2E5LM

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
122
structure length
122
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
molecule tags Ribosome
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
total genus 21
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2e5lM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2e5lM02
4LFAM 3VK7A 2UXCM 2Q2EB 5ITRA 3SARA 1Z5CA 4G4NA 1HNWM 4PCZA 3U6OA 3SATA 1Q3BA 3W0FA 3C58A 4DV5M 4DV2M 4DUYM 4JI7M 4LF5M 3VK8A 1I94M 4MB7A 2OPFA 1KFVA 5ITYA 2XZFA 3T1HM 2F5NA 1EE8A 4PD2A 3J80S 3J81S 3U6PA 3A46A 5IWAM 2VQFM 4JI8M 4GKKM 4X65M 4AQYM 1L2BA 3JR4A 2ZM6M 4DV1M 4DUZM 2UUCM 4NRWA 2VQEM 1XMOM 4X62M 5BR8M 4X66M 4LF4M 4LF6M 4G4RA 1L1ZA 1N36M 4B3TM 3U6SA 3GQ5A 4K0KM 2E5LM 1TDHA 3TWKA 3GQ3A 3J7AS 2UUBM 4JI3M 3U6EA 4JV5M 2UUAM 4YHHM 3JAMS 4DV3M 3T1YM 5ITQA 1PM5A 4NXNM 4JI1M 1IBMM 4DV6M 1K3XA 4B3RM 3U6QA 1N32M 5FLXS 1N33M 3GO8A 4NRVA 3GPUA 3GQ4A 1TDZA 4PDIA 1PJIA 1PJJA 1N34M 1R2YA 1R2ZA 2EA0A 2UXDM 4DR2M 1J5EM 4JI2M 4JI4M 4DR6M 4NXMM 2XZUA 3OTOM 4LF8M 3GPPA 1L1TA 1IBKM 3U6MA 1FJGM 2HHHM 1XNRM 4DV0M 1Z59A 4PDGA 4YY3M 1L2CA 1K82A 1MU5A 1L2DA 1Q39A 4CISA 4ITQA 4DR4M 5IT9S 5LMUM 5ITXE 3TWMA 3A42A 4JI5M 4LF7M 5A2QS 4GKJM 3GPYA 1MX0A 4DV4M 3U6DA 5ITXA 4DR3M 4JI0M 3SAWA 4JI6M 4DR1M 2UXBM 1Z5AA 4DV7M 1HR0M 2ZBKB 3A45A 3SAVA 4OX9M 3TWLA 5ITTA 1NNJA 1HNXM 4B3SM 4G4OA 1K3WA 3DOAA 2HKJA 3JR5A 4DR5M 1IBLM 1HNZM 4LFCM 2OQ4A 2F5PA 1XC8A 5LMNM 2UU9M 3GP1A 1Z5BA 4JYAM 3U6LA 1XMQM 1Q3CA 4G4QA 3U6CA 4LF9M 2F4VM 3SAUA 4KHPM 5ITUA 2F5SA 3GPXA 1XNQM 4B3MM 2F5OA 2F5QA 4LFBM 4X64M 3SBJA 4DR7M 3SASA
chains in the Genus database with same CATH superfamily
1W5TA 1G8PA 4LFAM 3VK7A 1GJTA 1NVMA 1OTRA 4D81A 5ITRA 2FNAA 3CF2A 4LJ7A 2D7GA 3W0FA 4DV5M 4JI7M 1H6UA 2OOAA 2KEBA 4MH0E 1DGFA 3LCUA 3RE8A 1MJGM 2XF3A 1TH4A 2DZLA 4R7GA 4MM3B 1I94M 1GKIA 2OPFA 3HU2A 4B7FA 2Y20A 4OVZB 1TR8A 2Y0TA 2LVAA 2R62A 3FUTA 4I4LA 3T1HM 2XZFA 4PD2A 2MGWA 3J81S 1N75A 1V33A 2X49A 5EXPA 3HGIA 1AUAA 2KHHA 1NV8A 5EXTA 5KO3A 4IBEA 2L2DA 2DENA 4JN6A 2LTUA 4QNMA 1WGLA 1XXHE 4S12A 3LVWA 1PJSA 4IJFA 4QOSA 1IN5A 4WP2A 3VDUA 4X62M 2VQEM 2LVOC 2X8AA 4G4RA 1QAQA 2JP7A 1YSYA 2W82A 3LVVA 5DFLA 2ERCA 2LHCA 4GH9A 1KSFX 1LV7A 4B3TM 2DAIA 1TH3A 2G8LA 2HWJA 4IBCA 2J7OA 4LCBA 2UUBM 3KSXA 3MK6A 4YHHM 3JAMS 1PM5A 4NXNM 5JI3E 2V6ZM 2YQZA 2ZAOA 4B3RM 1N32M 2KZSA 1N33M 4LJ6A 1QDRA 2QENA 2XLJA 3GQ4A 1LTMA 1TDZA 4PDIA 3HX3A 4MGKE 1PJIA 1PJJA 2FOIC 1OFHA 5H37D 2CEAA 2UXDM 2RKOA 3NBIA 3FKEA 5EP1A 3GLGA 2XZUA 2XFSA 3HZJA 4QOZC 1OQYA 3GLIE 1L1TA 4XBOA 4LJ5A 2H1RA 3U6MA 5C18A 1NO1A 3FUVA 3EIHA 1VQ1A 4DV0M 2BJVA 2QBYA 3B74A 2RRUA 2XEPA 1MU5A 2C99A 3T15A 2XFTA 3QWLA 2L4EA 5IT9S 5LMUM 3C3DA 3WHKA 4L15A 3V76A 2J5YA 3A42A 4LF7M 1XXHB 4UN2B 1VEJA 3M7GA 2CE7A 2M60A 5FTKA 4GKJM 3VKHA 4JXJA 4DR3M 4TUWA 1YUBA 3PXGA 3I04M 3TQSA 2VIIA 3T38A 4G4OA 2YNMD 4B3SM 2C96A 5GKNA 2QSFX 2K9DA 3H4MA 3JR5A 3SHGB 1HNZM 1T3TA 2L7IA 4LFCM 3IECA 3B7ZA 1DGHB 1QUTA 1P3QQ 1HT1E 1SG9A 3BOSA 3GP1A 4JYAM 3U6LA 1XMQM 2O01F 2DZNB 3Q8GA 1OIZA 2KRKA 3BBZA 1AIPC 1JQJC 2KW0A 2L7HA 2WSEF 3AOEC 3EIEA 4LJ9A 3FYDA 3FTEA 2XH9A 4A3VB 2F5SA 3CGWA 4IBBA 2DWLA 2H5XA 1R5LA 2F5OA 2F5QA 4P17A 4F2LA 1F4IA 3MMPA 4XK8F 4G3OA 2DNAA 2L4FA 1HQCA 4DR7M 1XB2B 1NV9A 3RGSA 3RGPA 3GLIB 4LG2A 1QAMA 1S3SA 2Q2EB 4ANRA 2LWXA 1D0MA 1OFIA 3SATA 3HWSA 4BLCA 2C9OA 4DUYM 2QHOB 2DAEA 2XGNA 1VEGA 2GNOA 3UZUA 3VK8A 1JR3A 2DAMA 2JNHA 1IN8A 5EJCA 1C1KA 4AI6A 3FTCA 3J7BA 4IJEA 1IXRC 4GHAA 2F5NA 3GLIA 4GITA 1D0LA 1UM8A 3KDSE 4LJAA 3GRUA 5IWAM 2DWNA 1R7RA 4MGHA 3UK6A 2VQFM 3DFZA 4JI8M 2FS1A 3J2PB 2BWBA 4RF1A 4LRSA 3UMMA 2ZANA 2KRUA 2Y21A 3MHVC 1IY1A 4BBAA 3F92A 4GMQA 3GRYA 3B9PA 2DHYA 2YR0A 3GLFB 3HU1A 2QNJA 4K0KM 4Z6YA 1IFYA 1NHGC 2WSCF 3MJ5A 4GC5A 5E26A 3J7AS 2APLA 4JV5M 2R46A 2V1CA 4DV3M 3T1YM 5EP4A 3M6AA 4DV6M 1NY6A 1Z6TA 2JA2A 3SYLA 4GRIA 2N35A 2X4AA 4NRVA 4B7HA 3GPUA 4FW9A 2AHMA 5F3WA 