2E5LM

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
122
structure length
122
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2e5lM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2e5lM02
3SASA 3U6LA 2F5PA 4B3TM 1MU5A 3T1HM 5IWAM 4OX9M 4NXNM 3VK8A 1HNXM 3GPXA 4JI3M 3GQ5A 1TDZA 3GQ4A 1IBLM 1L2DA 3W0FA 3A45A 4LF6M 1HNZM 4DV3M 3J80S 4DV1M 3GQ3A 4YY3M 4DV7M 4KHPM 4DV6M 4X66M 4DR1M 4DV5M 3TWMA 4LFBM 1K3XA 1L1ZA 4PDGA 4NRVA 4X62M 5ITXE 1TDHA 4LF8M 2UUCM 1N34M 1L2CA 4DR6M 2UXBM 3SATA 2UXCM 1HR0M 4JI7M 4GKJM 3JAMS 3SAVA 2OPFA 2F5OA 2OQ4A 2F4VM 4DR3M 1FJGM 1K82A 5ITYA 2F5SA 2EA0A 4DUZM 4G4NA 5ITQA 3C58A 3GPPA 4PDIA 4ITQA 3U6DA 4DV4M 5BR8M 1J5EM 1XC8A 3U6PA 4JI5M 1Z5AA 4NRWA 4PD2A 4G4OA 1PM5A 1L1TA 4DV2M 1HNWM 1L2BA 4NXMM 3TWKA 1R2ZA 4G4RA 4JI1M 4JI0M 4DR5M 4YHHM 4B3SM 5A2QS 3TWLA 2XZFA 2F5NA 2VQEM 3GP1A 2UUAM 2Q2EB 2E5LM 4K0KM 3U6MA 3U6SA 2ZBKB 3GPUA 4AQYM 4B3MM 5ITXA 4X64M 3J81S 5LMUM 1N33M 1N36M 4LFAM 4LF5M 3A42A 2UXDM 4JI2M 4CISA 5ITTA 3SAWA 4GKKM 1PJJA 1PJIA 4DR2M 3GO8A 3A46A 4LF4M 3T1YM 1N32M 1Q3CA 2HKJA 4DR7M 5IT9S 5ITRA 1Q3BA 1Z5BA 1EE8A 4G4QA 1K3WA 4LFCM 5FLXS 4DV0M 5LMNM 2UU9M 1KFVA 1IBMM 3DOAA 4DUYM 4JYAM 4MB7A 1MX0A 1R2YA 1Z59A 4DR4M 1XMQM 4PCZA 2HHHM 4X65M 3SARA 1XNQM 4B3RM 3SAUA 1NNJA 1I94M 3U6OA 3SBJA 3J7AS 3VK7A 2XZUA 4JV5M 4JI8M 2ZM6M 1XMOM 1IBKM 2UUBM 4LF9M 3GPYA 3U6EA 1Q39A 3JR5A 4LF7M 3OTOM 5ITUA 2F5QA 2VQFM 3U6CA 4JI6M 3U6QA 4JI4M 1XNRM 3JR4A 1Z5CA
chains in the Genus database with same CATH superfamily
1XXHE 1TH3A 1T3TA 2NQ8C 4AKIA 1GABA 2DWZB 4OX9M 1NY6A 1NY5A 1IXZA 1HNXM 3LCUA 1NJFA 1JQJC 3GQ5A 3U5ZB 4Q7JA 3R9XB 3FTDA 4TUWA 3J80S 4CJ6A 4DV1M 3L28A 4QOSA 2BWBA 2DHRA 4KLNA 4RKUF 4NSOB 3UJNA 4KHPM 4HEOA 2DZLA 2JY8A 3KSJA 3MJ5A 4ANRA 4B7HA 5EXTA 5H37D 1ORYB 1ZAEA 3FKEA 2ZTCA 3KOZE 5KQDA 1DGHB 1DGBA 3IHPA 4LF8M 2DWNA 1AUAA 1XHBA 1TH2A 1SXJC 2L4EA 3LVWA 3MK6A 5DYIA 1N34M 4DR6M 2UXCM 4L15A 1HR0M 2HAKA 4GKJM 3JAMS 3L25A 1WGNA 1IM2A 3B89A 3NBIA 2F5OA 3FYCA 5E6JA 2C5RA 1IY2A 3E46A 2DI0A 2DAEA 2HWJA 4GIPA 2EA0A 2A5YB 3VLFB 4AKHA 2M60A 4IBJA 3GPPA 4PDIA 2KZUA 5BR8M 3U6PA 5EXXA 2O01F 3HHWA 3C9PA 2R44A 1Z5AA 1QQWA 1TR8A 2WZJA 3NWLA 2O25A 1IN6A 3LMMA 1D2NA 2BWEA 2M5ZA 4DV2M 2CV0A 4JI1M 4DR5M 1OIPA 4GEWA 4M9SA 2V1CA 3LQQA 3VFDA 4YHHM 2F5NA 4B3SM 2QQ8A 3H4JA 1T43A 2G3QA 2UUAM 2QBYA 3E9SA 2V6ZM 3U6MA 2JZ0A 4AQYM 3M6AA 1SG9A 2EKFA 2QNJA 2R0IA 2LXEA 3J7BA 4LGMA 4NOOB 5IZ7D 4LFAM 4CHTB 1N36M 3PVSA 1GL6A 3SMSA 2LVPC 2X4AA 4L16A 4IBFA 3CGWA 3BOSA 3GLHA 5KPTA 1GJTA 3K9OA 1WIVA 1OFHA 3GLIA 1PJIA 2LVAA 3T1YM 1ZMWA 3WHKA 1N32M 1WXQA 2YNMD 1VEJA 1WGLA 1Q3CA 8CATA 2XEPA 4NL4H 1Z5BA 2GQFA 1EE8A 2LVOC 2OO9A 3I51A 3MMPA 3ZCBB 4G4QA 1HQYE 1K3WA 5FLXS 2Y20A 1PJTA 2J7NA 3HU2A 4P16A 1IBMM 2RKOA 1WR1B 2O5RA 2L6OA 4MB7A 3AV0A 1E32A 2ZAMA 4PCZA 2DAIA 2KNAA 5EP2A 1XNQM 3ZC7B 3SAUA 1I94M 3Q8GA 1IN4A 3C3DA 4L4UA 3AOGA 2G8LA 4IIWA 2B3TA 3IG5A 1IBKM 2QBYB 2VF8A 4MM3B 3VKHA 2DENA 4I4LA 3IG8A 2Z4SA 1V33A 1JR3E 1IXRC 1D0LA 2VDBB 2Z8YM 4QHTA 2HL7A 4Z8XA 3K92A 3L26A 3JR4A 3K9PA 1IN5A 3HHYA 3GLFA 4B3TM 4AW4A 1QUTA 2K47A 2CHVA 1KYIA 1G4AE 4NXNM 3GLIE 5EP1A 3SMPA 5L8RF 3GPXA 4LG2A 4DBGB 3GQ4A 1ZV1A 1SXJB 4GH9A 2MH8A 2BJVA 3DFZA 2CWBA 1QDRA 1SXJE 2DXIA 1GL7A 3GQ3A 1G8PA 2FS1A 2R62A 2JZ1A 4DV6M 3B74A 4DV5M 2CHGA 3TWMA 2RRUA 1Q02A 1XB2B 3FE3A 1NHGC 2R65A 4NSRA 5JI2E 1K3XA 2BNKA 3KVWA 3KOWE 4PDGA 3B7NA 1GKIA 1YLAA 2DZNB 3M0EA 1ZMVA 1XXHB 2R45A 2C9CA 2QSFX 1JB0F 4FWHA 3SHGB 1IN8A 1JR3D 1H6UA 2GNOA 4GHLA 2UXBM 1QVRA 4EIWA 4FD2A 3SATA 4D80A 4MH0E 1C1KA 4I5SA 1QAMA 4LGYA 3ILKA 2WSEF 2DHYA 3U61B 4F1IA 4DR3M 1FJGM 3J2PB 7CATA 3H4MA 2I7PA 2QP9X 2JWSA 5ITQA 4BB9A 1YSYA 2K9DA 4QNRA 1S3SA 1NV8A 2L7IA 3KOXE 1SXJD 3U6DA 2H1RA 4L8RC 2KNVA 2LNHC 4JI5M 4FWDA 1ZMUA 3EIHA 3CF0A 1L8QA 2KZSA 2L2DA 1IQPA 1VEGA 3KP0E 4PD2A 1L1TA 4MGZE 3E21A 3VKGA 1IXSA 2KRUA 4KODA 4I81A 1PJQA 2DZOB 1L2BA 4IBDA 