2E5JA

Solution structure of rna binding domain in methenyltetrahydrofolate synthetase domain containing
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
97
structure length
97
Chain Sequence
GSSGSSGPGSPPGEGAPLAADVYVGNLPRDARVSDLKRALRELGSVPLRLTWQGPRRRAFLHYPDSAAAQQAVSCLQGLRLGTDTLRVALARQQRDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of RNA binding domain in Methenyltetrahydrofolate synthetase domain containing
rcsb
molecule keywords Methenyltetrahydrofolate synthetase domain containing
molecule tags Structural genomics, unknown function
source organism Homo sapiens
total genus 13
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2e5jA01
1X4EA 1AUDA 1WEZA 1K9MT 4LJMA 1SJ3P 2YH0A 3NMRA 1SJFA 4OZ0A 4M5DB 3CCQS 2NZ4A 2KH9A 2LMIA 2DNQA 2RNEA 5GADU 1N52B 3CF5Q 1YITS 1OPIA 2V94A 4Y00A 3G96A 1F9FA 2KHCA 1N54B 4C0OC 2ADCA 3VAKA 1WG1A 3CXCR 2DGVA 2MHNA 4QQBA 4EGLA 2X1AA 3CCLS 5DDQC 3LQVA 5IQQA 3CD6S 2DNYA 1X4FA 3THTA 1VQ7S 3MOJB 2MQOA 1UP1A 2OTJS 1HD0A 5DM7Q 1M5VC 2RUGA 2DIUA 3IWNC 2KM8B 4TU7A 1FJEB 4U67Q 4TU9A 1KQSR 2MXYA 2K3KA 1YIJS 1X4BA 2I38A 2ZJQQ 2OJ3A 1HD1A 3THPA 2ZJPQ 3CUNA 2KRRA 5GVQA 2FHOB 5IFMA 4LMZA 3CCES 2MY8A 1VQ4S 2GHPA 4V19X 2MMYA 2DO4A 1U1PA 1ZZFA 2AYEA 5D77A 1VQ5S 3ZZZA 1DZ5A 2LCWA 2OTLS 2MGZB 2MB0B 1VQKS 1Q82T 2CQBA 2YH1A 3EX7B 2DNHA 3OW2R 4A8XA 1P1TA 1KD1T 1SXLA 3FEXB 5BJRA 2ERRA 4FXVA 4ED5A 4F26A 2JRSA 5LSLA 3SDEB 1FT8A 3S01A 1B7FA 2K8GA 3MD3A 2MKJA 2XSFA 1R8PA 2XS7A 3RW7A 5CXTA 3MUVP 2HGMA 3MI7X 1U6BA 2MQLA 1M90T 2MYFA 2I2YA 1WF0A 3ZZYA 1NO8A 2FC8A 2KG0A 2FY1A 3G6ES 3CMAS 4PKDB 3NS6A 2LQ5A 3G8TA 4QU6A 1A9NB 2J0QD 1VQPS 2D9OA 2YKAA 2DGOA 2CQ2A 1YJNS 2MZQA 2M52A 1WHVA 1H2UX 3VF0B 2DGQA 2B0GA 2DNOA 2CQDA 5JVHQ 4UY8T 3CMES 5GAHU 5FJ4A 1X0FA 5D78A 2M9KA 3LPYA 1JJ4A 1VQ8S 1U1NA 3V4MA 4Z2XA 1URNA 2MKSA 2OSRA 3PIOQ 1H2TZ 5DETA 5HO4A 2YTCA 1UAWA 1PO6A 3BS9A 4UQTA 2EK6A 2M8HA 3BEGB 2MGZA 2DNNA 2N7CA 1VQOS 2XS2A 3VAMA 1X5PA 1VBZA 3IRWP 2MZ1A 1CVJA 4WIIA 2J76E 2DH8A 2J8AA 2DGSA 4WFNQ 3CCVS 1S72S 2U1AA 2RVJA 1VQ9S 1SJ4P 3SDEA 3MURP 2PE8A 2CQGA 4F02A 1Q86T 5MLCV 3I55S 4W90B 3G71S 2KXHA 5LXYA 3DLLQ 2AYBA 2CQ1A 2DHSA 5LJ5Y 1VQ6S 3HHNB 2RRBA 4QU7A 2D9PA 2A3JA 4P6QA 2CQ4A 3U1MA 2MQPA 2DNMA 2RS2A 2X1BA 5HL7Q 1YI2S 3J7ZT 2RQ4A 4W92B 3VAGA 2DK2A 1M5OC 5GAEU 3H2VE 2MQQA 1WF2A 2ADBA 2E5HA 4QPTA 1QVFR 2RQCA 2DGUA 5LJ3Y 1VBYA 1Q7YT 2MQMA 2CPEA 1U1QA 2DGTA 2DH7A 1U1OA 1WEYA 1WHWA 2MKIA 1HA1A 4PRFA 2LYVA 3R1HA 2QA4S 5GMKa 2XS5A 1WEXA 3I56S 2MSSA 1FHTA 4WKRA 2DISA 2DHXA 3VAHA 2XB2D 1O0PA 1U2FA 1U1MA 3G9CA 2KXNB 3BO4A 2L41A 4RU2A 3UCGA 2E44A 1RKJA 1H6KX 1G2EA 1FJCA 2JVRA 3G8SA 2LA4A 2VONA 3P6YC 4C4WA 3SMZA 5DM6Q 2MKCA 2BOPA 2FPHX 1X4CA 2MKHA 2MPUA 4J5OA 2QEXS 1VC0A 1WF1A 3B4MA 2KG1A 2KRBA 2LEAA 2E5GA 2DNZA 1FJ7A 2KYXA 2CPJA 2MZRA 3CC2S 1QVGR 2DGWA 1DRZA 3J7YU 1XN9A 2CQPA 3L3CA 4IOAQ 2CPDA 3H2UB 2LECA 2CPZA 3Q2TC 2CQIA 3NNHA 1OO0B 3VAIA 2AD9A 4WFBQ 1K73T 1OIAA 2OSQA 1SJQA 2RT3A 2M8DB 1HL6A 4CIOA 1D8ZA 1Q81T 1ZZNA 4YOEA 1X5SA 3N9UC 2JVOA 4WCEQ 1KOHA 1VBXA 1JMTA 2LXIA 2M4MA 5ITHA 2FC9A 2PEHA 1PGZA 2UP1A 3PIPQ 5EN1A 3P3DA 4Y0FA 2MKKA 2RRAA 1N8RT 2CPIA 2G0CA 1X4DA 2M7SA 2ZJRQ 3NNCA 1YJWS 3CC7S 1WI8A 3D2WA 2RS8A 1OWXA 2D3OR 3CCSS 2LKZA 1X5TA 2L9WA 4LIRA 3MD1A 5DDOC 4BS2A 2BZ2A 2KM8C 2SXLA 3UD4P 3U1LA 2F9DA 3B4DA 1NU4A 2XNQA 2DNPA 4WFAQ 3R27A 2CQ3A 5JVGQ 3K0JA 2AYMA 3JB9k 1WHXA 1M5KC 2DNGA 3NNAA 3VALA 3EGNA 2DIVA 3UD3P 1RK8A 2CPHA 1X4AA 3R1LA 1FNXH 1WWHA 1R8HA 3P5TL 3VAJA 3NS5A 3CPWR 5CYJA 5CA5A 2DNLA 3RW6A 2M0GB 2QFJA 1WHYA 2JX2A 2X1GA 4YB1P 2DB1A 3CCJS 2HZCA 2HGNA 2J0SD 3VAFA 2X1FA 4PR6A 3S7RA 1SJRA 2VOPA 3US5A 1YWXA 2VOOA 1JJHA 2CQ0A 2OIHA 4FXWA 2AYGA 3CTRA 2WBRA 1YTYA 3UWTA 1ZH5A 1UW4A 4IUFA 3UE2A 3BO3A 1U1KA 1U1LA 1P27B 3S6EA 2DHGA 2M2BA 5LSOA 1W2BR 2F3JA 2CQCA 2HGLA 2KVIA 2MZTA 4TLQA 1U6FA 1WG5A 2LA6A 3TO8A 3S8SA 3CCMS 2XNRA 3Q2SC 3TYTA 2N3OA 3FEYB 1M5PC 1WG4A 5LXRA 2M88A 1IQTA 2DHAA 2O3DA 2U2FA 3CC4S 2MSTA 1S79A 2M70A 5IM0A 2Q79A 2DH9A 4IO9Q 2MJNA 1X4HA 2CQHA 3ULHA 2L08A 2LEBA 2MZJA 2HYIB 2DNRA 1X5OA 4CH1A 2KFYA 1DHMA 5GAGU 2CJKA 2KN4A 3HI9A 2CPYA 2N82B 1A7GE 1QM9A 2MY7A 4OZ1A 3EGZA 3UCZP 3P49B 2F9JA 3G4SS 2KI2A 3CULA 4IOCQ 1WELA 2E5JA 3MUMP 2MQNA 4ERDA 1VC6A 2MJUA 1JJ2R 4TU8A 2NLWA 3MDFA 4CQ1A 1N88A 1M1KT 1FO1A 2EVZA 3UCUP 2DNKA 1WI6A 4ZKAA 1H2VZ 2KT5A 4C7QA 3TP2A 3CCRS 2YWKA 2CPFA 1UFWA 4CH0S 2DITA 2G1DA 2MZSA 1X4GA 1U1RA 1BY9A 2N3LA 4WF9Q 1DBDA 2CPXA 1KOOA 2LXUA 1VC5A 2E5IA 4F25A 3CCUS 2EK1A 2HVZA 2KXFA 1KC8T 3MUTP 2DO0A 1WTBA 1K8AT 2VODA 5DDRC 4YUDA 1VQLS 1D9AA 1L3KA 5DDPC 1YJ9S 2JWNA 1VQNS 3SXLA 2G4BA 2KU7A 2GO9A 1NJIT 3BO2A 1FXLA 2DGXA 1YHQS 5H1SV 3DXBA 2RU3A 5IM0B 3MXHP 1VQMS
chains in the Genus database with same CATH superfamily
