2E5JA

Solution structure of rna binding domain in methenyltetrahydrofolate synthetase domain containing
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
97
structure length
97
Chain Sequence
GSSGSSGPGSPPGEGAPLAADVYVGNLPRDARVSDLKRALRELGSVPLRLTWQGPRRRAFLHYPDSAAAQQAVSCLQGLRLGTDTLRVALARQQRDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Methenyltetrahydrofolate synthetase domain containing
publication title Solution structure of RNA binding domain in Methenyltetrahydrofolate synthetase domain containing
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 13
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2e5jA01
3SDEA 4A8XA 2MPUA 4WCEQ 2DHGA 3MDFA 2DH8A 2RUGA 2YH1A 2G0CA 2LXUA 2MSTA 2LA4A 1FHTA 4QU7A 2YKAA 2MGZA 5JVHQ 3Q2TC 3VAHA 5GVQA 1R8HA 2M7SA 2LMIA 4IUFA 2LEAA 2CQ3A 3LQVA 2UP1A 3CCLS 1FJ7A 5DDPC 3BO2A 3CC2S 1SJFA 3TP2A 3ZZZA 2MZSA 4QPTA 2DGWA 2DNGA 3J7ZT 1U1PA 2DGXA 4CIOA 2DNQA 5IM0A 2HGLA 2KRRA 3R27A 3S7RA 2XB2D 1WHVA 4F25A 2J8AA 2MKIA 1QM9A 1VBZA 2Q79A 2MKJA 1WTBA 1X5TA 2DNNA 1DBDA 2D9PA 3UE2A 2J0QD 4PRFA 2CQ0A 1W2BR 1N8RT 2OIHA 3N9UC 1VQPS 1U1MA 2CPXA 1K73T 3MD3A 1U2FA 1Q82T 2M2BA 4J5OA 4P6QA 3CCES 2F9DA 1VQ6S 1N54B 2DNZA 3B4DA 2ERRA 2XS2A 2F9JA 2MZQA 3S6EA 3THTA 2ADCA 2X1GA 1YJWS 4YOEA 3CCRS 2DB1A 2CPFA 5BJRA 2KRBA 1HA1A 2KHCA 2F3JA 4FXVA 1JJ2R 3CCQS 2A3JA 2MQPA 1WEXA 5LXYA 2DGQA 2MQMA 4W92B 1U1NA 1FNXH 5IQQA 2KXNB 2RQ4A 2RS8A 4YUDA 2XNRA 1WF0A 2U2FA 1WF1A 2EK6A 4Y00A 5LSLA 3NS5A 5GAEU 3G71S 5DETA 2XS5A 1A7GE 3DLLQ 1NU4A 1VQNS 2XS7A 1K8AT 2CQ4A 4QQBA 3NMRA 1WELA 5GAGU 2YWKA 2U1AA 4EGLA 3MURP 2DGSA 2HGMA 3CCMS 1YHQS 2NLWA 4WFBQ 1H6KX 2D3OR 2LCWA 3B4MA 2CQDA 3D2WA 3CC7S 2DK2A 5JVGQ 3TYTA 5CXTA 3P6YC 2KG0A 2RVJA 2HZCA 4ZKAA 2WBRA 1UP1A 2O3DA 2JX2A 1UAWA 2E5HA 3JB9k 5DM7Q 1WHYA 3MOJB 3TO8A 5DDRC 1QVGR 1YITS 2MKHA 2ZJRQ 2M4MA 2DISA 3Q2SC 2QFJA 2OTLS 3CUNA 2J0SD 2CQ2A 2XSFA 3VF0B 3S8SA 3MUMP 2JVRA 2AYGA 1DRZA 2M8DB 4Z2XA 1X5OA 1YWXA 3G9CA 3CMES 4BS2A 2X1AA 2QA4S 2JRSA 3VAJA 2FPHX 2KI2A 2MKKA 1WG5A 3MXHP 4CQ1A 2DGUA 1VQ5S 2LECA 2YTCA 3MUVP 3G8TA 4ERDA 4OZ0A 1KOHA 2FC9A 2J76E 4OZ1A 1X4AA 4ED5A 3BO3A 4F02A 5CA5A 1VQ8S 2VOPA 2XNQA 3UWTA 1YJNS 2K3KA 1WI6A 2MQQA 5DM6Q 4LJMA 1D8ZA 1U1LA 3DXBA 4CH0S 2MQNA 4M5DB 3BEGB 1JMTA 1X4BA 1B7FA 5IFMA 5FJ4A 1X4DA 2DIVA 2KVIA 2RRBA 2BOPA 2CQCA 4WFAQ 2M8HA 2M88A 3HI9A 2ZJPQ 2LYVA 2I38A 2CPEA 4TU9A 1YI2S 4U67Q 1O0PA 3P5TL 2N82B 2CPIA 3K0JA 1WWHA 3VAKA 1M5OC 2QEXS 2CPZA 3P49B 2AD9A 4QU6A 5IM0B 1D9AA 2DNPA 2CPJA 4TU8A 1U1KA 3R1LA 5D77A 2EK1A 2MSSA 2FC8A 1X4EA 1WI8A 3CCUS 2RNEA 3CF5Q 2OTJS 2MY8A 1N88A 5CYJA 3THPA 1SJQA 2CQGA 2DHXA 1PO6A 1KOOA 1BY9A 5LJ3Y 5D78A 1AUDA 2DNOA 1CVJA 1WF2A 4IO9Q 4C0OC 3H2VE 1RKJA 3G8SA 3CMAS 1U1QA 2DHSA 1M5KC 2KYXA 3I55S 1X4GA 1M90T 2FHOB 1ZZFA 2DH9A 1VQOS 3R1HA 2MHNA 1VC6A 2DNYA 2M9KA 3S01A 3RW7A 2M70A 1VC5A 1WHXA 2ADBA 2BZ2A 1IQTA 5EN1A 3MD1A 3SMZA 3UD4P 1YIJS 1OPIA 1P1TA 4TU7A 1HD1A 2JWNA 2N3OA 2E44A 1SJ3P 3SXLA 2L41A 3CCJS 1JJHA 4IOCQ 3VAGA 2GHPA 2EVZA 3NNHA 2CPDA 2DNKA 2MZ1A 1SXLA 4RU2A 3NNCA 2DNRA 1Q81T 3BO4A 1OO0B 3EGZA 4PR6A 2MB0B 1NJIT 1DHMA 3LPYA 2OSQA 1VQLS 2RT3A 2CQHA 2DIUA 2N7CA 2DO0A 2M52A 1K9MT 1KQSR 2CPHA 2LEBA 3CD6S 1VC0A 2VODA 4F26A 2CQBA 2AYBA 1U6BA 4YB1P 2RRAA 2DNHA 2KU7A 5HL7Q 1VQ7S 2GO9A 3G4SS 2MY7A 1FJEB 2L9WA 1HL6A 1Q86T 2CQPA 5GADU 3CPWR 2DGTA 2OJ3A 1VBYA 3P3DA 3CC4S 1DZ5A 3MI7X 1N52B 1VBXA 2DGVA 1SJRA 5DDOC 1PGZA 1L3KA 3UD3P 4UQTA 3CULA 2HGNA 2D9OA 1A9NB 4C7QA 1YJ9S 1F9FA 2DHAA 2HVZA 3SDEB 1KD1T 2L08A 2PE8A 4Y0FA 3VAFA 1URNA 2MJNA 2DO4A 1M5PC 2I2YA 3US5A 4FXWA 1UW4A 2KXHA 2MGZB 1JJ4A 1VQ9S 1H2TZ 1G2EA 5LSOA 1P27B 2LQ5A 1X4FA 1M1KT 1S72S 1U1OA 2G1DA 1HD0A 3RW6A 1H2VZ 3EX7B 2YH0A 3CCVS 2N3LA 3PIPQ 5MLCV 5LXRA 1YTYA 1U1RA 1FO1A 1WHWA 3ULHA 1X5SA 1ZH5A 1WG4A 3CXCR 2E5IA 3BS9A 3IWNC 2OSRA 2MXYA 3CCSS 3HHNB 4LIRA 2DITA 2MKSA 4V19X 1M5VC 4C4WA 4WFNQ 2MQOA 1NO8A 1UFWA 2MZJA 3PIOQ 1SJ4P 3V4MA 3IRWP 2AYEA 1X5PA 3J7YU 1Q7YT 1X4CA 1H2UX 2LKZA 2E5JA 1R8PA 3MUTP 2CQIA 1OIAA 4WKRA 3OW2R 2G4BA 4TLQA 2VOOA 2DNLA 4LMZA 3G6ES 1QVFR 2FY1A 3U1LA 4W90B 3UCGA 2KH9A 5H1SV 2KG1A 2V94A 1X4HA 1WG1A 3CTRA 3VAIA 2E5GA 1ZZNA 4UY8T 2DH7A 4PKDB 2RS2A 1VQ4S 2JVOA 2VONA 2DGOA 2HYIB 3ZZYA 2AYMA 3UCZP 2KT5A 3NNAA 3VALA 5HO4A 1VQKS 2MQLA 2MZTA 5GAHU 2KFYA 1VQMS 2PEHA 2MZRA 2KM8B 2LA6A 2MYFA 2NZ4A 5GMKa 1FJCA 2M0GB 4CH1A 1OWXA 3UCUP 1S79A 2MJUA 2KXFA 1FXLA 3FEXB 2ZJQQ 4WF9Q 1U6FA 3U1MA 3VAMA 4IOAQ 3L3CA 5LJ5Y 3FEYB 2KN4A 2DNMA 5DDQC 2SXLA 3NS6A 2X1FA 1RK8A 2B0GA 2MMYA 5ITHA 1KC8T 2MKCA 2X1BA 3H2UB 2LXIA 2CQ1A 2KM8C 2CJKA 2RQCA 2CPYA 2RU3A 4WIIA 3G96A 2K8GA 1WEYA 3I56S 1WEZA 3EGNA 1X0FA 1FT8A 1XN9A
chains in the Genus database with same CATH superfamily