1G41A 1QANA 1AIPC 1QZMA 3CF2A 4L6V6 4LZJA 2XZFA 4AI6A 4OVZA 3GP1A 3HHXA 1VG5A 2EO2A 3D8LA 3GRRA 3RE8A 3UZUA 1DGFA 3KOYE 1DO0A 2ZBKB 3LQRA 3GPUA 5ITXA 4MGYE 3J81S 5LMUM 3HWSA 4LF5M 2Z4RA 1E94E 5EJCA 4CISA 5ITTA 2XSZA 1E9RA 3HY5A 3GRVA 3FTEA 3A46A 4LF4M 4RNAA 2C96A 2FH0A 1TF0B 3I01M 4LRSA 2D7GA 1QUSA 3B9PA 2ZTDA 4GC9A 5IT9S 2YR0A 4D82A 1EIJA 3RGSA 2DAGA 4FW9A 3RGPA 4IBEA 4DV0M 2C98A 2UU9M 2LHCA 4LJ5A 4WURA 3V76A 1NHWC 2MJ5B 2HHHM 2FFJA 1GLNA 2W82A 2CUZA 4MGKE 2LH0A 1DGGA 4M0DA 3LCVB 4Y28F 1V92A 1KSFX 4OVZB 4S12A 2ZM6M 3BBZA 4M9ZA 2UUBM 4MGHA 1CUKA 3GPYA 3AJIB 4LF9M 1Q39A 3JR5A 3FUTA 3BXWA 5ITUA 2F5QA 3UMMA 2JY5A 3U6CA 1F4IA 4JI6M 1XNRM 2V1UA 1Z5CA 2YQZA 3FUXA 5BPVA 2ERCA 1I4WA 2DAKA 3TPZA 2H5XA 3TE6A 3T1HM 4G6ZA 3ZQJA 1GJSA 2JUJA 3I4YA 3UK6A 4JI3M 2XFSA 4GRIA 3B7QA 1L2DA 3W0FA 3EIEA 3HGIA 5KQ8A 4NC6A 5E26A 4FWGA 1VEKA 1HNZM 3A98B 4QNMA 3TL4X 4FCVA 2L4FA 4REZA 2X49A 4X66M 4DR1M 2WSFF 3QYBA 5JI3E 2OOAA 2R4EA 1L1ZA 2LVNC 1R5LA 3IECA 1GVNA 1UFZA 2MGWA 4X62M 3W67A 2KNZA 3LW5F 5FSWA 1TDHA 4R3DA 3GLHB 3R8FA 2KA6B 3GLIB 3GLHE 4B08A 2CEAA 4JI7M 2DAMA 3SAVA 2JA2A 4R7GA 1VDDA 2F4VM 2QENA 3PNVA 4L78A 5GKNA 5ITYA 2F5SA 3KXEC 3QAUA 4DUZM 1HT2E 4G4NA 3C58A 1OFIA 1J09A 5KPRA 1QAQA 2CFOA 3KS8A 2MR9A 3SYKA 1HT1E 2Y21A 4DV4M 1N77A 1XC8A 3FUUA 4IJEA 3T38A 4WP2A 3C3EA 2EJSA 2KEBA 2RGOA 2R6FA 2XGNA 4RF1A 3I4VA 3U5ZA 1NJGA 1V34A 3I04M 3HHZA 1OAOC 3FTCA 3K1JA 3Q8XA 1W5SA 1R2ZA 4G4RA 1E9SA 1EFUB 1OJLA 4JI0M 5KPZA 3KFUG 3HJQA 3TWLA 3FUWA 1QZEA 3QWLA 5A2QS 4IBGA 2XF3A 4LJ6A 2VQEM 2FNAA 1QDTA 3FRIA 2E5LM 3GLFB 3E4RA 1LV7A 3U6SA 3NBXX 5DNYA 1XWIA 3GLFE 4B3MM 4LY6A 3ZH9B 4GC5A 1DV0A 3AFHA 1TH4A 5FTJA 3SAWA 4GKKM 1DGHA 4JN6A 1OTRA 3AOEC 4LJ8A 4RF0A 3PXGA 3WHLA 5FTNA 2I7NA 1MN3A 1TGUA 3HJ8A 3SYLA 4DR2M 2JY6B 2L7HA 3M7GA 1W5TA 3UGJA 2HKJA 2HCBA 1WHCA 3KS4A 2J5YA 5EP4A 5ITRA 4DR7M 5DYGA 5C18A 1PJSA 3FYDA 1UM8A 4AG6A 4LFCM 1GO5A 5EP3A 1YUBA 4DUYM 2DKLA 4CIZA 4JYAM 1MX0A 1IY0A 2LBCA 1Z59A 1R2YA 3AL0C 2CRUA 2RGHA 2CP8A 4IBKA 2LVQD 2EKKA 2CV2A 3T6PA 1NO1A 2K0BX 1NNJA 3U6OA 1G3IA 3FUVA 1QAOA 1R6BX 2XZUA 3KSXA 4JV5M 2J7OA 4FCTA 3PFIA 4JI8M 1XMOM 4M9XA 2LHGA 3U6EA 3GLGA 2KW0A 1P3QQ 2R46A 3OTOM 4LF7M 3HU1A 2VQFM 4ZPXA 2XFTA 4P17A 3U6QA 1C7YA 4JXJA 3QYEA 2P5TA 1RU3A 2VIIA 3U6LA 2F5PA 2Z7JA 1MU5A 1TTEA 4I8OA 4M0WA 2QHOB 5IWAM 3SC3A 3DA1A 5FTKA 2JY7A 3KP1E 1NVMA 3VK8A 3LVVA 2L09A 1N78A 1TDZA 4LJ9A 4WW0A 4PT5A 1LTMA 2KRKA 2D7EA 1IBLM 1IXSB 1T6OA 1A5TA 3FTFA 3A45A 4G3OA 4LJ4A 4LF6M 4DV3M 1NNUC 3J27B 4IBIA 1OAIA 4QHSA 3AOEA 1HQCA 4F2LA 4YY3M 4DV7M 2ZANA 4CGYB 3KDSE 1D0MA 5FTLA 4LFBM 3GRYA 2C9OA 3K2LA 4NRVA 3TWKA 3KW6A 5C1BA 5ITXE 1N75A 3GLGB 4II7A 2DWMA 2UUCM 4MGIE 2QZ4A 1PRBA 2R4JA 3HU3A 3GLGE 1L2CA 2FE8A 2D7HA 4IBBA 2C99A 1R4GA 3L29A 1X37A 1OQYA 2FOIC 4FCWA 1JR3A 1MJGM 3F92A 3FRHA 3HJSA 4Z6YA 2OQ4A 2OPFA 2DNAA 1R7RA 4LJ7A 1K82A 1HJPA 2QPAA 1DO2A 3FD9A 5IREB 2DWLA 1OIZA 3SFZA 4ITQA 1Y8GA 3GRUA 1J5EM 2LWXA 2QCUA 1BVSA 2CHQA 3SASA 4NRWA 3VDPA 4BLCA 4G4OA 4XBOA 1PM5A 1SXJA 1ZQ9A 3HZJA 1Z6TA 3HX3A 4AZFA 1HNWM 4OU7A 4NXMM 1D0KA 1YE9A 2APLA 4OW0A 3L2AA 2XH9A 4XGIA 2KHHA 3B7ZA 3RFWA 3TQSA 4D81A 4KT0F 2Z3XA 5F3WA 4KO8A 3CF6E 2JXNA 5KO3A 2KXEA 2ZAOA 2Q2EB 4LCBA 4K0KM 2XSZD 2JNHA 3HKPA 4BBAA 3U60A 3T15A 4X64M 4W5WA 1N33M 4XK8F 1PGYA 2EUCA 3A42A 3DZDA 1VQ1A 4JI2M 4B7GA 2UXDM 1XXHA 4GITA 5FTMA 1IY1A 3D8BA 1PJJA 1FNNA 5EXPA 3MHVC 3W68A 2LTUA 2JP7A 1NSFA 5DFLA 3SHFA 3GO8A 4FVMA 4AG5A 2YFQA 2MROB 4QOZC 1IN7A 1Q3BA 3U61A 2BJWA 2CE7A 1WJ7A 2XLJA 5EQTA 4AKGA 5LMNM 4IJFA 2OOBA 2Y0QA 1KFVA 1G59A 3DOAA 4B7FA 2G5GX 4DR4M 5EXSA 1XMQM 3VDUA 3CTWB 3K8ZA 4HLQA 4X65M 3SARA 4B3RM 3L27A 2Y0TA 4LRTA 4UN2B 1J7KA 2KDLA 3SBJA 3J7AS 2X8AA 2DVWB 2N35A 3VK7A 4LZZA 4A3VB 1IFYA 1VDLA 4GMQA 3THGA 4IBCA 2WSCF 3AKZA 1NV9A 3PNYA 4LJAA 2R18A 2CV1A 3U60B 4GHAA 1OKSA 1QYRA 2K6BA 4R71A 4HL4A 2AHMA 2VF7A 1G71A 4JI4M 3W0LB
