA 1RHQB 2ZEJA 4M94A 3R7SB 2BJ1A 3NBPB 2ZOMA 3HT0A 3HVTA 2PMZD 2CKWA 5BJRA 3IG1B 2N82B 2B51A 1G4CA 4DX8H 3BYRA 1XR6A 2GIFA 4P73A 4USTA 2CNKB 3MMCA 4R5PA 5GAEI 2C3PA 2VBXA 1X5OA 2KJWA 5L1IA 3UN5A 4RUHA 2XLIA 1Q16B 1WI8A 2JOQA 4MK8A 2I8EA 3BS9A 4DR6J 1HNWF 2RQMA 1N0UA 3KKFA 4ZVUB 5A2QY 5IQ6A 1R0AA 5I3UA 3DNCA 1CJTA 3NRBA 4ZKAA 4DSLA 2KHDA 2OIHA 4BWMA 4NPOA 3B54A 3VQSA 2RQ4A 3ZTQA 1X31C 4WP3A 2Q6CA 2KM8C 2BBEA 2ZWOA 3V2UC 1TVRB 3TUZC 3A3OB 1YK9A 3L7OA 4NXNF 3ET6B 2MSTA 3MPVA 4U95A 3CCES 4FS2A 3CCSS 2DGSA 1KHVA 5IM0A 5MLCV 2Q43A 4JOUA 4M5JA 1RTIA 3QO9B 2FJVA 2F63A 2Z2LA 2FC8A 3W63A 1S1UA 4FF3A 3U1MA 2FJAB 4QWAA 1XMBA 2VFVA 4P2XA 3QZ8A 2MQPA 2GX8A 1M5KC 3DDKA 3NAIA 1JLGA 2CYYA 4I2PA 4UOHA 2K3IA 1S6PA 2HG4A 4XTTA 3KLGB 2UU9J 2ZNYA 1JNRB 1KHWA 2X7IA 2MZSA 1HQUA 2N7CA 4AL7A 4A8OA 4O23A 3PYFA 1VFJA 1D9DA 4DV1J 4DV6J 1SC6A 2VQEF 1SQFA 2WVCA 3NGRA 3DU5A 5ETOA 3I0SA 1K73T 1LWFB 3OPKA 1K8AT 1RAHB 1VQKS 1FE4A 4MAKA 4AL6A 3UN3A 2VFTA 2ZH8A 1LK5A 3JXOA 2NXJA 4ED5A 2QL9B 1UW4A 2QYCA 1EQ0A 3OFGA 2W9AA 1BXNA 3CCLS 1SCJB 3IGNA 2EBGA 2R4FA 5B0FA 2CFXA 1HNXJ 3HF5A 3K8WA 1U26A 2V2KA 2RDJA 4KGXB 4B3MF 1JQGA 4JI8J 4ZPCA 1K44A 2Y9HA 2JFKA 4LUBA 1B4SA 2MQ8A 3BH6B 2R7OA 1FWKA 4C48A 2PE8A 4K5SA 2IRYA 3TZWA 1ITPA 3VCDA 5G0RB 3EPGA 1DTQA 5B0AA 3NS5A 1IBMJ 1FDAA 3UFCX 2BX6A 4C3MA 2ASJA 4X65F 4DR1J 1NXIA 2R2RA 5ADZA 1S6OA 1Q81T 1JLFB 3W8PA 1J27A 1FT8A 4MTPA 4WU2A 4F67A 3PHEA 1S0NA 1Q4RA 1UA0A 3VHQA 4CT8A 4B3OA 4NLVA 4BHQA 1AFIA 2J6UA 4PAAA 9ATCB 3SI8A 2HWTA 3D66A 4PWUA 2UV8G 3OTDA 5DM7Q 5E41A 2DR6A 2FGCA 1JLCB 2B4OA 4ZVEA 5C42B 5KG7A 2B5JB 3POTB 3OR2A 1T0TV 5KFSA 2IYGA 3FVYA 1EIYB 3RAQA 3THPA 3RGIA 2WVDA 3CSKA 1YZ7A 1LW2A 2HNDA 2BANA 2VQFJ 2A2CA 3TR5A 2M8HA 5AXLA 1G3OA 2LXFA 1LFPA 4DZDA 4FS1A 3CNQP 1IM6A 3K5LA 3J7YU 1M1KT 4DQQA 1NJIT 1HWUA 4JV5F 3PRVA 3P5BP 4ER8A 3H5SA 4PYDA 2CJQA 3MTKA 4DL7A 2A2DA 3HSDA 2ILYA 2UXDJ 1F9EB 4M5DB 2ZH1A 2MQNA 1HR0F 3TA0A 2D7SA 3M8PA 1I51B 1VRTA 5GMEA 3H25A 3W66A 3H2UB 1S9EA 1W7WA 3G2XA 3HI9A 4ZVSB 3PY8A 1JLEA 5KFMA 2B0GA 3EXCX 4LR8A 2K06A 3PM9A 1MWZA 3DLEB 4X66F 4OI3A 2DXEA 2ZJQQ 4FVCA 3PZPA 4IH6A 4LF6J 1H3DA 4USIA 1URNA 1YJUA 4RW9B 3DXBA 3FZ2A 2IC3A 1X4AA 2DGOA 4ECTA 4ED4A 4BWJA 4RW6A 4XAKA 2YKPA 1HKAA 4ZVGA 2EXUA 4NCGB 4HH0A 2XG8A 3Q2SC 3S7RA 1RCXB 3UCGA 4IH5A 6FD1A 1CSJA 4LJMA 