4PCQA 3ELHA 4M5KA 3T1YJ 2RNEA 5AXNA 2E66A 4DV0F 2HS0A 3Q89A 1Y0HA 3VAKA 3GMGA 3AD7C 2WHOA 3QGPA 4WP9A 4ZLJA 3RR8A 5HBMA 3CJ8A 3W1YC 3W65A 5H9FJ 2WOMA 2NSBA 1RA6A 3J7YI 1CULA 2MY8A 1S0MA 2GHPA 4NLGA 2P6SA 3UDVA 4KV8A 2AYEA 3LGNA 3W2WA 1V5VA 2CQBA 5A2QY 4I69A 2D3UA 4CLLA 2IDLA 3MR6A 3OTCA 4X4RA 4I7FA 3CIMA 1R8PA 3ILLA 4XAKA 5HVFA 4KGXB 5JJBA 3OHAA 2HMIB 1SC6A 1T9VA 4QIEA 2LQJA 1A9NB 2UUWA 2PMWA 5L39A 5ETOA 1HYSA 5HROA 3EVWA 3UNGC 3DOMA 3BR9A 4LF5F 1B0VA 3C19A 1KKHA 4DPYA 3OFGA 4ZVEA 4Z2XA 4MIWA 1Z1ZA 1XERA 1FNOA 4PG5A 1Q8LA 1N34J 1T9WA 3IMQJ 1X5PA 3PO5A 1RTZA 4F2SA 4HL9A 2IC3A 2AHOB 5KFTA 1Q86T 2F40A 4N56A 3Q86A 4DV7F 3LPEA 4RX6A 4C8LA 3CW2C 5D15A 3RBZA 3M6VA 2FLPA 2X1BA 2OPRB 2JHEA 2FTRA 2BKPA 1LWXA 3GWCA 3MMAA 2ADBA 2M3DA 3TAMA 3Q8RB 1ZTWA 4FVMA 3UFCX 1BWEA 4F4XA 2MKIA 2ASDA 2LYVA 2OPQA 3MAAB 3LALA 3WDOA 3ISNC 2R8IA 4RJVA 1VFJA 1TL1B 1NB2A 2IM3A 2XMWA 4LRCA 4C0BA 3GCWP 2C2ZB 5AE3A 5F3TA 1GFWB 3KHRA 2C3MA 2MPUA 4P2XA 1YQHA 3RZAA 3VV2B 5LMUF 1C4AA 1TP7A 3M1VB 1S4FA 3IBFB 5L46A 4LFCJ 3MMCB 1YBUA 3CC2S 1ZBTA 3RRHA 5K8PA 4QWEA 5AXLA 1T9UA 3I32A 1B70B 4C6AA 3W61A 5ETVA 3RRGA 4DSEA 3KJNB 4DXLA 4UUWA 1KOHA 1HNVB 2OMLA 1Q5YA 4OZJA 3G82A 4A8QA 3CJSA 3LP2B 1IBCB 4B3RJ 2CJBA 4BWMA 3LP0B 3JTPA 4WK1A 4DL6A 3UD4P 3DYAB 3QGIA 2COLA 1A6LA 3B4DA 4QYZJ 2Z57B 2Y0SD 1VK3A 5ETSA 1K47A 4U95A 2R8KA 5A8WB 4MKBA 1J5OA 4G1PA 3I96A 1RAFB 3DDKA 2WVDA 4AUKA 4NLDA 4HACA 1VJWA 3R2CJ 2GNKA 1S1XB 3VZHA 2F8HA 1JKHA 2MTLA 1C2PA 1RJJA 1F1BB 4U96A 3DU6A 3T5LA 2RUSA 3DLGB 2AGQA 5AXMA 3G6XA 2F3JA 3BR8A 3CJ4A 2HHWA 3IXQA 1FKPA 3JSYA 1SH0A 2UU9J 2F8EX 2U2FA 2B56A 2CNLB 2FD2A 4JI4F 3DLEB 1XQIA 1FTRA 1T0TV 3QT5A 4PQUB 3KLIB 5D0EA 2KZMA 4ZJQA 2ABYA 2F9JA 2GW8A 2KI2A 5J2PA 1M1KT 4L76A 4IFYB 1RP5A 1VISA 2CZ9A 3SCLE 4FPRA 5T41A 2BYCA 1S59A 5F8JA 2R8HA 4CNZA 4WXOA 2QN6B 3BGFA 3GR0A 3Q0AA 4DZDA 1S6QB 4LJMA 2BVZA 2AQ4A 4YB5A 3EDRB 5IWAF 2I8EA 4QIVA 3C2PA 1MWZA 2R9LA 4F7VA 3ISZA 2P5VA 1QDUB 3VCDA 3HXMA 5J2NA 3GSIA 2EG2A 2NYIA 2R2TA 1YJUA 3GQCA 3I87A 1S6PA 4B9SA 4JV1A 2F4VJ 1X9WA 5KFRA 2C3PA 5T7LB 3JSMB 4D3GA 2DCLA 2BM1A 1YKWA 1O6XA 1RTDB 3MM6A 2AJFE 2KDOA 2OEKA 3R7SB 1VQKS 5K8NA 1YG0A 4O0IA 4EFAC 4ZPDA 4A8XA 2HLTA 5HP1A 2PA8D 3BSOA 4OHYA 1KLNA 2B3TB 2QYGA 2F63A 3PR5B 1XBWA 3ZZYA 1LWEB 2FC8A 2BE2A 4B9LA 4QU6A 1ULRA 2ZHAA 3OVBA 2DYAA 2NPFA 2B0GA 1PYTA 4ZVFA 5GAHU 5FJ4A 3BN4A 2IMWP 2RIJA 2M9KA 4CT9A 4CLSA 5ETMA 2O67A 1LW2A 3RTVA 3HFKA 1H2TZ 1Y11A 4NYOA 4UQTA 4BC7A 1RWKB 2OEMA 1T05A 4CWBA 4X4VA 5MAOA 1FFGB 3EDQB 5ETRA 3SDEA 3UNYA 3ZTQA 4X2BA 3U1NA 4DQPA 1XC9A 5LXYA 2XGPA 4CLTA 1VYAA 2QRRA 3ETOA 3BZQA 3HHNB 4R5PA 2W7PA 3RG6A 5CYMB 1N34F 3M2RB 3P45B 3VAGA 5GAEU 4I6WA 3BREA 1Z2LA 3KXDA 4EMDA 4Q0BA 5KG2A 5I42A 2X3DA 3R1HA 2B6AA 4LBIA 5GMKa 2XS5A 1C0TB 2Z2MA 2VICA 3DRSB 2NUUG 3UR3C 2W8LA 1PYOB 1SC1B 2GVZA 4HHJA 4DWIA 1P8GA 4ZPVR 1FJCA 3PACA 2FJVA 4CO1A 2VC0A 4NLQA 2QMXA 1KEKA 2QEXS 3OR1A 4GC6A 1GNKA 2FVPA 1YJ7A 3WIVA 1IKVB 2QMWA 2ILYA 2DGWA 1YBTA 1N36J 4EU0A 4LSNB 2ZHBA 1TKZB 2AD9A 3PEJA 2F4FA 4QWAA 4I64A 4DFPA 2MLYA 2YNFB 2X3GA 3V4IA 2V9KA 1NKCA 1C4CA 4RU9A 2FC9A 3Q24A 2J9CA 4ECTA 1PGZA 1NKBA 3UDEA 4K7QA 2IA6A 3JQMA 4USVA 3AA9A 1X4DA 5CD4A 3CC7S 2RD5C 2D3OR 3H4BA 2ROPA 2YNHA 1KQGB 3SSSA 5KFEA 5KTQA 2NSCA 3K8VA 4YHHF 1XNQJ 5HLFB 1RACB 4DL7A 2AP6A 3HHKA 3EGNA 1BQMA 1HNIA 4E98A 1RYSA 2ZVIA 4L74A 2DVIA 5CYJA 1TQLA 1IKYA 4K4WA 1FJGF 3W63A 2HGNA 1J27A 1DTTB 4NLOA 4FXWA 1WC1A 3N6NA 4ID8A 1H74A 4Y2MA 2H5EA 3M8ZA 4IR9A 1UW4A 3OV7A 2VF3A 2FVCA 1W26A 4EZ9A 3I4PA 4WZMA 2L9NA 1SH2A 2RSQA 2P9CA 4Q7AA 2VQFF 4MYTA 3PW0A 2PFDA 4UZCA 1XMBA 4WFZA 2DR7A 1DLOB 3ULHA 4DFKA 2L08A 4P52A 2HPUA 4CH1A 3KUHA 1LXJA 4RW6A 5B0EA 2RAQA 2CPYA 3BF4A 2H4YB 1RHKB 3P49B 1AW0A 2XYGB 4IOCQ 1WELA 2C3UA 4LFBJ 4GVBB 1S1TB 4NXNF 1WI6A 5LL6d 3IC1A 1H2VZ 5KFXA 2HW3A 1DBDA 1KC8T 2E5IA 2VQEF 3CGIA 5GAEI 1L3KA 1UA1A 4CNYA 4MKAA 3SXLA 3Q22A 4DR2J 4I2PA 3VWSA 4OLOA 2DGXA 3MEGA 5AE2A 2RU3A 4ALZA 5K9FA 1VQMS 3MXHP 2D41A 4ZPCA 3UD5A 3RB0A 4K2XA 4ID5B 2LMIA 1W25A 2YKNA 1FWPA 2RDIA 3F56A 1FK9A 2DGVA 4C3KA 2XMUA 2HHUA 1HI0P 4PPZA 3MOJB 1UMJA 5DM7Q 3TAPA 5F41A 1B3TA 3KK3A 2UVWA 1WSRA 2KM8B 4ZJLA 3OXLA 1MG7A 3CJ5A 2ZJQQ 1ZM2A 4ZVGA 1R3NA 2RDJA 4KGKA 3Q8SB 4Q43A 2LCWA 4DL3A 1CJUB 1RI7A 2MGZB 3SQGB 2YH1A 3DRPB 1F2HA 3V6DB 5GMEA 4JYAJ 4A4JA 2ERRA 5BYSA 3H40A 5HMYA 4P71A 4AL6A 2W9AA 2HHHJ 1NSQA 2ACMA 4RO0A 4HI1A 2QMUB 4N77A 1RTHA 3K5LA 2GX8A 3IRXA 1W2IA 2CG4A 1TFWA 4DR3J 1UVLA 2M52A 1TV6B 1FFSB 2E5LJ 2V6AA 3I0SA 3KHHA 1S9EA 4PG6A 4U8VA 3OLAA 4U6PA 2N7CA 2VBYA 3CCZA 1C1CA 2HAIA 4CZCA 2J76E 1D9FA 3R9LA 5FIIA 1FVSA 1RAAB 2V69A 4QW9A 4JOUA 5CZXA 1FI4A 3ZNUA 4WXWA 2KXHA 1IKWA 1TL7A 1D0EA 1KLMB 4P2SA 1E6YB 4M5JA 1V9OA 2DNMA 4LF6F 3ZTRA 3W64A 3GIMA 3KG1A 2NXJA 1Z2ZA 4XPCA 3D1HA 2RQCA 1T03A 3WC2A 3T5JA 4B3TJ 4IG0A 3H5YA 2B7CB 2DH7A 2WK4A 3BDEA 3GYGA 2QA4S 5DG9A 3LGMA 4IH7A 4ZP8A 1U2FA 2KXNB 3DM2A 1RT5A 5HMWA 1QSSA 1RKJA 4N5SA 2YPYA 1VI7A 4B3MJ 2RQKA 3Q8VA 4PXBA 1VLYA 3I9ZA 2CPDA 2QTWA 3KJVB 4MTPA 2DR5A 2HNDB 3N9UC 1JMTA 1S6OA 1XJWB 2UVRA 3V6HA 2BV3A 2MKYA 4GVLA 3KMQA 3FQKA 4CT8A 4N76A 3UVJB 1UWBA 3TZXA 2H9ZA 2ZH1A 2EFPA 1QAIA 1KTVA 3ZZPA 4OMFG 2QA4G 5DQGA 3D2WA 1FKOB 1TU0B 1J5EF 1X5TA 3BBCA 3GIRA 2Y1JA 2JJ4D 3GG1A 2HVIA 2HFVA 3KLHA 1KHWA 5DGAA 1WHXA 3NNAA 3VALA 2DIVA 2QZ8A 1QE1A 3K5PA 3WIUA 5D4PA 1HNXJ 4GKJJ 2QV6A 4LR9A 3RW6A 4DV2F 2XZDB 3M9NB 2J0SD 2C1EB 5KG5A 1SJRA 2LFVA 1JLCB 2WB4A 3HMJG 3QIPA 5GAGI 4A48A 3EICA 