chains in the Genus database with same CATH topology
1TH3A 1T3TA 2NQ8C 4AKIA 2DWZB 4OX9M 1NY6A 1NY5A 1IXZA 1HNXM 1NJFA 1JQJC 3GQ5A 3U5ZB 3R9XB 3FTDA 4TUWA 3J80S 4DV1M 3L28A 4QOSA 4KLNA 2DHRA 4NSOB 3UJNA 4KHPM 3KSJA 3MJ5A 4B7HA 5EXTA 5H37D 1ORYB 1ZAEA 3FKEA 3KOZE 5KQDA 1DGHB 1DGBA 4LF8M 2DWNA 1N34M 1XHBA 1TH2A 1SXJC 3LVWA 3MK6A 4DR6M 5DYIA 2UXCM 4L15A 1HR0M 4GKJM 3JAMS 3L25A 1IM2A 3NBIA 2F5OA 3FYCA 5E6JA 2C5RA 1IY2A 4GIPA 2EA0A 2A5YB 3VLFB 4AKHA 2M60A 4IBJA 3GPPA 4PDIA 2KZUA 5BR8M 3U6PA 5EXXA 3HHWA 1Z5AA 1QQWA 3NWLA 1IN6A 3LMMA 1D2NA 2CV0A 2M5ZA 4DV2M 4JI1M 4DR5M 4M9SA 3VFDA 4YHHM 2V1CA 3LQQA 2F5NA 4B3SM 2UUAM 2QBYA 3E9SA 2V6ZM 3U6MA 4AQYM 3M6AA 4LGMA 3J7BA 2LXEA 4NOOB 5IZ7D 4LFAM 1N36M 4CHTB 3PVSA 1GL6A 3SMSA 2X4AA 4L16A 4IBFA 3GLHA 3BOSA 5KPTA 3GLIA 1OFHA 1PJIA 3T1YM 3WHKA 1N32M 1WXQA 2YNMD 8CATA 1Q3CA 2XEPA 4NL4H 1Z5BA 1EE8A 3I51A 3ZCBB 4G4QA 1K3WA 1HQYE 5FLXS 2Y20A 2J7NA 3HU2A 4P16A 1IBMM 2RKOA 2O5RA 2L6OA 4MB7A 3AV0A 1E32A 2ZAMA 4PCZA 5EP2A 1XNQM 3ZC7B 3SAUA 1I94M 1IN4A 4L4UA 3AOGA 2G8LA 4IIWA 3IG5A 1IBKM 2QBYB 4MM3B 3VKHA 4I4LA 3IG8A 2Z4SA 1IXRC 4QHTA 2HL7A 4Z8XA 3K92A 3L26A 3JR4A 3GLFA 1IN5A 3HHYA 4B3TM 4AW4A 2K47A 2CHVA 1KYIA 1G4AE 4NXNM 5EP1A 3SMPA 3GPXA 4LG2A 3GQ4A 1SXJB 4GH9A 2BJVA 3DFZA 1SXJE 2DXIA 1GL7A 3GQ3A 1G8PA 2R62A 4DV6M 4DV5M 2CHGA 3TWMA 1NHGC 2R65A 4NSRA 5JI2E 1K3XA 2BNKA 3KVWA 3KOWE 4PDGA 1GKIA 2DZNB 3M0EA 2R45A 1XXHB 4FWHA 2C9CA 3SHGB 1IN8A 1JR3D 1H6UA 4GHLA 2UXBM 1QVRA 4EIWA 4FD2A 3SATA 4D80A 4MH0E 1C1KA 4I5SA 1QAMA 4LGYA 3ILKA 3U61B 4DR3M 1FJGM 3J2PB 7CATA 3H4MA 2I7PA 2QP9X 5ITQA 4BB9A 1YSYA 4QNRA 1S3SA 2L7IA 3KOXE 1SXJD 3U6DA 2H1RA 4L8RC 2LNHC 4JI5M 4FWDA 3EIHA 3CF0A 1L8QA 2KZSA 1IQPA 3KP0E 4PD2A 1L1TA 4MGZE 3VKGA 4KODA 2KRUA 4I81A 2DZOB 1L2BA 4IBDA 1G41A 1QANA 1QZMA 3CF2A 4LZJA 2XZFA 4AI6A 4OVZA 3GP1A 3HHXA 2EO2A 3D8LA 3GRRA 3RE8A 3UZUA 1DGFA 3KOYE 1DO0A 2ZBKB 3LQRA 3GPUA 5ITXA 4MGYE 3J81S 5LMUM 3HWSA 4LF5M 2Z4RA 1E94E 5EJCA 4CISA 5ITTA 2XSZA 1E9RA 3GRVA 3FTEA 3A46A 4LF4M 4RNAA 2C96A 4LRSA 2D7GA 3B9PA 4GC9A 5IT9S 2YR0A 4D82A 3RGSA 4FW9A 3RGPA 4IBEA 4DV0M 2C98A 2UU9M 4LJ5A 4WURA 1NHWC 2HHHM 2FFJA 1GLNA 2W82A 2CUZA 4MGKE 2LH0A 1DGGA 4M0DA 1KSFX 4OVZB 4S12A 2ZM6M 4M9ZA 2UUBM 4MGHA 4LF9M 3GPYA 3AJIB 1Q39A 3JR5A 3FUTA 5ITUA 2F5QA 3UMMA 3U6CA 4JI6M 1XNRM 2V1UA 1Z5CA 3FUXA 2YQZA 5BPVA 2ERCA 1I4WA 3TPZA 3T1HM 3TE6A 4G6ZA 3I4YA 3UK6A 4JI3M 2XFSA 4GRIA 1L2DA 3W0FA 3EIEA 3HGIA 5KQ8A 5E26A 4FWGA 1HNZM 3A98B 4QNMA 3TL4X 4FCVA 4REZA 2X49A 4X66M 4DR1M 5JI3E 2R4EA 1L1ZA 1GVNA 4X62M 5FSWA 1TDHA 4R3DA 3GLHB 3R8FA 2KA6B 3GLIB 4B08A 2CEAA 4JI7M 3SAVA 2JA2A 4R7GA 1VDDA 2F4VM 2QENA 3PNVA 4L78A 5GKNA 5ITYA 2F5SA 3KXEC 3QAUA 4DUZM 1HT2E 4G4NA 3C58A 1OFIA 1J09A 5KPRA 1QAQA 2CFOA 3KS8A 3SYKA 1HT1E 2Y21A 4DV4M 1N77A 1XC8A 3FUUA 4IJEA 3T38A 2KEBA 2RGOA 2XGNA 4RF1A 3I4VA 3U5ZA 1NJGA 3HHZA 3FTCA 3K1JA 3Q8XA 1W5SA 1R2ZA 4G4RA 1E9SA 4JI0M 1OJLA 5KPZA 3KFUG 3HJQA 3TWLA 3FUWA 5A2QS 3QWLA 4IBGA 2XF3A 4LJ6A 2VQEM 2FNAA 2E5LM 3GLFB 3E4RA 1LV7A 3U6SA 5DNYA 1XWIA 4B3MM 4LY6A 3ZH9B 4GC5A 3AFHA 1TH4A 5FTJA 3SAWA 4GKKM 1DGHA 4JN6A 4LJ8A 3AOEC 3PXGA 4RF0A 3WHLA 5FTNA 2I7NA 1TGUA 3HJ8A 3SYLA 4DR2M 2L7HA 3M7GA 1W5TA 3UGJA 2HKJA 2HCBA 5EP4A 3KS4A 4DR7M 5ITRA 5DYGA 5C18A 3FYDA 1UM8A 4AG6A 4LFCM 5EP3A 1YUBA 4DUYM 4JYAM 1MX0A 1IY0A 1R2YA 1Z59A 3AL0C 2RGHA 4IBKA 2CV2A 1NNJA 3U6OA 1G3IA 3FUVA 1QAOA 1R6BX 2XZUA 3KSXA 4JV5M 2J7OA 4FCTA 3PFIA 4JI8M 1XMOM 4M9XA 3U6EA 3GLGA 2KW0A 2R46A 4LF7M 3OTOM 3HU1A 2VQFM 4ZPXA 2XFTA 3U6QA 4JXJA 3SASA 2P5TA 2VIIA 3U6LA 2F5PA 2Z7JA 1MU5A 4I8OA 4M0WA 5IWAM 3SC3A 3DA1A 5FTKA 3KP1E 1NVMA 3VK8A 3LVVA 2L09A 1N78A 1TDZA 4LJ9A 4WW0A 4PT5A 1IBLM 2KRKA 2D7EA 1IXSB 3FTFA 3A45A 4LJ4A 4LF6M 4DV3M 1NNUC 3J27B 4IBIA 4QHSA 3AOEA 1HQCA 4YY3M 4DV7M 2ZANA 4CGYB 3KDSE 5FTLA 4LFBM 3GRYA 2C9OA 3K2LA 4NRVA 5C1BA 3KW6A 5ITXE 1N75A 3GLGB 4II7A 2DWMA 2UUCM 4MGIE 2QZ4A 2R4JA 1L2CA 3HU3A 2FE8A 