1R4GA 1E94E 3U61B 1PRBA 1D0KA 3AKZA 2EA0A 1J09A 4KT0F 2DHRA 3E21A 1GL7A 2JY5A 4JI4M 1ZMVA 4NXMM 4FWDA 5EXXA 3OTOM 3TE6A 4DBGB 2M5ZA 3K1JA 4AKIA 2GQFA 1V92A 3KS4A 4IBKA 4M9SA 4W5WA 2FH0A 4LZZA 3SC3A 1FJGM 3FYCA 1TH2A 2R18A 2HHHM 1XNRM 1PJTA 1Z59A 3KSJA 4YY3M 5KPZA 1NY5A 1FNNA 1XWIA 2KDLA 4CISA 8CATA 2LVNC 4QHSA 4L16A 3T6PA 4PT5A 1ZMUA 3E4RA 3B7QA 3U60B 1OAIA 3KP1E 5A2QS 1MX0A 4JI6M 2Z4SA 1VDDA 2LXEA 4B08A 2UXBM 2D7EA 1E9RA 3FUUA 1DO0A 1IXSB 3RFWA 2R44A 3HHWA 4M9ZA 3K92A 2LNHC 5ITTA 4NL4H 1HNXM 4HEOA 4NSRA 2I7NA 2O5RA 2LH0A 3KOXE 1G4AE 3DOAA 1HJPA 4DR5M 2QPAA 2DWMA 1QANA 4NC6A 1XC8A 3HJSA 1TGUA 2NQ8C 5LMNM 2UU9M 2DVWB 1Z5BA 2K47A 2ZAMA 4IBDA 4R71A 4G4QA 4OW0A 3U6CA 2QBYB 2DWZB 2JY8A 5FTMA 2D7HA 4LF9M 3L28A 2L6OA 1ZQ9A 3IG8A 2CV2A 2CFOA 2CV0A 3DZDA 3B7NA 1XNQM 3KS8A 2I7PA 4IBFA 5E6JA 2G3QA 3L26A 4FWGA 1BVSA 2EUCA 2FFJA 3AJIB 4HL4A 3K9OA 2DKLA 4LGMA 3J27B 3HHXA 2R4EA 2UXCM 3HY5A 4BB9A 2JY7A 1Z5CA 4LRTA 4CIZA 4GHLA 4PCZA 4WURA 2Z7JA 1L8QA 1Q3BA 3C58A 1QQWA 1HT2E 3SMPA 3ZQJA 4DV2M 2EJSA 2XSZA 5JI2E 4AW4A 4LF5M 1KYIA 3QYBA 5L8RF 3U5ZB 1C7YA 2KNVA 3VFDA 1EIJA 3PNYA 1G3IA 2WZJA 3TPZA 2ZTCA 3HHZA 2K0BX 3K2LA 5IZ7D 4AKHA 3L2AA 1X37A 3SYKA 1XHBA 5KPTA 3I51A 4FVMA 1Q02A 3E9SA 1QDTA 3BXWA 4P16A 4GKKM 2R45A 1G59A 2CRUA 1L2BA 3QAUA 3JR4A 2ZM6M 1DO2A 4DV1M 4DUZM 2UUCM 3K9PA 3U61A 5BR8M 2EKKA 3VDPA 4X66M 7CATA 4LF4M 2B3TA 2DAKA 3L29A 3ZC7B 2KZUA 3SMSA 3W67A 1TTEA 4MGIE 2R0IA 1YE9A 3IG5A 4FD2A 3GQ5A 1N78A 3TWKA 4MGZE 4IBIA 3GQ3A 1OKSA 2C5RA 1ORYB 3AOEA 4D82A 1J7KA 1I4WA 4WW0A 3A98B 1IY0A 1IBMM 5DYGA 1K3XA 1SXJA 5EXSA 3U6QA 1HQYE 2J7NA 3VKGA 2QQ8A 2JZ0A 1IXZA 1ZAEA 2MJ5B 4AG6A 1EFUB 3LCVB 2CHQA 1R2YA 1N34M 4KO8A 1J5EM 2Z4RA 3AFHA 1PGYA 3SHFA 2WSFF 1GLNA 3AL0C 2EO2A 5FSWA 1PJQA 3GPPA 5KPRA 1IBKM 3FTFA 4AG5A 3FUWA 3B89A 2K6BA 3I01M 5KQDA 3GLFA 1GABA 3PNVA 3GLHE 1SXJD 3C3EA 1L2DA 3M0EA 1Q39A 1GL6A 3U5ZA 4KODA 4LY6A 2Z8YM 3LW5F 2P5TA 4LJ8A 1OJLA 2CHVA 5IREB 3CF6E 5ITXE 2RGHA 5C1BA 1OAOC 2VF8A 4JI5M 4AKGA 4L4UA 2CP8A 5EP3A 5ITXA 3SAWA 2C98A 4DR1M 1Z5AA 4DV7M 2JWSA 2CUZA 1HR0M 2LBCA 3L27A 3FRHA 4FCVA 3SAVA 3TWLA 4OX9M 4IBGA 3D8BA 1K3WA 5FTNA 3IHPA 3GLHA 5FTLA 1RU3A 4GC9A 2OQ4A 4GEWA 2LVPC 4CGYB 1Q3CA 4QHTA 1DGBA 2HL7A 3D8LA 1ZV1A 3LQQA 4CHTB 2CV1A 2F4VM 4I5SA 3ZCBB 3U60A 2R6FA 4KHPM 3GPXA 3R9XB 4F1IA 3AV0A 1VEKA 2DI0A 4LFBM 1NNUC 2YFQA 3SBJA 1T43A 3GLFE 1MN3A 2KXEA 2BWEA 2FE8A 3KFUG 1QUSA 3UGJA 4Q7JA 1N77A 1A5TA 1CUKA 3SARA 4GIPA 1V34A 4Z8XA 4G4NA 3U6OA 1HNWM 3HKPA 4I81A 1OIPA 2LVQD 3H4JA 4NSOB 4MB7A 5KQ8A 2BJWA 2BNKA 2HCBA 3FUXA 1KFVA 1WIVA 1SXJC 2DXIA 4QNRA 5ITYA 2A5YB 4RNAA 2QP9X 3FTDA 1EE8A 3NBXX 2C9CA 3QYEA 4M0DA 3J80S 4EIWA 1QZEA 3U6PA 4ZPXA 3A46A 1E32A 3ILKA 3TL4X 2QZ4A 5EP2A 4X65M 4AQYM 2JUJA 2DAGA 2VDBB 4FCWA 4NRWA 1XMOM 4L78A 5DNYA 4LF6M 3KOYE 1SXJE 4M0WA 1G41A 1L1ZA 1N36M 1JR3E 3U6SA 1WHCA 1QZMA 3CTWB 3HJQA 3I4YA 3ZH9B 2E5LM 1TDHA 2VF7A 1IN6A 4I8OA 2OO9A 4OVZA 3GRRA 4JI3M 3U6EA 4II7A 3AOGA 3KW6A 3FD9A 2UUAM 4JI1M 5ITQA 4LJ4A 4R3DA 1IXSA 1UFZA 5FLXS 2Y0QA 3GO8A 2HAKA 3Q8XA 1JB0F 3W68A 1WR1B 2JZ1A 2ZTDA 3C9PA 3DA1A 1WJ7A 1T6OA 3PFIA 1R2ZA 4NOOB 5DYIA 4DR2M 4JI2M 1IQPA 3KXEC 3K8ZA 3GRVA 1W5SA 2CWBA 3HU3A 2JY6B 3KOWE 4DR6M 3GLGE 4LF8M 5FTJA 4KLNA 1XXHA 2KNZA 2XSZD 4HLQA 4OU7A 3LQRA 1DGHA 1VG5A 1NJGA 1WGNA 1IY2A 1NHWC 1QYRA 2RGOA 4PDGA 1IM2A 1DGGA 1GVNA 2QCUA 1L2CA 3VLFB 1K82A 1JR3D 1IN4A 4RKUF 4ITQA 2MROB 3KOZE 4G6ZA 4IIWA 2V1UA 4RF0A 2Z3XA 1VDLA 4DR4M 3GLHB 3GLGB 1GO5A 3LMMA 3FE3A 1IN7A 1ZMWA 2LHGA 1D2NA 3TWMA 4M9XA 1YLAA 4L8RC 4FWHA 2CHGA 3GPYA 3I4VA 4DV4M 3U6DA 3L25A 4JI0M 2KA6B 3KVWA 3PVSA 1QAOA 4LZJA 1GJSA 1SXJB 1TF0B 2ZBKB 3A45A 2G5GX 1NJFA 1WXQA 3FRIA 1NNJA 4AZFA 1QVRA 2EKFA 2O25A 5BPVA 2MH8A 2MR9A 4LGYA 1DV0A 3KP0E 2HKJA 4IBJA 1IBLM 2F5PA 3E46A 4D80A 2DZOB 3HJ8A 3HHYA 4MGYE 2OOBA 3SFZA 3THGA 3W0LB 4XGIA 2R4JA 2L09A 4B7GA 3NWLA 3SAUA 3CF0A 1G71A 4L6V6 5ITUA 1E9SA 4CJ6A 1R6BX 3UJNA 1NSFA 4B3MM 3WHLA 4X64M 1Y8GA 2JXNA 5EQTA 4FCTA 2KNAA 2R65A 4REZA 3SASA 3R8FA 4Y28F