1LKZA 1JLAB 1SPBP 3HVWA 1V6HA 5IT9U 4RWXA 1AZSB 2I5JB 3EE3A 2MZSA 4DBQA 2XYHB 1N33J 4CTAB 1N5TA 2H3EB 3N6NA 3EVWA 5T14A 1U1MA 2GS8A 4OI1A 3EDQB 4J5OA 4KV8A 2RB7A 3LANA 1HMVB 1UA0A 3THTA 2X1GA 4OJHA 2DB1A 2JH3A 1FX4A 5DZ6A 4X4VA 2BQ3A 1RTJB 1TUVA 3TUZC 1FNXH 3KFWX 5KG3A 4DSEA 1MROB 3RBZA 4ANCA 1IKXB 2PA3A 2V4JB 1VQNS 1KNZA 4QQBA 4F67A 1WELA 3RAXA 1TZ0A 2UXCJ 2ZOGA 3KJFB 3B4MA 1TKXA 3BREA 2PA8D 3R7BB 4QR2A 4B08A 4OV1A 5CQGA 3U1NA 2DR9A 3TAPA 4ZVTB 3TO8A 2OI2A 2BJ7A 2GQ2A 2ZWOA 2VU5A 1SVDA 2VPXB 2QJ3A 4P72A 2YKQA 1FKAF 3K8VA 4WTOB 1RAOA 3JTPA 2JVRA 3CJRA 4F2RA 3MGJA 2DGUA 2HSEB 5I3PA 2HVEA 4EYIB 2HIYA 1KOHA 1UVIA 4A8SA 5IS2A 4F02A 4PWDB 1PKUA 3BV8A 4CO3A 1S6QB 4LJMA 3J80U 4YQWA 4CLUA 3LGHA 2EXUA 2B7BB 4JI2F 2DIVA 1Z1ZA 3ELHA 3QAUA 1JXVA 1RWKB 1ZTTA 1B3TA 3K0JA 1H3DA 3QJLA 2MSSA 5HLFB 5E3PA 4OZ5A 4CLZA 4M63A 2RNEA 1TP7A 2W8LA 2IHR1 2EKNA 1RWNB 4CLSA 4CLLA 4JI5F 5E3CA 3DRSA 2O67A 4ETZA 4ID5A 4EO8A 3ZFVA 2FY8A 2F63A 1WUUA 1DJ0A 1SH0A 1IR1A 3FZ2A 1MMLA 3CIMA 1JJHA 3MPWA 4P2MA 2JLGA 4RU2A 2HBRB 5FD1A 4K50A 4PXBA 4OYAA 2WW8A 5E7OB 2LEBA 4DPOA 2RDDA 2VODA 5F41A 4DQSA 5KFAA 4JI7F 1ZPWX 4QWEA 3G4SS 4DL3A 5HVHA 3P96A 3HHEA 4AXJA 2CQPA 1S10A 4DV7F 4A8FA 5A2QU 4A8WA 2UU9F 2M3DA 3AOBA 4RPFA 2P6TA 2DHAA 2NXEA 3VAFA 5A0YA 1KFDA 1N36J 1S9EA 3BQ0A 4PQAA 1M1KT 4X66F 1Q95G 1RYSA 1NB2A 2R3VA 1DURA 4QWAA 2R8IA 2XI3A 4LF6J 3HFKA 1WC5A 3VZIA 1WG4A 3M9MB 2VH7A 4B3RF 3R5JB 2JEFA 2MKSA 4XK8C 1SJ4P 3PIOQ 4YDDB 4WPAA 4OHXA 3UFCX 2VBWA 3R3TA 2RQMA 1R8PA 4DX7A 1RT5A 2GIRA 1YJVA 4QWDA 1JWWA 4URSA 4NCGA 2IM2A 2CNNB 3NEKA 3MM8B 1WOSA 2ZBRA 4LSZB 2W25A 5J1EB 4E98A 4A47A 4OL8A 4H4OB 5KFWA 4PAAA 2EFPA 1SC3B 4YFUA 1IBKJ 2FHJA 5EX3A 2R2UA 3IXQA 2DNMA 3ZTRA 1FD8A 2ZD1A 1SQGA 3VGSA 3ZTSA 2OPPB 3QLHB 2AU0A 1KC8T 2HNYB 4YMEA 3UNGC 2RQKA 1Y3JA 2DCLA 3C19A 2GCFA 3BYRA 1U4BA 1YBAA 2E9TA 1XN9A 4E8UA 2EPIA 3A3PB 5HROA 3M32A 5JVHQ 1Q1KA 2Z58B 3GB0A 3UN3A 2M7SA 2DCUB 3BB5A 5KFTA 1RI7A 2CQ3A 4U96A 3SV4A 5J2QA 4ID8A 4I56A 1T3NA 2FVPA 4HTJA 2MKIA 1QM9A 2Q79A 1WTBA 1CJUB 2BE2A 2RD5C 2ATCB 4K2JA 3D3BJ 4F4YA 3ET6B 4J37A 9RUBA 2Y1LB 1HPZA 3KK1A 1FDAA 1NJZA 1REVA 2E1PA 3FK4A 2KHCA 1N5QA 2QX0A 3OL6A 1TL1B 4DUYJ 2F3JA 1FRHA 1IKVB 4KGZB 3R2CJ 1WEXA 3M8WA 4LF5F 1TAUA 4O4GB 1HNWJ 4Y00A 1SB6A 4IG0A 2ASDA 4NPOA 4UT4A 3A3NB 1Q8IA 4C3KA 1OMSA 2QC3A 1VDHA 4FS1A 3VVUA 1BQMB 4O3SA 1P9QC 3ISNC 3NY0A 3BH6B 2WBRA 3K5NA 4NXMF 3JB9k 5DM7Q 1N0VC 4YR3A 2XULA 2JL9A 2F4VF 2DISA 3MR6A 2YNFA 4I1TA 3NCRA 2DT9A 1NK5A 2ZE2B 5KFPA 2QA4S 3UPFA 4XO0A 4DV5J 4ZMMA 3MAQA 4B9NA 1VQ5S 3UDVA 4ECQA 3OTCA 3C14A 2ZC4A 4JI0F 4ED5A 3SCKE 2YWEA 1DLOB 3BO3A 2GVZA 3H2LA 2VJUA 1F9HA 3LP2B 4O3PA 2MQNA 4M5DB 4NA3A 1X4BA 2MLZA 1A6LA 3KNAA 1ZBTA 3PKYA 3K5OA 5GAHI 2ZJPQ 3CJKB 3UQSA 1JX4A 5I3UA 4KGKA 4F0KA 3W5ZA 2AHOB 3HF5A 1SKRA 4ECYA 3BR9A 4C11B 5IZHA 4A8QA 1CVJA 6FDRA 3MHYA 3G8SA 1HNZF 2AW0A 2HWTA 2ZH5A 1G3OA 1MLAA 1JLFB 3TAQA 2M9KA 2EFGA 3RW7A 1RCXB 3SYZA 4X4SA 4PZVA 4DV0J 1J27A 3R8YA 3OXFA 4ZN3A 3QFHA 4DF4A 3NS7B 4DZDA 2WSEC 2GHPA 2CPDA 4NLXA 2VFUA 4C2MA 3PXGa 5D4OA 2H4WB 3PW2A 2CQHA 1TL3A 2DO0A 2UVRA 2MLXA 1GX6A 2DHHA 3CEDA 2R7SA 3GP9A 3MR7A 2OFHX 1VQ7S 1IKWA 1I1GA 3RR8A 2QMWA 3P45B 4FZVA 2PI4A 2EFNA 2GGPB 3ONQA 2DY9A 2JFDA 4QPXA 5HI7A 4YR0A 1Z2LA 3M8YA 1SJRA 2RDJA 1QE1A 1SJ1A 3UD3P 4IH5A 1U0HB 3CULA 4P10A 5D6GA 4DOZA 1TKDA 2GAHC 2IBKA 1URNA 5LT5A 3B78A 2I2YA 1CLFA 2C22A 1F9EB 1RAGB 1VQ9S 2KZZA 1RHQB 3TUPA 3FDSA 4X4RA 1NH7A 1O51A 4OI2A 2NS1B 1EAYC 4G3IA 1C0UB 3KTQA 3KJNB 3HVAA 1X5SA 4OI4A 3HX9A 1RAFB 4ER8A 1LFPA 4V19X 4ZPWR 4WFNQ 2PEBA 1WNEA 2ABYA 3MM7B 4QW9A 1FWLA 3H0PA 5KFMA 4OX9F 3D6MB 3GR0A 3E8OA 5J2PB 2P5VA 3H5YA 3OW2R 4DSIA 2ZOMA 2HWHA 1VLOA 4J9QA 2OKQA 3M6WA 4JI6F 1UVMA 2DH7A 2HHXA 4PPDA 4FYVB 1IN0A 3EZUA 4MYTA 2LEPA 4O0IA 4NLGA 4FYDA 3KUGA 3OTDA 3CE8A 1VQMS 2M0GB 3GYGA 1U6FA 5LJ5Y 4BBYA 1OQ6A 5KFLA 3H5SA 1IBLF 2DXFA 3CJQA 2SXLA 2WB4A 1C4CA 3RU0A 2D3O1 2X1BA 2KM8C 4ED1A 2CQ1A 3VGUA 1D09B 3MMCA 1G6BA 1KDNA 1SI9A 4ZVGA 1S7HA 3VCDA 4YHHF 2WB1D 2LDIA 2YQ0A 4R0JA 4OHWA 3PJXA 2GA7A 2LA4A 3J81U 3J7YI 1HARA 4JOUA 5FDLA 3MPUB 1LOUA 2F8EX 1NNDA 1FJ7A 3OPKA 1HLWA 2V8GA 3J7ZT 2B4OA 4A8OA 2HHHF 5KG2A 3N5FA 3RR7A 1IQZA 2XMVA 5EDWA 1S1WB 3ILIA 4L74A 1R8BA 4NEYA 3M2UB 4ZLNA 1R89A 4OHYA 3R6LB 2ZC3A 3K59A 3I4PA 1M5HA 3IBCB 1JKHA 2POKA 4XAKA 3BKTA 4NL5A 4WP8A 2GJIA 2YX4A 2GV1A 4FXVA 2GMHA 1EP4A 4LBIA 3OV7A 1KTVA 4X4PA 4CT8A 4E2FB 1RDRA 1VHIA 5EWFA 4L72B 2HVIA 2IYGA 4EYHB 2CNLB 2F40A 3D0IE 1NU4A 2CQ4A 5CH7B 3NMRA 2XHCA 3QQCD 3GR1A 4WBFA 2XSJA 1X9MA 2IC3B 2LCWA 4ILLA 4U8YA 2XM3A 3GU0A 4Q8FA 4Y2IA 1FI4A 3QGPA 3P6YC 1U25A 3D1QA 4A8KA 1F3FA 1VHFA 2E5HA 2B9EA 3MMJA 5HBMB 3ZZPA 2BABA 3TW0A 2KL8A 3IN5A 2ZJRQ 1N34F 3KLGB 2HAIA 4DN9A 4IG3A 3PW5A 5C25A 1ZA2B 1TAQA 4B9TA 5IOLA 4ZLJA 2XMJA 2ZH4A 3MM5A 4ZN1A 2BJ8A 5B0BA 5E5NA 4LIWA 2MLYA 4GC7A 3DRYA 4ALZA 4LBHA 3MEDB 1FDNA 4RZRA 2XY5A 1IBCB 3PW4A 4CM2A 4CH0S 4NLRA 4K4SA 3BEGB 1JMTA 3UDLA 1WC4A 2EKYA 1RYRA 4Z7YA 4F3MA 2RRBA 2VG7A 2VBXA 1PG5B 5GAGI 4TU9A 1O0PA 3PHTA 4EBEA 4W4MA 2N82B 2HFSA 2DPIA 3D28A 4ZPBA 1D9AA 3ITHA 5K8MA 3LP0B 4DX8H 1SV5A 1R0AB 5KFQA 5E3AA 4R5PB 2DNOA 2YWGA 1SL2A 4U7UD 3O44A 4XIUA 3HXMA 4NRUA 3QSYB 4X84A 4LF9J 5E41A 1UL3A 3CJ3A 2BZ2A 1IQTA 1XWLA 2FVCA 5RUBA 4RW8A 4PG4A 3MEKA 4C8ZA 3NNHA 2MZ1A 1SXLA 1HWUA 3DDKA 3A8EA 1FKOB 1YJTA 4I2PA 4AQYJ 3OUYB 1S6OA 4TLRA 4LRCA 5GADU 4JV2A 2DR7A 4W98A 1FK9A 3Q8SB 1TK5A 4ECVA 2DGVA 4R8UA 5KFDA 4RWWA 4DX6A 3A12A 1Y9OA 3K8WA 4OJ3A 