5AJ3J 2XZDB 3HT3A 1AFJA 1T94A 4ZLPA 2NQPA 1TKTB 3AOBA 4B3TF 1YBUA 3PYEA 2P9EA 5KFDA 2ZH9A 2KVQE 1LV5A 5HMWA 4CM0A 2HS0A 1DAXA 2RHQB 2VG5A 1CS4B 5L1LA 1UEUA 3D0HE 3VGUA 2HHWA 3BN4A 4CIOA 1IKXB 4AE5A 2I2YA 3NP5A 1UFWA 2G9OA 1HHTP 3FZBA 1R27B 1I3OB 1WUUA 2ZBIA 3M9OB 3KHGA 5DDOC 2CPJA 3R5DA 2WRMA 4O4GA 1N36J 2J7KA 3TX0A 4X4SA 2ASDA 3BGRA 3G71S 4KJIA 4QPXA 1YIJS 2VDHA 3K57A 2HFNA 2YWEA 2KZMA 1Y11A 1P6TA 1LXJA 2DTJA 2VZ9A 4CNYA 2GVZB 2LCWA 3VGVA 3UDVA 2B56A 2J7UA 4RUAA 3K5NA 5A8WB 1QE1A 4XPEA 1PYSB 2HZCA 1FRLA 2AGPA 4X62F 3C15B 4ZHRB 2GW8A 3A8IA 2A0FB 4N47A 4JUZA 1B64A 1VCTA 1Z4UA 4WPAA 1RT4A 4WK1A 3AHPA 2G2YA 1HARA 3G9CA 4Y65A 4NLSA 4X4RA 3RTVA 3HM9A 3A8EA 5CZXA 4DQIA 4DR2J 1YRXA 1T05B 1CQNA 5JVGQ 3BKFA 3PFOA 2AX1A 4EYIB 3B8HA 3AB2B 1KTQA 1DURA 1U1MA 3DOMA 1AW0A 1OMSA 2RHSB 2JC1A 5F8GA 2Q66A 1JIHA 4ECSA 2I0XA 2OO4A 3EWGA 2XGPA 2APOA 2FD2A 3PW7A 1A9NB 4DV3F 2QO3A 4OZ2A 3MM9B 3NGUA 2JX2A 5K14B 7AT1B 3H5YA 2XY7A 2R8GA 3KJVA 3OXFA 1VQMS 3H0PA 2C2OB 1HL6A 3T5HA 1YG0A 3UQSA 1HNVB 2CPFA 1H7XA 2IFXA 4NL5A 1ZS6A 2CAJA 5CYMB 2RAQA 3DOLA 1JB0C 5L46A 3FDSA 3SQGB 3MEDA 1XIQA 1YJVA 4EWTA 4ANEA 3O44A 2HFUA 3AJ1A 1ELOA 2WTFA 2HBZB 3CEDA 3MMAA 2IBOA 2HW3A 5DRKA 3D9BA 5CCLA 1KR4A 3WX4A 1SUQB 4LQ9A 1U02A 2KT3A 3KOAA 3IS9B 3HLUA 2KYXA 1MROB 1S1XB 1L5UA 5MAOA 2HGNA 3M2UA 3GQCA 5DDRC 4OYIA 1V3RA 1MN9A 3OFHA 1ROFA 2R7WA 2O66A 4HH1A 2DRBA 3PW5A 2YH1A 2GVDB 3TQ1A 1PBUA 1Y5LB 4R8UB 2EVZA 1HBMA 2DR8A 2O67A 2QG9B 3BBCA 2XI3A 3V4IB 2NZCA 4GC6A 3X3UA 5K20B 1Q95G 3I55S 4X2BA 5JXSA 2DRAA 3EDQB 4GO5X 3T1HJ 2A6MA 3CIZA 3BM7A 4K4YA 5FLXU 4J91A 3E3XA 2QZ8A 4PWWA 1N6QB 1VOMA 3HPOA 2BABA 4DPYA 4LBPA 2M9KA 3MEKA 3PX0A 2CQ2A 1NSQA 3WDOA 1KFSA 1CJUA 3RBXA 1OWXA 2CG4A 3NBPA 2QLXA 1XWLA 2BVZA 3M6XA 1VI7A 2MLZA 4LR9A 4XIUA 1NKEA 4DMZA 1D0EA 4DSIA 4YB5A 3R3TA 1YKWA 2DPIA 1R8HA 4IG3B 2E44A 1IJFB 3R5BA 1RT6B 4P2MA 2Q6BA 3Q22A 1M5SA 1UVJA 1OQ3A 3CCQS 2DNLA 1HW8A 1J5OB 1T9WA 3HSJA 4CRJA 4DSFA 1JLBB 3MOJB 5D0EA 2Z8QA 1N32F 1FXLA 3MPDA 3Q24A 1SKSA 1TL7A 4L75A 3GILA 2FJXA 1D9AA 4DS5A 2MZQA 4TY9A 1BGXT 2DNQA 1IM4A 3DLBA 2FHMA 4X4NA 1GXTA 4H4MB 4MFBA 3N6LA 3FUYA 2AJQA 5B0GA 1G7CB 5LXRA 4HKQA 5ETRA 2J9DA 3T1YF 2AZ3A 1RE1B 3QAUA 2CG8A 3QO9A 2WW4A 2KO1A 3BB5A 1X5PA 5HMZA 3SFGA 5DQIA 1LW0B 4RO0A 2X51A 3I4PA 5KFGA 2B4VA 3SEOA 2WW8A 1BQNB 