1XR5A 3GFZA 5ETTA 2DEJA 3DMJA 3DGPA 5C42A 3KK1B 2VD3A 2B4PA 4LSLB 4F0KA 3AQOA 1M5HA 3OL8A 3AD9C 2ZH7A 3EGVA 4I4BA 3TQEA 3MMBA 1Y3JA 1VS3A 2MSTA 1RT1A 1UFKA 2CQHA 2MZJA 4FKXA 3D4JA 1B0PA 2HRTA 2IY5B 3KNAA 2N82B 5KT4A 2NXUA 5D4OA 1WOSA 3RAMA 4R8UA 4X4UA 4ANEA 2KT3A 1LWFA 2MJUA 4XTTA 5HBMB 5I3UA 4QR2A 1NK9A 2Q1LA 3FNNA 1TKXA 2WOMB 2VC1A 3N0VA 4NLYA 1BY9A 2JLGA 4JV2A 2W4CA 2HQCA 5KFHA 4DUZF 3QWUA 1TMJA 3EM1A 4KV8B 4YUDA 3D5MA 2IYGA 1HWUA 1VQNS 2JWNA 3GCXP 3W2WB 5H1SV 1RAHB 4ES2A 1BQXA 3E01B 4EYIB 3AJDA 2ZOMA 5C7PA 4ZVOB 4OI6A 2F5GA 4CM2A 2V0NA 4OZ0A 3CCTA 2KH9A 1JLGA 4I7FB 4LRDA 2XY6A 4DSFA 1YITS 4OX9F 2B43A 3DRYA 3DOLA 1XWLA 1ZPWX 1R6VA 4C11A 4QIFA 3D67A 4K4UA 2VV5A 1XK8A 4F4WA 1JNRB 2C42A 1RU1A 5HROB 4YMEA 3DOMB 3HHLA 5DLGA 1FRMA 4YQWA 3LAKA 1SV5A 5E3CA 4DU8A 1DZ5A 4YFUA 2AX0A 3EX7B 2BX6A 4OYOA 3HP6A 2FGOA 4ILMA 2IC3B 4J90A 3MWBA 3RW7A 4CP5A 2MYFA 1SH3A 2JC0A 2VDIA 3EXYA 2D3O1 4JI6J 2KG0A 1RISA 4AXIA 3G8TA 4LF2A 2W25A 1RAGB 3TEGA 1VQPS 2RU9A 2XLKA 4CO5A 1TAUA 4J9NA 1EP4A 1DQAA 2CQDA 4DR5J 4KE5A 5D78A 3M2UA 3FCVA 2YQ1A 3OXFA 5HO4A 2OPQB 2GJFA 1KHVA 1OMSA 4K4YA 1HW8A 4Y2IA 2DGSA 2PC6A 1VQ9S 3J80U 2BA9A 1A0OB 3KUGA 2E9TA 1LK7A 2WRMA 4QR1A 1RWVB 2C3OA 5KFQA 4IQMA 5K8MA 2CDQA 1U02A 4QU7A 4JUZA 2IAJA 3M9OB 4DCPB 4JV5F 1OYEA 4NLUA 1KWMA 1AUSL 4CO2A 3KUEA 2FYXA 3G82B 3NGDA 2E1AA 2DD8S 3R5DA 5GMDA 4F36A 2EC0A 5KG4A 4ZVPB 4KKOB 1RAIB 2LA4A 2QG9B 2BOPA 1X4CA 2VJUA 1CQNA 3P4UB 4DV6F 1AFJA 4RPFA 2J7UA 4RBVA 2W9CA 1IJEB 5F8HA 1J5OB 3Q2TC 3HJFA 2A10A 4HACB 1P1LA 1I6JA 1JKHB 5CQGA 1RE1B 2HIYA 1HNZJ 2FHKA 2YKPA 3DGVA 3PHTA 3D6HB 4ED8A 2RS8A 2W9BA 1H73A 3PJXA 1U0HA 3GFXA 5DRKA 4H4MB 1FKPB 4OI1A 4E8UA 2OEJA 1RTJB 2HZAA 3CNQP 7FDRA 4F67A 1RK8A 4HHUA 1HBNA 1X4AA 2NXCA 1EB0A 4CCHA 4C8MA 3QMQA 3IA0A 3CPWR 2AKWB 1HHTP 2XMVA 3RRKA 3M32A 4N7TA 3HKZD 4OIXA 3JSBA 4M8LA 3FCWA 8ATCB 2V8VA 5G0RA 3DOKA 1NH7A 2UXCJ 1U47A 2W2MP 4PG7A 2M2BA 2DXEA 3A13A 4I67A 2H5JB 2MZTA 3OUYA 3C66A 4RR5A 1KTQA 2DHAA 3ILJA 1RT2A 5IM0A 5A2QU 3H7HB 4ED7A 3BKFA 2XMKA 4O3NA 3PRVA 4OI4A 4WFXA 2KJWA 2QFIA 4OYWA 4OI0A 5B0FA 3KDOA 4MK7A 3OTDA 5EX3A 1VHFA 1DURA 5J2NB 3UW1A 2NLWA 2HFNA 4LF4F 1S6PB 3POTA 3N5BA 2KT5A 2HVEA 3PHEA 1SKSA 2B51A 4WYLA 3CCUS 5CCMA 5DDRC 3MM6B 1WC4A 1N5VA 1AROP 2K7JA 2KO1A 2PMZD 1X4EA 4KHPF 2CADA 1NJWA 1QUVA 3W66A 5HP1B 3K5OA 3PCOB 3MCOA 3CF5Q 3CD7A 1OPIA 3HD1A 3BJYA 3GG0A 2HMIA 4X84A 3CSKA 1FVQA 3THTA 3K59A 1WC0A 4F50A 3QRPA 1QUPA 4TU7A 3N6LA 4M94A 2R2SA 1Q79A 2KRRA 4EBDA 1NJXA 1H72C 2HHPA 1LW2B 1TL5A 4IOBA 3GZ7A 4RUBA 3FCHA 4FNHA 1QAXA 1N0UA 4NYZA 1T05B 2XMMA 1QTNB 3SDEB 3L7PA 2HQGA 4Q2LA 1NSPA 3MUVP 2QE5A 1RKIA 2IRXA 1NK7A 1K44A 1REGX 1NK5A 3CMAS 3T41A 4FF3A 1ELOA 2ZEJA 4R5PB 2LDYA 2ZC3A 2G9OA 1REVB 2JEFA 4K59A 2IHR1 4UY8T 2K06A 2A6OA 1I51B 3QO9B 5LT5A 4Q0BB 5IQ6A 5I42B 4NMLA 1MROB 2B6AB 4KT0C 2C2OB 4KJIA 3NGKA 1TL1A 1RAOA 2GVZB 1YJVA 5KFJA 2GHWA 1XMOJ 4ZP6A 4J9LA 1FF2A 4YB7A 2DXFA 1NM2A 1BQNA 2AJQA 2UUCJ 4X64F 3DLLQ 2W01A 4HHHA 1FA0A 1R0BG 4P6QA 3PRDA 2FJBB 3DKDA 2MQQA 1WDDA 4RKUC 4Q44A 1HNVA 3TZWA 3C15A 1RLDA 4ECZA 4KHRA 2YWWA 1WHWA 4LR8A 4DCJB 4RW9A 1CPZA 3MHYA 1Q1KA 1VR6A 3LP2A 2XCAA 4Y28C 5ETNA 3O6QA 3LP0A 2YNHB 1ZA2B 3OL9A 4ZPAA 1NPKA 4P2FA 2HKEA 1ZAVA 3B4MA 4AL5A 4USJC 1SKUB 1L3TA 3OTOF 4NCAA 1BQMB 1HNIB 2CYYA 3IG1A 5IV3A 5DO2A 5D0RA 5DZ6A 1SKRA 3K7RA 3QATA 2RT3A 5H9EK 1S1XA 1D8ZA 4OZ3A 1XEZA 1VBXA 4RBUA 3CDEA 2DY1A 3H5UA 4DOZA 4GKKF 3DLGA 5D8HB 3KDNA 3TA1A 3NGUA 4CLZA 3GIKA 3LF0A 1KP6A 3MD1A 2BZ2A 3HSJA 2P9EA 4ER8A 1FEEA 3GTYX 4DV3J 2QLXA 1R89A 3U27A 2VDHA 4FXDA 4ES3A 1SKWA 1YK9A 1LK5A 4Z7CA 2G0JA 4PQUA 3PYFA 2GQCA 3PX4A 3KTQA 1UJ4A 3H98A 3US5A 3D9BA 2CQ0A 2Z56B 1MWQA 5C2GA 3CJQA 1RT7A 1ZH5A 2VH7A 2AW0A 2XY7A 2BQUA 3F44A 1T9YA 1RYRA 4JI7J 1TKDA 3AB4B 3VHQA 3PNIA 1FD2A 4I2PB 2W8KA 2AF6A 3CC4S 3MEGB 3ZZUA 5SZTA 1R6YA 2Q79A 4KSEB 2W2OP 5C25A 2ZBPA 1DQ8A 4IKAA 4BCAA 1D1UA 2LQBA 1U4BA 2YKNB 5L8RC 2R7XA 1FK9B 3M8RA 1N56A 5J2MA 2OP5A 2E5JA 1RHMB 1JJ2R 4EK2A 2ZH5A 3MR7A 5HATA 4AL7A 3KK3B 3FRYA 1RWWB 1RHQB 3O3LA 2DITA 4ATNA 1XMQJ 2HFUA 3J7Z5 1VRTA 2AJ2A 2CPXA 3JSMA 2KXFA 3NXZA 3DLKB 2VODA 2HZVA 3K8WA 1N4LA 2GO9A 4DUYF 3RJMB 2R7VA 2XHCA 2YWGA 2HHXA 1HBMA 5GADU 2ZFHA 4DR4F 2DEIA 4UQGA 4PXDA 4QIGA 3G96A 3CMQA 2RF2B 3UO0A 5DDQC 4DPTA 1RTHB 2IIHA 2DNYA 3IRXB 2OTJS 2RDDA 3TANA 1OY6A 3OL6A 1K1QA 4PXEA 4EEYA 3FBFA 5KT3A 3SFUA 2OJ3A 4E2FB 3I0SB 2BMBA 4I2QA 2FHOB 3CCES 5F8MA 1BXNA 4N47A 1S9EB 1HHQA 2LXFA 4N8OA 4TQSA 3AB2B 3JAMY 3NWRA 1KD1T 4DQQA 1NPPA 1RBOB 1KBRA 1B7FA 3LTOA 4PZVA 1X31C 2HGMA 2QT7A 3RB4A 5E33A 3BYPA 1I94F 3J81j 1IBKF 1VRUA 4FYXB 4ZHRB 4CI0B 3E2EA 2DNOA 3MZIA 1WKKA 1T03B 1HARA 3TVKA 4IG0B 3QT8A 1HQUA 2DY9A 4HT7A 3T6JA 1VQ8S 3PFOA 3MGJA 5KG7A 3BS9A 3T1HJ 4QYRA 1FE0A 2XS2A 3DM2B 1RT5B 2DH8A 2IDEA 1K0VA 2OFGX 4BC9A 2YQ0A 1LFWA 3PYEA 4Y2KA 4DR7F 3B78A 1XNRF 4ETZA 1Y4ZB 3R5GA 5CH7B 4A8MP 4JI3J 3BGOP 4DSJA 3H2LA 3C6UB 5A6WA 5D6GA 4ZCKA 3NCRA 4DL4A 3K17A 2XGQA 2I1RA 2KYZA 3HSZA 4OHXA 2O1PA 4A46A 3DRRA 4Q2MA 4PRFA 1TK0A 1WEXA 1UWBB 1URRA 1O0PA 2Z8QA 1T3NA 2LEPA 3JSRA 1IR0A 4OZ5A 3TVZA 2ZM6J 5IXUA 4LF8F 