1JB0C 4KBIA 4FXWA 2OMOA 4YS2A 2DVIA 1UW4A 3DLKB 4OHZA 2WZ1A 4GC6A 2QLFB 4FNIA 1K44A 5F0WA 1HQ2A 4Y6IA 3ULHA 4KC5A 3FFIB 3HHNB 2DITA 4ED3A 3ENVA 4OMFG 3IBFB 2XZDB 4WKRA 1BQNA 3LWLA 4LMZA 1H98A 2YPZA 1GMWA 2E1MC 3HLUA 1S0OA 1IVZA 1ZZNA 4UY8T 2HBZB 4DF8A 3ZTPA 2DGOA 2AYMA 4WFZA 3NRBA 2OPQB 1TUWA 5DGBA 3SQGB 4DXLA 4O3OA 4AYBD 3K17A 4M1KA 4CM0A 1UJ6A 5IXUA 4DU7A 3L3CA 5A8RB 2Z0GA 4M8LA 4PWWA 3KNGA 4TNOA 1DFDA 4Y28C 2RU3A 1M5SA 1XMQJ 1HIYA 3I56S 2AP6A 1UJ5A 3RBEA 2CWKA 1FT8A 2XMKA 4NYZA 2F8HA 3PRDA 3CO9A 2MSTA 3OHBA 2V2QA 1KS2A 2IM0A 3PR5B 1N32J 2AJFE 4NZ7A 3MCSA 5DG7A 4H4MA 3TP2A 3UNYA 1S48A 4QPTA 4F4XA 1RISA 2FJVA 5HJYA 1TL7B 3M2VB 2ZH7A 1IBKF 4C9DA 2HS3A 4K4VA 1EIYB 3IM9A 3HHDA 2A1BA 5B0EA 3I0RB 3B4DA 4LFAJ 4DV4F 4C8YA 3F73A 2Q6BA 3VTIA 3IR7B 3FBBA 4GO5X 1TV6A 5D0RA 4NA2A 4ES3A 3WZ0A 2RQ4A 1T8EA 1U6ZA 1WF0A 2HHWA 5LSLA 3L9ZA 4F8RA 4KPCA 4WFBQ 4P71A 4RW9B 2BJ9A 3MECA 4DFJA 5CXTA 5CYMB 2RVJA 2PDAA 4RBTA 1RT7A 1XQIA 3FQLA 4NA1A 1RTDA 4DV1F 2V63A 3OVBA 5T7LB 4ECSA 1YITS 5AXMA 4USHA 3B54A 4FN5A 4LVNP 4RO0A 1X60A 2JEGA 3BN4A 3OXLA 3CJ4A 2JRSA 2UUTA 1KRPA 1GNKA 1GH8A 4DL6A 3MUVP 2R2RA 4ERDA 1T9WA 4OX6A 2NQPA 3K57A 4Y65A 1D8ZA 3KJVA 1GXTA 1NDLA 1N4LA 1WKJA 2CQCA 1QSSA 4JV1A 2G13A 5IM0B 2DNPA 1U09A 4CO4A 4K4WA 3N28A 1WI8A 5ETLA 5J1NA 4YP3A 1RA6A 2CQGA 1PO6A 2VF3A 3R2DJ 1RKJA 2FZCB 2R7QA 4UF4A 3LWMA 4LFBJ 4L73A 4DV5F 1QUPA 1UWBB 3S01A 1AROP 4F7VA 2ZH8A 2JWNA 1YVFA 4IDKA 3IRXB 2W9BB 1HW9A 1TR0A 4WFYA 1OO0B 2WOMA 3Q0AA 1ZAXA 4IRCA 2MTLA 3QJPA 3MAAB 4IRKA 1VC0A 3H98A 5E3RA 2XGPA 2AWZA 3AXMA 4CO5A 2DNHA 3DOMA 5DZ7A 1N5YA 3P8BB 4ATNA 3SEOA 2A6MA 4F4KA 5HMZA 4B3SF 3KLIA 3DLEA 1FTCA 4AXIA 4C0BA 5KFOA 3KK2B 1F5CA 2VL1A 1GMWD 4G1QB 2D3ZA 1M1HA 4DV0F 1FFSB 5KFHA 5LSOA 1EETB 2AJ4A 2V9KA 4MIAA 1S7IA 3M9OB 1YJ7A 5G0RB 1KR4A 4TY8B 4CCHA 3LP1B 4A8YA 1WKLA 2D69A 4I7FA 1Q7YT 3TJ8A 2BYCA 2W4DA 2QLXA 3TQEA 2G0JA 1XNQJ 4PXCA 4Q0BA 3GFYA 3R5AA 4NLOA 2YBVA 2KT5A 1XMOF 3D0GE 3N01A 4P7TA 3TEHB 2NZ4A 3PFEA 3D54A 3FUYA 2B5JB 1F5AA 4MFBA 2XHWA 2J7UA 2ZJQQ 2EBGA 3LA0A 4DZ6A 4XPCA 1EHWA 1S9GB 3NS6A 4CP5A 4NMLA 2IJFA 1Q78A 3IG1B 5DQGA 9ATCB 4X4TA 2XYGB 1W2IA 1WTFA 3W66A 2MPUA 4J9OA 1OY8A 2EWHA 4OJ1A 2FLLA 2YKAA 1LWFA 2H65B 4G6VB 3I5CA 2ZHAA 2LLZA 3TAMA 3M6VA 5LMUF 1RSCA 2DGXA 3GONA 5IC4B 2J6SA 4F25A 1X7VA 1RWXB 2DXDA 1NCLA 4ZJQA 1S1VB 2CZ9A 1Y0HA 3OTOF 2IYIA 3MD3A 2OELA 3TZZA 3OL9A 1NKCA 4DLGA 3HVTA 5HANA 3AD9C 3U7JA 4YOEA 3ENQA 4X64J 5ETPA 2A3JA 2B51A 2FQQB 3W7BA 4OV6A 1HBOB 2GVDA 2HQIA 5D4LA 2FYXA 3OTBA 4JV0A 3QZ8A 2JC1A 2L3MA 3OTEA 1FJGJ 3CVKA 2XS7A 1C1CB 3MEEA 3AB4B 2NPIA 4HKQA 3EVMA 2DGSA 1FKPB 5K9FA 3CCZA 5B0GA 1LWCB 2CQDA 3ZZOA 5JVGQ 4LREA 3IO1A 4AD6A 1HNVB 2KG0A 3ADAC 5I3QA 4ZKAA 2JX2A 3W2WA 4F3QA 1WHYA 2BEFA 4JI4F 2HEKA 2L9DA 1KLMA 4DL7A 3MFHA 3T5JA 2VQFF 4BC7A 3BQ2A 3PW7A 1X9WA 3D1HA 4KO0B 2CFXA 1JXLA 3RAMA 1DTQA 2M8DB 1PBUA 3D0HE 3KK3B 4CLKA 3TANA 4E0DA 1DAXA 1K1QA 2UXBJ 1JLBA 3HHKA 2VFVA 2FTRA 2EC2A 4ZLPA 2ZH9A 3R5CA 1LW2B 2ZUGA 3MMAB 1U1LA 3E01A 3KLHA 3OVSA 1VRTB 1RQ0A 1NJWA 2CPEA 1QAYA 4RW4A 3FKBA 2CPZA 1S0NA 1VBKA 5KFJA 4O44B 2ZVIA 3DYAA 2UUAJ 2F65A 1XK8A 4Q7AA 5JMNA 2J9EA 3CCUS 2BM0A 2BJDA 3OVAA 2QYGA 4B3MJ 1NSQA 2RF2A 4Q2LA 4IO9Q 3IR6B 1NKBA 5B7WA 1B0TA 2B6AA 4HI2A 2W9CB 2DH9A 1RT4B 4RNNA 4OX8A 3A4TA 1CULA 3UD4P 2ASYA 4XPEA 2HFUA 3E2EA 2E9ZA 1V5IB 3IR5B 1RADB 5H9FJ 3IWXA 3W2VB 3OL8A 2BJEA 3AOAA 5THWA 4HHUA 1NPRA 2ALZA 2OSQA 3I0SB 3I32A 1K9MT 2RRAA 1F2GA 4C48A 4Q8EA 3QIDA 1FJEB 5K8NA 1HL6A 1L3SA 1AZSA 2QRRA 3CPWR 4ECUA 3OSNA 2I5JA 5KG4A 3OD2A 1IWGA 1QSYA 4DV3J 1T05A 1HWIA 1RWVB 2BDPA 2K06A 4CTAA 3M8SA 5LM7E 1ZPVA 4N76A 2JNJA 4FYWB 2MJNA 3UDEA 2DO4A 2QMUB 3US5A 2AGOA 3CD5A 3I5AA 1LWEB 3RJMB 1G2EA 2W2OP 5F8JA 1HD0A 2W2QP 1H2VZ 1HMVA 2HQCA 4ZPDA 3W3SA 5HMYA 4ZVQB 3CCVS 3RBDA 3SFGA 2ACMA 1YTYA 5D0HA 2D41A 4B9SA 1YLXA 1M5VC 5H9FK 1UTAA 1IKXA 4RJVA 2V4JA 2CXEA 4GKKJ 4AQYF 2E5JA 3PJ9A 1YSJA 3BM7A 3CCTA 4KV8B 2QL7B 4KHPF 4J9LA 4IR1A 2W7AA 4U8VA 2WVEA 2V94A 4JUZA 2QGFB 1HBMB 4OYIA 1S1TA 4GKJJ 2H48B 1BXNA 2Y1IA 3PZPA 3UCZP 5ETVA 2CJQA 2Y9HA 2PC6A 2MZTA 5GAHU 4ZVSB 3JYTA 2PEHA 2YWHA 4RNOA 2HLTA 3GPAA 4NZ0A 1ZS6A 2VIHA 2GMJA 4YY3F 4ZJOA 3VR1A 3Q86A 3H42A 1AFIA 5EWEA 5DDQC 1XNRJ 2P9CA 2NUUG 1HWKA 2EW9A 1FXRA 4C8KA 2UVUA 4F04B 2NSBA 2E7XA 4FKYA 2RQCA 3CJ5A 5ETQA 3SIPB 1PYSB 4PWDA 5KFXA 2XG8A 3MDFA 2RUGA 1S6QA 2GQCA 5F8IA 4Y3CA 4RLEA 1BLUA 3HHLD 3ZZZA 2DNGA 4ZVPB 4CIOA 1NPKA 2HGLA 5HQ8A 2N4CA 3PHEA 1VBZA 4ZVUB 4LFCF 1P9YA 2V68A 5M2PA 2OIHA 4NRTA 1N8RT 4FYYB 2XZWA 1YJUA 2B43A 4PYAA 3ENAA 2ERRA 3GWCA 4DUTA 1F1BB 1XMQF 2HMIB 3VQTA 4F36A 2Z2ZA 2IVMA 4V1Ak 1WF1A 3AODA 2ZH3A 1AUSL 3G71S 5IWAF 1SIWB 2CIMA 2HURA 2C2EA 4TQSA 4KAIA 3DRSB 5H9EJ 2KTQA 1WC3A 1N32F 1X31C 2U1AA 4ID5B 1H6KX 2LQ8A 3D2WA 3DCAA 2NYIA 5BYSA 1RXOB 4J9RA 1VLYA 1NZAA 4P2XA 3M8PA 1ACMB 2V9WA 4LFAF 5L1IA 3BYPA 1B99A 3MUMP 1N6QB 1RTIA 4TYBA 2FDNA 4DL0C 3A8KA 3VGVA 3GFHA 5LMNJ 2FJAB 5EHHA 2FJDB 1WC0A 3MXHP 3KLFB 5L39A 2JEIA 4FVCA 3LOUA 3AJDA 4OZ0A 4UUXA 2I0XA 3A1YG 2UUBJ 3DRRB 3VGTA 3H7HB 4JBCA 5DM6Q 2J6TA 1CEZA 2WHOA 4LF8F 5FJ4A 1NPPA 5H9EK 2M88A 