chains in the Genus database with same CATH topology
1W5TA 1G8PA 4LFAM 3VK7A 1NVMA 4D81A 5ITRA 2FNAA 3CF2A 4LJ7A 2D7GA 3W0FA 4DV5M 4JI7M 1H6UA 2KEBA 4MH0E 1DGFA 3RE8A 2XF3A 1I94M 1TH4A 4R7GA 4MM3B 1GKIA 2OPFA 3HU2A 4B7FA 2Y20A 4OVZB 2Y0TA 4I4LA 2R62A 3T1HM 3FUTA 2XZFA 4PD2A 3J81S 1N75A 2X49A 5EXPA 3HGIA 5EXTA 5KO3A 4IBEA 4JN6A 4QNMA 4S12A 3VDUA 3LVWA 4IJFA 4QOSA 2VQEM 1IN5A 4X62M 2X8AA 4G4RA 1QAQA 1YSYA 2W82A 3LVVA 2ERCA 4GH9A 1KSFX 1LV7A 4B3TM 1TH3A 2G8LA 4IBCA 2J7OA 4LCBA 2UUBM 3KSXA 3MK6A 4YHHM 3JAMS 1PM5A 4NXNM 5JI3E 2V6ZM 2YQZA 2ZAOA 4B3RM 1N32M 2KZSA 1N33M 4LJ6A 2QENA 2XLJA 3GQ4A 1TDZA 4PDIA 1PJIA 4MGKE 1PJJA 2FOIC 1OFHA 5H37D 2CEAA 2UXDM 2RKOA 3NBIA 3FKEA 5EP1A 3GLGA 2XZUA 2XFSA 4QOZC 1L1TA 4XBOA 4LJ5A 2H1RA 3U6MA 5C18A 3FUVA 3EIHA 4DV0M 2BJVA 2QBYA 2XEPA 1MU5A 2C99A 3T15A 2XFTA 3QWLA 5IT9S 5LMUM 3WHKA 4L15A 3A42A 4LF7M 1XXHB 3M7GA 2CE7A 2M60A 5FTKA 4GKJM 3VKHA 4JXJA 4DR3M 4TUWA 1YUBA 3PXGA 3TQSA 2VIIA 3T38A 4G4OA 2YNMD 4B3SM 2C96A 5GKNA 3H4MA 3JR5A 3SHGB 1HNZM 1T3TA 2L7IA 4LFCM 1DGHB 1HT1E 3BOSA 3GP1A 4JYAM 3U6LA 1XMQM 2DZNB 2KRKA 2L7HA 3EIEA 1JQJC 2KW0A 3AOEC 4LJ9A 3FYDA 3FTEA 2XH9A 4A3VB 2F5SA 4IBBA 2DWLA 2F5OA 2F5QA 4DR7M 1HQCA 3RGSA 3GLIB 3RGPA 4LG2A 1QAMA 1S3SA 2Q2EB 2LWXA 1OFIA 3SATA 3HWSA 4BLCA 2C9OA 4DUYM 2XGNA 3UZUA 3VK8A 1JR3A 1IN8A 5EJCA 1C1KA 4AI6A 3FTCA 3J7BA 4IJEA 1IXRC 4GHAA 2F5NA 3GLIA 4GITA 3KDSE 1UM8A 4LJAA 3GRUA 5IWAM 2DWNA 1R7RA 4MGHA 3UK6A 2VQFM 3DFZA 4JI8M 3J2PB 4RF1A 4LRSA 3UMMA 2ZANA 2KRUA 2Y21A 3MHVC 1IY1A 4BBAA 4GMQA 3GRYA 2YR0A 3GLFB 3HU1A 4K0KM 4Z6YA 1NHGC 3MJ5A 4GC5A 5E26A 3J7AS 4JV5M 2R46A 2V1CA 4DV3M 3T1YM 5EP4A 3M6AA 4DV6M 1NY6A 1Z6TA 2JA2A 3SYLA 4GRIA 2X4AA 4NRVA 4B7HA 3GPUA 4FW9A 2AHMA 5F3WA 1E94E 3U61B 3AKZA 2EA0A 1J09A 2DHRA 1GL7A 4JI4M 4NXMM 4FWDA 5EXXA 3OTOM 3TE6A 2M5ZA 3K1JA 4AKIA 3KS4A 4IBKA 4M9SA 4W5WA 3SC3A 4LZZA 1FJGM 3FYCA 1TH2A 2R18A 2HHHM 1XNRM 1Z59A 3KSJA 4YY3M 5KPZA 1NY5A 1FNNA 1XWIA 4CISA 8CATA 4QHSA 4L16A 4PT5A 3E4RA 3U60B 3KP1E 5A2QS 1MX0A 4JI6M 2Z4SA 1VDDA 2LXEA 4B08A 2UXBM 2D7EA 1E9RA 3FUUA 1DO0A 1IXSB 3RFWA 3HHWA 4M9ZA 3K92A 2LNHC 5ITTA 4NL4H 1HNXM 4NSRA 2I7NA 2O5RA 2LH0A 3KOXE 1G4AE 3DOAA 4DR5M 2QPAA 2DWMA 1QANA 1XC8A 3HJSA 1TGUA 2NQ8C 5LMNM 2UU9M 2DVWB 1Z5BA 2K47A 2ZAMA 4IBDA 4G4QA 4OW0A 3U6CA 2QBYB 2DWZB 5FTMA 2D7HA 4LF9M 3L28A 2L6OA 1ZQ9A 3IG8A 2CV2A 2CFOA 2CV0A 3DZDA 1XNQM 3KS8A 2I7PA 4IBFA 5E6JA 3L26A 4FWGA 2EUCA 2FFJA 3AJIB 4HL4A 4LGMA 3J27B 3HHXA 2R4EA 2UXCM 4BB9A 1Z5CA 4LRTA 4GHLA 4PCZA 4WURA 2Z7JA 1L8QA 1Q3BA 3C58A 1QQWA 1HT2E 3SMPA 4DV2M 2XSZA 5JI2E 4AW4A 4LF5M 1KYIA 3U5ZB 3VFDA 3PNYA 1G3IA 3TPZA 3HHZA 4AKHA 3K2LA 5IZ7D 3L2AA 1X37A 3SYKA 1XHBA 5KPTA 3I51A 4FVMA 3E9SA 4P16A 4GKKM 2R45A 1G59A 1L2BA 3QAUA 3JR4A 2ZM6M 1DO2A 4DV1M 4DUZM 2UUCM 3U61A 5BR8M 3VDPA 4X66M 7CATA 4LF4M 3L29A 3ZC7B 2KZUA 3SMSA 3GQ5A 4MGIE 3IG5A 1YE9A 4FD2A 1N78A 3TWKA 4MGZE 4IBIA 3GQ3A 2C5RA 1ORYB 3AOEA 4D82A 1J7KA 1I4WA 4WW0A 3A98B 1IY0A 1IBMM 5DYGA 1K3XA 1SXJA 5EXSA 3U6QA 1HQYE 2J7NA 3VKGA 1IXZA 1ZAEA 4AG6A 1N34M 2CHQA 1R2YA 4KO8A 1J5EM 2Z4RA 3AFHA 3SHFA 3AL0C 1GLNA 2EO2A 5FSWA 3GPPA 5KPRA 1IBKM 3FTFA 4AG5A 3FUWA 3GLFA 5KQDA 3PNVA 1SXJD 1L2DA 3M0EA 1Q39A 1GL6A 3U5ZA 4KODA 4LY6A 4LJ8A 2P5TA 1OJLA 2CHVA 5IREB 3CF6E 5ITXE 2RGHA 5C1BA 4JI5M 4AKGA 4L4UA 5EP3A 5ITXA 3SAWA 2C98A 4DR1M 1Z5AA 4DV7M 2CUZA 1HR0M 3L27A 4FCVA 3SAVA 3TWLA 4OX9M 4IBGA 3D8BA 1K3WA 5FTNA 3GLHA 5FTLA 4GC9A 2OQ4A 4CGYB 1Q3CA 4QHTA 3LQQA 1DGBA 2HL7A 3D8LA 4CHTB 2CV1A 2F4VM 4I5SA 3ZCBB 3U60A 4KHPM 3GPXA 3R9XB 3AV0A 4LFBM 1NNUC 2YFQA 3SBJA 2KXEA 2FE8A 3KFUG 3UGJA 1N77A 3SARA 4GIPA 4Z8XA 4G4NA 1HNWM 3U6OA 3HKPA 4I81A 4NSOB 4MB7A 5KQ8A 2BJWA 2BNKA 2HCBA 3FUXA 1KFVA 1SXJC 2DXIA 4QNRA 5ITYA 2A5YB 4RNAA 2QP9X 3FTDA 1EE8A 2C9CA 3J80S 4M0DA 4EIWA 3U6PA 4ZPXA 3A46A 1E32A 3ILKA 3TL4X 