3KLHB 3M6XA 2J9EA 1Y7PA 5EHHA 4PYAA 1QE1B 2X51A 3IFEA 2CQIA 1NDKA 4Z37A 1CJTB 2M8DB 4CIOA 1ZZNA 2KKHA 1EQMA 2R7UA 2JVOA 5EDWA 1TKTA 3OT9A 4EWTA 2LXIA 1HNWF 2FGCA 2RMLA 3HLUA 2GMJA 2D74B 3QIPB 4X66F 1JB0C 1D3WA 3NNCA 2CVEA 3BH7B 4DV1J 1OWXA 5C42B 2J6SA 4DV0J 2ZDPA 2CZVC 2BJ7A 4DSIA 3GV7B 4KH1B 2VA3A 1L3VA 4URSA 1FKAF 2AZ3A 3MMBB 2DNGA 1RT1B 4F2RA 1TUVA 1JLEA 3BGRA 2HQDA 1HQEA 3AXKA 2AU0A 3BQ0A 1MW7A 2DB1A 2R7WA 3S7RA 1VK8A 4QWBA 3KHGA 4R8UB 2G1HA 2CG8A 1LWFB 4GVBA 5I3UB 5KFAA 4OYPA 1TKXB 4HKQA 5A0YA 3GV5B 1SC4B 4G6VB 1VGYA 3ZTOA 2PDAA 1ZAWA 2WVEA 3C3LA 4NCGA 3VQSA 4P74A 3KLVA 2ZH9A 4QJVA 4RNHA 2VKRA 1KVKA 4PWUA 4ETXA 1RHRB 1EIYB 4AE5A 1SQFA 4LF5J 3GIIA 4ID5A 3H42A 2CJKA 4OHVA 1HBOA 4CYUB 2OAUA 2CJYB 1QM9A 4WU3A 2MY7A 5T14A 4ZLPA 3DHWC 4C11B 2ZKUA 4YR0A 3A8JA 1FRIA 3VGTA 3SIPB 1H7WA 2FHMA 2CPFA 3BBBA 2BJEA 4OQJA 3SSRA 3HHLB 4DV7J 1VC5A 3ZTPA 4CO4A 1AT1B 4NA1A 2H51B 2J6UA 3BO2A 3DRPA 1AUDA 5EWEA 3V6DA 2HFSA 1UWAA 2V34A 1SUQA 2GQQA 1HQ2A 4LF1A 1GH8A 1RUSA 2HHTA 5B0DA 3M30B 4KIAA 4OL8A 2PO4A 3X1LB 3LAMA 1IBMF 3CB4A 3GYNA 3IWNC 5F3ZA 3MM9A 2VBZA 1EP4B 2K3KA 5BYRA 4AXJA 1DTQA 1RTIA 4ELTA 3M2UB 5IFMA 3MAQA 3D54A 4C8ZA 2DO4A 1H0HB 1U1PA 2PSZA 2P9GA 4FYDA 1YDLA 2OTLS 2WTFA 2I9SA 1CLFA 2D1CA 2AV5A 4NZ6A 4F26A 4M5DA 4NLRA 2QC3A 4ZCLA 4O44A 1ACMB 2MQLA 2PEBA 2FY1A 3V6KA 1VCTA 3ILOA 1KLMA 3NS6A 2LQ5A 2YWHA 1PIEA 1X9MA 4WTYA 2CNKB 2O01C 1JXEA 4P10A 3NOGA 1P6TA 4C8OA 4ZA1A 5B0BA 2CKWA 2BDPA 2BW2A 2CFXA 3EPGA 3ITHB 5THWA 4HDGA 1VQYA 1JJ4A 3V4MA 4G3IA 3GP9A 2MKSA 2JLEA 4ES1A 2Q3PA 2VA2A 1N33F 4O3PA 1WNEA 3OPKA 3J80Y 1YZ7A 3UR0A 1S9GB 3FSYA 2HFZA 1M5SA 2UXBF 1B99A 3A4TA 2ROGA 3MR3A 4YS2A 2JNJA 4JI8F 2K1RA 3LO3A 4ED3A 2A3JA 3U1MA 3Q8YA 3MF5A 2RQ4A 1AXQA 1WORA 1M5OC 3T6BA 2HNDA 5KFGA 2L9DA 2IVYA 5LJ3Y 4IFVB 4ED1A 4RUAA 1U1OA 2UV8G 5HQMA 1Y10A 4D3HA 3MM7B 4JI2F 5DQIA 4JI4J 4ANDA 1U48A 2HVDA 5J1PA 3G9CA 2UUBF 2W9BB 2XMJA 1BGXT 1G2EA 3P6YC 2YNGB 3B6BA 5AJ3F 3PO4A 2QO3A 2ZNYA 1NH8A 4O0NA 4LBPA 2HNZB 3UI3A 5IC4B 2DNZA 1DRZA 4DU7A 4B9UA 3QRQA 2J0WA 1OIAA 2HBZB 2VJVA 3M32B 2V2VA 3HVTA 3QZ8A 2BABA 4G65A 4B9MA 3WQPA 2M4MA 1JLCA 5EWGA 2PEHA 1U8SA 5G0RB 2UP1A 2PN6A 3DOKB 5EWFA 4F0HA 4LRFA 4LF7J 3CJ3A 4H4OA 2M7SA 5IWAJ 2EXUA 2XMAA 4EO6A 3OUYB 5DDOC 2IMOA 4F4YA 2F9DA 2XNQA 1MMNA 2DNPA 3OTBA 3E3XA 4XIUA 3Q8QB 3JB9k 1RT2B 1NDLA 3UD3P 1UPMB 4GC7A 1XIQA 5ETPA 1JK9B 3R1LA 2KL8A 1S1VA 3NS5A 4FVCA 1KFSA 4J9QA 2M0GB 4DV1F 4FF1A 3CCJS 3NL0A 3NY0A 2Q6CA 2VU5A 3TARA 4X62F 3NGRA 1OQ3A 2E7XA 3AODA 3ISND 6AT1B 3POTB 2QJ3A 4TLQA 2V2KA 4YN3B 4YDDB 1VIXA 2VL1A 3E01A 5B0CA 1GAOA 5D4LA 1S99A 2BJ1A 1ZPVA 3G8QA 1JWWA 1OQ6A 2HHSA 2LQ9A 2FVSA 3EWGA 3OSPA 3N6MA 1PJ5A 4OZ1A 3G4SS 3CULA 1S10A 1ITPA 1Q78A 3RU0A 4J9PA 3IO1A 3UCUP 1RWXB 1U6ZA 4IR1A 4C7QA 4LF9F 3TP2A 3UN5A 3AAWB 4B08A 1KRPA 3ZTSA 2IA0A 4ZVSB 4MKVA 1L3UA 2JLFA 3OFFA 4NLVA 1VQLS 1NNDA 1RT3B 3CCWA 2BQ3A 3DXBA 2KT2A 2HFOA 3EZUA 5HSPA 1SJFA 2EBEA 4L3NA 2XZWA 1UVJA 4OJGA 1WG1A 2MHNA 4EGLA 3A3NB 4XO0A 1UP1A 3JXOA 2F65A 3KG0A 2P2CB 2OD6A 4Q8FA 4P7VA 3VVUA 2I38A 2BKNA 3KLGA 5KG6A 1KQFB 2EFGA 1F9HA 5K5MA 1ZZFA 3WHIA 3CDBA 4C3LA 3A12A 1DARA 1MU2B 2V5HG 5AT1B 1CSJA 4J9KA 2W1BA 1JNZB 3IP0A 1N5SA 5E3RA 5E7OB 3NAIA 3FEXB 5ADZA 1F3FA 1UZDA 4FXVA 1IKXA 2XSFA 3EUNA 4LQ9A 1U6BA 1BQNB 2ATCB 3C6TB 5KG1A 2AGPA 1UCNA 3G6ES 3QJPA 5F8GA 3IBCB 1CJKA 4Q8EA 3C14A 3BPDA 1ZM3A 4DSLA 3EXCX 4YY3F 4ED2A 4YHHJ 3C15B 3ENQA 2CJ9A 2PIIA 1EZZB 4B17A 5KFFA 4RW9B 4ZN3A 5DETA 1UEUA 2QIFA 2YTCA 4UTGA 4KB7A 2DNNA 4O3SA 4RUCA 1FJGJ 3IRWP 4KKOA 1S72S 3PTWA 1UKUA 4TYBA 3PW4A 3FDSA 4WJBA 2YY3A 3H90A 4ZCMA 4URGA 2CQ1A 3IG1B 2E7VA 4MAKA 3KLFB 2OMOA 4WPAA 4DLGA 4IG3B 4OX7A 1ZM4A 2VQFJ 3SCKE 2YKMA 3KJFB 5DG8A 2AGOA 5KFCA 5F9LA 2MEWA 1WEYA 4B3SF 2ASYA 4ELUA 1T9TA 2HWTA 4CLPA 2YBVA 3EPIA 3BO4A 5F8LA 4ZP7A 2CAJA 5KT7A 4H4MA 2GQ2A 1RTJA 1RLCL 3MMJA 3HX9A 2UZAA 3C8YA 2EKYA 4HT5A 4J9MA 4NZ0A 4NXNJ 1UJ6A 2OKQA 5CCLA 2OO4A 5H9EJ 3UN2A 1XN9A 2CQPA 2AJ1A 3H2UB 2CVIA 4C48A 4DPXA 4YB6A 3P8BB 2J9DA 3PEHA 3A8IA 4KPYA 2QLFB 4PPDA 4YOEA 5KG0A 2VQEJ 1N0VC 2E1MC 1FWLA 1IQZA 3R8YA 2DRBA 5AXKA 5KFIA 1FX4A 1RT7B 2XWYA 4DG1A 2B4VA 3W5YA 1NHVA 4DV4F 5F8NA 4AQYF 1X9SA 4WFAQ 3K0JA 3OVSA 3N28A 5C25B 2CPHA 4LF7F 2LQ8A 5C24B 4WIQA 4JI1F 1VIOA 2VPZB 4FN5A 4UOFA 2DNLA 1VDHA 3FVYA 1T3OA 4PR6A 5J2MB 2WBRA 3W5ZA 2VFSA 3R7BB 1U1KA 3JQKA 2DHGA 3CD5A 4P73A 2W4DA 2KVIA 5K20B 1VRTB 3K2YA 3R5BA 2XNRA 3BPSP 3FBBA 4HTJA 4I0WA 2BKOA 3RYLA 3AJ1A 3GSDA 4HTIA 2DH9A 2DRAA 2A2CA 3L95X 4ZPWR 1NCLA 3DRXA 1X5OA 2GIQA 4PUOA 4C98A 3I5CA 1HBMB 4OJ3A 1FCAA 4R25A 3H20A 3LH2S 2GC8A 4ERDA 3L7OA 3L09A 4FZVA 1HI1A 2B5JA 4ZKAA 4ZJOA 3H4DA 5K8OA 3TW0A 4WF9Q 4I2QB 3MR5A 3D0IE 5IOLA 5CYQA 4RLEA 1NUEA 5LMNJ 4J9OA 1YJ9S 1SVDA 4XK8C 1T94A 2V63A 4HLBA 3HD2A 4LF6J 1F6TA 3T5KA 3MFHA 3I9V9 2V94A 3AD8C 2OFHX 3PYGA 4QQBA 3LA0A 2V50A 1D09B 3TA0A 2B4UA 1VRUB 1QTMA 3EYZA 2XLJA 1M5VC 1REVA 2ZH8A 3ZZOA 4IDKA 4KYZA 2HK2A 3MM8A 4TU9A 2FLNA 2RHSB 2EFVA 2ZDOA 1HQUB 4UT4A 1PJ7A 2UXDF 1TAQA 2QA1A 3QO9A 2MMYA 2WVFA 1NSKL 1FXDA 1MROA 3HT3A 4KY3A 4LQ3A 2ZBQA 1U8WA 4X65F 4LSZB 2A1BA 5KFOA 2HHVA 