3H2VE 4K4ZA 3AB4B 4QWEA 4EEYA 5CD4A 1F9HA 1Y4ZB 3GJQB 4KKOB 4F4YA 3CD5A 3TZXA 1PKUA 2A18A 3KK3B 3VV2B 3KLGA 2MKHA 4FZVA 2C22A 3OLAA 3EGNA 1YJTA 1ZETA 4RR5A 4OI1A 3FSIA 3BR8A 3ZO7A 4CI0B 2NSCA 4O3NA 4DZ6A 4WZQA 3CCVS 4PXBA 1EJ7L 3PXGa 1KQFB 2G4BA 2FHJD 1UJ6A 3M30B 3MUMP 2HIQA 2G1DA 4NI2B 4Q43A 1RCOB 1VQPS 5HBMB 5M2PA 2UUCJ 2VICA 5KFXA 1QY7A 5L39A 3P5TL 1XMQF 2W7OA 2C1EB 1OPIA 2FB0A 4TLRA 4ZK7M 3JAMU 1U1NA 3MXHP 1TKZB 3OTOF 1NPPA 1RHJB 1TUWA 4AXIA 5K8NA 2W9BA 1IKYA 3OBIA 5CYQB 1H2VZ 2VPZB 2DHSA 2BE7D 4MIAA 4ID5A 5I42A 3D6FB 2F65A 2F3JA 3DGVA 5ETMA 4TLQA 4Z7YA 4CO2A 2PFFB 5IWAJ 4NLXA 1FERA 4LFAF 1F5AA 2Z2ZA 4HYKA 4IH7A 3BV8A 1FXRA 4E0DA 3GTYX 1TP7A 3Q8QB 4DUYJ 2I9SA 3ULHA 2UXCF 2OEMA 2ZUAA 3OL9A 3U1LA 5KFLA 3DOKB 4M5GA 4NA2A 1RT3B 3ZTPA 1KLNA 1JLFA 1FKPB 2UUAJ 1WHVA 1NEEA 2OPRB 5KFFA 3JTNA 2PFDA 3KLIB 4DU8A 5C25B 4XPCA 4ZLJA 2W24A 3HHLB 4I68A 3SXLA 5HATA 2Z0GA 4F2RA 1IVZA 2XI2A 2NXCA 3DYAB 2QSFA 1HW9A 4DPXA 4ZJQA 3SV3A 3OTEA 5E3RA 5KFUA 2RUSA 2XLJA 4UOCA 3CF5Q 1JLCA 2FHJA 4Q0BB 5C42A 1EB0A 4FKYA 2XO7A 2B5JA 3POTA 4LREA 2HVDA 1B7FA 4F0KA 4F3MA 2OLWA 2BA9A 2R8JA 3JQMA 1NH8A 1FRKA 2ASLA 4NA3A 5IT9Y 5E5NA 4WZMA 2BZ2A 2AKWB 2R8KA 5E3AA 2Z56B 2C2DA 4ZPDA 2BUNA 1JJ2R 3BQ1A 2V34A 4HACB 4M5IA 2H4YB 4PXCA 3ZZYA 4WP8A 1LQ9A 4DV0F 5F8NA 1LWEA 3NNHA 2GS8A 2PN6A 3QFWA 2H48B 4RW8B 1Q7YT 1FX2A 3PX6A 4JI0J 3DHXA 3SCIE 5KFZA 2VFUA 5KFPA 4GKJJ 4DSJA 4HL9A 2W7PA 3Q8RB 2V5HG 3PR5B 2BW2A 4ZLNA 2Y1LB 3A1YG 2B9YA 1CPZA 3HFKA 3TX8A 2AU0A 1Y7PA 3KJFB 1M1HA 2DO4A 4JI4J 4KPYA 4OHVA 3RB4A 5LOQA 2WSCC 4KGVB 2DT9A 3DDIA 1SBRA 4BCAA 2XMJA 3NLCA 1WC6A 1RWMB 4QWBA 3DLEA 5KG2A 1NSPA 1FF2A 1WKJA 4ED7A 2WHOA 4ZCKA 4G3IA 1BQXA 4YHHJ 3TZYA 3UPFA 1IN0A 1TV6B 2CQCA 2R2TA 2V63A 3C19A 4FPIA 3Q8PB 1M5PC 1HQ2A 1UFKA 2KXHA 4HVZA 2QN6B 3FFIA 5ETKA 1U1PA 4HT5A 1VLYA 4WJBA 3BKUA 4ERDA 5J1EB 4NCGA 1FCAA 4L3NA 4FF4A 3MPYA 2DR5A 3O6QA 2V8PA 4GO7X 4B3SF 2E7XA 1VQ5S 5JMNA 1UA1A 4IO9Q 1OPZA 4LF7J 4BS2A 3OTCA 4WCEQ 4C11B 1CLFA 4IUFA 2BQ3A 2HFVA 3HSGA 2VB6A 1QLNA 4YOEA 1RTJB 4A8WA 2CQBA 1VHFA 2DISA 5GMKa 2C3OA 1IKXA 1TU0B 3C46A 4Q2LA 1VQOS 3WC2A 3CJ2A 2AJ1A 4CLFA 2VH7A 4F3OA 5KG0A 1MMLA 3W62A 2VA2A 4IFVB 3EYZA 4ED0A 3M4XA 4BC7A 1AZSB 4C3KA 1TK0A 1BWEA 2ZZNA 5H9EK 2XLKA 1SKUB 4KFBB 1HYSB 3LQVA 4USUA 2BJ8A 3I9ZA 3RB3A 1R89A 1UJ4A 5KG4A 