2QZ4A 5EP2A 4X65M 4AQYM 4FCWA 4NRWA 1XMOM 4L78A 5DNYA 4LF6M 3KOYE 1SXJE 4M0WA 1G41A 1L1ZA 1N36M 3U6SA 1QZMA 3CTWB 3HJQA 3I4YA 3ZH9B 2E5LM 1TDHA 1IN6A 4I8OA 4OVZA 3GRRA 4JI3M 3U6EA 4II7A 3AOGA 3KW6A 3FD9A 2UUAM 4JI1M 5ITQA 4LJ4A 4R3DA 5FLXS 2Y0QA 3GO8A 3Q8XA 3DA1A 3PFIA 1R2ZA 4NOOB 5DYIA 4DR2M 4JI2M 3KXEC 1IQPA 3K8ZA 3GRVA 1W5SA 3HU3A 4DR6M 3KOWE 4LF8M 5FTJA 4KLNA 1XXHA 2XSZD 4HLQA 4OU7A 3LQRA 1DGHA 1NJGA 1IY2A 1NHWC 1QYRA 2RGOA 4PDGA 1IM2A 1DGGA 1GVNA 2QCUA 1L2CA 3VLFB 1K82A 1JR3D 1IN4A 4ITQA 3KOZE 4G6ZA 2V1UA 4IIWA 4DR4M 4RF0A 2Z3XA 3GLHB 3GLGB 3LMMA 1IN7A 1D2NA 3TWMA 4M9XA 4L8RC 4FWHA 2CHGA 3GPYA 3I4VA 4DV4M 3U6DA 3L25A 4JI0M 2KA6B 3PVSA 3KVWA 1QAOA 4LZJA 1SXJB 2ZBKB 3A45A 2G5GX 1NJFA 1WXQA 1NNJA 4AZFA 1QVRA 5BPVA 4LGYA 3KP0E 2HKJA 4IBJA 1IBLM 2F5PA 4D80A 2DZOB 3HJ8A 3HHYA 4MGYE 3SFZA 3THGA 3W0LB 4XGIA 2R4JA 2L09A 4B7GA 3NWLA 3SAUA 3CF0A 5ITUA 1E9SA 1R6BX 3UJNA 1NSFA 4B3MM 3WHLA 4X64M 5EQTA 4FCTA 2R65A 3B9PA 4REZA 3SASA 3R8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA M;  3VK7 A;  2UXC M;  2Q2E B;  5ITR A;  3SAR A;  1Z5C A;  4G4N A;  1HNW M;  4PCZ A;  3U6O A;  3SAT A;  1Q3B A;  3W0F A;  3C58 A;  4DV5 M;  4DV2 M;  4DUY M;  4JI7 M;  4LF5 M;  3VK8 A;  1I94 M;  4MB7 A;  2OPF A;  1KFV A;  5ITY A;  2XZF A;  3T1H M;  2F5N A;  1EE8 A;  4PD2 A;  3J80 S;  3J81 S;  3U6P A;  3A46 A;  5IWA M;  2VQF M;  4JI8 M;  4GKK M;  4X65 M;  4AQY M;  1L2B A;  3JR4 A;  2ZM6 M;  4DV1 M;  4DUZ M;  2UUC M;  4NRW A;  2VQE M;  1XMO M;  4X62 M;  5BR8 M;  4X66 M;  4LF4 M;  4LF6 M;  4G4R A;  1L1Z A;  1N36 M;  4B3T M;  3U6S A;  3GQ5 A;  4K0K M;  2E5L M;  1TDH A;  3TWK A;  3GQ3 A;  3J7A S;  2UUB M;  4JI3 M;  3U6E A;  4JV5 M;  2UUA M;  4YHH M;  3JAM S;  4DV3 M;  3T1Y M;  5ITQ A;  1PM5 A;  4NXN M;  4JI1 M;  1IBM M;  4DV6 M;  1K3X A;  4B3R M;  3U6Q A;  1N32 M;  5FLX S;  1N33 M;  3GO8 A;  4NRV A;  3GPU A;  3GQ4 A;  1TDZ A;  4PDI A;  1PJI A;  1PJJ A;  1N34 M;  1R2Y A;  1R2Z A;  2EA0 A;  2UXD M;  4DR2 M;  1J5E M;  4JI2 M;  4JI4 M;  4DR6 M;  4NXM M;  2XZU A;  3OTO M;  4LF8 M;  3GPP A;  1L1T A;  1IBK M;  3U6M A;  1FJG M;  2HHH M;  1XNR M;  4DV0 M;  1Z59 A;  4PDG A;  4YY3 M;  1L2C A;  1K82 A;  1MU5 A;  1L2D A;  1Q39 A;  4CIS A;  4ITQ A;  4DR4 M;  5IT9 S;  5LMU M;  5ITX E;  3TWM A;  3A42 A;  4JI5 M;  4LF7 M;  5A2Q S;  4GKJ M;  3GPY A;  1MX0 A;  4DV4 M;  3U6D A;  5ITX A;  4DR3 M;  4JI0 M;  3SAW A;  4JI6 M;  4DR1 M;  2UXB M;  1Z5A A;  4DV7 M;  1HR0 M;  2ZBK B;  3A45 A;  3SAV A;  4OX9 M;  3TWL A;  5ITT A;  1NNJ A;  1HNX M;  4B3S M;  4G4O A;  1K3W A;  3DOA A;  2HKJ A;  3JR5 A;  4DR5 M;  1IBL M;  1HNZ M;  4LFC M;  2OQ4 A;  2F5P A;  1XC8 A;  5LMN M;  2UU9 M;  3GP1 A;  1Z5B A;  4JYA M;  3U6L A;  1XMQ M;  1Q3C A;  4G4Q A;  3U6C A;  4LF9 M;  2F4V M;  3SAU A;  4KHP M;  5ITU A;  2F5S A;  3GPX A;  1XNQ M;  4B3M M;  2F5O A;  2F5Q A;  4LFB M;  4X64 M;  3SBJ A;  4DR7 M;  3SAS A; 
#chains in the Genus database with same CATH topology
 1W5T A;  1G8P A;  4LFA M;  3VK7 A;  1GJT A;  1NVM A;  1OTR A;  4D81 A;  5ITR A;  2FNA A;  3CF2 A;  4LJ7 A;  2D7G A;  3W0F A;  4DV5 M;  4JI7 M;  1H6U A;  2OOA A;  2KEB A;  4MH0 E;  1DGF A;  3LCU A;  3RE8 A;  1MJG M;  2XF3 A;  1TH4 A;  2DZL A;  4R7G A;  4MM3 B;  1I94 M;  1GKI A;  2OPF A;  3HU2 A;  4B7F A;  2Y20 A;  4OVZ B;  1TR8 A;  2Y0T A;  2LVA A;  2R62 A;  3FUT A;  4I4L A;  3T1H M;  2XZF A;  4PD2 A;  2MGW A;  3J81 S;  1N75 A;  1V33 A;  2X49 A;  5EXP A;  3HGI A;  1AUA A;  2KHH A;  1NV8 A;  5EXT A;  5KO3 A;  4IBE A;  2L2D A;  2DEN A;  4JN6 A;  2LTU A;  4QNM A;  1WGL A;  1XXH E;  4S12 A;  3LVW A;  1PJS A;  4IJF A;  4QOS A;  1IN5 A;  4WP2 A;  3VDU A;  4X62 M;  2VQE M;  2LVO C;  2X8A A;  4G4R A;  1QAQ A;  2JP7 A;  1YSY A;  2W82 A;  3LVV A;  5DFL A;  2ERC A;  2LHC A;  4GH9 A;  1KSF X;  1LV7 A;  4B3T M;  2DAI A;  1TH3 A;  2G8L A;  2HWJ A;  4IBC A;  2J7O A;  4LCB A;  2UUB M;  3KSX A;  3MK6 A;  