3LTOA 3M30B 1S12A 4O3RA 2CPIA 3PCOB 1NXIA 1B0PA 4PPZA 3P49B 1A0OB 2IJNA 1RTHA 2ZDOA 3MM8A 4DR4J 2FC8A 1SBRA 2KB2A 3MOZA 2RRNA 5CYJA 2BRLA 2BUNA 1WF2A 1VJWA 3KXDA 1UFLA 2ILYA 2AJ2A 3HFZB 1RT5B 2B4UA 1VC5A 1LXJA 1TL4A 2VICA 2DR6A 1TL5A 2QE5A 1KWMA 4ITSA 2OPPA 2OPRB 2QV6A 5A76A 2BBEA 3DFEA 3NG8A 2YNIA 2RT3A 5HMWA 3KDNA 2V6AA 4WKYA 2GO9A 3T19A 2CKWA 1NSKL 1NBEB 3CC4S 1N52B 2PMZD 1TUGB 1L3KA 4DI6A 3Q23A 2K3IA 1P6TA 3A13A 3F0NA 1R43A 3QIPB 1CJUA 5HAOA 3V2UC 3UDCA 4YR2A 3M32B 1RT2B 5JXSA 3I6PA 4CO2A 5CZXA 1UZHA 1S72S 5KAKA 3J7AN 2B4PA 2QA2A 4YB6A 2AGQA 1B4SA 1PAUB 1TL1A 5IV3A 1VQYA 4JI8J 3I9V9 3D5MA 3MCMA 1FDDA 2MZJA 1N48A 4O4GA 5L38A 4FVMA 1YKWA 3PR4A 3FCHA 3GV7B 2HW3A 2C3MA 4TLQA 1F2HA 2XO6A 2KH9A 5H1SV 1REVB 2FJBB 4Q44A 1BQMA 4CLWA 2W24A 3BSAA 1MWQA 1VQ4S 2HAFA 5GADI 3ILLA 5HO4A 4B9LA 4CH7A 2KM8B 4IG0B 4ED0A 1U2RA 4URGA 4KB7A 3TZWA 1RWUA 2V2KA 2H54B 1G1XA 2ZE2A 4L75A 1S1UA 5CYQB 2QA1A 3R5DA 1HW8A 3H2UB 3QSIA 5FLXU 3QAEA 2QL9B 4DUZJ 1RUSA 4L76A 5A6PA 2R7RA 3OL7A 2BQUA 4RUAA 3M8QA 1DLOA 2L9NA 5K8PA 2Z56B 3IM8A 4N8NA 5CABA 4FS2A 3MTKA 4M5DA 2IM3A 1R8HA 3CJKA 3D4JA 4FF2A 3GG1A 4HL9A 3CCLS 3PVXA 3H20A 4UOFA 3QWPA 3OQ2A 3HKZD 4HHHA 5KFYA 1NJYA 4DL5A 3N4WA 3SCIE 3PKMA 2HBYB 2EI5A 4C11A 1DBDA 5F3ZA 1RCOB 2UVVA 2CPXA 2HG4A 2RAQA 2MZQA 5I3UB 2J9CA 5LXYA 2DGQA 2MQMA 4LF7J 1BMQB 4OZ2A 2RS8A 2U2FA 2V2VA 3QMQA 1Q8LA 2BE7D 5C5JA 4G65A 3KOAA 2VG5A 1YHQS 4OYPA 2DK2A 4MAKA 2WRMA 4ECTA 2Z2YB 5FIIA 3GJSB 2XCAA 4ICLB 1Y4ZB 2GGPA 3KDOA 2X7IA 1UETA 1Z2ZA 4X62J 2YVSA 4OZLA 1QTNB 1TFYA 4NI2A 4HDGA 5KFCA 3GV8B 4DV2J 3NL0A 4G1PA 1X5OA 1YWXA 4PQUB 4LUBA 2W4CA 5L1KA 1VIOA 1IKWB 1VRQC 2XLKA 4S0MA 5AE3A 1FJGF 4BC9A 2E5LJ 4RBUA 1VK3A 3DGVA 1RJJA 5DS7A 4EZ6A 3HKWA 1NDCA 1I94J 1WD6A 4J9VA 2AEMA 3W8PA 3ZZRA 1X4DA 2C28A 1UPMB 2NUHA 3T3FA 5J2PA 1YI2S 1UCNA 3GIIA 4D3HA 5AE1A 1SKSA 2CNOB 2YPYA 2AJQA 1RBLA 2MY8A 4G1IA 2IA0A 4WWSA 3TJAA 2IDLA 3D6TB 1QJHA 3B82A 5E2QA 4M95A 2Z2LA 3EZOA 4A48A 4ZP6A 4M94A 2ZNYA 4OYBA 2Y1JA 3RG6A 1RHRB 1W26A 3BKUA 1ZZFA 1VQOS 4IO1A 1VC6A 2H4YB 4ZCIA 1FE4A 4CDIA 5KG1A 3CT9A 1UEKA 4NOHA 1HD1A 2O5DA 1FFWB 2AQ4A 1Y5NB 2CYYA 3OJUA 1RU2A 3QFWA 3ZO7A 1NRKA 1H38A 1D9FA 3VVTA 4PR6A 2IRUA 3C66A 5M2RA 1NJIT 4C8OA 1MSWD 1S1XA 2VV5A 1KQSR 4DR3J 1Y5LB 3QO9B 4ECRA 4YB5A 5HL7Q 2E29A 3S1TA 1K0TA 4B3MF 3HMJG 4DJBA 1QDUB 4DFMA 4EU0A 3MMCB 4OI0A 4X4NA 3NGSA 3W62A 4B3OB 1ZM2A 2HGNA 2BV3A 1S1WA 3DN9A 2CJXB 4NLUA 3OFHA 3M2UA 1KQKA 1KEKA 3HSGA 5A8KA 5GAEI 1NK0A 1YRUA 3RW6A 2J5AA 2IY5B 3N6MA 1GX5A 2BANA 1JLCA 4TKTA 3TUJC 3W1YC 1FO1A 2XYPB 4DX5A 2VG6A 1KHWA 1K47A 1U49A 2Z2MA 4UTGA 3FSIA 5L1LA 4XTTA 2FVRA 1RT6A 2FJWA 3GYXB 2DNLA 2HHVA 4M5GA 1VFJA 3JQMA 2CADA 3VAIA 4ZLLA 2RS2A 4B17A 4A4JA 2VONA 1EP4B 3ZZYA 2QSFA 3NNAA 2R7XA 5HBMA 1IWAA 5CD4A 2CDRB 3PACA 1T9VA 1R8CA 2Y0SD 1S79A 4F0HA 3LGMA 3VAMA 4IOAQ 1D3WA 5ADZA 1S0VA 4Y2CA 3JAMY 1JLGB 1JJCB 3D1OA 5L46A 4PUOA 1RACB 4L6V3 4GKKF 4L3KA 3A8IA 2FJEB 1C0TA 6FD1A 3MEDA 1PJ6A 1LW0B 3PX6A 4IG3B 4RW7A 1WOPA 2AEJA 2C3OA 5DQHA 2RSQA 4OZNA 4JB8B 4CZCA 3Q22A 1FRXA 3K5MA 3LQVA 3POTB 3AD7C 1J5EJ 1WSVA 1U1PA 1NK4A 2DNQA 3LP0A 2B7CB 3R27A 1Y3KA 1UEVA 3JSMA 1U7LA 3PEJA 1R0AA 2J0QD 1OY6A 2MEWA 4USUA 2EFQA 3HSJA 4USVA 3TWZA 2AKWB 2C2NA 1K73T 1ZM9A 1XNRF 1WOOA 4QBUA 1HI8A 2VG7B 3TX8A 4X65J 2F9JA 1F6TA 1YJWS 3HJFA 2KRBA 1S6PA 1KHVA 3LF0A 3HVRA 1HA1A 2YWFA 1TK8A 1VS3A 3ITHB 2Z57B 1U1NA 3G82A 1TVRA 2E7VA 2XY7A 2AX0A 5J2MA 4WXOA 1K8AT 2HKEA 2ASJA 3GLJA 1OJ4A 2P9EA 3T5HA 2GIFA 1UW9A 1FKOA 1C2PA 2V67A 2WVCA 2WVDA 1JLQA 2LU2A 2AIRB 3O5TB 4ED2A 4MTPA 4RW8B 5KG6A 4U9RA 3KMQA 2DRBA 4ZHRA 1UJ4A 2RUSA 5M2UA 3EGWB 3KUHA 4D3GA 2W2MP 2GAGC 2RIJA 3G9CA 3CMES 3DLKA 3VAJA 3NXZA 3MCOA 4DR6J 4NASA 3V4IB 4IH7A 1T0TV 4FPRA 5KT7A 3UWTA 2MQQA 4FNHA 1JLEB 4LF4J 2O01C 3W60A 2ATLA 3DLBA 3G8QA 2N4DA 1YK9A 4LT6A 3HK2A 4PEOA 4F50A 2EFVA 3SFUA 2HNZB 5KOXA 1RKIA 4P73A 4YDXA 4F0MA 4TU8A 3ETOA 4M5JA 1MWYA 2X3DA 2EG2A 4MKYA 1TKTA 4I6WA 1QD1A 1LQ9A 5LOQA 1PAEX 1UVJA 1JXEA 2KYXA 4O4RA 3DU6A 1HYSB 1BQNB 2ZWPA 1EJ7L 3G6XA 5D4NA 5A8RA 1WHXA 1E6VA 2ADBA 1V3ZA 2RMLA 2P9GA 2EC0A 1SJ3P 2HBQB 2ZHBA 3ZZUA 3BDEA 4OI3A 3TNVA 3PDNA 1J2VA 1O5JA 1T11A 3TJ9A 2MB0B 3EGZA 2DR5A 4F4ZA 3PRBA 2FLPA 3FSXA 4LQ9A 4C98A 4CO1A 1Q4RA 4I0WA 3DI6A 1NDPA 3SSSA 4JI5J 5ETTA 3I31A 1Q86T 3ENWA 2XBPA 2YNGB 5C2GA 4C97A 4LSLB 4OLPA 3BQ1A 3M2RA 4Q43A 3IS9B 3M2VA 4DR1F 3AY0A 5JUMA 4X4OA 3GQCA 2HFOA 2OUGA 3I0RA 3AXKA 3RAQA 3KLEA 2YH0A 1W25A 4DR7F 4H4MB 2BR0A 5HQMA 1WHWA 3L95X 3OR1B 3CXCR 2B8PA 1TMJA 2OSRA 4USJC 2MXYA 3CCSS 5L8RC 1NO8A 1UFWA 3JSBA 4CI0B 1X4CA 4DV7J 3H59A 2PI5A 2CQIA 2C2DA 2UU9J 3UN5A 3QJJA 4LRBA 3FQKA 3GYNA 5BYQA 1LK7A 4NLSA 1J5OB 3RB3A 1ZAWA 2C2OB 1OS5A 5CYMA 3B8HA 4I6AA 4K0KF 2CA9A 2JVOA 4C8MA 3DM2A 2LU1A 4X66J 1AT1B 1U47A 1BC6A 3HFVA 2O66A 3WX4A 1SUQB 2NR0A 2W9AA 3NGKA 3L09A 1EKRA 4BHQA 2H5IB 4RUBA 1XIQA 4ETXA 3MECB 1YX2A 2FHKA 2B0GA 1UMJA 1FE0A 2FD2A 4EEYA 2CJKA 1GTHA 2CPYA 1NJXA 4QCLA 4JV5J 1U45A 3OR2A 1V3RA 3FMWA 1N5SA 5KT3A 4KRWA 3AJ1A 3RRGA 3FCWA 3FBEA 2VDHA 2IJRA 3PG9A 3T9ZA 1FHTA 1DTTB 1HKAA 5GVQA 2LEAA 2GW8A 4MYUA 2JSXA 