1NK6A 3AD7C 3LPYA 3GB0A 1NNDA 1S1WB 1C0UB 4A8FA 1OSCA 5A8WA 2J6TA 3D4JA 2FHKA 4KC5A 3OVBA 1FE0A 1TQLA 2CPZA 1XMOF 1N34J 5L9XA 1DRZA 4QYZJ 1YSJA 3RR7A 1WOSA 4A8YA 3HVRA 3K5MA 2HMIA 1HHSA 2DNPA 3E8OA 3AODA 4ZVQB 4N7TA 1T05A 4ED3A 2E9RX 4K7QA 5B0DA 4ZVOB 1XR7A 5FDLB 1OY8A 3TUJC 2DR9A 5AXMA 1X4GA 2OTJS 4Q44A 1G1XA 1GAOA 5CHCB 3MFIA 5J2PA 3UN2A 1L3VA 5KFIA 2B6AB 3M6VA 3TAPA 4IQXA 2MHEA 2YKNB 2R7UA 3VAFA 4O0IA 1RT1B 2V2ZA 2Y3YA 1MU2A 3CTRA 2XM3A 4ZOSA 4O3SA 1MW7A 4ECXA 3ZZOA 3PW0A 2KTQA 1M1GA 1C0TB 4LBIA 4DR4J 2IRXA 3GSIA 5ETLA 1R6YA 1HA1A 1YI2S 5CYMA 1MLAA 2DPJA 3RUBL 2CVEA 2JEJA 3R5CA 2R8IA 2KZZA 2P5VA 2DCLA 1S6UA 3JSYA 4EZ9A 3THTA 1N5QA 2ZC4A 1K0TA 1S7IA 3HKWA 4NCBA 3CJ0A 1VQLS 2YX4A 3EGVA 4PPDA 4Y2AA 1P1LA 4NYPA 4C0OC 2KVIA 1H38A 3IS9A 3T1AA 1MROA 5AXKA 3ZTRA 3QZ7A 2BOAA 2HQIA 4JI2J 5DZ7A 5A6WA 3EGZA 1ZM2A 2GVDA 4DHVA 2JFDA 4ES3A 2EPIA 2XBPA 1Q5YA 4HI2A 1VC6A 1U45A 4DV2F 3H59A 2E1AA 2RS2A 2V8HA 3V4IA 3DI6A 3CD0A 1LKZA 2AX0A 3KYLA 3IBFB 3DLJA 2SXLA 2MKCA 2AYMA 4KH1B 2OPQA 1S1VA 1XTZA 4DFJA 4PRFA 1KSPA 1WJ9A 4F4ZA 3CJ4A 1N6QA 1RHRB 2BJ7A 3M9NB 5U47A 2LU1A 4LRCA 2WCXA 1MNEA 2V4JA 4E2FB 4P2FA 3BO2A 5CA5A 3PACA 1TL1A 2GQCA 2GQ2A 4NMXA 4OX9F 3DLKA 3PRBA 3FEXB 2R2UA 3W64A 2X1BA 3ITHB 1F9FA 4IG3A 2HWIA 2OPSA 5LMNF 3FSXA 3PTWA 4NE9C 4L73A 1H6KX 3D68A 1U6ZA 1EKSA 1J5OA 3B82A 1KTVA 3LANA 2VKRA 4I0WA 5T41A 3ETMA 2RD5C 3A12A 4YFUA 4FKXA 1RISA 1ZM9A 5T14A 4ILRA 3QLHA 1WTBA 1UCNA 3MEGB 2MZJA 3RBZA 1UFLA 2HVZA 2F8EX 1S49A 2FYXA 2FVQA 2V2QA 3TOQA 3UR0A 4NYOA 2OFHX 3H40A 4DR6F 1NJYA 3J81U 3HO1A 1R6VA 4F3QA 1VDHA 4ECUA 4PG8A 2GA7A 3M05A 5L9NA 4NA1A 2GIRA 2UUWA 2NLWA 2DVIA 1X4DA 4QR2A 1QVFR 1AA1B 3VWSA 3R27A 1RU1A 5DGBA 4K50A 1BQNA 2AJ2A 1XK8A 4OL8A 3HKZD 3HSZA 4KKOA 4A47A 4NXMF 5HROB 4KY3A 5AXNA 1S9GB 3HHLD 5KAKA 3KK3A 1V9OA 3EVWA 3HHDA 2OMOA 4USKA 3PRDA 3HZGA 4URQU 4N41A 4PKDB 2EFNA 2RB7A 2DRDA 4TKTA 3CPWR 4Y28C 1F5BA 2CJXB 2ROGA 1VQYA 3M30A 3LGHA 2KFYA 1U6FA 4KIAA 2ALZA 2XYGB 3MURP 5HLFA 2WOMB 3WC0A 4KGKA 4LSNA 1NJZA 2JEGA 4IOCQ 2UU9F 1E6VB 4FNHA 1S10A 3T5LA 4DV5J 1TKZA 4TU7A 4LT6A 1GXUA 2Y1JA 5CYQA 2IM1A 3O2IA 3MOZA 1RAEB 2AEFA 4DV1F 3IC1A 4DV6F 3CUNA 2KXFA 3MECB 1VJWA 2J0WA 3BGOP 2H65B 1OSDA 4M8LA 4WFYA 3M2VB 4ZCMA 1GMUA 2B7BB 3PW4A 1RT5B 2YWGA 2FHOB 3RB0A 1HIYA 4CLPA 2KJVA 2XSJA 4EO6A 1DTTB 3BSCA 