4YHH M;  3JAM S;  1PM5 A;  4NXN M;  5JI3 E;  2V6Z M;  2YQZ A;  2ZAO A;  4B3R M;  1N32 M;  2KZS A;  1N33 M;  4LJ6 A;  1QDR A;  2QEN A;  2XLJ A;  3GQ4 A;  1LTM A;  1TDZ A;  4PDI A;  3HX3 A;  4MGK E;  1PJI A;  1PJJ A;  2FOI C;  1OFH A;  5H37 D;  2CEA A;  2UXD M;  2RKO A;  3NBI A;  3FKE A;  5EP1 A;  3GLG A;  2XZU A;  2XFS A;  3HZJ A;  4QOZ C;  1OQY A;  3GLI E;  1L1T A;  4XBO A;  4LJ5 A;  2H1R A;  3U6M A;  5C18 A;  1NO1 A;  3FUV A;  3EIH A;  1VQ1 A;  4DV0 M;  2BJV A;  2QBY A;  3B74 A;  2RRU A;  2XEP A;  1MU5 A;  2C99 A;  3T15 A;  2XFT A;  3QWL A;  2L4E A;  5IT9 S;  5LMU M;  3C3D A;  3WHK A;  4L15 A;  3V76 A;  2J5Y A;  3A42 A;  4LF7 M;  1XXH B;  4UN2 B;  1VEJ A;  3M7G A;  2CE7 A;  2M60 A;  5FTK A;  4GKJ M;  3VKH A;  4JXJ A;  4DR3 M;  4TUW A;  1YUB A;  3PXG A;  3I04 M;  3TQS A;  2VII A;  3T38 A;  4G4O A;  2YNM D;  4B3S M;  2C96 A;  5GKN A;  2QSF X;  2K9D A;  3H4M A;  3JR5 A;  3SHG B;  1HNZ M;  1T3T A;  2L7I A;  4LFC M;  3IEC A;  3B7Z A;  1DGH B;  1QUT A;  1P3Q Q;  1HT1 E;  1SG9 A;  3BOS A;  3GP1 A;  4JYA M;  3U6L A;  1XMQ M;  2O01 F;  2DZN B;  3Q8G A;  1OIZ A;  2KRK A;  3BBZ A;  1AIP C;  1JQJ C;  2KW0 A;  2L7H A;  2WSE F;  3AOE C;  3EIE A;  4LJ9 A;  3FYD A;  3FTE A;  2XH9 A;  4A3V B;  2F5S A;  3CGW A;  4IBB A;  2DWL A;  2H5X A;  1R5L A;  2F5O A;  2F5Q A;  4P17 A;  4F2L A;  1F4I A;  3MMP A;  4XK8 F;  4G3O A;  2DNA A;  2L4F A;  1HQC A;  4DR7 M;  1XB2 B;  1NV9 A;  3RGS A;  3RGP A;  3GLI B;  4LG2 A;  1QAM A;  1S3S A;  2Q2E B;  4ANR A;  2LWX A;  1D0M A;  1OFI A;  3SAT A;  3HWS A;  4BLC A;  2C9O A;  4DUY M;  2QHO B;  2DAE A;  2XGN A;  1VEG A;  2GNO A;  3UZU A;  3VK8 A;  1JR3 A;  2DAM A;  2JNH A;  1IN8 A;  5EJC A;  1C1K A;  4AI6 A;  3FTC A;  3J7B A;  4IJE A;  1IXR C;  4GHA A;  2F5N A;  3GLI A;  4GIT A;  1D0L A;  1UM8 A;  3KDS E;  4LJA A;  3GRU A;  5IWA M;  2DWN A;  1R7R A;  4MGH A;  3UK6 A;  2VQF M;  3DFZ A;  4JI8 M;  2FS1 A;  3J2P B;  2BWB A;  4RF1 A;  4LRS A;  3UMM A;  2ZAN A;  2KRU A;  2Y21 A;  3MHV C;  1IY1 A;  4BBA A;  3F92 A;  4GMQ A;  3GRY A;  3B9P A;  2DHY A;  2YR0 A;  3GLF B;  3HU1 A;  2QNJ A;  4K0K M;  4Z6Y A;  1IFY A;  1NHG C;  2WSC F;  3MJ5 A;  4GC5 A;  5E26 A;  3J7A S;  2APL A;  4JV5 M;  2R46 A;  2V1C A;  4DV3 M;  3T1Y M;  5EP4 A;  3M6A A;  4DV6 M;  1NY6 A;  1Z6T A;  2JA2 A;  3SYL A;  4GRI A;  2N35 A;  2X4A A;  4NRV A;  4B7H A;  3GPU A;  4FW9 A;  2AHM A;  5F3W A;  1R4G A;  1E94 E;  3U61 B;  1PRB A;  1D0K A;  3AKZ A;  2EA0 A;  1J09 A;  4KT0 F;  2DHR A;  3E21 A;  1GL7 A;  2JY5 A;  4JI4 M;  1ZMV A;  4NXM M;  4FWD A;  5EXX A;  3OTO M;  3TE6 A;  4DBG B;  2M5Z A;  3K1J A;  4AKI A;  2GQF A;  1V92 A;  3KS4 A;  4IBK A;  4M9S A;  4W5W A;  2FH0 A;  4LZZ A;  3SC3 A;  1FJG M;  3FYC A;  1TH2 A;  2R18 A;  2HHH M;  1XNR M;  1PJT A;  1Z59 A;  3KSJ A;  4YY3 M;  5KPZ A;  1NY5 A;  1FNN A;  1XWI A;  2KDL A;  4CIS A;  8CAT A;  2LVN C;  4QHS A;  4L16 A;  3T6P A;  4PT5 A;  1ZMU A;  3E4R A;  3B7Q A;  3U60 B;  1OAI A;  3KP1 E;  5A2Q S;  1MX0 A;  4JI6 M;  2Z4S A;  1VDD A;  2LXE A;  4B08 A;  2UXB M;  2D7E A;  1E9R A;  3FUU A;  1DO0 A;  1IXS B;  3RFW A;  2R44 A;  3HHW A;  4M9Z A;  3K92 A;  2LNH C;  5ITT A;  4NL4 H;  1HNX M;  4HEO A;  4NSR A;  2I7N A;  2O5R A;  2LH0 A;  3KOX E;  1G4A E;  3DOA A;  1HJP A;  4DR5 M;  2QPA A;  2DWM A;  1QAN A;  4NC6 A;  1XC8 A;  3HJS A;  1TGU A;  2NQ8 C;  5LMN M;  2UU9 M;  2DVW B;  1Z5B A;  2K47 A;  2ZAM A;  4IBD A;  4R71 A;  4G4Q A;  4OW0 A;  3U6C A;  2QBY B;  2DWZ B;  2JY8 A;  5FTM A;  2D7H A;  4LF9 M;  3L28 A;  2L6O A;  1ZQ9 A;  3IG8 A;  2CV2 A;  2CFO A;  2CV0 A;  3DZD A;  3B7N A;  1XNQ M;  3KS8 A;  2I7P A;  4IBF A;  5E6J A;  2G3Q A;  3L26 A;  4FWG A;  1BVS A;  2EUC A;  2FFJ A;  3AJI B;  4HL4 A;  3K9O A;  2DKL A;  4LGM A;  3J27 B;  3HHX A;  2R4E A;  2UXC M;  3HY5 A;  4BB9 A;  2JY7 A;  1Z5C A;  4LRT A;  4CIZ A;  4GHL A;  4PCZ A;  4WUR A;  2Z7J A;  1L8Q A;  1Q3B A;  3C58 