2DGWA 2VJVA 3RB6A 4HEA9 1PJ7A 5IM0A 4B3TF 2J8AA 2JHEA 4FF3A 2OP5A 4HR2A 4ELVA 4PRFA 2ZH6A 5CHCB 3K5PA 3KJVB 4FF1A 4QIFA 1U8WA 3M4XA 1N54B 5KFKA 3S6EA 3T1YF 4USIA 8RUCA 3WX8A 2XGQA 2VUGA 1YQHA 2VKZG 5IQQA 2ZVSA 5F8NA 5BYRA 3IRXA 3I4HX 5K14A 4HHJA 4DFKA 5F0UA 3MM9B 2FVSA 2E1CA 2PGCA 2J9DE 4LRFA 2RKIB 3MAAA 5E0OA 1EARA 3R6GB 2E1RA 2J0XA 4RNHA 1AFJA 1M0SA 2DJWA 2QA4G 3PYDA 5F3TA 3IMQJ 5BR8F 3Q89A 3FGVA 5AT1B 3MEGB 5D8HB 2VPWB 2OTLS 4KPYA 4XDCA 4UQGA 4G1QA 4YEAA 3HDSA 3C46A 1FD2A 2IVYA 1R6VA 3DOMB 1NB7A 1KVIA 3V6DB 1EETA 3EWGA 3W63A 1IBMF 5J2NA 2BQRA 4P52A 2K1RA 1NLKL 3NCQA 1R3NA 4N8OA 4J9KA 2ROGA 3KLIB 1CQMA 4QR0A 5G0RA 3SQOP 4TY8A 1PIEA 1YJNS 3LP1A 1RWMB 2IA6A 3NGRA 4NXMJ 3DXBA 2XMTA 3RRKA 4CNYA 4P7VA 3PO5A 4WFAQ 3BPDA 3K5LA 1Q7LB 1RT1B 1I6JA 2GFFA 1M5OC 1LFWA 2YKOA 2AD9A 4X62F 2CPJA 2WCXA 8AT1B 1UZDA 2CG8A 2OTJS 1N88A 4DPUA 2DHXA 3TRGA 5KFBA 4DV2F 2XLJA 1KOOA 4C0OC 3LH2S 3CMAS 2BX6A 2BKOA 2RH3A 4I7FB 4DQPA 4JI0J 2E1AA 3UVJA 1SC6A 2MHNA 1RA7A 1RHKB 1KLNA 1IR2A 2M70A 4NLVA 1RTZA 2E5LF 2ASLA 3RUBL 1TTHB 1S9GA 5IT9Y 2IAJA 4IOCQ 3IG1A 2R2TA 3OXGA 4J9SA 1Q81T 2XMWA 3EPGA 5HVFA 4RR5A 3IC1A 3CJ8A 4NLWA 4QYZJ 3CNQP 5C24B 1HNZJ 5KOWA 2UV8G 5B0DA 3GIKA 4J9UE 2HZVA 1EX8A 1A9NB 2OEJA 1IUJA 2XWYA 2HVZA 4AT1B 2EFOA 3HSZA 2FGCA 4LR9A 2OEKA 3LGNA 1MN9A 3I9ZA 1P27B 4ELTA 4ZA1A 3TAMB 1ELOA 2YNHB 2WVFA 4DU8A 2LDYA 1WC1A 1HQEA 2E5IA 3TA2A 3BS9A 3IWNC 2CWXA 4DR3F 2B3TB 3V4MA 1H73A 4OJGA 1APSA 4NXNF 4R25A 5U47A 1C1CA 1XR7A 3HJVA 1Z4UA 4QYZK 4IKAA 3BSOA 1Q16B 1PJ5A 3EGVA 4I2QA 1T3OA 3HT3A 1REGX 1KONA 2GVDB 4LF2A 4EO6A 4KT0C 3EDRB 2X51A 2F5GA 7AT1B 4IFVB 5GMKa 3MEEB 2OO4A 3JTOA 2KXFA 1FXLA 2KFZA 4DV6J 4BLGA 3IFEA 1N33F 3HZGA 3J80Y 4KO0A 4ECZA 3KK3A 1MN7A 4KIAA 4BWJA 3RB0A 1T03B 4DHVA 4OX9J 2MKCA 3W2WB 2LXFA 2K8GA 2CNKB 1HFEL 2HNDA 3VQSA 3EGNA 5MAOA 4OZJA 4HLBA 4B9MA 4JI6J 4C0HA 1LW2A 2AX1A 2HZAA 5AXNA 1DTQB 1VRTA 1IKYA 3DHWC 3AAWB 2NSCA 1JLBB 4HT5A 3CJ2A 1IBLJ 1CJKB 3C16A 4KHMA 1FNOA 2UXCF 2DNNA 3UE2A 3CJTA 4LSNA 3QT8A 2D74B 3KG4A 2R7OA 1U48A 1U8SA 2YKNB 4C8LA 1B7YB 1WC6A 3E01B 2N7YA 2ILZA 3KLHB 1Q8KA 3RB4A 1Q82T 2W9CA 1D8YA 2V4RA 4YHHJ 1RT4A 1S99A 2IRXA 5DLGA 2CPFA 1FDBA 3AHPA 2WONB 3L4BC 4RKUC 3VWSA 4O0NA 3QZ7A 3RBXA 4W92B 2QL5B 4DQRA 3EXCX 3FZBA 1KVJA 3W2VA 5DETA 2RF2B 3CDWA 2HHHJ 3OJSA 1ZM3A 3KHGA 1WSRA 1UA1A 4O3NA 1YGYA 2D3OR 3MMBB 1J5EF 3CC7S 1FWKA 5AXLA 2MQ8A 1TELA 2P6SA 5HK4A 1CULB 3PRVA 3HD1A 1UAWA 2QLJB 3DGPA 2IIHA 2GZOA 1QVGR 4Y2AA 3C6UB 4X65F 1HI1A 1PBAA 5CCLA 2CQ2A 2XSFA 2VC1A 5HP1B 1T9XA 2GJ2A 1LWEA 4RU9A 2CDQA 4CQ1A 4CO0A 2FZKB 2YTCA 1Q0NA 1ROFA 2D7SA 2ZBQA 2J76E 3JS9A 3IAM9 2Z8QA 5D4PA 1T05B 3BZQA 3DLGA 3BBCA 5CZVA 3T1AA 2K2PA 3UO0A 1VMBA 3KKFA 1HHQA 4DR2J 3HI9A 1HBUA 4RX6A 1N34J 5B0CA 2ZZNA 2HRTA 4QU6A 1HQUA 4JI3J 2BACA 1HBMA 5KFFA 4QIEA 4EI2A 3K89A 2HFVA 3CDEA 5F8LA 3FMBA 3F41A 1BY9A 2RDIA 1WKKA 3G6VA 4WFXA 5B0FA 3QGIA 4RW6B 2MDAA 3AA8A 4FDFA 3GMGA 4ZITA 4DR6F 1V9OA 3SMZA 1TMMA 1LEOA 1NM2A 1OPIA 2DXEA 1P1TA 2KT3A 3L7UA 1GXLA 1S1TB 2EG1A 5CAAA 3CCJS 1PILA 4IH6A 4NLYA 2KKHA 2PFDA 3OT9A 4LF4F 1N36F 2ACYA 2BXJA 4ZP8A 3JYTB 4KTQA 4CT9A 4EMDA 4DG1B 1XBWA 3RGIA 4YN3B 3KHRA 4LF6F 2KHDA 1RZMA 3N5BA 2MY7A 4MKAA 1TK0A 2GJFA 2R7TA 2XMUA 3W5YA 5KTQA 2W2PP 1C1BA 1VBYA 4K7QA 5D3GB 2DEJA 4Q5VA 4EFAC 3TOQA 2VFRA 2A2CA 2BOAA 3NBPB 1TQLA 4ED8A 3HSDA 3UN2A 4KYZA 5EUHA 3LO3A 2Q43A 3V81A 2G2OA 1F60B 2QMXA 4M5MA 2QYCA 3IGNA 4ECWA 2VPZB 3H4BA 3C6TB 1UVNA 1RHUB 5LXRA 1CC8A 2HMIA 1NK9A 1HBNB 5JJBA 4DPTA 1VCTA 1KTQA 1S49A 4ZVRB 4WJBA 1H2UX 5KT4A 2A10A 3H5XA 2WW4A 3UCGA 2NZCA 5KFEA 1FRIA 3MPVA 4C8NA 4UOHA 3RRHA 2IFXA 1VQKS 3OSPA 2G1HA 3WC2A 3AJ2A 3V6JA 4J7CA 1FJCA 2HLUA 4CH1A 2DY1A 1BD6A 1ZYQA 2R2SA 1NK8A 2G2YA 2IVFB 1N6QA 4DQQA 2NPFA 3F56A 2JDJA 3IP0A 2V8PA 2FGOA 3QT5A 4ZJLA 3KLFA 2LXIA 2AT1B 2AJ1A 2IM1A 5KT6A 5C2CA 1VIXA 2YKPA 1WEYA 3M8PB 3B6BA 4KKOA 3DRRA 3DMJA 1KVKA 2DH8A 1ITPA 4WP3A 4DUYF 4X2BA 3O2IA 2LXUA 1R7IA 2UXDJ 2HS4A 2ZHOA 3VAHA 1RTIB 3DHXA 4WZMA 5DG8A 4UOGA 2C3UA 2ZH2A 1HNWF 3M30A 2CJ9A 1SH3A 3CC2S 1SJFA 4PXDA 1CJTB 1GTEA 1WDDA 4ZCKA 3GIMA 3MCNA 3TR5A 3U02A 5DQIA 1RAHB 4M5LA 2V8HA 4PABA 1VQPS 2PIIA 2B9YA 3TVYA 3DNCA 3CB4A 3MAHA 4P6QA 5K20B 7FDRA 2FLNA 2XS2A 1S0MA 3EPIA 5KG0A 4JV5F 3N6LA 1T9YA 2HVHA 2MQPA 1RTHB 2OPRA 1HHSA 1VYAA 4DR5J 4DQIA 3R5GA 3QRQA 5DJBA 5GAEU 4DMZA 2G2ZA 2YWKA 4EGLA 3M9NB 3MURP 3M05A 3D3CJ 3QGHA 2HHSA 2XTJP 3QRPA 5I42B 1QAXA 5G4DA 4ZCMA 4NMXA 5A8WA 4DV4J 3EMTA 1CJVB 3D7SB 5SZTA 3Q2SC 2JEJA 4GVBB 2YNIB 2FZGB 2AGPA 3CW2C 2KJWA 5F8MA 1QLNA 2NXNA 2MHEA 3QIPA 2ZEJA 1MMDA 2I9SA 2AV5A 3J81j 2OPSB 1RT2A 3GG0A 5HSPA 4CYUB 2H5JB 5HVGA 1S9FA 3PNIA 1S4EA 4NWBA 4HACA 2J9DA 4OZ1A 1C4AA 1LWXA 5CA5A 2R7UA 5E3QA 2K3KA 3LALA 1WI6A 2HS0A 3AT1B 4DV1J 4N47A 2BOPA 1P1LA 2LYVA 2PFFB 2V2ZA 3QT7A 4U67Q 2QEXS 4USWA 4ZIWA 1U1KA 4ENOA 2C2KB 1NZ8A 1SQEA 1IM6A 3ZXWA 4DSKA 1TKZB 5LJ3Y 2L48A 1T9TA 1U1QA 1X4GA 5HQLA 2QZ8A 2AJ0A 2WBMA 1VJQA 2MKYA 1YRTA 2A2DA 5KFIA 3J81Y 5CYQA 5DO2A 4UUWA 2Q1LA 3VAGA 2F4FA 2OFGX 3WIUA 3DRPB 1UPPA 1DQ8A 1VOMA 2YXLA 4K5RA 2Y1RI 4OYXA 3UW1A 1PCAA 4C3MA 4Y34A 3PY8A 