5HJXA 2IYIA 2BRLA 3DLHA 3H0PA 1UL3A 2O66A 3S01A 2K8GA 2ZWOA 4C8YA 5IT4A 4CH7A 4NEYA 5CXTA 3OTEA 4MT1A 4QWDA 3I6PA 2ZWPA 1JLQA 2PI4A 4P75A 2AJ4A 3HPOA 3PM9A 1U45A 1GXLA 2HBRB 5KFKA 1J5EJ 3LGHA 4LBHA 3DU5A 1RA7A 3TWZA 4OV6A 1NJZA 5DQHA 4FS2A 1AA1B 3HZEA 3DRRB 5ETLA 2DXDA 4USWA 4PXCA 5C5JA 1WTFA 3I4HX 4DV2J 1VBZA 4RUHA 4LFAF 1YLXA 1CVJA 2HQ3A 5FDLA 3I5BA 3TA2A 2AEFA 1GMUA 2JEJA 1WJ9A 4FF4A 3HVRA 2VBXA 4C3MA 3MPVA 4TQRA 2D3ZA 4RNMA 1IVZA 4P7TA 1FDAA 4I1TA 2RRBA 1TVRA 4CTAB 4NCBA 3K5MA 1IN0A 3AY0A 2MQPA 2XMTA 4RNNA 3N5FA 2KZZA 4KHMA 1HR0F 2DK2A 4P9SA 1Y00A 2E5HA 1TKTB 3NMAA 2XI2A 2CXEA 1R8CA 3DHXA 2HRYA 2Q6BA 1U1QA 3BSAA 3O5TB 1T95A 1Y5NB 1UTAA 2F1FA 4DEZA 4HEA9 3UQSA 2DBBA 2WZ1A 2MSSA 4WKRA 2DHXA 4MIAA 3GJSB 1U1MA 4ANCA 4DFMA 4QCLA 1H6KX 5A6PA 3MPDA 1OSCA 2VONA 4ICLB 2EWHA 2CWXA 5DM6Q 2MKCA 3LANA 1X60A 3PW5A 1SL1A 4L72B 2KRBA 5RUBA 4WKYA 2Z0GA 2VKZG 1IBLF 3AQPA 2DCUB 1JLEB 4H4KC 2ATLA 2CPZA 2OD4A 3BGRB 3HULA 3SFGA 1HQEB 4DUZJ 3MECA 2J0XA 1X5SA 2LDIA 4DS4A 2Y1LB 2FLLA 2HRUA 3W9IA 1RWUA 3QYYA 5I4MA 2VHGA 1IR1A 1L5UA 3GB0A 2Q66A 1N8RT 4DQRA 1Q53A 5A0YB 3W7BA 3CCSS 4OX9J 1UEVA 1RB0A 3RBDA 3U1LA 4IH5A 4FYWB 5HQLA 4NCGB 1LNQA 4FYVB 3R5JB 4MJKA 2HEKA 2R2RA 4CO3A 3HFZB 1JXLA 4TY9A 2QFJA 1HBOB 4K4ZA 5KFPA 2FB0A 4EBCA 4WTOB 2VOOA 2OIHA 2GVDB 1PJ6A 3CTRA 4NI2A 4I68A 2VB6A 2V9WA 2P8IA 1JQGA 2QL7B 2CIMA 3GJTB 2FZCB 1U6FA 3DLKA 2BOAA 3TYTA 3R6GB 4C2MA 1QAYA 1YRUA 4IO9Q 3JAMU 2MDAA 3CJRA 4JV0A 4KR0B 4ILLA 3KK2A 3PW2A 3MTKA 4LVNP 3MCMA 1SUQB 2KFYA 5GAGU 1ZAXA 2CJXB 4O3RA 3D66A 2RF2A 2GZOA 4K5SA 2Y1IA 4CQ1A 2PA3A 2EVZA 4LIWA 1KSPA 1U25A 4ZVRB 3MM9B 3MEDA 3QWPA 3SSQA 3QJLA 4LREA 1DTQB 4ZK7M 2FIUA 1U1RA 2YPZA 1RTIB 2LXUA 4ZCIA 2G4BA 4JV5J 1M1GA 4JI0J 2H3EB 3VZIA 4NEZA 4DS5A 1VLOA 4U8YA 5LOQA 2Z58B 3IN5A 4M5DB 2ZH3A 2XO6A 4O44B 1NK6A 4UOHA 1I1GA 4WE1A 4TYAA 5LMNF 1XTZA 1VQ7S 4ZHRA 3HHDA 2NUHA 3RBEA 4V1Ak 2MXYA 5E3PA 1YIJS 3TVYA 4DDFA 3THPA 4FYYB 1PG5B 4DV6J 3CUNA 5GVQA 2D7SA 1X8DA 4V19X 1MNEA 2OLWA 2YX1A 2UUAF 1VQ5S 2B7BB 1U26A 3MFIA 1IJFB 1P1TA 3OQ2A 2IBOA 1LWCB 2VFUA 4L3KA 2H1YA 1GX5A 2HS3A 2ALYB 1UVKA 2GIRA 1NAQA 2K1RB 3BKTA 5DG7A 3C6UA 2CQ2A 1FXRA 4JI5F 5KFZA 1BD6A 1B4SA 3KHLA 4KFBB 4O23A 1F3VA 3G2XA 4NRUA 3GONA 1IUJA 4BWJA 1MN9A 2OSRA 2ZZTA 1G4CA 3SEOA 5KFBA 3ENVA 5F9NA 1DFDA 2RQMA 4ZVQB 3ET6A 3OBIA 8AT1B 3HM9A 1VOMA 2RKIB 1HI8A 3D1OA 4KH0B 4F0MA 3IGNA 3W9JA 3H8YA 5HVHA 2DHSA 1U0SA 3JTOA 2V8PA 5J1EA 3SQOP 1R0CB 2VBWA 3R5AA 5DZ7A 4KGMA 3FJ2A 1WC3A 4OFZA 1YI2S 1CJTA 2ZD1B 4Y6IA 2C2MB 4DR1F 4NYPA 1GK8A 3HVTB 1VBYA 1Q7YT 1GMVA 4CLKA 4DX5A 2J6TA 2VFVA 4OZLA 4H4OB 3M2VA 1R8BA 1FNMA 1O5JA 2W7AA 1CQMA 5B09A 4M5NA 2JVRA 3M05A 2HQFA 1FE4A 2NXNA 5E0OA 3F73A 1YZ6A 1WF1A 2BJ3A 4U7UD 3H59A 4LF4J 3X3UA 4CLFA 2KYXA 1GMWA 3NKYA 4DR6F 4A8YA 4XPEA 4DX6A 1S1VB 4ILRA 3DNCA 4CDIA 4ENOA 5HAOA 1NHUA 1K73T 4MH8A 2I6WA 1Q81T 4WCEQ 3B8HA 3RB3A 3BDPA 3D6FB 4LRBA 5A8RB 4FDFA 5B7WA 3TI0A 4ED6A 4KHPJ 4QR0A 4C8NA 2CPIA 3AFGA 4IO1A 3QSIA 4ECUA 3TEHB 4BS2A 2KM8C 2L3MA 2V2ZA 3CEDA 2SXLA 4QBUA 1Q8KA 4Q45A 1S97A 2BQRA 1R8AA 2ZE2B 3HJVA 4Y2CA 1NU4A 1FRLA 3TNVA 4RBTA 4YEAA 2BJ8A 4JBCA 3LWMA 1HPZA 3FMBA 1P9QC 3H5SA 3P5TL 1RXOB 2FQQB 4DHVA 1VMBA 2BW7A 3EZ5A 5IT9U 4DL2A 2JX2A 2CRLA 4CYUA 2HZCA 1F60B 2OPPA 3NP5A 4WWSA 1YRXA 4F04B 4OYMA 3R3TA 2B8QA 1Y5LB 3F41A 4GRSA 1RWOB 2GFFA 3BO3A 4OHZA 3IAM9 2XWXA 4Y65A 4PQAA 5KAKA 5KOWA 2DPIA 4UY85 1DQ9A 3FEYB 1WG4A 3LUYA 4PEOA 1NK8A 2V4JA 1X4HA 3BKUA 3AOBA 4CRJA 1O8BA 4DPWA 3A8KA 2KN4A 5F8IA 3M30A 2YQ3A 4GO7X 4KGZB 3UCZP 3CDUA 1NLKL 2FDNA 3ILIA 2G13A 4CO0A 4TU8A 1N32F 3L9ZA 2G2OA 1YBAA 2GV1A 1W7WA 2R4FA 3PJWA 3KLGB 4X64J 2HSEB 4EBEA 3A8EA 4KC5A 4RW7B 3TUPA 1WKJA 1SQGA 1HIYA 2KFNA 3QGHA 1FXLA 2JH3A 4ZVUB 4PABA 1KDNA 3D6MB 4EZ6A 3NMRA 3IM8A 4BBYA 3JQJA 1IKXB 1JJCB 2XBPA 1PBUA 3AH6A 4ZDNA 2V4RA 3JTNA 5L1LA 2KFZA 3OR2A 4H54A 1Q95G 2WW8A 3RAXA 2DTJA 2VFRA 4S0MA 4IRDA 1CJKB 1HD0A 3GLJA 3C14B 2B9XA 2HLUA 1MLAA 4JI0F 2Z2YB 2QL9B 4ZIVA 2IJRA 2HS4A 1HD1A 4CLUA 4PYDA 3ITHA 5KFUA 3VTIA 1G7CB 3OTOJ 2LVWA 4DZ6A 4IQXA 1TL3B 4M5HA 3Q8PB 3LW5C 1LEOA 1ZA1B 4O4GA 3OW2R 4ED4A 5KFLA 3IS9A 5LSLA 1S9GA 3ZZRA 4DI6A 5HVGA 5CD4H 2MKJA 2UVVA 1SJ1A 3MI7X 2R7TA 2AJ0A 2HWHA 2XSJA 4GKKJ 5HI7A 3IGVA 1FX2A 2BANA 2D69A 4PKDB 1PILA 1R0AA 4DV5F 3D68A 2YWFA 2QLJB 2MZQA 1GMWD 1H2UX 3VF0B 1QLNA 5L38A 4WBFA 2I5JA 4OJ1A 2YKMB 5EX0A 4IFVA 1WACA 1H38A 1DY3A 1SCJB 3QNWB 4ZN1A 1HWKA 3VGSA 3MM7A 2M8HA 2H4WB 1BMQB 4PWDA 1GX6A 3PX6A 3A3OB 4RWWA 3AJ2A 1D8YA 1HW9A 2YNGA 1Q4RA 1RT6A 4O4RA 2W7OA 1SI9A 3KWMA 2NCKL 2HNZA 5BR8F 3E51A 2N4DA 5FD1A 2Y9HA 4ZPBA 3CO9A 3W2VB 1BHNA 1WF2A 2GCFA 4HYKA 3T1YF 2FVQA 4PAAA 1HWJA 2MQ8A 1HA1A 1QAJA 3I56S 3QGGA 4DG1B 1OSDA 2JC1A 2EEYA 4J7CA 3G8SA 3SMZA 2MKHA 2PD1A 3HHLD 1SQEA 3TR5A 2LEAA 3VGUA 3NNHA 1XR6A 5KFYA 2CZ4A 2XI3A 1FDDA 2J5AA 2FVRA 2IFXA 4DUYJ 2B9WA 1F9EB 2I0XA 3DXSX 2BBEA 2LP4A 2Y3YA 1NZ8A 4IRCA 3P3DA 4OYZA 2RRAA 4FKYA 1NSAA 4DR4J 1GXTA 3BGUA 3CJTA 5E41A 4KRWA 4LUBA 4BDPA 2WAQD 3EGWB 2R8GA 3T5HA 5JVGQ 4RZRA 4A8WA 1M5KC 3T1AA 5K14B 4X4QA 1S1UA 4FF2A 4DN0A 3M6UA 3DC2A 4PUOB 4LT6A 3SI8A 2ZUGA 3VAFA 1GT8A 1YWXA 1ZTTA 2YXLA 2FLOA 1T9XA 1UJ5A 3QQCD 1K0TA 3MEEA 3S1TA 2GIFA 2EBGA 2E1PA 2H48B 1IR2A 2GS8A 3BN7A 1S7HA 1U1LA 2B5JB 2OELA 2CNNB 2C28A 5LSOA 1W2BR 3I31A 1WG5A 2ZBRA 5J2QA 5CYQB 3DDNA 1WUUA 2BE7D 3Q2SC 1I94J 1M5PC 1RWNB 1IBKJ 3JYTB 1HKAA 1OJ4A 1RT3A 1S12A 2CWKA 2HYIB 2GGPB 4MIBA 3A1YG 1NZAA 1QY7A 3P96A 2JSXA 3VQTA 1Y3KA 3TJ9A 3HI9A 2JFDA 2OPSA 3BB5A 2XCPA 2MQNA 2EPIA 4F4KA 2GAGC 2ZBIA 3R5CA 1FO1A 4LFCF 1NB7A 4IDKB 1TTHB 3MM8B 4P2MA 4DX8H 3AOCA 4BLGA 1BC6A 3CCRS 5KFDA 2EKNA 4NRTA 1O51A 4DR7J 2RRNA 1XNRJ 1K1SA 3RB6A 3V5RA 1JLFB 3I0RA 4WYWA 5DDPC 4U9RA 4RW4A 1MU2A 1NJIT 3KFWX 1YHQS 1S0NA 1EETA 3TJ8A 1K9MT 1EARA 4EI2A 4B3RF 1IWAA 3BV8A 4K0KJ 3C6TA 2NPIA 2V8GA 4C0OC 3W8PA 5IC6B 2C2DA 1JLQB 4V19J 5IQQA 3B54A 5DLFA 1X4FA 3W62A 3OJSA 2ZOGA 3MTJA 3M9MB 1QSLA 1KQSR 5KG3A 4LF8J 1JLAA 4LMZA 3EZOA 4J9SA 3HFVA 2JZ5A 3NBPB 2G0IA 1SPBP 3NOCA 5GAHI 2DNHA 1TELA 4LR7A 5FDLB 2XHWA 1NXIA 1SC3B 2JRSA 1HNWJ 3MD3A 3QSYB 4NXMJ 1ZM9A 1J2VA 2XS7A 3GYXB 4HH0A 4X66J 1M90T 1HMVA 4DLEA 3RGIA 1NO8A 2LLZA 4DUTA 2HNYA 2UU9F 2IRYA 1TVRB 4KPCA 3KLFA 3SCIE 3BQ1A 3QBCA 2EFQA 5BXIA 4IG3A 2E9RX 1PSDA 4MMOA 3CO0P 3MCSA 1X0FA 4X4OA 4AT1B 1U1NA 1S0OA 2WONB 5B0AA 3BSCA 2XTJP 2E1RA 1N5YA 4XDCA 1FTCA 4UZBA 4YR3A 2CUYA 3VAMA 1CS4A 2MZ1A 3CCVS 4OYXA 2U1AA 3PVXA 2RVJA 4USIA 2JEIA 1FRHA 1RSCA 2NS1B 4G1QA 2BXJA 5A8KB 2GO8A 5IS2A 1TUWA 7FD1A 1C0UA 3SZ2A 2OI2A 5HL7Q 3MECB 4W92B 4L73A 3BSNA 1S49A 2E9ZA 1EJ7L 2GA7A 4QPTA 1QVFR 2DGUA 3QIDA 3D28A 4TKTA 2A2DA 1C1BA 1GEHA 2G2YA 2E29A 3O8WA 4FPIA 2HG4A 2IJFA 3CJKA 4OX8A 3OFHA 1P9YA 2APOA 2F4VF 3P5BP 1PBAA 2YKQA 3M8YA 3PXGa 1H3DA 3OVAA 4FS1A 5C24A 3VR1A 3VAIA 5U47A 4CM0A 4DX7A 3MM5B 4RW8B 2ALZA 3IR6B 2C2RA 3I82A 4E0DA 2QYCA 5HMXA 1M0SA 5L1JA 4OZNA 2JEGA 4NI2B 3PIPQ 3LWLA 2MKKA 4B3OA 4J9RA 3PG9A 3M8QA 1RT4A 2MHEA 4NLXA 1G6BA 1N48A 3FBCA 2AYMA 3D3BJ 1I3OB 1IBMJ 1TR0A 1DJ0A 4NZ7A 5ETKA 5L1IA 3QLHB 1OY9A 3M7VA 3FFIB 3KK2B 3AOAA 1S57A 1N6QB 3SBMA 3KLEA 1G3OA 4KGVB 1TK5A 4YDXA 3FZ2A 3QPIA 2DR9A 4F8RA 1NDPA 1FD8A 1PYSB 3UDCA 1JJHA 4Z7YA 1MN7A 5L1KA 3UWTA 2QLWA 1WD6A 1E6VA 5FLXU 3MEDB 2WSFC 4ECYA 3GPAA 2CQCA 3S8SA 1ZYQA 2Y8WA 1U2CA 1KONA 3PZPA 3J81U 3PY8A 2R7OA 2ILZA 4AD6A 2GJ2A 2ZBCA 2AIRB 4TNOA 2ZKTA 2AZ1A 2ZUAA 1FEHA 4L75A 4M5GA 4ZS6A 4ITSA 4WE1B 4NA2A 5DS7A 2VG5A 1N33J 1N88A 1TMMA 3IWLA 1LW0A 1N36F 3HF5A 2G1DA 3Q83A 2UXBJ 2JOQA 4F25A 3TZYA 3MUTP 3L4BC 4JI8J 1WTBA 3QZ7A 4QPXA 1LFPA 2Y1RI 3EVOA 4KO0A 1RQ0A 2JL9A 2R7QA 4DL0C 1IWGA 4CLWA 5KOXA 3C46A 1F9FA 4JI2J 3CXCR 2X1AA 2HHQA 3LQVA 1FRKA 1XNQF 2XYPB 2FUG9 3TX8A 2UUBJ 4ZVHA 4C0HA 4HI2A 1AFIA 5AJ3J 2NXEA 3KKFA 4OJHA 3OXGA 4K0KF 1S6UA 3PV8A 1F2GA 1QSYA 5D77A 1FWKA 2HBQB 2ZZNA 3ZZZA 3K58A 1Z4UA 2WW4A 5HJYA 9RUBA 4NMXA 1F0XA 5J1NA 1Q82T 4DF4A 4NLWA 3D3CJ 3ET6B 4HVZA 3PJ9A 4ZMMA 2DHHA 1LXNA 2R7RA 5L9NA 5KFMA 1Q0NA 1WF0A 2XG8A 4DL5A 2W4PA 2W2PP 3DDIA 5J1EB 1NHKL 4CTAA 2D9OA 3N4WA 3O2IA 2FJAB 2Z2ZA 4NX9A 4J91A 4TY8A 3CMES 1CULB 4BHQA 3PRBA 4NXMF 4PWWA 3C16A 1V6HA 1PAEX 4ZIWA 1OYDA 3UDLA 1NK4A 3M2VB 4M5LA 4LFBF 1GQEA 4WFNQ 5B08A 2QLBB 1LV5A 4L6V3 2ASJA 1TL4A 2FY8A 4ICLA 1EHWA 2HK3A 3SCJE 4XDDA 3PKYA 2W2NP 2XYHB 1SL0A 4X62J 1CJVA 3GFYA 4MFBA 1Q8IA 3GU0A 4P72A 1YX2A 2YWEA 1RHUB 3BYRA 4DR2F 2RS2A 1YGYA 2UV8A 2YVSA 1S9FA 1HYSB 3B82A 3TUIC 1KVIA 4QWCA 2V67A 4NL5A 2LU2A 5D3GA 2B4OA 4WFYA 2L41A 1RCXB 1S1WA 1R31A 2FPHX 3ONQA 2H65B 4GMKA 2E5GA 2VG7A 3HK2A 2CDRB 2C3YA 2CPJA 1KVJA 1HPZB 2IM2A 4LF9J 4IYQA 2R7SA 4K4TA 3R2DJ 2Z2LA 2NZCA 1HL6A 2PI5A 1NBEB 3L7UA 3K89A 3MMAB 4JYAF 3TAMB 2V4QA 2OPPB 1NJYA 2GVDA 2ZH6A 2R8JA 3AHPA 3AXMA 1T02A 1HHSA 3M8PA 2HHHF 4Q5VA 3QFHA 3V81A 2XZTB 2G0CA 1ZS6A 1WI8A 3OL7A 2LKZA 2L9WA 4LIRA 2GJIA 1T11A 4OLPA 4DR3F 4USKA 4DQSA 3M4XA 4Y3CA 1YRTA 2QL5B 1HBUA 3NS7B 2E5LF 2A18A 1Q5VA 1CEZA 1V3ZA 4PG4A 2QGFB 2V4JB 4K2JA 1FNXH 1WWHA 2DKOB 3VAJA 3DCAA 4A8OA 5IT9Y 5CA5A 3J7AN 5EUHA 1AZSA 1U24A 2RH3A 2YNIA 3KOAA 3NGTA 4USUA 2DR8A 1CC8A 1IM6A 1YJRA 5EGYA 4IUFA 3PKMA 3QAEA 3H25A 4YR2A 2XEXA 5IV4A 2XM3A 3DI6A 2IM1A 1VRQC 4MYUA 2DPJA 1ICEB 3GV8B 1U7LA 2V2QA 1OS5A 2M88A 4B3TF 3TOQA 3E8OA 1MSWD 2WBMA 4KBIA 4IH6A 4ECVA 2KTQA 2IRUA 5D0HA 4YY3J 3FUYA 1JLBA 2LEBA 4WK3A 4I56A 5CABA 5HK4A 4K8RA 2A0FB 5HN0A 3LP1A 1A7GE 2FZKB 4B3MF 2VG6A 2FJEB 3NRBA 3OR2B 1F5BA 1NPRA 4ZLLA 3PDNA 4EO8A 3WX4A 2VPYB 1V3SA 1UFWA 3NGSA 6FDRA 3IWXA 1EKRA 3RAQA 2DO0A 1K8AT 1D9AA 4O4GB 4A8SA 4LVOP 1VHIA 4OYIA 1WEZA 4X4NA 1SJ3P 1LWCA 3IS9B 3MPWA 2F8MA 5KT6A 1R7IA 4ZP9A 4B3SJ 2MLXA 5A76A 4Y00A 3U02A 2KHCA 2XSJB 2ADCA 2PGCA 3U7JA 3OJUA 2BANB 1OPZA 1X0PA 1R0AB 2MQOA 4W98A 5J2PB 2O5DA 2UVUA 1VJQA 5M2RA 3PFEA 1FJEB 4WZQA 1HNXF 4GKJF 2I5JB 1NRKA 2WSEC 4KFBA 2EW9A 1X4BA 2ZJPQ 3PX0A 2BJDA 3QAUA 5H9FK 3BH6B 3R97A 3HCXA 1TZ0A 2GMLA 1S76D 3BGLA 2MB0B 4PWDB 2BM0A 4RWXA 3DFEA 4DBQA 1SXLA 2AX1A 3WC0A 1FT8A 2B8PA 1RT6B 2RKIA 3HSGA 2DR6A 1RAEB 4MK8A 2HBYB 4YP3A 5IT0A 3FGVA 1R43A 2YKAA 4ECXA 2ZD1A 2N7YA 1U2RA 3CJ0A 1WHVA 3HVAA 4DV4J 1UA0A 4MK9A 4AQYJ 1S0VA 2ZOFA 3LPYA 4ZVTB 2F7VA 2XULA 2XO7A 1T7PA 4DFJA 2DJWA 3TUZC 5F0WA 1Q7LB 4JI1J 1BE4A 1H7XA 4DPOA 2Y8YA 1VQOS 4PG8A 2J8AA 