2WVBA 4KB7A 2RQCA 2BJ9A 3WQPA 1KWMA 1U1QA 2CIMA 4RPFA 2MGZB 3AT1B 2HZVA 2BM0A 1ZOTA 1HNXF 2XMUA 5F41A 2KN4A 4J7CA 1S6QB 2OPRA 4JI8F 2ATLA 4LFCF 3KLIA 4NLRA 3M1VA 1URRA 1S0MA 3TEGA 3MF5A 3DYAA 2VG7B 4P10A 3QWPA 1OJ4A 2Z30B 1IBMF 2IAJB 5EN1A 3OUYB 4DR1F 3V6DA 5L1JA 4R0EA 1SJQA 2JEFA 3ILIA 3CD7A 4PG4A 3K58A 3DGPB 2R8HA 4CLKA 5DQHA 2F40A 1FJCA 4ALZA 1DQ8A 1NPRA 3AOAA 3IRXB 4WXOA 4QU7A 2ZBPA 2LXUA 3M8YA 1T9TA 1YVFA 1X4BA 4IG0B 1HNIB 2FZGB 2RS8A 2PC6A 3GR1A 2LLZA 4CTAB 3GIMA 4OX6A 3W5YA 2G2ZA 3GSDA 1UZDA 2Y0BB 2YH0A 4Y3CA 4YY3J 4X4QA 1NHUA 3MEEA 2B8PA 3LP2B 3KLFB 3MM7A 2Z2MA 4OHZA 4CYUB 2XQCA 4DX5A 1MN7A 4G1PA 2VFSA 3OVAA 3W9HA 2AWZA 3IM9A 2MYFA 2VQFF 2ACYA 1HWKA 1UVKA 1EP4B 1RWNB 3V81A 1D1UA 5BYSA 1S57A 2U1AA 3BZQA 2L9NA 4J9LA 2OEKA 4DR5F 1PYTA 2BXJA 5CXTA 3MCNA 3JB9k 2BW7A 4J9NA 3OJSA 1FHTA 1HLWA 5HQ8A 2UXDF 4A8MP 4HEA9 3CJ8A 2MZRA 4RU2A 2N3OA 2CQDA 5CZVA 2K7KA 4F2SA 2HNZB 1TV6A 3TUPA 1U8WA 4L3KA 1GX6A 2VBWA 3L9ZA 4Q8FA 2HNYA 3AFGA 5KFQA 3J80U 3VVTA 3BR9A 2HHUA 5FLXY 2W9CB 4TU9A 3JQJA 1U2RA 3CWJA 3SSRA 2FPHX 3AJDA 4ECZA 4MYUA 1RQ0A 5J1EA 2NXNA 3DC2A 3RAMA 3CDUA 3I32A 1LK7A 2ADBA 5KFNA 4EO8A 1L3KA 1FKOA 4NWBA 2WZ1A 2LA6A 4LF6F 4EGLA 1IQZA 3HHEA 3HHNB 1T03B 1PO6A 3M8QB 5F3ZA 5M2UA 2Y1RI 1FRMA 4PPZA 2WSEC 2HZAA 1N48A 4OYXA 4KRWA 4OYAA 2LU2A 5CYJA 1D8YA 4KAIA 4EUVA 1NHKL 4EYHB 2BACA 2KFZA 5E3CA 1SH2A 5K5MA 1NK4A 2CNLB 3J7AN 3GYXB 4I67A 5AJ3F 3NGKA 2FIUA 1FXDA 3HD2A 4O4RA 1RKIA 4KBIA 2ACMA 2QFJA 2IBKA 2LECA 1UVNA 1TFYA 1YQHA 3K7RA 4USHA 1HPZB 4HHJA 3VAGA 3N01A 2Y8YA 1F3VA 5K9FA 1AZSA 2CADA 3RB6A 4P2SA 3DKDA 2DY1A 3C14B 3U02A 3D3BJ 2UUTA 3M32B 1WTFA 4V19X 2GIQA 1IWGA 2ZHAA 3CMES 1HYSA 4XK8C 3KUGA 3I5CA 2LA4A 3TWZA 2QC3A 3R6LB 4PQAA 2HWHA 4UQGA 1E6YB 2LEPA 4B02A 1HBNB 1FVSA 2XMAA 2HRYA 4QWCA 3HMJG 1RUSA 2VOPA 5I4MA 4FYYB 3QNWB 2DEIA 4FXDA 4IYQA 2NR0A 2HS4A 4IOAQ 2RVJA 3DRPB 1KNZA 3TVZA 1EQMA 2IMWP 2ZH2A 1DBDA 4WIIA 1T9UA 4AQYJ 2ZE2B 1R43A 3QIPB 1YJWS 4A8XA 2ZHBA 1KKHA 4I6AA 2YWKA 3KLVA 3THVA 5D4NA 2CZ4A 4DN0A 1TAQA 2VL1A 3CJRA 2HQCA 3FMWA 2AJ4A 4YN3B 1QSYA 2HS3A 2BKNA 3TA1A 4WYWA 4ZP7A 2GHWA 4I7FA 4ZIWA 3PR4A 2QRRA 2ATCB 4KGMA 1HBOB 3DMJB 2X1GA 2OP5A 2VDIA 1V6HA 3CCZA 2HHQA 3N0VA 2ZD1A 4Y2MA 2GMLA 3GU0A 4NX9A 1SJRA 1V3SA 2B6AA 5A8RB 3IBWA 4ECWA 2I5JA 4YR2A 2NPIA 2E1MC 3SDEB 1RHUB 1RT1A 