4DCOB 1VRUB 2M52A 1UVLA 3FSYA 2UUCJ 1CQNA 1I3OB 1S1UB 4PG7A 3ISND 2OJ3A 1YDLA 2R8JA 1FVSA 5GMEA 1L5UA 1YJRA 2ZDPA 4C7QA 3M8QB 5A6WA 3C3LA 3PTWA 1KQFB 3D6FB 3C15A 4M5IA 1EQ0A 3BGOP 2KXHA 3BGRA 4OLOA 4X4UA 2LQ5A 2CG4A 3FBFA 4U6PA 5DGAA 1OSCA 5C7PA 4ED7A 1CG2A 5MLCV 5AE2A 1U1RA 1Y11A 2VQEJ 1JK9B 4IQXA 3NWRA 3U27A 2QIFA 2VZ9A 1RE1B 4B3SJ 1Y00A 2FUG9 3OFEA 4WE1B 2HQGA 1S5ZA 2ZFHA 1X4HA 3THVA 1G7CB 5C42A 4KFBB 1BWEA 4PKDB 2K7JA 2RILA 4ICLA 3HHLA 2CJYB 2KFYA 2MYFA 1HNXJ 4MK8A 4IFYB 2ZKUA 4F2SA 3Q24A 4WF9Q 4DSLA 2VG5B 1GXUA 1YBUA 2YQ1A 2V50A 1FRJA 3NP5A 2XI2A 4PQUA 5B09A 1RK8A 3MM6A 1KN6A 1HWJA 2APOA 4ZVEA 4HYKA 4N5SA 3KG0A 3PEHA 2QTWA 4FP9A 1GEHA 1X0FA 3SDEA 2CAJA 2DHGA 1HNIB 1FA0A 1U26A 4NI2B 1T7PA 1RB0A 2KT2A 4QU7A 1XMOJ 5AJ3J 4FBUA 1RT3A 2MGZA 4WZQA 3KWMA 1H72C 4H54A 5KFRA 3SV3A 4QIGA 3BSNA 1L3UA 3OFFA 1FXDA 3KJQB 1MW7A 1JIHA 3Q8RB 1CS4B 5KFNA 2XB2D 3AA9A 4M5NA 4I6YA 2D9PA 4DV6F 1P8GA 2FHJD 5L1JA 7FD1A 3EYZA 3K58A 5ETNA 3BGFA 3QATA 3AQPA 3DDNA 1OY9A 1VQ6S 1FRMA 3CCRS 1RGVA 3DOLB 5B0AA 2EEYA 4USKA 3GSIA 4DS4A 2JC0A 1E6YA 3BGLA 3TUIC 3O8WA 3NS5A 1I51B 2XS5A 3M1VA 3N0VA 5LMUJ 4H4KA 3M8RA 2D1CA 1QAJA 4USMA 2HIQA 3CCMS 4PWUA 3QO9A 2BW2A 1MU2A 4Q2MA 3T1HJ 3GFXA 3TZXA 3OTOJ 2O3DA 4LR7A 2VD3A 3DOKA 3E3XA 1JLAA 2ZM6J 2QFJA 4B3OA 1F0XA 1CC7A 3CUNA 2IPOB 1S1XB 3JQKA 3CD7A 3W9HA 2X1AA 2GMLA 2C3YA 2BM1A 1B64A 1H0HB 3X1LB 1PYTA 4EZ9A 4QWBA 4X4QA 2YKMB 5IQ6A 5T41A 5SUHA 1GMVA 2AZ1A 3ZNUA 5EWGA 2VHGA 1EKSA 2V69A 5F8GA 3GCXP 1VQ8S 1FWPA 3ZC4A 4LF9F 2A0FB 3V5RA 3PYGA 1JNRB 2BJ1A 4JI4J 4HH0A 2KVIA 2PMHA 5HATA 1WDTA 2QLBB 2I38A 1XERA 4NEZA 5A8KB 2VQFJ 4NE9C 3P5TL 2CVIA 2BANB 1JLCB 4U95A 2DBBA 1RTJA 3AB2B 4AL7A 3HT0A 4DCPB 1X4EA 2VG6B 2Z30B 2G9OA 1MROA 3THPA 5D78A 3H2VE 2ZZMA 4CLTA 3I55S 1CBKA 3QYYA 4F4WA 4OX7A 4NYPA 1RT6B 3M8ZA 3PX4A 2B9WA 1S6UA 3DDIA 2IMWP 3EZ5A 1FERA 3T9NA 1RABB 5L9NA 4IRDA 2N3OA 2E44A 3KYLA 1JLGA 4V19J 1Q5VA 1FRLA 4HT7A 1T02A 3BO4A 1R6YA 2OH2A 4DR2F 1DHMA 3WHIA 1LW0A 3Q8PB 2CQBA 1TKXB 1U6BA 4YB1P 4JI3F 4I4BA 3LUYA 1Y10A 1MMNA 3HHLC 2BKPA 3POTA 3HO1A 3HZEA 3N79A 2ALYB 3UR0A 3TZYA 4PUOB 1N5VA 3GSDA 4ZVHA 2D9OA 1YJ9S 1C0TB 3ICLA 2L08A 2PE8A 3Q8YA 3HPOA 2VFTA 3LAKA 4RW7B 1OYDA 2DD8S 5CD4H 4CLFA 4ZPAA 3EX7B 4C6AA 3O6QA 1HWLA 5HLFA 2OD4A 3JTNA 4M5HA 2KYZA 4C4WA 1RAIB 3JSMB 4DSFA 4P2FA 2LVWA 5KG7A 2XQCA 2OHDA 2R9LA 1I5OB 1OIAA 2YQ3A 1QVFR 3GJRB 4ILRA 2F7VA 1S6PB 4PG6A 3FC9A 2OEMA 4ELUA 3KLVA 1X9SA 5D15A 2IMOA 3MTJA 5J1PA 4EUVA 3VALA 4GO7X 3PX0A 3G82B 1TVRB 3RTVA 1XR6A 5KT2A 5ETRA 3H8YA 5J2MB 3NGUA 1OWXA 3UCUP 1GT8A 4ZPVR 1EQMA 3LPEA 3Q83A 2DPJA 4MK7A 2WVBA 4OHVA 1JLQB 5I4MA 1XR5A 4N7TA 4KHPJ 2V5HG 4WIIA 4H4KC 3V4IA 2C2RA 4I69A 1WACA 4A8XA 1Q79A 4ZHRB 5KFGA 2YH1A 3PO4A 2FVQA 1TFWA 1JLEA 4NZ6A 2JZ5A 3Q2TC 3TEGA 1GQEA 3Q8VA 1N0UA 2LMIA 2HNZA 5ETOA 2WTFA 2CZ4A 2ZUAA 1NSPA 4YY3J 3BBBA 3CGIA 4K4YA 5A0YB 1S9EB 4TY9A 1U2FA 2M2BA 1K0VA 1HYSA 3QWUA 4IR9A 2CJAA 5ETSA 1ULRA 4K5SA 5J1EA 3BBFA 2HHQA 2W4PA 4ZDNA 3OHAA 1TKTB 2KXNB 1URRA 1KQGB 3BJYA 3QPIA 2UXDF 4H4OA 3DLLQ 4OI6A 4I64A 4OQJA 4Q45A 1HR0J 1ICEB 2HGMA 1R0BG 2Y0BB 4NCGB 3BDPA 4LFCJ 3I96A 1E6VB 3GCWP 3QLHA 2HNYA 3BSCA 4UOCA 1H7WA 1SIZA 5E33A 2YNGA 3VV2B 1QTMA 3MOJB 1DY3A 5DDRC 2HHPA 2VKRA 2PMWA 2MKHA 2A6OA 4LSLA 4ZIVA 2HK2A 2HFZA 4DSJA 2J6UA 3IS9A 2E9RX 2ROEA 1ZA1B 4Z7CA 1AXQA 2Q6CA 4WIQA 4QJVA 2RHQB 2ZD1B 4Z37A 2JLEA 3DI6B 5IWAJ 1B0VA 2OLWA 3AQOA 2W01A 4DR5F 1YBTA 2FC9A 2PSZA 4LFBF 1BUXA 3OR1A 2VOPA 1XC9A 1GAOA 4GMKA 3M2RB 5F9LA 5HROB 3ET6A 5IFMA 2RJZA 1LXNA 2P8IA 2M8HA 1SH2A 2JFKA 4WK1A 1ZOTA 2R8HA 3SI8A 5BXIA 5J2QB 3VAKA 1VISA 3KLEB 1J5OA 1IKVA 2RU9A 5D77A 4HI1A 4IYQA 1XMBA 1XTZA 2YX1A 2BE2B 2F8MA 1AUDA 3J7Z5 1T94A 3SCJE 2ZITA 3MZIA 2VDIA 3I82A 4LQ3A 1NAQA 1BHNA 1HPZB 1SUQA 3KK1B 1GFWB 5EN1A 2VASA 1RBOB 3T41A 4LF8J 4ZS6A 4WU3A 3DM2B 4AL6A 3CD0A 2DNRA 1NHKL 3EJMA 3T5LA 4OZ3A 4P75A 3HCXA 2FLOA 2YX7A 1ZM4A 2P2CB 1DTTA 1IXKA 3M6UA 3MPYA 3PYEA 1F5BA 5GMDA 2J7WA 4WYWA 3L7PA 2R4FA 4UZCA 1VBXA 1XEZA 5DDOC 4URQU 1AB8A 3KUEA 4RNFA 3OR2B 2YNFB 1NSAA 3UR3C 3LP2A 4P2SA 4KGXB 3D6HB 4Y0FA 2PT0A 1XNQF 4J91A 4GVLA 2G1DA 3ZNJ1 2C2MB 4P74A 1LNQA 3NAIA 2V34A 4K8RA 4ZPTR 3C14B 3CDAA 3UD5A 1ZH5A 2GVZB 3WDOA 2BKNA 3NOGA 1SCJB 2AYEA 2UUCF 4OYZA 3MM9A 1KBRA 4JP8A 1Q5YA 1JLFA 2RKIA 1XJWB 2IRYA 3U1LA 3J7A1 3JSYA 3CTRA 4N77A 4I67A 1NH8A 5KG5A 2B8QA 4CLPA 2OMLA 2GNKA 4EBCA 2QO3A 2MZRA 4WYLA 5HN0A 5K14B 3MEGA 4NX9A 2LA6A 4TQRA 3CIZA 2MJUA 4N41A 3FEYB 1FX2A 4KGVB 2LQJA 2IDEA 2VQEF 4NCBA 2W7OA 2X1FA 1NKEA 2YY3A 1OYEA 3LW5C 3MPDA 4Y2KA 3V6DA 4AL5A 3K7RA 3CSKA 3LAMA 2OD6A 3T6BA 2HHUA 2QG9B 1S59A 3IAS9 1U0HA 4MJKA 3M6XA 4KH0B 1TL3B 3KHHA 5DRKA 4X64F 3SCLE 3OFGA 1RWWB 3GJQB 4DWIA 1DQAA 1HHTP 1CSJA 1JQGA 4IUFA 5DDPC 2JLFA 1EB0A 1C0UA 5J2NB 1RT1A 2K1RB 3TQ1A 4A8MP 2PD1A 1QE1B 3Q8QB 1HNXF 4MIWA 3MM7A 8ATCB 1X5TA 3UI3A 3R7SB 3F44A 3D9BA 2V4QA 4O23A 1X0PA 3K2YA 2B9XA 4CWBA 3CCES 2DNZA 3QT6A 2HVDA 1Q53A 3HULA 4KY3A 1NK6A 4GRSA 1OQ3A 1JJ2R 3CCQS 1UFKA 3X3UA 2R7WA 3NAHA 4YUDA 2XNRA 2EK6A 4JYAJ 5AJ3F 1QUVA 1GMUA 2LQBA 2FIUA 1F3VA 2VPYB 2UXBF 3UVJB 2KJVA 3W61A 3TYTA 