2D7HA 4IBBA 2C99A 3L29A 1X37A 2FOIC 4FCWA 1JR3A 3HJSA 4Z6YA 2OQ4A 2OPFA 1R7RA 4LJ7A 1K82A 2QPAA 1DO2A 3FD9A 5IREB 2DWLA 4ITQA 3SFZA 3GRUA 1J5EM 2LWXA 2QCUA 2CHQA 4NRWA 3VDPA 4BLCA 4G4OA 4XBOA 1PM5A 1SXJA 1ZQ9A 1Z6TA 4AZFA 1HNWM 4OU7A 4NXMM 3TWKA 1YE9A 4OW0A 4XGIA 3L2AA 2XH9A 3RFWA 3TQSA 4BBAA 4D81A 2Z3XA 5F3WA 4KO8A 3CF6E 5KO3A 2KXEA 2ZAOA 2Q2EB 4LCBA 4K0KM 2XSZD 3HKPA 3U60A 3T15A 4X64M 4W5WA 1N33M 2EUCA 3A42A 3DZDA 2UXDM 4JI2M 4B7GA 1XXHA 4GITA 5FTMA 1IY1A 3D8BA 1PJJA 1FNNA 5EXPA 3MHVC 3SHFA 3GO8A 1NSFA 4FVMA 4AG5A 2YFQA 4QOZC 1IN7A 1Q3BA 3U61A 2BJWA 2CE7A 2XLJA 5EQTA 4AKGA 5LMNM 4IJFA 2Y0QA 1KFVA 1G59A 3DOAA 4B7FA 2G5GX 4DR4M 5EXSA 1XMQM 3VDUA 3CTWB 3K8ZA 4HLQA 4X65M 3SARA 4B3RM 3L27A 2Y0TA 4LRTA 1J7KA 3SBJA 3J7AS 2X8AA 2DVWB 3VK7A 4LZZA 4A3VB 4GMQA 3THGA 4IBCA 3AKZA 3PNYA 4LJAA 2R18A 2CV1A 3U60B 4GHAA 1QYRA 4HL4A 2AHMA 4JI4M 3W0LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SAS A;  3U6L A;  2F5P A;  4B3T M;  1MU5 A;  3T1H M;  5IWA M;  4OX9 M;  4NXN M;  3VK8 A;  1HNX M;  3GPX A;  4JI3 M;  3GQ5 A;  1TDZ A;  3GQ4 A;  1IBL M;  1L2D A;  3W0F A;  3A45 A;  4LF6 M;  1HNZ M;  4DV3 M;  3J80 S;  4DV1 M;  3GQ3 A;  4YY3 M;  4DV7 M;  4KHP M;  4DV6 M;  4X66 M;  4DR1 M;  4DV5 M;  3TWM A;  4LFB M;  1K3X A;  1L1Z A;  4PDG A;  4NRV A;  4X62 M;  5ITX E;  1TDH A;  4LF8 M;  2UUC M;  1N34 M;  1L2C A;  4DR6 M;  2UXB M;  3SAT A;  2UXC M;  1HR0 M;  4JI7 M;  4GKJ M;  3JAM S;  3SAV A;  2OPF A;  2F5O A;  2OQ4 A;  2F4V M;  4DR3 M;  1FJG M;  1K82 A;  5ITY A;  2F5S A;  2EA0 A;  4DUZ M;  4G4N A;  5ITQ A;  3C58 A;  3GPP A;  4PDI A;  4ITQ A;  3U6D A;  4DV4 M;  5BR8 M;  1J5E M;  1XC8 A;  3U6P A;  4JI5 M;  1Z5A A;  4NRW A;  4PD2 A;  4G4O A;  1PM5 A;  1L1T A;  4DV2 M;  1HNW M;  1L2B A;  4NXM M;  3TWK A;  1R2Z A;  4G4R A;  4JI1 M;  4JI0 M;  4DR5 M;  4YHH M;  4B3S M;  5A2Q S;  3TWL A;  2XZF A;  2F5N A;  2VQE M;  3GP1 A;  2UUA M;  2Q2E B;  2E5L M;  4K0K M;  3U6M A;  3U6S A;  2ZBK B;  3GPU A;  4AQY M;  4B3M M;  5ITX A;  4X64 M;  3J81 S;  5LMU M;  1N33 M;  1N36 M;  4LFA M;  4LF5 M;  3A42 A;  2UXD M;  4JI2 M;  4CIS A;  5ITT A;  3SAW A;  4GKK M;  1PJJ A;  1PJI A;  4DR2 M;  3GO8 A;  3A46 A;  4LF4 M;  3T1Y M;  1N32 M;  1Q3C A;  2HKJ A;  4DR7 M;  5IT9 S;  5ITR A;  1Q3B A;  1Z5B A;  1EE8 A;  4G4Q A;  1K3W A;  4LFC M;  5FLX S;  4DV0 M;  5LMN M;  2UU9 M;  1KFV A;  1IBM M;  3DOA A;  4DUY M;  4JYA M;  4MB7 A;  1MX0 A;  1R2Y A;  1Z59 A;  4DR4 M;  1XMQ M;  4PCZ A;  2HHH M;  4X65 M;  3SAR A;  1XNQ M;  4B3R M;  3SAU A;  1NNJ A;  1I94 M;  3U6O A;  3SBJ A;  3J7A S;  3VK7 A;  2XZU A;  4JV5 M;  4JI8 M;  2ZM6 M;  1XMO M;  1IBK M;  2UUB M;  4LF9 M;  3GPY A;  3U6E A;  1Q39 A;  3JR5 A;  4LF7 M;  3OTO M;  5ITU A;  2F5Q A;  2VQF M;  3U6C A;  4JI6 M;  3U6Q A;  4JI4 M;  1XNR M;  3JR4 A;  1Z5C A; 
#chains in the Genus database with same CATH topology
 1XXH E;  1TH3 A;  1T3T A;  2NQ8 C;  4AKI A;  1GAB A;  2DWZ B;  4OX9 M;  1NY6 A;  1NY5 A;  1IXZ A;  1HNX M;  3LCU A;  1NJF A;  1JQJ C;  3GQ5 A;  3U5Z B;  4Q7J A;  3R9X B;  3FTD A;  4TUW A;  3J80 S;  4CJ6 A;  4DV1 M;  3L28 A;  4QOS A;  2BWB A;  2DHR A;  4KLN A;  4RKU F;  4NSO B;  3UJN A;  4KHP M;  4HEO A;  2DZL A;  2JY8 A;  3KSJ A;  3MJ5 A;  4ANR A;  4B7H A;  5EXT A;  5H37 D;  1ORY B;  1ZAE A;  3FKE A;  2ZTC A;  3KOZ E;  5KQD A;  1DGH B;  1DGB A;  3IHP A;  4LF8 M;  2DWN A;  1AUA A;  1XHB A;  1TH2 A;  1SXJ C;  2L4E A;  3LVW A;  3MK6 A;  5DYI A;  1N34 M;  4DR6 M;  2UXC M;  4L15 A;  1HR0 M;  2HAK A;  4GKJ M;  3JAM S;  3L25 A;  1WGN A;  1IM2 A;  3B89 A;  3NBI A;  2F5O A;  3FYC A;  5E6J A;  2C5R A;  1IY2 A;  3E46 A;  2DI0 A;  2DAE A;  2HWJ A;  4GIP A;  2EA0 A;  2A5Y B;  3VLF B;  4AKH A;  2M60 A;  4IBJ A;  3GPP A;  4PDI A;  2KZU A;  5BR8 M;  3U6P A;  5EXX A;  2O01 F;  3HHW A;  3C9P A;  2R44 A;  1Z5A A;  1QQW A;  1TR8 A;  2WZJ A;  3NWL A;  2O25 A;  1IN6 A;  3LMM A;  