1JWWA 4IR9A 3A8KA 3JAMY 4IKAA 1RAAB 4DR2F 4PEOA 5IOLA 3CC4S 3CJKB 3VGTA 1VC5A 1C0TA 4CO0A 1CJVB 4DL4A 3FJ2A 1GX5A 1HI0P 4A4JA 2O3DA 3TRGA 3EE3A 1WKKA 1F2GA 3MAQA 4NZ7A 1SVDA 3GWCA 1RADB 1C2PA 1SIZA 5HANA 2ZH3A 3LWLA 3CVKA 2H54B 1N5TA 4UTGA 4TYAA 1XJWB 4LVNP 1NK0A 1DQ9A 1PAUB 4Z37A 4YR3A 5AE2A 4ELUA 1FD2A 2ZZMA 1VQ6S 2C2RA 4DBQA 1V3ZA 2GFFA 3D2WA 3QBCA 4PWDB 3FRYA 2UZAA 4C8ZA 4ITSA 1BQMB 3WX8A 3ZFVA 1GNKA 2PMWA 1NJWA 1R0BG 4OIXA 2YTCA 4WU3A 1DLOB 1U8SA 1C1CA 1TL3A 2JLFA 2PA8D 1YHQS 2UXBJ 3FCWA 4M95A 3PKMA 4EBDA 3EUNA 3CW2C 3GPAA 2HBQB 4TQRA 3BREA 5KFBA 1N54B 4KO0B 1G2EA 4I69A 1AYEA 2IMOA 1T7PA 1CC7A 2AIRB 1JLAA 1A7GE 2PT0A 2XHCA 4IQMA 3N28A 4DPTA 1VBZA 1JX4A 3T5JA 5H9FJ 1FFSB 2CPDA 1FO1A 2M0GB 4LF9F 3PNIA 3IGVA 5JUMA 2PSZA 4DI6A 4C4WA 3G6XA 3KUEA 2MPUA 1VS3A 3KHLA 2V8DA 1S99A 3QATA 5A8KB 2AGOA 1JJHA 2X3DA 2DNKA 4HTIA 3TW0A 2OSRA 3D0GE 1GMWD 3T1HF 3RG6A 3ITHA 4M1KA 1WKLA 4H4OA 1CJKB 2NPFA 4MH8A 2HURA 2HFSA 3IMQJ 2JSXA 5GVQA 2B7CB 4OLOA 1P9QC 2CQIA 3G6YA 1EZZB 8RUCA 2EFQA 2BE9B 2NREA 1H2TZ 5D0HA 4U8VA 2YX1A 4Q7AA 5KFKA 4FYVB 4LF1A 2LQ9A 3MEGA 2AJFE 4ZPBA 3P6YC 2C28A 2JC0A 1LNQA 1B0TA 2DH8A 3IR5B 3TI0A 4ED1A 3IWXA 3UNYA 4Q2MA 5IT4A 1S1TB 3NAHA 5KFOA 2YWFA 2YNGB 4C97A 3ZZUA 3HCXA 4KGZB 1KRPA 2E1PA 3KHHA 5IFMA 2DIUA 1RT2A 4D3GA 3CT9A 3AQOA 5DLGA 4GKKF 3MAAB 1X60A 4K4XA 5F0WA 2N3LA 2VPXB 1UW9A 1IBCB 1X4EA 1ZAWA 1KS2A 2PDAA 4YDXA 1QAIA 2FLPA 5GADU 1K0VA 4W92B 3H5XA 3CB4A 2CJYB 2UVWA 2XS5A 2IJFA 1M0SA 1S9GA 2C42A 3PEHA 1N52B 1B0PA 4NMLA 2HHVA 2HIYA 3F0NA 3EX7B 4NRUA 2OH2A 2B9EA 2FLOA 2CXEA 1JKHB 2HQGA 1RT7A 1WELA 2MJUA 3GR0A 1GMWA 4IRKA 1I5OB 5LMUF 1IBKJ 4EMDA 3K5PA 4LSZB 2HAFA 5J1PA 4OHXA 2B43A 2AYEA 1TAUA 2VC1A 1BHNA 2NUUG 1M5VC 2EW9A 3A3PB 3C2PA 1TK8A 2RH3A 3SZ2A 3QGPA 2EKNA 1E6VA 5GADI 3LGNA 1FVQA 1UPMB 1I6JA 4F36A 1VBYA 3H20A 1WI6A 3MECA 2CQGA 3NS7B 1SH0A 1AT1B 1HQEB 3P49B 2KB2A 4I4BA 4ATNA 4A8SA 2KDOA 2C2KB 5F3TA 1JLQB 1RK8A 2AGQA 2W2PP 3ZZZA 4X84A 2RRAA 1NDCA 3ILOA 3IR7B 3ILLA 3RJMB 2YVSA 2EFOA 3ISND 3ISNC 1CBKA 4ICLB 1M5OC 2D3UA 2MGZA 3QT6A 4RNHA 3DN9A 3B4DA 4P71A 2CNOB 1NLKL 1SL1A 1S6QA 2VC0A 4W98A 1QSSA 1VQNS
chains in the Genus database with same CATH topology