4TXSA 4RUCA 2B56A 4M5KA 5C24A 1UEUA 2IAJB 1MWZA 4PYDA 4ECXA 3CWJA 3QNWB 4BCAA 4UY85 3QGGA 2H51B 1O8BA 3VF0B 3S8SA 2UUAF 2DR8A 2R7VA 3DRXA 2AYGA 1DRZA 3C8YA 1B70B 3PYFA 2FPHX 1NK7A 5IT4A 2AF6A 2NXJA 2YNHA 4CNZA 4R0EA 1X4AA 3TA1A 2XNQA 2ZNZA 3KHLA 2HQDA 4NLQA 4EWTA 3MR2A 3Q8UA 1IR0A 3T1HF 2V8VA 5HJXA 4K4XA 3ILJA 3NOCA 2WSCC 5FDLB 3WC0A 3TX0A 2D3UA 2NYHA 3TI0A 2NXCA 2ZM6F 4FKXA 3CF5Q 1HQEB 4TN2A 1SJQA 4RBVA 2CZVC 5K8OA 4FXDA 2DHSA 3I5BA 4ANEA 1M90T 1JKHB 3KMSA 4IFVA 4LRDA 2IC3A 2K7KA 2UV8A 1FVQA 2XWXA 2KO1A 3GTYX 2DNYA 4DV3F 4UZBA 1NHUA 3CJSA 2GC8A 3MD1A 4B9UA 4TU7A 3SSRA 2HRUA 1Y5IB 1T03A 2VBZA 4I2QB 4RL1A 3KLGA 1SL1A 4JI1J 4XDDA 2X3GA 1RWOB 2XSJB 4HDHA 4DPXA 4F4AA 3JXOA 1D0EA 2AYBA 3EICA 1KKHA 3ZTOA 3PV8A 2L9WA 3CCWA 3M7VA 4QIVA 2XMAA 1ZTWA 1FEHA 2QN6B 1DZ5A 2ZKTA 4DPWA 2ZBPA 4UQTA 2HNDB 1CJKA 2I1RA 5C25B 1F9FA 3P4UB 2DTJA 2YKNA 4GKJF 1RAEB 2VB6A 1T9UA 1H2TZ 3MM5B 3WIVA 1IKYB 1V3SA 2V8DA 1RU1A 2N3LA 4OIXA 2WONA 1M1GA 2DRDA 3CO0P 2PO4A 1FF2A 2GIQA 4AE5A 2CJBA 3C16B 2MQOA 4R5PA 2G0IA 3IRWP 1X5PA 4LSNB 3D66A 2BE9B 2ZH1A 4ILMA 2LKZA 2B4VA 3AH6A 4CLYA 2VOOA 4IOBA 3RYLA 4W90B 3DU5A 3MMBA 1HI0P 1SQFA 2KG1A 2HFNA 3BGUA 1SV5B 3TA0A 2E5GA 1T95A 3W8GA 4K4TA 3PW0A 2HYIB 2I6WA 5L9XA 2Y8YA 1UVKA 4QWCA 3SBMA 2COLA 4LBPA 3C6UA 2W2NP 1W7WA 1JNZB 3U1MA 2BRKA 2C3PA 3SSQA 5HP1A 1IJFB 4NLTA 1AA1B 1OSDA 3L7OA 3OUYA 2OGUA 5DLFA 1KSPA 3T6JA 1H74A 3BN7A 2MMYA 2ZBCA 2BJ3A 2C42A 2J8SA 3DGPB 3R7NB 3G96A 3W64A 1WEZA 3PJWA 4WCEQ 3GIRA 4OYWA 3H40A 2G0CA 1VGYA 3W9IA 1S77D 4FPIA 4I2PB 2W7PA 2FB0A 4MMOA 1LV5A 1DARA 1AW0A 4B02A 3RZAA 3EUNA 2UP1A 1FK9B 3BO2A 2HHTA 4NYOA 4R8UB 3FFIA 1WHVA 1YZ6A 1S76D 2H9ZA 2UVWA 3DLGB 5K5MA 3HP6A 1FRKA 2CQ0A 4WU2A 1W2BR 3GZ7A 4ZCLA 2CVEA 4RW6A 4P9SA 2Q3PA 1HBUB 1DQ9A 5LSRA 3FCVA 5BJRA 4Y2MA 4EBDA 3QBCA 2GO8A 2KZMA 2VFSA 1R27B 2W8KA 1HQUB 4QW8A 1D9DA 1FEEA 3V6HA 4HTIA 1R0CB 2OPQA 3SQGA 5LMNF 3ETMA 1A7GE 3W9JA 4PG8A 4DG1A 5CCMA 4PG5A 2Z4PA 3BKFA 2NLWA 3MR5A 3R97A 5HMXA 4A46A 2UUBF 4JI2J 2HZCA 5KFSA 1UP1A 4ZK7M 4PXEA 3FVYA 4HH1A 5D3GA 4K4UA 1U02A 3GILA 1VR6A 4B9VA 1QY7A 3NBPA 4RNMA 1PSDA 1UKUA 1BQXA 2AEFA 3DC2A 2HQFA 4DR4F 1D1UA 4Z2XA 4DS5A 4BS2A 5ETMA 3SZ2A 4QIWD 4NCAA 4AFFA 1WG5A 3C6TA 6AT1B 4OFZA 1C1BB 2XEXA 2FJXA 2O1PA 2XO7A 3A3OB 3G6YA 1HBNA 1TL7A 3CDUA 1HR0F 1R8AA 3H25A 3DXSX 1R31A 1RHMB 3JAMU 1H7XA 3V81B 3NMAA 3BF4A 1N56A 3R9LA 4DL4A 4IQMA 2LQ9A 4FF4A 1WWHA 1L3VA 2DEIA 4JI7J 2NXUA 2XLIA 2EK1A 2XY6A 3R5BA 2VA3A 4TVAB 2HWIA 5FLXY 1BWVA 2CUYA 2QSWA 4NLPA 4BDPA 2FHOB 4L3NA 2LP4A 2PN6A 5LL6d 3R1HA 4RW9A 3IGVA 1NMEB 3GV5B 2C1EB 2E66A 1YIJS 5EX0A 1PYOB 4RUHA 1TV6B 1SC1B 3SXLA 2L41A 3MR3A 3H90A 2DNKA 5T7LA 4J90A 3AD8C 1RLCL 4K4ZA 2KDOA 4TYAA 4LR8A 3LPYA 4B3RJ 2DIUA 2N7CA 2CPHA 2HK3A 1NDKA 1U24A 3ZTQA 2QT7A 1RHJB 4JI8F 4DN0A 2QLWA 2KU7A 2HRYA 1TU0B 1RT7B 2DGTA 5KFZA 1RTDB 3BPSP 2QFIA 3HM9A 1O6XA 1WORA 2ZBIA 1CJTA 3JSRA 1PGZA 3EXYA 4KKOB 4J9MA 3D67A 2ZOFA 3DMJB 5KT5A 1GK8A 4ED6A 3E51A 1M5PC 4O3QA 2XC9A 1VK8A 1VQSA 1X4FA 2IBOA 2Y3YA 3G86A 5EGYA 2HPUA 1U0SA 4LIRA 3WQPA 1RAJA 2KFNA 2AZ3A 4KJIA 4C3LA 3J7YU 1S97A 3I87A 4ZP7A 3MUTP 5DG9A 2R8GA 2OAUA 3GE9A 2M5YA 2G4BA 4FBTA 1UWBA 4DUZF 3W5XA 3FEZA 2FY1A 4DR1J 1WG1A 1EZZB 1Q8BA 3ZZ0A 2J7KA 5I42A 2R42A 1FNMA 4ED4A 4QZVB 1IM4A 2W9BA 4OYMA 2XZTB 2UZAA 2A18A 2I8EA 4DR7J 3VZHA 1CJVA 4EK2A 2DKOB 4ANDA 1YZ7A 4GVBA 3FEXB 1X8DA 2KN4A 4LVOP 4FYXB 3CJ0A 3WBZA 4BWMA 2OPSA 2Q66A 1BGXT 2LFVA 4IDKB 4CYUA 4J9PA 2VA2A 4ZPCA 4KSEB 4OYOA 5ITHA 2JJ4D 2J0WA 4F3OA 3TARA 3GFZA 5A8WB 1KP6A 4MIBA 2WOMB 4DL2A 2BVZA 3KK2A 1QSLA 4MK9A 4U7UK 4UW2A 4LF5J 4MKVA 2GQQA 4NLDA 4K0KJ 4J9NA 4USTA 1WJ9A 4AUKA 1N5YB 4LF7F 2C2ZB 3H4DA 1U2CA 4K59A 3ILOA 4WK3A 2FHMA 3O3LA 3DLEB 1VI7A 1SL0A 4HACB 1OPZA 2KRRA 3S7RA 2MKJA 1TKZA 4CRJA 3N9UC 2F4VJ 3NWGA 2F9DA 3CDBA 1NHVA 4I68A 2ADCA 2Y8WA 3DKDA 2VBYA 3CMQA 3PFOA 2VC0A 3T5KA 2HQ3A 4DEZA 3IA0A 3IWLA 4KE5A 5B08A 1QAIA 3DRPA 5D0EA 4QOTA 2B5JA 4B3TJ 5GAGU 1S57A 1VRUA 1Y7PA 4DDFA 5IC6B 3W65A 3FRYA 1AYEA 2E7WA 4Q0BB 3IBWA 3G87A 3OLAA 1I94F 4ZVFA 3AFGA 3T1YJ 4MH8A 5F8HA 3NLCA 1FESA 2M4MA 3OLBA 2GHVC 4LF1A 1RP5A 4WTYA 2XMMA 4MFBB 2CRLA 2NREA 2J0SD 3NCPA 4MT1A 4DCJB 1RBAA 1MG7A 3C2PA 2F1FA 3MF5A 4ES1A 4WP9A 2DRAA 2KI2A 2MKKA 2EBEA 2LECA 1PC4A 3G8TA 4JYAF 3TVKA 1KFSA 3MWBA 1ZAVA 1S1VA 2UUWA 5BR8J 5D0GA 1LK5A 3C15B 1B7FA 5AXKA 1LWFB 1NUEA 1K1SA 4KHRA 3BGRB 4KH1B 3NKYA 4WE1A 4K2XA 2GX8A 1IJEB 2BA9A 3P5BP 3R1LA 4KFBA 1YG0A 1HBOA 1BE4A 1YRXA 4ZVOB 1IBMJ 3EM1A 1RWPB 1M5KC 3HD2A 2ROPA 3HVTB 1FKPA 1FFGB 4IFYA 1LWCA 3ZZTA 1HNVA 4KGMA 5IV4A 5C42B 1PC5A 2EVZA 3HHLB 3DLHA 3NNCA 3V6KA 1V5VA 1VQLS 4DFPA 3PM9A 3CD6S 1HNIA 4F26A 2W1BA 1RAAB 5KFVA 3FBCA 3NGDA 4DLEA 3GIJA 4DPYA 1FCAA 3MM6B 3P3DA 2WSFC 3A8JA 3MI7X 1KLMB 5ETKA 1CS4A 1MNEA 4MKBA 4QR1A 3SDEB 3MMAA 1KD1T 1NEEA 2WAQD 2YWWA 2KVQE 3FNNA 2ZZTA 1SC4B 1JJ4A 1RT3B 2MGZB 2JOQA 4QYRA 5KFUA 1CPZA 1U1OA 5IT0A 4O44A 3DOLA 3PIPQ 3BR8A 4KQZA 3ISZA 1SKUB 3AOCA 3TVZA 4JI1F 3MFIA 3QRRA 3JQJA 2AMCB 1UWAA 2DYAA 2RHSB 2NCKL 1RLDA 4ZP9A 1SKWA 1G4CA 4RW4B 3G6ES 4YB7A 3D68A 3OBIA 3DYAB 2WK4A 3FRZA 3O1LA 2V0NA 2H5EA 2H1YA 3FJ2A 4KR0B 1E6YB 5F9NA 5A2QY 2MQLA 2BW7A 4N56A 2B6AB 3G2XA 4U7CA 3I0SA 3M1VB 3DLJA 3KG1A 4LRAA 2XCPA 4ES2A 2RE1A 3EVOA 3NGTA 2BMBA 1ZETA 3BH7B 1S4FA 1L3TA 1MU2B 3GJTB 3H5UA 2GHWA 2R8KA 4NXNJ 4HVZA 2YKMA 4WXWA 4PCQA 3DOKB 4ZOSA 3VHQA 1FTRA