A;  1QQW A;  1HT2 E;  3SMP A;  3ZQJ A;  4DV2 M;  2EJS A;  2XSZ A;  5JI2 E;  4AW4 A;  4LF5 M;  1KYI A;  3QYB A;  5L8R F;  3U5Z B;  1C7Y A;  2KNV A;  3VFD A;  1EIJ A;  3PNY A;  1G3I A;  2WZJ A;  3TPZ A;  2ZTC A;  3HHZ A;  2K0B X;  3K2L A;  5IZ7 D;  4AKH A;  3L2A A;  1X37 A;  3SYK A;  1XHB A;  5KPT A;  3I51 A;  4FVM A;  1Q02 A;  3E9S A;  1QDT A;  3BXW A;  4P16 A;  4GKK M;  2R45 A;  1G59 A;  2CRU A;  1L2B A;  3QAU A;  3JR4 A;  2ZM6 M;  1DO2 A;  4DV1 M;  4DUZ M;  2UUC M;  3K9P A;  3U61 A;  5BR8 M;  2EKK A;  3VDP A;  4X66 M;  7CAT A;  4LF4 M;  2B3T A;  2DAK A;  3L29 A;  3ZC7 B;  2KZU A;  3SMS A;  3W67 A;  1TTE A;  4MGI E;  2R0I A;  1YE9 A;  3IG5 A;  4FD2 A;  3GQ5 A;  1N78 A;  3TWK A;  4MGZ E;  4IBI A;  3GQ3 A;  1OKS A;  2C5R A;  1ORY B;  3AOE A;  4D82 A;  1J7K A;  1I4W A;  4WW0 A;  3A98 B;  1IY0 A;  1IBM M;  5DYG A;  1K3X A;  1SXJ A;  5EXS A;  3U6Q A;  1HQY E;  2J7N A;  3VKG A;  2QQ8 A;  2JZ0 A;  1IXZ A;  1ZAE A;  2MJ5 B;  4AG6 A;  1EFU B;  3LCV B;  2CHQ A;  1R2Y A;  1N34 M;  4KO8 A;  1J5E M;  2Z4R A;  3AFH A;  1PGY A;  3SHF A;  2WSF F;  1GLN A;  3AL0 C;  2EO2 A;  5FSW A;  1PJQ A;  3GPP A;  5KPR A;  1IBK M;  3FTF A;  4AG5 A;  3FUW A;  3B89 A;  2K6B A;  3I01 M;  5KQD A;  3GLF A;  1GAB A;  3PNV A;  3GLH E;  1SXJ D;  3C3E A;  1L2D A;  3M0E A;  1Q39 A;  1GL6 A;  3U5Z A;  4KOD A;  4LY6 A;  2Z8Y M;  3LW5 F;  2P5T A;  4LJ8 A;  1OJL A;  2CHV A;  5IRE B;  3CF6 E;  5ITX E;  2RGH A;  5C1B A;  1OAO C;  2VF8 A;  4JI5 M;  4AKG A;  4L4U A;  2CP8 A;  5EP3 A;  5ITX A;  3SAW A;  2C98 A;  4DR1 M;  1Z5A A;  4DV7 M;  2JWS A;  2CUZ A;  1HR0 M;  2LBC A;  3L27 A;  3FRH A;  4FCV A;  3SAV A;  3TWL A;  4OX9 M;  4IBG A;  3D8B A;  1K3W A;  5FTN A;  3IHP A;  3GLH A;  5FTL A;  1RU3 A;  4GC9 A;  2OQ4 A;  4GEW A;  2LVP C;  4CGY B;  1Q3C A;  4QHT A;  1DGB A;  2HL7 A;  3D8L A;  1ZV1 A;  3LQQ A;  4CHT B;  2CV1 A;  2F4V M;  4I5S A;  3ZCB B;  3U60 A;  2R6F A;  4KHP M;  3GPX A;  3R9X B;  4F1I A;  3AV0 A;  1VEK A;  2DI0 A;  4LFB M;  1NNU C;  2YFQ A;  3SBJ A;  1T43 A;  3GLF E;  1MN3 A;  2KXE A;  2BWE A;  2FE8 A;  3KFU G;  1QUS A;  3UGJ A;  4Q7J A;  1N77 A;  1A5T A;  1CUK A;  3SAR A;  4GIP A;  1V34 A;  4Z8X A;  4G4N A;  3U6O A;  1HNW M;  3HKP A;  4I81 A;  1OIP A;  2LVQ D;  3H4J A;  4NSO B;  4MB7 A;  5KQ8 A;  2BJW A;  2BNK A;  2HCB A;  3FUX A;  1KFV A;  1WIV A;  1SXJ C;  2DXI A;  4QNR A;  5ITY A;  2A5Y B;  4RNA A;  2QP9 X;  3FTD A;  1EE8 A;  3NBX X;  2C9C A;  3QYE A;  4M0D A;  3J80 S;  4EIW A;  1QZE A;  3U6P A;  4ZPX A;  3A46 A;  1E32 A;  3ILK A;  3TL4 X;  2QZ4 A;  5EP2 A;  4X65 M;  4AQY M;  2JUJ A;  2DAG A;  2VDB B;  4FCW A;  4NRW A;  1XMO M;  4L78 A;  5DNY A;  4LF6 M;  3KOY E;  1SXJ E;  4M0W A;  1G41 A;  1L1Z A;  1N36 M;  1JR3 E;  3U6S A;  1WHC A;  1QZM A;  3CTW B;  3HJQ A;  3I4Y A;  3ZH9 B;  2E5L M;  1TDH A;  2VF7 A;  1IN6 A;  4I8O A;  2OO9 A;  4OVZ A;  3GRR A;  4JI3 M;  3U6E A;  4II7 A;  3AOG A;  3KW6 A;  3FD9 A;  2UUA M;  4JI1 M;  5ITQ A;  4LJ4 A;  4R3D A;  1IXS A;  1UFZ A;  5FLX S;  2Y0Q A;  3GO8 A;  2HAK A;  3Q8X A;  1JB0 F;  3W68 A;  1WR1 B;  2JZ1 A;  2ZTD A;  3C9P A;  3DA1 A;  1WJ7 A;  1T6O A;  3PFI A;  1R2Z A;  4NOO B;  5DYI A;  4DR2 M;  4JI2 M;  1IQP A;  3KXE C;  3K8Z A;  3GRV A;  1W5S A;  2CWB A;  3HU3 A;  2JY6 B;  3KOW E;  4DR6 M;  3GLG E;  4LF8 M;  5FTJ A;  4KLN A;  1XXH A;  2KNZ A;  2XSZ D;  4HLQ A;  4OU7 A;  3LQR A;  1DGH A;  1VG5 A;  1NJG A;  1WGN A;  1IY2 A;  1NHW C;  1QYR A;  2RGO A;  4PDG A;  1IM2 A;  1DGG A;  1GVN A;  2QCU A;  1L2C A;  3VLF B;  1K82 A;  1JR3 D;  1IN4 A;  4RKU F;  4ITQ A;  2MRO B;  3KOZ E;  4G6Z A;  4IIW A;  2V1U A;  4RF0 A;  2Z3X A;  1VDL A;  4DR4 M;  3GLH B;  3GLG B;  1GO5 A;  3LMM A;  3FE3 A;  1IN7 A;  1ZMW A;  2LHG A;  1D2N A;  3TWM A;  4M9X A;  1YLA A;  4L8R C;  4FWH A;  2CHG A;  3GPY A;  3I4V A;  4DV4 M;  3U6D A;  3L25 A;  4JI0 M;  2KA6 B;  3KVW A;  3PVS A;  1QAO A;  4LZJ A;  1GJS A;  1SXJ B;  1TF0 B;  2ZBK B;  3A45 A;  2G5G X;  1NJF A;  1WXQ A;  3FRI A;  1NNJ A;  4AZF A;  1QVR A;  2EKF A;  2O25 A;  5BPV A;  2MH8 A;  2MR9 A;  4LGY A;  1DV0 A;  3KP0 E;  2HKJ A;  4IBJ A;  1IBL M;  2F5P A;  3E46 A;  4D80 A;  2DZO B;  3HJ8 A;  3HHY A;  4MGY E;  2OOB A;  3SFZ A;  3THG A;  3W0L B;  4XGI A;  2R4J A;  2L09 A;  4B7G A;  3NWL A;  3SAU A;  3CF0 A;  1G71 A;  4L6V 6;  5ITU A;  1E9S A;  4CJ6 A;  1R6B X;  3UJN A;  1NSF A;  4B3M M;  3WHL A;  4X64 M;  1Y8G A;  2JXN A;  5EQT A;  4FCT A;  2KNA A;  2R65 A;  4REZ A;  3SAS A;  3R8F A;  4Y28 F; 
#chains in the Genus database with same CATH homology
 1W5T A;  1G8P A;  4LFA M;  3VK7 A;  1NVM A;  4D81 A;  5ITR A;  2FNA A;  3CF2 A;  4LJ7 A;  2D7G A;  3W0F A;  4DV5 M;  4JI7 M;  1H6U A;  2KEB A;  4MH0 E;  1DGF A;  3RE8 A;  2XF3 A;  1I94 M;  1TH4 A;  4R7G A;  4MM3 B;  1GKI A;  2OPF A;  3HU2 A;  4B7F A;  2Y20 A;  4OVZ B;  2Y0T A;  4I4L A;  2R62 A;  3T1H M;  3FUT A;  2XZF A;  4PD2 A;  3J81 S;  1N75 A;  2X49 A;  5EXP A;  3HGI A;  5EXT A;  5KO3 A;  4IBE A;  4JN6 A;  4QNM A;  4S12 A;  3VDU A;  3LVW A;  4IJF A;  4QOS A;  2VQE M;  1IN5 A;  4X62 M;  2X8A A;  4G4R A;  1QAQ A;  1YSY A;  2W82 A;  3LVV A;  2ERC A;  4GH9 A;  1KSF X;  1LV7 A;  4B3T M;  1TH3 A;  2G8L A;  4IBC A;  2J7O A;  4LCB A;  2UUB M;  3KSX A;  3MK6 A;  4YHH M;  3JAM S;  1PM5 A;  4NXN M;  5JI3 E;  2V6Z M;  2YQZ A;  2ZAO A;  4B3R M;  1N32 M;  2KZS A;  1N33 M;  4LJ6 A;  2QEN A;  2XLJ A;  3GQ4 A;  1TDZ A;  4PDI A;  1PJI A;  4MGK E;  1PJJ A;  2FOI C;  1OFH A;  5H37 D;  2CEA A;  2UXD M;  2RKO A;  3NBI A;  3FKE A;  5EP1 A;  3GLG A;  2XZU A;  2XFS A;  4QOZ C;  1L1T A;  4XBO A;  4LJ5 A;  2H1R A;  3U6M A;  5C18 A;  3FUV A;  3EIH A;  4DV0 M;  2BJV A;  2QBY A;  2XEP A;  1MU5 A;  2C99 A;  3T15 A;  2XFT A;  3QWL A;  5IT9 S;  5LMU M;  3WHK A;  4L15 A;  3A42 A;  4LF7 M;  1XXH B;  3M7G A;  2CE7 A;  2M60 A;  5FTK A;  4GKJ M;  3VKH A;  4JXJ A;  4DR3 M;  4TUW A;  1YUB A;  3PXG A;  3TQS A;  2VII A;  3T38 A;  4G4O A;  2YNM D;  4B3S M;  2C96 A;  5GKN A;  3H4M A;  3JR5 A;  3SHG B;  1HNZ M;  1T3T A;  2L7I A;  4LFC M;  1DGH B;  1HT1 E;  3BOS A;  3GP1 A;  4JYA M;  3U6L A;  1XMQ M;  2DZN B;  2KRK A;  2L7H A;  3EIE A;  1JQJ C;  2KW0 A;  3AOE C;  4LJ9 A;  3FYD A;  3FTE A;  2XH9 A;  4A3V B;  2F5S A;  4IBB A;  2DWL A;  2F5O A;  2F5Q A;  4DR7 M;  1HQC A;  3RGS A;  3GLI B;  3RGP A;  4LG2 A;  1QAM A;  1S3S A;  2Q2E B;  2LWX A;  1OFI A;  3SAT A;  3HWS A;  4BLC A;  2C9O A;  4DUY M;  2XGN A;  3UZU A;  3VK8 A;  1JR3 A;  1IN8 A;  5EJC A;  1C1K A;  4AI6 A;  3FTC A;  3J7B A;  4IJE A;  1IXR C;  4GHA A;  2F5N A;  3GLI A;  4GIT A;  3KDS E;  1UM8 A;  4LJA A;  3GRU A;  5IWA M;  2DWN A;  1R7R A;  4MGH A;  3UK6 A;  2VQF M;  3DFZ A;  4JI8 M;  3J2P B;  4RF1 A;  4LRS A;  3UMM A;  2ZAN A;  2KRU A;  2Y21 A;  3MHV C;  1IY1 A;  4BBA A;  4GMQ A;  3GRY A;  2YR0 A;  3GLF B;  3HU1 A;  4K0K M;  4Z6Y A;  1NHG C;  3MJ5 A;  4GC5 A;  5E26 A;  3J7A S;  4JV5 M;  2R46 A;  2V1C A;  4DV3 M;  3T1Y M;  5EP4 A;  3M6A A;  4DV6 M;  1NY6 A;  1Z6T A;  2JA2 A;  3SYL A;  4GRI A;  2X4A A;  4NRV A;  4B7H A;  3GPU A;  4FW9 A;  2AHM A;  5F3W A;  1E94 E;  3U61 B;  3AKZ A;  2EA0 A;  1J09 A;  2DHR A;  1GL7 A;  4JI4 M;  4NXM M;  4FWD A;  5EXX A;  3OTO M;  3TE6 A;  2M5Z A;  3K1J A;  4AKI A;  3KS4 A;  4IBK A;  4M9S A;  4W5W A;  3SC3 A;  4LZZ A;  1FJG M;  3FYC A;  1TH2 A;  2R18 A;  2HHH M;  1XNR M;  1Z59 A;  3KSJ A;  4YY3 M;  5KPZ A;  1NY5 A;  1FNN A;  1XWI A;  4CIS A;  8CAT A;  4QHS A;  4L16 A;  4PT5 A;  3E4R A;  3U60 B;  3KP1 E;  5A2Q S;  1MX0 A;  4JI6 M;  2Z4S A;  1VDD A;  2LXE A;  4B08 A;  2UXB M;  2D7E A;  1E9R A;  3FUU A;  1DO0 A;  1IXS B;  3RFW A;  3HHW A;  4M9Z A;  3K92 A;  2LNH C;  5ITT A;  4NL4 H;  1HNX M;  4NSR A;  2I7N A;  2O5R A;  2LH0 A;  3KOX E;  1G4A E;  3DOA A;  4DR5 M;  2QPA A;  2DWM A;  1QAN A;  1XC8 A;  3HJS A;  1TGU A;  2NQ8 