1VGYA 4NA3A 5IT9Y 5E5NA 3CO9A 3CULA 4DOZA 5IWAF 3D54A 2BZ2A 4WZMA 2R8KA 5E3AA 1UKUA 2C2DA 4GC7A 4ETZA 4ZPDA 4LMZA 2BUNA 4JI6F 4TY8A 1JJ2R 1SH3A 1JLBA 2IYIA 2PA3A 3BQ1A 5J2PB 1ULRA 4JI2F 1IBKF 3KG0A 1H98A 1SIWB 4PXCA 3ZZYA 3OL7A 4WYLA 1NKBA 1LQ9A 4DV0F 1C1BB 1LWEA 3NNHA 4K59A 1U6BA 5F8NA 3N6NA 2PN6A 3LP1B 3TVYA 1CQMA 3OLBA 2R7QA 1VQ9S 4DUYF 2GO9A 4RW8B 1MU2B 4RW7A 1Q7YT 3I4HX 2QA1A 4F4XA 4R0JA 1GQEA 3PX6A 4WKYA 2NUHA 3CJ5A 1WF0A 3DHXA 3SCIE 5KFZA 1FNOA 3RBEA 2NYIA 2VFUA 3MMJA 1KVIA 5KFPA 2W25A 2IAJA 4YMEA 4DSJA 2J6SA 1QUVA 4HL9A 2POKA 1H2UX 2W7PA 2OMLA 2V5HG 3JSBA 3RRKA 3OQ2A 1AXQA 4ZPAA 3PR5B 5A8KA 1DARA 2X1FA 4FP9A 1VQ7S 4L72B 1FDNA 2BW2A 1T3OA 4RW6B 2UUAF 1FRXA 5HP1B 1IXKA 3JYTB 3A1YG 3I9V9 4DR3F 1X8DA 1X5TA 4H4MA 2QLWA 2B9YA 5KG1A 4DUZF 3MFHA 3DGPA 3KLHA 3FEZA 5B0BA 1CPZA 3JSRA 3HFKA 3DLHA 4LVOP 3TX8A 4XDDA 1Y7PA 2AU0A 3MMBB 3IRXA 4UUWA 3O1LA 2DO4A 4O3OA 2ZNZA 3BF4A 4KPYA 3UCUP 4OHVA 3RB4A 2IJNA 1RTHA 2WB4A 2WSCC 3CDEA 4IG0A 2RF2B 5GAGU 1RYSA 4DV7F 1HNIA 2NSBA 3JSMB 2DT9A 3BSNA 4OV1A 3BJYA 1SV5A 2BE2A 2JVOA 2E29A 1LW0A 2ZM6F 5KFCA 4CTAA 2RKIB 1SBRA 3VAHA 4UQTA 2V4RA 4BCAA 2XMJA 3NLCA 3VQTA 4QWBA 3CGIA 1X5SA 3FRZA 4HTJA 2OD6A 2YNFA 1KLMA 3AA8A 3DLEA 5KG2A 3RBDA 3KNAA 1FF2A 4ED7A 2WHOA 4ZCKA 4B9LA 4G3IA 2VUGA 4IR1A 1BQXA 5DM6Q 4F50A 4YUDA 1A6LA 3MHYA 1QTMA 1FRJA 4QOTA 1EETB 3LP2A 3OXGA 3UPFA 3KLFA 2YX7A 4C0BA 3QGGA 1IN0A 4QIVA 3CC7S 1TV6B 3OR1B 2CQCA 1Y0HA 2R2TA 3FQLA 4DL5A 4DQPA 2FJDB 3G86A 4ZP9A 3Q8PB 3W2WA 1M5PC 1Q79A 3HHLC 3SV4A 2DBBA 1S72S 4B9MA 1KOOA 1XBWA 3DXSX 2KXHA 1ZM3A 4HVZA 3PDNA 5F8HA 4AYBD 4ECQA 5CD4H 4Y2CA 4KV8B 3SSQA 3FFIA 1D9FA 1KD1T 3GFYA 3VAJA 1S48A 1U1PA 2ZJPQ 4HT5A 3J7ZT 1VLYA 1SKRA 4WJBA 3OL6A 1NZAA 2CRLA 4ERDA 5J1EB 4NCGA 3ISZA 4NLQA 3MR6A 4C7QA 2FTRA 2CPHA 2G13A 4C8YA 1SJFA 5KFRA 4WFXA 4YB7A 3HVTB 4FN5A 2K7JA 1FCAA 4L3NA 1UWBB 4FF4A 3MPYA 3BQ2A 3O6QA 2DR5A 4DS4A 5GAGI 3TO8A 3BGRB 5J2NA 1Q86T 4OJHA 2BDPA 4EBCA 4GO7X 2BR0A 4B3SF 2D9OA 2E7XA 1VQ5S 2ZUGA 3DI6B 5A0YB 2W4PA 1UA1A 3MMCB 5HBMA 3D1QA 4JI0F 1OPZA 4IO9Q 2VG6B 2HQ3A 2QMXA 3U27A 1WG5A 2CZVC 2QA4G 3DLGB 3E51A 4BS2A 1CVJA 1Q7LB 2HFZA 4GKJF 1VK8A 3DFEA 2EC0A 2VODA 1IKVA 2JHEA 3OTCA 4WCEQ 2F7VA 3GV7B 4C11B 1CLFA 1GH8A 4RU9A 1TL4A 4IUFA 1VQ4S 2OPQB 4DPOA 1S1VB 5KG6A 3K59A 2BQ3A 4B9UA 2OPPA 2VB6A 1QLNA 3F73A 1LFWA 4ZPWR 4YOEA 1TKXA 4RW4A 1HMVA 3VR1A 2J8AA 1RTJB 4K4TA 2OSQA 4A8WA 1H7WA 2B4UA 3GZ7A 2CQBA 4ES2A 4U7UK 1VHFA 