1U09A 1GTEA 4MKYA 2RE1A 3CDWA 3FC9A 4W90B 1G1XA 5LM7E 3HHEA 1WC6A 2CJQA 2AYBA 5LJ5Y 1VQ6S 2CQ4A 2BE2B 3MPUB 1VBKA 3RR7A 3N01A 4F3MA 4IRKA 2CPEA 5A8RA 4KTQA 4OYBA 2DGTA 1N5TA 4F4ZA 2XLIA 1VQSA 3QT6A 1BWVA 1FHTA 2DISA 2V8HA 3VAHA 2OUGA 2E44A 3NG8A 2DRDA 2VZ9A 2ZE2A 2ACYA 4DN9A 1RADB 3HHLC 1VC0A 3PR4A 4NLSA 1FJ7A 2MZRA 4W4MA 3THVA 1S1UB 2LECA 1MMDA 4A8KA 1OO0B 4WFBQ 2OPRA 2OSQA 2EFNA 1NMEB 2BJ9A 5HANA 4Y34A 5E5NA 2EG1A 4NE9C 3ENWA 1WDTA 6FD1A 2EC2A 3MAAA 1SIZA 3MEEB 4JI6F 5I3PA 2BACA 3R7NB 3ZZ0A 2C2KB 2ZJRQ 2YKOA 1FRXA 1NDCA 1EAYC 5J2QB 4R0EA 5E3AA 4DR5F 3OR1B 3M1VA 1QJHA 3MMCA 4QYZK 2CNOB 2R2UA 4K4SA 3OD2A 1Y9OA 3W8GA 2Z30B 2UXDJ 1NK0A 2K3IA 4JB8B 3FSXA 1T8EA 4YB1P 8RUCA 4NLTA 2X1FA 4M95A 4X65J 3V4IB 2OPSB 3ZO7A 5HQ8A 4B9TA 3TJAA 2L48A 3W3SA 4TLRA 5M2UA 1YTYA 4ZPTR 2NREA 3EE3A 4ZOSA 2R42A 4R0JA 2OH2A 3S6EA 5D0GA 2FHJA 2J7WA 2WVBA 3DYAA 1DAXA 4RW7A 4QZVB 3I0RB 2N3OA 3DN9A 5LXRA 3TX0A 3ZXWA 4RW4B 5JMNA 2Q43A 2O3DA 1S79A 4ELVA 4OZ2A 1EETB 4NPOA 5A8WA 2EI5A 4FNIA 4TXSA 1IKYB 1FRJA 4F3QA 1ROFA 3AA8A 3MR2A 2Y0BB 1S48A 3CE8A 1UVNA 3CT9A 2ZHOA 3ENAA 1VC6A 4LFAJ 3MDFA 4EYHB 5E2QA 2JFKA 4OI3A 4CH0S 1UVIA 3HZGA 1XR7A 1FERA 4K4XA 1JLAB 3NEKA 2EK1A 2HVZA 1R27B 1TL3A 4FBTA 2ZNZA 4JP8A 2PMHA 2VUGA 5F0UA 1HNZF 2KU7A 3HO1A 2VASA 1WOPA 2W2QP 1HR0J 4U7CA 1SB6A 3V2UC 2IBKA 1EQ0A 3DLEA 3CCQS 2N4CA 2VFTA 2DNQA 1SL2A 3GE9A 4I6AA 4RW6B 1RWPB 3KLIA 1HMVB 2B9YA 1ZETA 2C22A 5KFSA 3CCLS 1RHJB 4NWBA 2HNYB 3FBEA 1H98A 5KFWA 4N41A 1PAUB 4ECSA 2RUGA 1L3SA 2DIUA 3NAHA 3CJ2A 2X7IA 2C2NA 4IFYA 1MWYA 3BM7A 1VQ4S 1IBLJ 4ZITA 3TRGA 1PC4A 2RJZA 4H4KA 1N5YB 3GFHA 2POKA 1PC5A 3Q8UA 1CS4B 2ROEA 1S6QA 2UXCF 1RAJA 1Q8BA 4ED5A 3SV4A 4USHA 1U49A 1LOUA 1NEEA 4RL1A 4G1QB 3QFWA 2R3VA 4M63A 5ETQA 1S7IA 2I2YA 2GAHC 1C0UB 2IVMA 3CDAA 2J0QD 2BR0A 3M8SA 3CIZA 2C2EA 2XY5A 2M5YA 1BLUA 3W2VA 2DGQA 1TUGB 1UEKA 5T7LA 2AWZA 1C1BB 2DT9A 2IPOB 1RTDA 3PIOQ 5E3QA 1UAWA 1PO6A 2J7KA 3PW7A 4N8NA 4F3OA 2WVCA 2IJNA 3CJKB 2ZZMA 2B9EA 4WIIA 4HR2A 1SJ4P 1KQKA 2WCXA 4F02A 4ECQA 3CWJA 1RZMA 3G71S 1LWEA 3D0HE 3TZZA 3ICLA 3JS9A 4EUVA 2YX7A 5JXSA 1IM4A 5M2PA 1LKZA 3DLBA 4HH1A 4AFFA 3H2VE 4USMA 2GMHA 4C8KA 3ETMA 2YX4A 2MQMA 4J37A 2XQCA 3ZFVA 1HLWA 2BUNA 3ADAC 4OYAA 3GJQB 3D1QA 2P6TA 4B3OB 1RDRA 3EVMA 3FZBA 3HKWA 3KNGA 3M8QB 1C1CB 3EJMA 3G86A 3UCGA 2VPWB 4J9UE 1JX4A 3HSDA 1RT4B 4K50A 3PYDA 2V8DA 4WP3A 3T3FA 2FHJD 4J5OA 5CZVA 3M8WA 1PKUA 1IKWB 2KG1A 1TL7B 5K14A 1QVGR 4DF8A 3T9ZA 3L3CA 5KT2A 2OGUA 2KVQE 1ZOTA 5CYMA 3J7A1 2Z4PA 3KLEB 3TQ1A 3M2RA 3GR1A 3K57A 2ZITA 4ECWA 1JXVA 2UUTA 4WP8A 3O1LA 5ITHA 4NLPA 3W9HA 5EN1A 4B02A 1E6VB 1C0TA 3Q23A 7AT1B 2IM0A 3MPYA 4OX6A 3DRSA 3G6VA 5C2CA 3RUBL 1B64A 3GJRB 4FBUA 2QSWA 3I5AA 2ZH2A 1AB8A 3SYZA 3JYTA 4B9VA 2CQ3A 1IKVA 1GXUA 3F0NA 1I5OB 4LSNA 2GGPA 1KFDA 1TKZA 2UUAJ 2YNFA 2X1GA 1XMOF 4C97A 1AYEA 1FESA 4X4SA 3GILA 2AYGA 1WKLA 2VG5B 2UUCF 3G6YA 2E1CA 5FLXY 1V5IB 1Y5IB 1CC7A 1LW0B 1P27B 1QD1A 2HVHA 1M1HA 1UETA 3QRRA 1S77D 2HGLA 2LA6A 3CCMS 4X4TA 2ASLA 1JLFA 4KO0B 3J81Y 5HLFA 1IQTA 2M70A 2NR0A 3IM9A 2JDJA 4JI5J 1TFYA 3RBXA 2HURA 5G4DA 1B7YB 4DJBA 2QA2A 1F5CA 2RILA 1DHMA 4AYBD 3VVTA 3G87A 2IVFB 4UW2A 3EGZA 1DTTA 3D6TB 2VPXB 4ECRA 1RU2A 5DGBA 5GADI 2AEMA 5DJBA 3O44A 5KT5A 5D4NA 3DMJB 4O3QA 4OV1A 3DGPB 1X4GA 3HDSA 5B0GA 3WZ0A 2FJXA 3WX8A 2VIHA 1KN6A 2NYHA 4J9VA 3D7SB 1FFWB 3NBPA 2QX0A 5LSRA 2XC9A 1DLOA 2LU1A 4TVAB 4DR1J 2RHQB 2YH0A 1CBKA 4A8FA 2NZ4A 2H54B 3IR7B 1N52B 1Q16B 1SIWB 3NLCA 1N54B 4KQZA 5IZHA 3CD6S 1S1TA 3KYLA 2W24A 3FK4A 3GIJA 3LOUA 4DV3F 4DCOB 1UZHA 3V6JA 4U67Q 1UVMA 3TAQA 1RABB 4TY8B 2QSFA 2BRKA 5L9XA 1OY8A 1B0TA 4A47A 4M5IA 5CAAA 4NOHA 2WONA 4UUXA 3MAHA 3SV3A 4DR6J 3C16B 2PT0A 1WSVA 2NQPA 1N5QA 1MMLA 2AT1B 3FQLA 2KB2A 2G2ZA 2HWIA 4K5RA 5BJRA 1CG2A 4LRAA 4TN2A 1JLGB 5A8KA 5HMZA 1YJTA 3OFEA 1CJVB 3DOLB 3W5XA 4JI7F 4MFBB 4C9DA 4FP9A 3HVWA 2KHDA 2H5IB 2PFFB 4Y2AA 2DGOA 2WSCC 1PCAA 1YJNS 3QT7A 3NCPA 3BBFA 3KG4A 5JVHQ 3MCNA 1WOOA 4RNOA 5AE1A 5KFVA 1URNA 2AEJA 5BYQA 1SV5B 5D3GB 3T19A 2FZGB 2EK6A 3BEGB 1CJUA 2MGZA 3SQGA 2ZC4A 1S1WB 3MURP 2PE8A 1FDNA 2CQGA 2HIQA 5MLCV 3I55S 1XMQF 5KFNA 1RBAA 1IXKA 3KJQB 2CA9A 1JIHA 3AT1B 1EX8A 2VG7B 4I6YA 3ZZTA 2D9PA 2FJWA 2BEFA 2OHDA 3NCQA 3OSNA 3J7ZT 3T9NA 3K5NA 4USTA 3MM5A 4RW8A 2HAFA 1TV6A 2HQIA 1S5ZA 3KMSA 2ZH4A 3ZC4A 2ZVSA 1UFLA 2K2PA 5LMUJ 1V3RA 1X7VA 4RNFA 3OHBA 3M8PB 2CJAA 3V81B 4URQU 1NKEA 2XB2D 2BE9B 3BQ2A 2V68A 4RU2A 4QIWD 3UN3A 1S4EA 2RB7A 3IAS9 4M1KA 4C4WA 3R6LB 1WC5A 2J8SA 1D9DA 1HBUB 1N32J 3EMTA 1BUXA 3FSIA 3QLHA 3J7YU 4IOAQ 2IAJB 1E6YA 3FFIA 3CVKA 5SUHA 4F4AA 4GO5X 4X4PA 4NA3A 4CLYA 1N6QA 1RBLA 1SJQA 3CD0A 3NWGA 1AZSB 2YNIB 3IR5B 4ED0A 1YSJA 1LQ9A 4ZLNA 4WU2A 4Y0FA 2K7KA 1YJWS 3DI6B 1KR4A 4HDHA 4UOGA 3R27A 4DSKA 3TUJC 4KAIA 2W9CB 1RGVA 1EKSA 1JLBB 3KJVA 1R8HA 3T1HF 3IBWA 3OLBA 2WB1D 4M5MA 2FJDB 2EFOA 1WHYA 1KS2A 3LP1B 2AMCB 3H5XA 2VOPA 1HFEL 2VG6B 1UW9A 5I3QA 1HWIA 2KJVA 3D0GE 2A6MA 3UVJA 3MEKA 3UE2A 4U7UK 4UF4A 1RCOB 4JI3F 3N79A 3UPFA 1FKOA 3VGVA 1U0HB 3QJJA 3TO8A 4QOTA 1KNZA 3W60A 4DV5J 3HT0A 1HWLA 9ATCB 1GTHA 4O3OA 1HBNB 2MJNA 1SBRA 3MOZA 2DNRA 3FMWA 3FKBA 4B9NA 2GHVC 2J9DE 4UOCA 2ZM6F 1YVFA 4OHWA 3MUMP 4DPUA 4DQIA 4QW8A 2DNKA 1UPPA 1FDBA 3DLJA 1APSA 3FEZA 5CHCB 2YWKA 2MZSA 4G1IA 3A3PB 3KK1A 4K4VA 2N3LA 1KOOA 4LSLA 4DMZA 1F5AA 5BR8J 3M6WA 3WBZA 2E7WA 2MLZA 3ZNJ1 1RWMB 5JUMA 4NASA 3FRZA 5IM0B 1TK8A 4OI2A