C;  5LMN M;  2UU9 M;  2DVW B;  1Z5B A;  2K47 A;  2ZAM A;  4IBD A;  4G4Q A;  4OW0 A;  3U6C A;  2QBY B;  2DWZ B;  5FTM A;  2D7H A;  4LF9 M;  3L28 A;  2L6O A;  1ZQ9 A;  3IG8 A;  2CV2 A;  2CFO A;  2CV0 A;  3DZD A;  1XNQ M;  3KS8 A;  2I7P A;  4IBF A;  5E6J A;  3L26 A;  4FWG A;  2EUC A;  2FFJ A;  3AJI B;  4HL4 A;  4LGM A;  3J27 B;  3HHX A;  2R4E A;  2UXC M;  4BB9 A;  1Z5C A;  4LRT A;  4GHL A;  4PCZ A;  4WUR A;  2Z7J A;  1L8Q A;  1Q3B A;  3C58 A;  1QQW A;  1HT2 E;  3SMP A;  4DV2 M;  2XSZ A;  5JI2 E;  4AW4 A;  4LF5 M;  1KYI A;  3U5Z B;  3VFD A;  3PNY A;  1G3I A;  3TPZ A;  3HHZ A;  4AKH A;  3K2L A;  5IZ7 D;  3L2A A;  1X37 A;  3SYK A;  1XHB A;  5KPT A;  3I51 A;  4FVM A;  3E9S A;  4P16 A;  4GKK M;  2R45 A;  1G59 A;  1L2B A;  3QAU A;  3JR4 A;  2ZM6 M;  1DO2 A;  4DV1 M;  4DUZ M;  2UUC M;  3U61 A;  5BR8 M;  3VDP A;  4X66 M;  7CAT A;  4LF4 M;  3L29 A;  3ZC7 B;  2KZU A;  3SMS A;  3GQ5 A;  4MGI E;  3IG5 A;  1YE9 A;  4FD2 A;  1N78 A;  3TWK A;  4MGZ E;  4IBI A;  3GQ3 A;  2C5R A;  1ORY B;  3AOE A;  4D82 A;  1J7K A;  1I4W A;  4WW0 A;  3A98 B;  1IY0 A;  1IBM M;  5DYG A;  1K3X A;  1SXJ A;  5EXS A;  3U6Q A;  1HQY E;  2J7N A;  3VKG A;  1IXZ A;  1ZAE A;  4AG6 A;  1N34 M;  2CHQ A;  1R2Y A;  4KO8 A;  1J5E M;  2Z4R A;  3AFH A;  3SHF A;  3AL0 C;  1GLN A;  2EO2 A;  5FSW A;  3GPP A;  5KPR A;  1IBK M;  3FTF A;  4AG5 A;  3FUW A;  3GLF A;  5KQD A;  3PNV A;  1SXJ D;  1L2D A;  3M0E A;  1Q39 A;  1GL6 A;  3U5Z A;  4KOD A;  4LY6 A;  4LJ8 A;  2P5T A;  1OJL A;  2CHV A;  5IRE B;  3CF6 E;  5ITX E;  2RGH A;  5C1B A;  4JI5 M;  4AKG A;  4L4U A;  5EP3 A;  5ITX A;  3SAW A;  2C98 A;  4DR1 M;  1Z5A A;  4DV7 M;  2CUZ A;  1HR0 M;  3L27 A;  4FCV A;  3SAV A;  3TWL A;  4OX9 M;  4IBG A;  3D8B A;  1K3W A;  5FTN A;  3GLH A;  5FTL A;  4GC9 A;  2OQ4 A;  4CGY B;  1Q3C A;  4QHT A;  3LQQ A;  1DGB A;  2HL7 A;  3D8L A;  4CHT B;  2CV1 A;  2F4V M;  4I5S A;  3ZCB B;  3U60 A;  4KHP M;  3GPX A;  3R9X B;  3AV0 A;  4LFB M;  1NNU C;  2YFQ A;  3SBJ A;  2KXE A;  2FE8 A;  3KFU G;  3UGJ A;  1N77 A;  3SAR A;  4GIP A;  4Z8X A;  4G4N A;  1HNW M;  3U6O A;  3HKP A;  4I81 A;  4NSO B;  4MB7 A;  5KQ8 A;  2BJW A;  2BNK A;  2HCB A;  3FUX A;  1KFV A;  1SXJ C;  2DXI A;  4QNR A;  5ITY A;  2A5Y B;  4RNA A;  2QP9 X;  3FTD A;  1EE8 A;  2C9C A;  3J80 S;  4M0D A;  4EIW A;  3U6P A;  4ZPX A;  3A46 A;  1E32 A;  3ILK A;  3TL4 X;  2QZ4 A;  5EP2 A;  4X65 M;  4AQY M;  4FCW A;  4NRW A;  1XMO M;  4L78 A;  5DNY A;  4LF6 M;  3KOY E;  1SXJ E;  4M0W A;  1G41 A;  1L1Z A;  1N36 M;  3U6S A;  1QZM A;  3CTW B;  3HJQ A;  3I4Y A;  3ZH9 B;  2E5L M;  1TDH A;  1IN6 A;  4I8O A;  4OVZ A;  3GRR A;  4JI3 M;  3U6E A;  4II7 A;  3AOG A;  3KW6 A;  3FD9 A;  2UUA M;  4JI1 M;  5ITQ A;  4LJ4 A;  4R3D A;  5FLX S;  2Y0Q A;  3GO8 A;  3Q8X A;  3DA1 A;  3PFI A;  1R2Z A;  4NOO B;  5DYI A;  4DR2 M;  4JI2 M;  3KXE C;  1IQP A;  3K8Z A;  3GRV A;  1W5S A;  3HU3 A;  4DR6 M;  3KOW E;  4LF8 M;  5FTJ A;  4KLN A;  1XXH A;  2XSZ D;  4HLQ A;  4OU7 A;  3LQR A;  1DGH A;  1NJG A;  1IY2 A;  1NHW C;  1QYR A;  2RGO A;  4PDG A;  1IM2 A;  1DGG A;  1GVN A;  2QCU A;  1L2C A;  3VLF B;  1K82 A;  1JR3 D;  1IN4 A;  4ITQ A;  3KOZ E;  4G6Z A;  2V1U A;  4IIW A;  4DR4 M;  4RF0 A;  2Z3X A;  3GLH B;  3GLG B;  3LMM A;  1IN7 A;  1D2N A;  3TWM A;  4M9X A;  4L8R C;  4FWH A;  2CHG A;  3GPY A;  3I4V A;  4DV4 M;  3U6D A;  3L25 A;  4JI0 M;  2KA6 B;  3PVS A;  3KVW A;  1QAO A;  4LZJ A;  1SXJ B;  2ZBK B;  3A45 A;  2G5G X;  1NJF A;  1WXQ A;  1NNJ A;  4AZF A;  1QVR A;  5BPV A;  4LGY A;  3KP0 E;  2HKJ A;  4IBJ A;  1IBL M;  2F5P A;  4D80 A;  2DZO B;  3HJ8 A;  3HHY A;  4MGY E;  3SFZ A;  3THG A;  3W0L B;  4XGI A;  2R4J A;  2L09 A;  4B7G A;  3NWL A;  3SAU A;  3CF0 A;  5ITU A;  1E9S A;  1R6B X;  3UJN A;  1NSF A;  4B3M M;  3WHL A;  4X64 M;  5EQT A;  4FCT A;  2R65 A;  3B9P A;  4REZ A;  3SAS A;  3R8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...