1D2N A;  2BWE A;  2M5Z A;  4DV2 M;  2CV0 A;  4JI1 M;  4DR5 M;  1OIP A;  4GEW A;  4M9S A;  2V1C A;  3LQQ A;  3VFD A;  4YHH M;  2F5N A;  4B3S M;  2QQ8 A;  3H4J A;  1T43 A;  2G3Q A;  2UUA M;  2QBY A;  3E9S A;  2V6Z M;  3U6M A;  2JZ0 A;  4AQY M;  3M6A A;  1SG9 A;  2EKF A;  2QNJ A;  2R0I A;  2LXE A;  3J7B A;  4LGM A;  4NOO B;  5IZ7 D;  4LFA M;  4CHT B;  1N36 M;  3PVS A;  1GL6 A;  3SMS A;  2LVP C;  2X4A A;  4L16 A;  4IBF A;  3CGW A;  3BOS A;  3GLH A;  5KPT A;  1GJT A;  3K9O A;  1WIV A;  1OFH A;  3GLI A;  1PJI A;  2LVA A;  3T1Y M;  1ZMW A;  3WHK A;  1N32 M;  1WXQ A;  2YNM D;  1VEJ A;  1WGL A;  1Q3C A;  8CAT A;  2XEP A;  4NL4 H;  1Z5B A;  2GQF A;  1EE8 A;  2LVO C;  2OO9 A;  3I51 A;  3MMP A;  3ZCB B;  4G4Q A;  1HQY E;  1K3W A;  5FLX S;  2Y20 A;  1PJT A;  2J7N A;  3HU2 A;  4P16 A;  1IBM M;  2RKO A;  1WR1 B;  2O5R A;  2L6O A;  4MB7 A;  3AV0 A;  1E32 A;  2ZAM A;  4PCZ A;  2DAI A;  2KNA A;  5EP2 A;  1XNQ M;  3ZC7 B;  3SAU A;  1I94 M;  3Q8G A;  1IN4 A;  3C3D A;  4L4U A;  3AOG A;  2G8L A;  4IIW A;  2B3T A;  3IG5 A;  1IBK M;  2QBY B;  2VF8 A;  4MM3 B;  3VKH A;  2DEN A;  4I4L A;  3IG8 A;  2Z4S A;  1V33 A;  1JR3 E;  1IXR C;  1D0L A;  2VDB B;  2Z8Y M;  4QHT A;  2HL7 A;  4Z8X A;  3K92 A;  3L26 A;  3JR4 A;  3K9P A;  1IN5 A;  3HHY A;  3GLF A;  4B3T M;  4AW4 A;  1QUT A;  2K47 A;  2CHV A;  1KYI A;  1G4A E;  4NXN M;  3GLI E;  5EP1 A;  3SMP A;  5L8R F;  3GPX A;  4LG2 A;  4DBG B;  3GQ4 A;  1ZV1 A;  1SXJ B;  4GH9 A;  2MH8 A;  2BJV A;  3DFZ A;  2CWB A;  1QDR A;  1SXJ E;  2DXI A;  1GL7 A;  3GQ3 A;  1G8P A;  2FS1 A;  2R62 A;  2JZ1 A;  4DV6 M;  3B74 A;  4DV5 M;  2CHG A;  3TWM A;  2RRU A;  1Q02 A;  1XB2 B;  3FE3 A;  1NHG C;  2R65 A;  4NSR A;  5JI2 E;  1K3X A;  2BNK A;  3KVW A;  3KOW E;  4PDG A;  3B7N A;  1GKI A;  1YLA A;  2DZN B;  3M0E A;  1ZMV A;  1XXH B;  2R45 A;  2C9C A;  2QSF X;  1JB0 F;  4FWH A;  3SHG B;  1IN8 A;  1JR3 D;  1H6U A;  2GNO A;  4GHL A;  2UXB M;  1QVR A;  4EIW A;  4FD2 A;  3SAT A;  4D80 A;  4MH0 E;  1C1K A;  4I5S A;  1QAM A;  4LGY A;  3ILK A;  2WSE F;  2DHY A;  3U61 B;  4F1I A;  4DR3 M;  1FJG M;  3J2P B;  7CAT A;  3H4M A;  2I7P A;  2QP9 X;  2JWS A;  5ITQ A;  4BB9 A;  1YSY A;  2K9D A;  4QNR A;  1S3S A;  1NV8 A;  2L7I A;  3KOX E;  1SXJ D;  3U6D A;  2H1R A;  4L8R C;  2KNV A;  2LNH C;  4JI5 M;  4FWD A;  1ZMU A;  3EIH A;  3CF0 A;  1L8Q A;  2KZS A;  2L2D A;  1IQP A;  1VEG A;  3KP0 E;  4PD2 A;  1L1T A;  4MGZ E;  3E21 A;  3VKG A;  1IXS A;  2KRU A;  4KOD A;  4I81 A;  1PJQ A;  2DZO B;  1L2B A;  4IBD A;  1G41 A;  1QAN A;  1AIP C;  1QZM A;  3CF2 A;  4L6V 6;  4LZJ A;  2XZF A;  4AI6 A;  4OVZ A;  3GP1 A;  3HHX A;  1VG5 A;  2EO2 A;  3D8L A;  3GRR A;  3RE8 A;  3UZU A;  1DGF A;  3KOY E;  1DO0 A;  2ZBK B;  3LQR A;  3GPU A;  5ITX A;  4MGY E;  3J81 S;  5LMU M;  3HWS A;  4LF5 M;  2Z4R A;  1E94 E;  5EJC A;  4CIS A;  5ITT A;  2XSZ A;  1E9R A;  3HY5 A;  3GRV A;  3FTE A;  3A46 A;  4LF4 M;  4RNA A;  2C96 A;  2FH0 A;  1TF0 B;  3I01 M;  4LRS A;  2D7G A;  1QUS A;  3B9P A;  2ZTD A;  4GC9 A;  5IT9 S;  2YR0 A;  4D82 A;  1EIJ A;  3RGS A;  2DAG A;  4FW9 A;  3RGP A;  4IBE A;  4DV0 M;  2C98 A;  2UU9 M;  2LHC A;  4LJ5 A;  4WUR A;  3V76 A;  1NHW C;  2MJ5 B;  2HHH M;  2FFJ A;  1GLN A;  2W82 A;  2CUZ A;  4MGK E;  2LH0 A;  1DGG A;  4M0D A;  3LCV B;  4Y28 F;  1V92 A;  1KSF X;  4OVZ B;  4S12 A;  2ZM6 M;  3BBZ A;  4M9Z A;  2UUB M;  4MGH A;  1CUK A;  3GPY A;  3AJI B;  4LF9 M;  1Q39 A;  3JR5 A;  3FUT A;  3BXW A;  5ITU A;  2F5Q A;  3UMM A;  2JY5 A;  3U6C A;  1F4I A;  4JI6 M;  1XNR M;  2V1U A;  1Z5C A;  2YQZ A;  3FUX A;  5BPV A;  2ERC A;  1I4W A;  2DAK A;  3TPZ A;  2H5X A;  3TE6 A;  3T1H M;  4G6Z A;  3ZQJ A;  1GJS A;  2JUJ A;  3I4Y A;  3UK6 A;  4JI3 M;  2XFS A;  4GRI A;  3B7Q A;  1L2D A;  3W0F A;  3EIE A;  3HGI A;  5KQ8 A;  4NC6 A;  5E26 A;  4FWG A;  1VEK A;  1HNZ M;  3A98 B;  4QNM A;  3TL4 X;  4FCV A;  2L4F A;  4REZ A;  2X49 A;  4X66 M;  4DR1 M;  2WSF F;  3QYB A;  5JI3 E;  2OOA A;  2R4E A;  1L1Z A;  2LVN C;  1R5L A;  3IEC A;  1GVN A;  1UFZ A;  2MGW A;  4X62 M;  3W67 A;  2KNZ A;  3LW5 F;  5FSW A;  1TDH A;  4R3D A;  3GLH B;  3R8F A;  2KA6 B;  3GLI B;  3GLH E;  4B08 A;  2CEA A;  4JI7 M;  2DAM A;  3SAV A;  2JA2 A;  4R7G A;  1VDD A;  2F4V M;  2QEN A;  3PNV A;  4L78 A;  5GKN A;  5ITY A;  2F5S A;  3KXE C;  3QAU A;  4DUZ M;  1HT2 E;  4G4N A;  3C58 A;  1OFI A;  1J09 A;  5KPR A;  1QAQ A;  2CFO A;  3KS8 A;  2MR9 A;  3SYK A;  1HT1 E;  2Y21 A;  4DV4 M;  1N77 A;  1XC8 A;  3FUU A;  4IJE A;  3T38 A;  4WP2 A;  3C3E A;  2EJS A;  2KEB A;  2RGO A;  2R6F A;  2XGN A;  4RF1 A;  3I4V A;  3U5Z A;  1NJG A;  1V34 A;  3I04 M;  3HHZ A;  1OAO C;  3FTC A;  3K1J A;  3Q8X A;  1W5S A;  1R2Z A;  4G4R A;  1E9S A;  1EFU B;  1OJL A;  4JI0 M;  5KPZ A;  3KFU G;  3HJQ A;  3TWL A;  3FUW A;  1QZE A;  3QWL A;  5A2Q S;  4IBG A;  2XF3 A;  4LJ6 A;  2VQE M;  2FNA A;  1QDT A;  3FRI A;  2E5L M;  3GLF B;  3E4R A;  1LV7 A;  3U6S A;  3NBX X;  5DNY A;  1XWI A;  3GLF E;  4B3M M;  4LY6 A;  3ZH9 B;  4GC5 A;  1DV0 A;  3AFH A;  1TH4 A;  5FTJ A;  3SAW A;  4GKK M;  1DGH A;  4JN6 A;  1OTR A;  3AOE C;  4LJ8 A;  4RF0 A;  3PXG A;  3WHL A;  5FTN A;  2I7N A;  1MN3 A;  1TGU A;  3HJ8 A;  3SYL A;  4DR2 M;  2JY6 B;  2L7H A;  3M7G A;  1W5T A;  3UGJ A;  2HKJ A;  2HCB A;  1WHC A;  3KS4 A;  2J5Y A;  5EP4 A;  5ITR A;  4DR7 M;  5DYG A;  5C18 A;  1PJS A;  3FYD A;  1UM8 A;  4AG6 A;  4LFC M;  1GO5 A;  5EP3 A;  1YUB A;  4DUY M;  2DKL A;  4CIZ A;  4JYA M;  1MX0 A;  1IY0 A;  2LBC A;  1Z59 A;  1R2Y A;  3AL0 C;  2CRU A;  2RGH A;  2CP8 A;  4IBK A;  2LVQ D;  2EKK A;  2CV2 A;  3T6P A;  1NO1 A;  2K0B X;  1NNJ A;  3U6O A;  1G3I A;  3FUV A;  1QAO A;  1R6B X;  2XZU A;  3KSX A;  4JV5 M;  2J7O A;  4FCT A;  3PFI A;  4JI8 M;  1XMO M;  4M9X A;  2LHG A;  3U6E A;  3GLG A;  2KW0 A;  1P3Q Q;  2R46 A;  3OTO M;  4LF7 M;  3HU1 A;  2VQF M;  4ZPX A;  2XFT A;  4P17 A;  3U6Q A;  1C7Y A;  4JXJ A;  3QYE A;  2P5T A;  1RU3 A;  2VII A;  3U6L A;  2F5P A;  2Z7J A;  1MU5 A;  1TTE A;  4I8O A;  4M0W A;  2QHO B;  5IWA M;  3SC3 A;  3DA1 A;  5FTK A;  2JY7 A;  3KP1 E;  1NVM A;  3VK8 A;  3LVV A;  2L09 A;  1N78 A;  1TDZ A;  4LJ9 A;  4WW0 A;  4PT5 A;  1LTM A;  2KRK A;  2D7E A;  1IBL M;  1IXS B;  1T6O A;  1A5T A;  3FTF A;  3A45 A;  4G3O A;  4LJ4 A;  4LF6 M;  4DV3 M;  1NNU C;  3J27 B;  4IBI A;  1OAI A;  4QHS A;  3AOE A;  1HQC A;  4F2L A;  4YY3 M;  4DV7 M;  2ZAN A;  4CGY B;  3KDS E;  1D0M A;  5FTL A;  4LFB M;  3GRY A;  2C9O A;  3K2L A;  4NRV A;  3TWK A;  3KW6 A;  5C1B A;  5ITX E;  1N75 A;  3GLG B;  4II7 A;  2DWM A;  2UUC M;  4MGI E;  2QZ4 A;  1PRB A;  2R4J A;  3HU3 A;  3GLG E;  1L2C A;  2FE8 A;  2D7H A;  4IBB A;  2C99 A;  1R4G A;  3L29 A;  1X37 A;  1OQY A;  2FOI C;  4FCW A;  1JR3 A;  1MJG M;  3F92 A;  3FRH A;  3HJS A;  4Z6Y A;  2OQ4 A;  2OPF A;  2DNA A;  1R7R A;  4LJ7 A;  1K82 A;  1HJP A;  2QPA A;  1DO2 A;  3FD9 A;  5IRE B;  2DWL A;  1OIZ A;  3SFZ A;  4ITQ A;  1Y8G A;  3GRU A;  1J5E M;  2LWX A;  2QCU A;  1BVS A;  2CHQ A;  3SAS A;  4NRW A;  3VDP A;  4BLC A;  4G4O A;  4XBO A;  1PM5 A;  1SXJ A;  1ZQ9 A;  3HZJ A;  1Z6T A;  3HX3 A;  4AZF A;  1HNW M;  4OU7 A;  4NXM M;  1D0K A;  1YE9 A;  2APL A;  4OW0 A;  3L2A A;  2XH9 A;  4XGI A;  2KHH A;  3B7Z A;  3RFW A;  3TQS A;  4D81 A;  4KT0 F;  2Z3X A;  5F3W A;  4KO8 A;  3CF6 E;  2JXN A;  5KO3 A;  2KXE A;  2ZAO A;  2Q2E B;  4LCB A;  4K0K M;  2XSZ D;  2JNH A;  3HKP A;  4BBA A;  3U60 A;  3T15 A;  4X64 M;  4W5W A;  1N33 M;  4XK8 F;  1PGY A;  2EUC A;  3A42 A;  3DZD A;  1VQ1 A;  4JI2 M;  4B7G A;  2UXD M;  1XXH A;  4GIT A;  5FTM A;  1IY1 A;  3D8B A;  1PJJ A;  1FNN A;  5EXP A;  3MHV C;  3W68 A;  2LTU A;  2JP7 A;  1NSF A;  5DFL A;  3SHF A;  3GO8 A;  4FVM A;  4AG5 A;  2YFQ A;  2MRO B;  4QOZ C;  1IN7 A;  1Q3B A;  3U61 A;  2BJW A;  2CE7 A;  1WJ7 A;  2XLJ A;  5EQT A;  4AKG A;  5LMN M;  4IJF A;  2OOB A;  2Y0Q A;  1KFV A;  1G59 A;  3DOA A;  4B7F A;  2G5G X;  4DR4 M;  5EXS A;  1XMQ M;  3VDU A;  3CTW B;  3K8Z A;  4HLQ A;  4X65 M;  3SAR A;  4B3R M;  3L27 A;  2Y0T A;  4LRT A;  4UN2 B;  1J7K A;  2KDL A;  3SBJ A;  3J7A S;  2X8A A;  2DVW B;  2N35 A;  3VK7 A;  4LZZ A;  4A3V B;  1IFY A;  1VDL A;  4GMQ A;  3THG A;  4IBC A;  2WSC F;  3AKZ A;  1NV9 A;  3PNY A;  4LJA A;  2R18 A;  2CV1 A;  3U60 B;  4GHA A;  1OKS A;  1QYR A;  2K6B A;  4R71 A;  4HL4 A;  2AHM A;  2VF7 A;  1G71 A;  4JI4 M;  3W0L B; 