1R0AB 2DISA 2WONA 1ZYQA 1TKDA 5I3UB 2GQQA 2MZTA 2C3OA 1IKXA 3DM2B 3E01A 3OXLA 5GMKa 4YQWA 5D4PA 4JI4F 1W2IA 2UVRA 3D5MA 2MY8A 1REVA 2W9CA 1R8PA 3LWMA 2L9DA 3C46A 4Q2LA 1VQOS 2A1BA 3WC2A 3CJ2A 3UI3A 3MM6A 2AJ1A 3QPIA 2YNHB 2K1RB 1GT8A 2V4JB 4LSLA 3U7JA 4OHWA 2VH7A 4F3OA 2H9ZA 4FXWA 4QQBA 5KG0A 3WZ0A 1VQNS 1WG1A 2CQHA 2DCUB 4DG1A 1TL1B 4N56A 1MMLA 4QR1A 4ELVA 5EUHA 3S01A 2VA2A 4IFVB 4ZS6A 2L41A 3EYZA 3T6JA 4NLYA 3DLKB 3ZZ0A 2L48A 2VBYA 1ZTWA 1ZM4A 4DLGA 4YHHF 1F0XA 5KOXA 1QAJA 3DRSB 5J2MA 4ED0A 3AQPA 3B78A 5D4OA 3M4XA 2R2SA 1RT4B 4BC7A 1T03A 3FGVA 3TVKA 4C3KA 1RAJA 1RTIB 1TK0A 1BWEA 2L3MA 2OPSB 4NCAA 2ZZNA 1HD1A 3SFUA 1UETA 1FD8A 2CQ4A 4EBEA 2J0XA 2A3JA 3OV7A 3CJ3A 1WF1A 2RU3A 1X7VA 2QSWA 2ZKTA 5KT2A 3CDAA 2HHXA 2XLKA 1S1UB 1DQAA 3CCUS 4KFBB 3C6TA 3ETOA 3H2LA 4USJC 1HYSB 1ZPVA 4DV4F 4EZ6A 3LQVA 4CQ1A 2D3OR 4Z2XA 3I9ZA 3DOKA 3RB3A 1R89A 3S1TA 2LKZA 1UJ4A 2R9LA 3E2EA 2ZBCA 1NO8A 4ZMMA 5KG4A 1NK6A 1HI8A 1RT3A 1AROP 1SJ1A 4BDPA 4C8KA 4MKAA 1FKPA 1Y3JA 2GGPB 4BBYA 1U1OA 2EI5A 3GB0A 3LPYA 1OO0B 4C98A 1NNDA 2VBZA 1S1WB 5IQQA 4YDDB 4DL6A 1JXLA 2XNRA 1C0UB 1RA7A 1IR0A 4A8FA 2F8MA 2BQRA 3BGFA 3AA9A 4K5RA 1OSCA 2AYGA 5A8WA 5KG3A 5C25A 2J6TA 3HHLA 2R7SA 1SI9A 1X9SA 2FHKA 2IM3A 4KC5A 5KT5A 3NKYA 3OVBA 1FE0A 1TQLA 5K8MA 2CPZA 1XMOF 4K4UA 1S6PB 3QLHB 5L9XA 3KTQA 1KONA 3G8TA 4CO5A 3SCJE 3UCZP 1VC0A 2YKQA 1DRZA 4QYZJ 5K8PA 1YSJA 4X64F 2HAIA 4LF7F 1S0OA 2JVRA 5F0UA 3RR7A 2DHAA 2XMMA 3LAMA 3W2VB 4A8YA 3HVRA 1FK9B 1FRIA 2CQPA 3K5MA 1JLQA 1HPZA 3RW7A 2DGWA 4N8NA 3IFEA 1GTEA 2HMIA 4V19J 5B0EA 1HHSA 2ZVSA 1X4FA 1Y9OA 2DNPA 5IXUA 3FQKA 4UUXA 5KTQA 4Q0BA 1MSWD 2GO8A 4E98A 1YJRA 5T7LA 3E8OA 3LH2S 4TNOA 4QWDA 2BRLA 3D28A 1WF2A 2D9PA 1Q8IA 1JK9B 2PMHA 3TANA 3M32A 4R25A 4ECRA 3V6KA 1T05A 4ICLA 4ED3A 2ASYA 3QJLA 5K8OA 5EWGA 2E9RX 5B0DA 2M2BA 2J9EA 2E5IA 2LEBA 3DCAA 3DOLB 3CIMA 3J81Y 2DGXA 1N8RT 3IR6B 1VQ8S 1XR7A 4KHRA 5FDLB 1BD6A 3TUJC 3GIIA 2DR9A 2D41A 2I1RA 3MEDB 3TARA 2VV5A 3T6BA 5AXMA 3T3FA 3LP0A 1O8BA 1ZZNA 4FF1A 1X4GA 3GG0A 3EGWB 2OTJS 1WHXA 3HXMA 3D0IE 4RNMA 3OSNA 2YKMB 3EXYA 4Q44A 2MY7A 2RIJA 3N5BA 2CQ0A 2FJEB 1S76D 1G1XA 3KMQA 3MI7X 1HWIA 1GAOA 2MMYA 1RKJA 5CHCB 3MFIA 5J2PA 4OZ1A 3K2YA 2XC9A 2DNMA 1IKWA 1L3VA 3GIJA 3J7YI 1RJJA 2B6AB 3P96A 5KFIA 3M6VA 2XS2A 4QW8A 1VRUB 3TAPA 4IQXA 3MMAB 1MMDA 4JV2A