chains in the Genus database with same CATH topology
1X4EA 4DL0C 4KHPF 3T5KA 1NJWA 1QUVA 5HP1B 4PCQA 3MFHA 3K5OA 3I9V9 2RNEA 3CF5Q 5AXNA 3CD7A 2E66A 1OPIA 2V94A 5KOXA 2HS0A 4DV0F 3C46A 3BJYA 1F9FA 3GG0A 2OFHX 1Y0HA 3VAKA 3GMGA 4QQBA 2X1AA 3CXCR 2HMIA 2WHOA 2HHQA 3LQVA 3TA0A 3QGPA 2B4UA 4X84A 3CSKA 1FRKA 1XNQF 1FVQA 3THTA 2FUG9 3TX8A 1VRUB 3K59A 1QTMA 3RR8A 4ZVHA 5HBMA 3EYZA 2XLJA 4F50A 1M5VC 1REVA 2ZH8A 1QUPA 3ZZOA 4IDKA 4HI2A 4C0HA 5H9FJ 4TU7A 3MM8A 4TU9A 2WOMA 2FLNA 1AFIA 2NSBA 1RA6A 3J7YI 3N6LA 2EFVA 3KKFA 2ZDOA 4OJHA 4M94A 2R2SA 1HQUB 1Q79A 2KRRA 3OXGA 2UXDF 1TAQA 2QA1A 2MY8A 3QO9A 2GHPA 1S6UA 4EBDA 2P6SA 1S0MA 1NJXA 4NLGA 4K0KF 2MMYA 4KV8A 2HHPA 3PV8A 1F2GA 1LW2B 1FXDA 1MROA 1QSYA 1TL5A 3HT3A 2AYEA 5D77A 2ZZNA 4LQ3A 3ZZZA 3K58A 1Z4UA 3LGNA 4IOBA 3W2WA 4X65F 3GZ7A 1F0XA 5J1NA 3FCHA 2A1BA 2CQBA 4FNHA 1QAXA 5KFOA 2IYIA 4DF4A 1Q82T 2HHVA 1N0UA 4NYZA 4NLWA 2BRLA 2XMMA 5A2QY 1T05B 4I69A 3DLHA 2D3UA 4HVZA 1UL3A 3MR6A 3SDEB 3OTCA 4ZMMA 2O66A 3S01A 2K8GA 4C8YA 4X4RA 5IT4A 4I7FA 3L7PA 1LXNA 3CIMA 4Q2LA 4CH7A 1R8PA 5CXTA 3MUVP 2R7RA 4XAKA 5L9NA 3OTEA 2QE5A 1RKIA 5KFMA 1WF0A 2IRXA 2XG8A 4QWDA 1NK7A 5JJBA 3I6PA 3OHAA 4DL5A 2HMIB 2W4PA 1JLQA 1SC6A 2PI4A 1NK5A 4QIEA 3CMAS 2LQJA 4FF3A 1ELOA 5J1EB 2AJ4A 4CTAA 4R5PB 3HPOA 3PM9A 1U45A 1A9NB 2UUWA 1GXLA 5KFKA 2LDYA 2D9OA 2ZC3A 3N4WA 2G9OA 1REVB 2JEFA 3O2IA 3DU5A 4K59A 2FJAB 5L39A 1RA7A 1HYSA 2IHR1 4NX9A 1NJZA 5HROA 4UY8T 4TY8A 3UNGC 3DOMA 3CMES 5DQHA 3BR9A 4FS2A 4LF5F 1B0VA 3HZEA 4BHQA 3PRBA 4NXMF 3OFGA 4ZVEA 3QO9B 4Z2XA 3DRRB 5LT5A 4Q0BB 4MIWA 5IQ6A 5I42B 4NMLA 1MROB 1V6HA 1Z1ZA 1XERA 1FNOA 4PXCA 2B6AB 4KT0C 4PG5A 1Q8LA 3UDLA 1NK4A 3M2VB 5C5JA 1WTFA 4KJIA 3NGKA 3I4HX 1TL1A 1X5PA 1VBZA 4RUHA 4LFBF 4LFAF 3PO5A 1CVJA 2HQ3A 1GQEA 1YJVA 3I5BA 5FDLA 5KFJA 4WFNQ 5B08A 2GHWA 3TA2A 1LV5A 4L6V3 2ASJA 4F2SA 1TL4A 4ZP6A 4J9LA 4HL9A 4ICLA 1FF2A 2IC3A 3SCJE 5KFTA 1Q86T 4YB7A 4XDDA 3PKYA 2JEJA 2F40A 1BQNA 1SL0A 4N56A 4FF4A 2AJQA 4DV7F 4RX6A 4X64F 3DLLQ 3HVRA 2VBXA 4C3MA 4C8LA 1FA0A 3GFYA 4MFBA 3MPVA 4TQRA 2D3ZA 3M6VA 4RNMA 4P7TA 1FDAA 1Q8IA 4I1TA 2RRBA 1TVRA 4P6QA 4CTAB 4NCBA 2YWEA 3K5MA 1IN0A 3AY0A 3PRDA 2MQPA 4DR2F 2RS2A 1YGYA 2FLPA 2XMTA 4RNNA 2X1BA 2OPRB 2FJBB 2UV8A 3N5FA 2KZZA 2YVSA 4KHMA 2JHEA 2FTRA 1S9FA 1HR0F 2DK2A 1Y00A 2MQQA 3GWCA 1HYSB 3MMAA 2ADBA 3B82A 4RKUC 3TUIC 2M3DA 2E5HA 1TKTB 1HNVA 4Q44A 3NMAA 2XI2A 1KVIA 3TAMA 3Q8RB 1ZTWA 1R8CA 4FVMA 3UFCX 4QWCA 3DHXA 4NL5A 4ECZA 2HRYA 2Q6BA 1U1QA 1BWEA 4KHRA 4F4XA 1WHWA 2MKIA 3BSAA 3O5TB 4RW9A 1T95A 1Y5NB 2F1FA 2LU2A 2LYVA 4HEA9 2OPQA 2B4OA 1Q1KA 3MHYA 2DBBA 3LALA 3UQSA 5D3GA 3WDOA 3LP2A 3ISNC 2MSSA 2XCAA 4WFYA 4WKRA 2DHXA 4MIAA 2R8IA 1U1MA 1VFJA 1TL1B 2IM3A 2XMWA 4Y28C 4DFMA 2L41A 4C0BA 4QCLA 1H6KX 3O6QA 5A6PA 3LP0A 2YNHB 1OSCA 1S1WA 5F3TA 5AE3A 4ZPAA 2VONA 4DEZA 4ICLB 3KHRA 3OL9A 1R31A 2EWHA 2C3MA 5DM6Q 2MKCA 3LANA 2FPHX 2MPUA 3RZAA 1YQHA 5LMUF 3PW5A 1C4AA 3ONQA 1SL1A 4L72B 1TP7A 3M1VB 4GMKA 1ZAVA 3B4MA 4AL5A 1S4FA 2KRBA 4USJC 4WKYA 1L3TA 3OTOF 2Z0GA 2E5GA 2VKZG 2VG7A 3MMCB 1IBLF 1BQMB 3AQPA 2C3YA 1HNIB 2CPJA 1ZBTA 3CC2S 3HK2A 2DCUB 5K8PA 3RRHA 1KVJA 2CYYA 1JLEB 1HPZB 2IM2A 4H4KC 4QWEA 3IG1A 2CPZA 2ATLA 2OD4A 3BGRB 4IYQA 5DO2A 3SFGA 5AXLA 3I32A 1HQEB 1SKRA 2R7SA 4K4TA 3K7RA 3MECA 2RT3A 2Z2LA 1S1XA 1HL6A 2PI5A 1D8ZA 3RRGA 2J0XA 4DSEA 1X5SA 3MMAB 4JYAF 4UUWA 1XEZA 1KOHA 1VBXA 1HNVB 2LDIA 3TAMB 2OMLA 4DS4A 2V4QA 2OPPB 1NJYA 2FLLA 4OZJA 2HRUA 2ZH6A 2R8JA 3AHPA 4RBUA 1RWUA 3QYYA 5I4MA 3CDEA 1T02A 1HHSA 3M8PA 2HHHF 4A8QA 3H5UA 4DOZA 4Q5VA 1L5UA 2Q66A 3GB0A 4GKKF 3DLGA 3V81A 5D8HB 1N8RT 3LP2B 3TA1A 4DQRA 2G0CA 1Q53A 5A0YB 3W7BA 3GIKA 1WI8A 3LF0A 3OL7A 3CCSS 2LKZA 2L9WA 2CJBA 3MD1A 4LIRA 2GJIA 4BWMA 1UEVA 3LP0B 4OLPA 4DR3F 2BZ2A 2P9EA 3JTPA 4WK1A 4DL6A 4DQSA 3DYAB 3M4XA 3QGIA 4Y3CA 3UD4P 1YRTA 3RBDA 3U1LA 2COLA 1A6LA 4IH5A 3B4DA 1HBUA 4QYZJ 1FEEA 4NCGB 2E5LF 2A18A 2Y0SD 1CEZA 2QLXA 1R89A 1V3ZA 1VK3A 3U27A 4PG4A 2R8KA 4MJKA 5A8WB 2V4JB 4MKBA 2R2RA 1J5OA 4G1PA 3I96A 3DDKA 4FXDA 4CO3A 4ES3A 1FNXH 1WWHA 1SKWA 4AUKA 4NLDA 3VAJA 3DCAA 1LK5A 4A8OA 5IT9Y 1VJWA 5CA5A 1JXLA 4TY9A 2GNKA 1S1XB 5EUHA 2QFJA 3VZHA 4PQUA 2F8HA 1JKHA 1HBOB 1C2PA 1U24A 2GQCA 3PX4A 1RJJA 3KTQA 2RH3A 4K4ZA 1UJ4A 3H98A 2YNIA 5KFPA 2FB0A 4EBCA 3US5A 2VOOA 2CQ0A 3KOAA 2OIHA 3CTRA 3DU6A 3T5LA 2DR8A 1CC8A 1YJRA 1RT7A 5EGYA 1ZH5A 4I68A 4IUFA 2VH7A 3PKMA 2AW0A 3DLGB 2VB6A 3QAEA 3H25A 2V9WA 2AGQA 4YR2A 5AXMA 2CIMA 2XEXA 3G6XA 2XY7A 2F3JA 2BQUA 3DI6A 4B9VA 3BR8A 3F44A 3CJ4A 1U6FA 2IM1A 1RYRA 2HHWA 3DLKA 3IXQA 1FKPA 4MYUA 2DPJA 3JSYA 3TYTA 1SH0A 1TKDA 3AB4B 4C2MA 3PNIA 3GV8B 1U7LA 1OS5A 1FD2A 2M88A 1QAYA 4B3TF 3TOQA 3E8OA 4I2PB 2W8KA 2U2FA 2AF6A 2F8EX 1MSWD 2WBMA 4KBIA 3MEGB 3ZZUA 5SZTA 3CC4S 1R6YA 1YRUA 4IH6A 2Q79A 4KSEB 2B56A 4IO9Q 4ECVA 2KTQA 2IRUA 5C25A 1DQ8A 4IKAA 2MDAA 4BCAA 1JLBA 2LEBA <