#chains in the Genus database with same CATH homology
 1TH3 A;  1T3T A;  2NQ8 C;  4AKI A;  2DWZ B;  4OX9 M;  1NY6 A;  1NY5 A;  1IXZ A;  1HNX M;  1NJF A;  1JQJ C;  3GQ5 A;  3U5Z B;  3R9X B;  3FTD A;  4TUW A;  3J80 S;  4DV1 M;  3L28 A;  4QOS A;  4KLN A;  2DHR A;  4NSO B;  3UJN A;  4KHP M;  3KSJ A;  3MJ5 A;  4B7H A;  5EXT A;  5H37 D;  1ORY B;  1ZAE A;  3FKE A;  3KOZ E;  5KQD A;  1DGH B;  1DGB A;  4LF8 M;  2DWN A;  1N34 M;  1XHB A;  1TH2 A;  1SXJ C;  3LVW A;  3MK6 A;  4DR6 M;  5DYI A;  2UXC M;  4L15 A;  1HR0 M;  4GKJ M;  3JAM S;  3L25 A;  1IM2 A;  3NBI A;  2F5O A;  3FYC A;  5E6J A;  2C5R A;  1IY2 A;  4GIP A;  2EA0 A;  2A5Y B;  3VLF B;  4AKH A;  2M60 A;  4IBJ A;  3GPP A;  4PDI A;  2KZU A;  5BR8 M;  3U6P A;  5EXX A;  3HHW A;  1Z5A A;  1QQW A;  3NWL A;  1IN6 A;  3LMM A;  1D2N A;  2CV0 A;  2M5Z A;  4DV2 M;  4JI1 M;  4DR5 M;  4M9S A;  3VFD A;  4YHH M;  2V1C A;  3LQQ A;  2F5N A;  4B3S M;  2UUA M;  2QBY A;  3E9S A;  2V6Z M;  3U6M A;  4AQY M;  3M6A A;  4LGM A;  3J7B A;  2LXE A;  4NOO B;  5IZ7 D;  4LFA M;  1N36 M;  4CHT B;  3PVS A;  1GL6 A;  3SMS A;  2X4A A;  4L16 A;  4IBF A;  3GLH A;  3BOS A;  5KPT A;  3GLI A;  1OFH A;  1PJI A;  3T1Y M;  3WHK A;  1N32 M;  1WXQ A;  2YNM D;  8CAT A;  1Q3C A;  2XEP A;  4NL4 H;  1Z5B A;  1EE8 A;  3I51 A;  3ZCB B;  4G4Q A;  1K3W A;  1HQY E;  5FLX S;  2Y20 A;  2J7N A;  3HU2 A;  4P16 A;  1IBM M;  2RKO A;  2O5R A;  2L6O A;  4MB7 A;  3AV0 A;  1E32 A;  2ZAM A;  4PCZ A;  5EP2 A;  1XNQ M;  3ZC7 B;  3SAU A;  1I94 M;  1IN4 A;  4L4U A;  3AOG A;  2G8L A;  4IIW A;  3IG5 A;  1IBK M;  2QBY B;  4MM3 B;  3VKH A;  4I4L A;  3IG8 A;  2Z4S A;  1IXR C;  4QHT A;  2HL7 A;  4Z8X A;  3K92 A;  3L26 A;  3JR4 A;  3GLF A;  1IN5 A;  3HHY A;  4B3T M;  4AW4 A;  2K47 A;  2CHV A;  1KYI A;  1G4A E;  4NXN M;  5EP1 A;  3SMP A;  3GPX A;  4LG2 A;  3GQ4 A;  1SXJ B;  4GH9 A;  2BJV A;  3DFZ A;  1SXJ E;  2DXI A;  1GL7 A;  3GQ3 A;  1G8P A;  2R62 A;  4DV6 M;  4DV5 M;  2CHG A;  3TWM A;  1NHG C;  2R65 A;  4NSR A;  5JI2 E;  1K3X A;  2BNK A;  3KVW A;  3KOW E;  4PDG A;  1GKI A;  2DZN B;  3M0E A;  2R45 A;  1XXH B;  4FWH A;  2C9C A;  3SHG B;  1IN8 A;  1JR3 D;  1H6U A;  4GHL A;  2UXB M;  1QVR A;  4EIW A;  4FD2 A;  3SAT A;  4D80 A;  4MH0 E;  1C1K A;  4I5S A;  1QAM A;  4LGY A;  3ILK A;  3U61 B;  4DR3 M;  1FJG M;  3J2P B;  7CAT A;  3H4M A;  2I7P A;  2QP9 X;  5ITQ A;  4BB9 A;  1YSY A;  4QNR A;  1S3S A;  2L7I A;  3KOX E;  1SXJ D;  3U6D A;  2H1R A;  4L8R C;  2LNH C;  4JI5 M;  4FWD A;  3EIH A;  3CF0 A;  1L8Q A;  2KZS A;  1IQP A;  3KP0 E;  4PD2 A;  1L1T A;  4MGZ E;  3VKG A;  4KOD A;  2KRU A;  4I81 A;  2DZO B;  1L2B A;  4IBD A;  1G41 A;  1QAN A;  1QZM A;  3CF2 A;  4LZJ A;  2XZF A;  4AI6 A;  4OVZ A;  3GP1 A;  3HHX A;  2EO2 A;  3D8L A;  3GRR A;  3RE8 A;  3UZU A;  1DGF A;  3KOY E;  1DO0 A;  2ZBK B;  3LQR A;  3GPU A;  5ITX A;  4MGY E;  3J81 S;  5LMU M;  3HWS A;  4LF5 M;  2Z4R A;  1E94 E;  5EJC A;  4CIS A;  5ITT A;  2XSZ A;  1E9R A;  3GRV A;  3FTE A;  3A46 A;  4LF4 M;  4RNA A;  2C96 A;  4LRS A;  2D7G A;  3B9P A;  4GC9 A;  5IT9 S;  2YR0 A;  4D82 A;  3RGS A;  4FW9 A;  3RGP A;  4IBE A;  4DV0 M;  2C98 A;  2UU9 M;  4LJ5 A;  4WUR A;  1NHW C;  2HHH M;  2FFJ A;  1GLN A;  2W82 A;  2CUZ A;  4MGK E;  2LH0 A;  1DGG A;  4M0D A;  1KSF X;  4OVZ B;  4S12 A;  2ZM6 M;  4M9Z A;  2UUB M;  4MGH A;  4LF9 