chains in the Genus database with same CATH topology
1N5SA 1LKZA 1JLAB 4A8XA 5KT3A 1Q79A 2MPUA 4KRWA 4ZHRB 5KFGA 3AJ1A 2YH1A 4J9OA 3PO4A 3RRGA 2EWHA 2FVQA 1TFWA 1JLEA 4NZ6A 2JZ5A 3T9ZA 4OJ1A 1FHTA 2FLLA 2YKAA 1DTTB 3HVWA 1V6HA 3Q2TC 1GQEA 1LWFA 4RWXA 5GVQA 1N0UA 2LMIA 4G6VB 3I5CA 2ZHAA 2LLZA 2LEAA 2GW8A 4MYUA 2HNZA 3M6VA 3TAMA 2JSXA 2I5JB 2MZSA 5LMUF 4DBQA 2DGWA 2WTFA 3RB6A 2DGXA 2CZ4A 4HEA9 5IM0A 4B3TF 4CTAB 2J6SA 1N5TA 4F25A 2J8AA 2JHEA 1X7VA 4FF3A 2OP5A 3N6NA 1S1VB 3CGIA 4K4YA 4ELVA 4PRFA 5A0YB 1Y0HA 5T14A 3OTOF 2ZH6A 5CHCB 3K5PA 3KJVB 1S9EB 4TY9A 1U1MA 4FF1A 4OI1A 2IYIA 3MD3A 1U2FA 4QIFA 2M2BA 4J5OA 4KV8A 2RB7A 1NKCA 3OL9A 3LANA 3HVTA 4DLGA 1K0VA 3M4XA 1N54B 3QWUA 1HYSA 1HMVB 1UA0A 4IR9A 2CJAA 3THTA 3S6EA 3U7JA 4USIA 5KFKA 3T1YF 2X1GA 4OJHA 4YOEA 2DB1A 3ENQA 2JH3A 1ULRA 4X4VA 4K5SA 2BQ3A 2A3JA 5J1EA 2B51A 2XGQA 1RTJB 2HHQA 3W7BA 2W4PA 4ZDNA 3OHAA 1TUVA 2VUGA 1TKTB 3TUZC 1HBOB 1YQHA 2HQIA 1FNXH 5D4LA 3KFWX 3OTBA 2VKZG 5IQQA 4JV0A 2ZVSA 5KG3A 1URRA 2KXNB 1MROB 3QZ8A 4DSEA 5F8NA 2JC1A 2L3MA 3IRXA 5BYRA 1IKXB 3OTEA 1KQGB 2PA3A 3I4HX 3QPIA 4HHJA 2V4JB 5F0UA 3CVKA 5K14A 3BJYA 3MM9B 4H4OA 2FVSA 2UXDF 3DLLQ 1VQNS 4OI6A 2XS7A 1C1CB 3MEEA 2E1CA 4QQBA 4F67A 4I64A 4OQJA 3AB4B 1WELA 4Q45A 1KNZA 2PGCA 2NPIA 2J9DE 4HKQA 2DGSA 2HGMA 2RKIB 1FKPB 5K9FA 5E0OA 3RAXA 1TZ0A 2ZOGA 3CCZA 2E1RA 2J0XA 4NCGB 4RNHA 5B0GA 1LWCB 3B4MA 2CQDA 1AFJA 1M0SA 3BDPA 1TKXA 3I96A 3ZZOA 2DJWA 2QA4G 5JVGQ 3BREA 2PA8D 1E6VB 3IO1A 1HNVB 3QLHA 5F3TA 2KG0A 4QR2A 5I3QA 4ZKAA 5BR8F 2HNYA 4B08A 4OV1A 3BSCA 2JX2A 4UOCA 5CQGA 1H7WA 3U1NA 3W2WA 4F3QA 1SIZA 3FGVA 5E33A 2DR9A 1WHYA 3TAPA 4JI4F 2YNGA 1QTMA 3MOJB 2L9DA 1KLMA 3TO8A 4DL7A 5DDRC 2HHPA 2VKRA 3MEGB 3MFHA 2GQ2A 2MKHA 3T5JA 4LSLA 2VQFF 4BC7A 5D8HB 2HFZA 2VPWB 3BQ2A 2OTLS 4DSJA 2VPXB 2J6UA 4KPYA 3IS9A 2E9RX 2ROEA 2YKQA 4XDCA 1FKAF 3PW7A 1X9WA 4UQGA 1AXQA 3D1HA 3K8VA 2Q6CA 4KO0B 2CFXA 3JTPA 4G1QA 3HDSA 4QJVA 4YEAA 2JVRA 1JXLA 3RAMA 1DTQA 4F2RA 2M8DB 2ZD1B 3D0HE 1FD2A 3MGJA 2JLEA 4Z37A 3DI6B 3KK3B 3C46A 2IVYA 1NB7A 1KVIA 3V6DB 3TANA 4E0DA 1EETA 1B0VA 1DAXA 1K1QA 2OLWA 1IBMF 5J2NA 2BQRA 2K1RA 3AQOA 2DGUA 5I3PA 3NCQA 1JLBA 1R3NA 4N8OA 4DR5F 3HHKA 4J9KA 4EYIB 2ROGA 1KOHA 2FC9A 2PSZA 2VFVA 3KLIB 1UVIA 1CQMA 4A8SA 4LFBF 2FTRA 4QR0A 5IS2A 3OR1A 5G0RA 4TY8A 4ZLPA 4F02A 1XC9A 4PWDB 1GAOA 4GMKA 2ZH9A 2VOPA 3R5CA 3LP1A 1YJNS 3M2RB 2IA6A 5F9LA 1LW2B 2ZUGA 4CO3A 1S6QB 5HROB 4LJMA 3MMAB 1U1LA 3DXBA 3E01A 4YQWA 2XMTA 3RRKA 4CNYA 3OVSA 3KLHA 4P7VA 5IFMA 2RJZA 2B7BB 1LXNA 2DIVA 4JI2F 3PO5A 1Z1ZA 1VRTB 4WFAQ 2M8HA 1SH2A 1RQ0A 2JFKA 3QAUA 3K5LA 2CPEA 1NJWA 1QAYA 4WK1A 4RW4A 1ZOTA 2R8HA 3SI8A 1Q7LB 1ZTTA 3K0JA 1RT1B 3VAKA 2GFFA 5J2QB 1H3DA 3KLEB 2CPZA 1LFWA 2YKOA 1M5OC 1J5OA 3QJLA 1S0NA 2AD9A 5KFJA 4X62F 1IKVA 2RU9A 4O44B 2CPJA 3DYAA 5D77A 4Q7AA 1XK8A 2MSSA 2WCXA 5E3PA 4OZ5A 5HLFB 2J9EA 4HI1A 4IYQA 4M63A 3CCUS 2BM0A 2BJDA 2RNEA 3OVAA 2OTJS 1XMBA 1N88A 1TP7A 1XTZA 2W8LA 2IHR1 2YX1A 2BE2B 2DHXA 3TRGA 5KFBA 4DV2F 2F8MA 2XLJA 1KOOA 1AUDA 2RF2A 4Q2LA 3J7Z5 4IO9Q 4C0OC 3LH2S 1T94A 3IR6B 1NKBA 4JI5F 3SCJE 3CMAS 5E3CA 5B7WA 1B0TA 3DRSA 2B6AA 2RH3A 2ZITA 2O67A 3MZIA 4HI2A 4I7FB 4DQPA 4ETZA 4ID5A 3I82A 4LQ3A 1NAQA 1HPZB 1SUQA 3KK1B 2W9CB 2DH9A 2E1AA 1RT4B 1SC6A 4RNNA 2MHNA 1RA7A 4OX8A 4EO8A 1KLNA 2M70A 4NLVA 3ZFVA 5EN1A 2VASA 1DJ0A 3UD4P 1SH0A 2E5LF 2ASLA 2ASYA 3FZ2A 4XPEA 5IT9Y 1S9GA 3E2EA 2E9ZA 1MMLA 3CIMA 4ZS6A 2IAJA 3IR5B 1JJHA 5H9FJ 4IOCQ 3IG1A 3MPWA 4WU3A 3IWXA 2R2TA 3OXGA 3W2VB 2JLGA 4RU2A 3OL8A 3DM2B 4AL6A 2BJEA 3CD0A 4J9SA 2DNRA 1Q81T 5THWA 5FD1A 4K50A 3T5LA 2XMWA 2ALZA 3EPGA 2OSQA 4PXBA 3I0SB 3I32A 3IC1A 1K9MT 2WW8A 5E7OB 2LEBA 4DPOA 2VODA 5F41A 2FLOA 4NLWA 4QYZJ 2YX7A 4DQSA 5KFAA 1ZM4A 4JI7F 2RRAA 1ZPWX 1DTTA 1F2GA 4Q8EA 3QIDA 1IXKA 3M6UA 4QWEA 3MPYA 5K8NA 1HL6A 5C24B 3G4SS 4DL3A 1L3SA 1FJEB 3P96A 3HHEA 5KOWA 2UV8G 2CQPA 2QRRA 4AXJA 3CPWR 4ECUA 3OSNA 1F5BA 1S10A 2J7WA 4WYWA 5B0DA 4DV7F 3L7PA 2I5JA 5KG4A 2R4FA 3GIKA 4A8FA 1QSYA 1T05A 1HWIA 4A8WA 1VBXA 1XEZA 5DDOC 2UU9F 2BDPA 4CTAA 4URQU 3M8SA 4RNFA 3OR2B 1ZPVA 2M3DA 2YNFB 4N76A 3UR3C 1A9NB 1IUJA 2P6TA 3LP2A 2XWYA 2DHAA 2HVZA 4P2SA 4Y0FA 3VAFA 2MJNA 2PT0A 1XNQF 2DO4A 2EFOA 5A0YA 2FGCA 1KFDA 3US5A 2AGOA 3CD5A 1S9EA 3I5AA 1LWEB 3BQ0A 3LGNA 1G2EA 4PQAA 3I9ZA 1P27B 1M1KT 4ELTA 5F8JA 4X66F 2G1DA 1HD0A 4ZA1A 1H2VZ 1HMVA 3W3SA 4ZPDA 5HMYA 3CCVS 3TAMB 1ELOA 2YNHB 3RBDA 1RYSA 3NAIA 1DURA 3SFGA 4QWAA 4ZPTR 1YTYA 2LDYA 2D41A 2XI3A 2R8IA 4B9SA 3HFKA 3CDAA 3VZIA 1ZH5A 1WG4A 3M9MB 1HQEA 2E5IA 3TA2A 2VH7A 3BS9A 4B3RF 3IWNC 3WDOA 2JEFA 2MKSA 1M5VC 4DR3F 2B3TB 4XK8C 1SJ4P 3PIOQ 3V4MA 4YDDB 2AYEA 4OJGA 2UUCF 4OHXA 1APSA 1IKXA 3UFCX 2VBWA 3R3TA 2V4JA 4NXNF 2RQMA 3MM9A 4R25A 2E5JA 5U47A 1R8PA 4AQYF 1C1CA 1RT5A 1YSJA 3BM7A 2GIRA 1YJVA 1JLFA 1XR7A 3CCTA 4QWDA 4KV8B 4KHPF 2RKIA 4J9LA 1Z4UA 1JWWA 4URSA