M;  3GPY A;  3AJI B;  1Q39 A;  3JR5 A;  3FUT A;  5ITU A;  2F5Q A;  3UMM A;  3U6C A;  4JI6 M;  1XNR M;  2V1U A;  1Z5C A;  3FUX A;  2YQZ A;  5BPV A;  2ERC A;  1I4W A;  3TPZ A;  3T1H M;  3TE6 A;  4G6Z A;  3I4Y A;  3UK6 A;  4JI3 M;  2XFS A;  4GRI A;  1L2D A;  3W0F A;  3EIE A;  3HGI A;  5KQ8 A;  5E26 A;  4FWG A;  1HNZ M;  3A98 B;  4QNM A;  3TL4 X;  4FCV A;  4REZ A;  2X49 A;  4X66 M;  4DR1 M;  5JI3 E;  2R4E A;  1L1Z A;  1GVN A;  4X62 M;  5FSW A;  1TDH A;  4R3D A;  3GLH B;  3R8F A;  2KA6 B;  3GLI B;  4B08 A;  2CEA A;  4JI7 M;  3SAV A;  2JA2 A;  4R7G A;  1VDD A;  2F4V M;  2QEN A;  3PNV A;  4L78 A;  5GKN A;  5ITY A;  2F5S A;  3KXE C;  3QAU A;  4DUZ M;  1HT2 E;  4G4N A;  3C58 A;  1OFI A;  1J09 A;  5KPR A;  1QAQ A;  2CFO A;  3KS8 A;  3SYK A;  1HT1 E;  2Y21 A;  4DV4 M;  1N77 A;  1XC8 A;  3FUU A;  4IJE A;  3T38 A;  2KEB A;  2RGO A;  2XGN A;  4RF1 A;  3I4V A;  3U5Z A;  1NJG A;  3HHZ A;  3FTC A;  3K1J A;  3Q8X A;  1W5S A;  1R2Z A;  4G4R A;  1E9S A;  4JI0 M;  1OJL A;  5KPZ A;  3KFU G;  3HJQ A;  3TWL A;  3FUW A;  5A2Q S;  3QWL A;  4IBG A;  2XF3 A;  4LJ6 A;  2VQE M;  2FNA A;  2E5L M;  3GLF B;  3E4R A;  1LV7 A;  3U6S A;  5DNY A;  1XWI A;  4B3M M;  4LY6 A;  3ZH9 B;  4GC5 A;  3AFH A;  1TH4 A;  5FTJ A;  3SAW A;  4GKK M;  1DGH A;  4JN6 A;  4LJ8 A;  3AOE C;  3PXG A;  4RF0 A;  3WHL A;  5FTN A;  2I7N A;  1TGU A;  3HJ8 A;  3SYL A;  4DR2 M;  2L7H A;  3M7G A;  1W5T A;  3UGJ A;  2HKJ A;  2HCB A;  5EP4 A;  3KS4 A;  4DR7 M;  5ITR A;  5DYG A;  5C18 A;  3FYD A;  1UM8 A;  4AG6 A;  4LFC M;  5EP3 A;  1YUB A;  4DUY M;  4JYA M;  1MX0 A;  1IY0 A;  1R2Y A;  1Z59 A;  3AL0 C;  2RGH A;  4IBK A;  2CV2 A;  1NNJ A;  3U6O A;  1G3I A;  3FUV A;  1QAO A;  1R6B X;  2XZU A;  3KSX A;  4JV5 M;  2J7O A;  4FCT A;  3PFI A;  4JI8 M;  1XMO M;  4M9X A;  3U6E A;  3GLG A;  2KW0 A;  2R46 A;  4LF7 M;  3OTO M;  3HU1 A;  2VQF M;  4ZPX A;  2XFT A;  3U6Q A;  4JXJ A;  3SAS A;  2P5T A;  2VII A;  3U6L A;  2F5P A;  2Z7J A;  1MU5 A;  4I8O A;  4M0W A;  5IWA M;  3SC3 A;  3DA1 A;  5FTK A;  3KP1 E;  1NVM A;  3VK8 A;  3LVV A;  2L09 A;  1N78 A;  1TDZ A;  4LJ9 A;  4WW0 A;  4PT5 A;  1IBL M;  2KRK A;  2D7E A;  1IXS B;  3FTF A;  3A45 A;  4LJ4 A;  4LF6 M;  4DV3 M;  1NNU C;  3J27 B;  4IBI A;  4QHS A;  3AOE A;  1HQC A;  4YY3 M;  4DV7 M;  2ZAN A;  4CGY B;  3KDS E;  5FTL A;  4LFB M;  3GRY A;  2C9O A;  3K2L A;  4NRV A;  5C1B A;  3KW6 A;  5ITX E;  1N75 A;  3GLG B;  4II7 A;  2DWM A;  2UUC M;  4MGI E;  2QZ4 A;  2R4J A;  1L2C A;  3HU3 A;  2FE8 A;  2D7H A;  4IBB A;  2C99 A;  3L29 A;  1X37 A;  2FOI C;  4FCW A;  1JR3 A;  3HJS A;  4Z6Y A;  2OQ4 A;  2OPF A;  1R7R A;  4LJ7 A;  1K82 A;  2QPA A;  1DO2 A;  3FD9 A;  5IRE B;  2DWL A;  4ITQ A;  3SFZ A;  3GRU A;  1J5E M;  2LWX A;  2QCU A;  2CHQ A;  4NRW A;  3VDP A;  4BLC A;  4G4O A;  4XBO A;  1PM5 A;  1SXJ A;  1ZQ9 A;  1Z6T A;  4AZF A;  1HNW M;  4OU7 A;  4NXM M;  3TWK A;  1YE9 A;  4OW0 A;  4XGI A;  3L2A A;  2XH9 A;  3RFW A;  3TQS A;  4BBA A;  4D81 A;  2Z3X A;  5F3W A;  4KO8 A;  3CF6 E;  5KO3 A;  2KXE A;  2ZAO A;  2Q2E B;  4LCB A;  4K0K M;  2XSZ D;  3HKP A;  3U60 A;  3T15 A;  4X64 M;  4W5W A;  1N33 M;  2EUC A;  3A42 A;  3DZD A;  2UXD M;  4JI2 M;  4B7G A;  1XXH A;  4GIT A;  5FTM A;  1IY1 A;  3D8B A;  1PJJ A;  1FNN A;  5EXP A;  3MHV C;  3SHF A;  3GO8 A;  1NSF A;  4FVM A;  4AG5 A;  2YFQ A;  4QOZ C;  1IN7 A;  1Q3B A;  3U61 A;  2BJW A;  2CE7 A;  2XLJ A;  5EQT A;  4AKG A;  5LMN M;  4IJF A;  2Y0Q A;  1KFV A;  1G59 A;  3DOA A;  4B7F A;  2G5G X;  4DR4 M;  5EXS A;  1XMQ M;  3VDU A;  3CTW B;  3K8Z A;  4HLQ A;  4X65 M;  3SAR A;  4B3R M;  3L27 A;  2Y0T A;  4LRT A;  1J7K A;  3SBJ A;  3J7A S;  2X8A A;  2DVW B;  3VK7 A;  4LZZ A;  4A3V B;  4GMQ A;  3THG A;  4IBC A;  3AKZ A;  3PNY A;  4LJA A;  2R18 A;  2CV1 A;  3U60 B;  4GHA A;  1QYR A;  4HL4 A;  2AHM A;  4JI4 M;  3W0L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...