2E5LM

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
122
structure length
122
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2e5lM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2e5lM02
5FLXS 4PDGA 4DV3M 1L1ZA 3SAVA 1MX0A 2F4VM 1TDZA 5ITXA 4JI6M 1XMQM 3J81S 3U6MA 1I94M 5IT9S 1TDHA 4DV7M 4B3MM 4PD2A 3OTOM 3A45A 1Z5AA 4DUZM 4DR5M 3SBJA 3U6SA 3T1YM 1PM5A 2HHHM 2XZUA 3U6LA 4LF4M 1HNXM 4X64M 1NNJA 1XNRM 5LMUM 4JI4M 3GQ4A 1K3XA 4LFAM 3T1HM 2VQFM 2ZM6M 4JI5M 5A2QS 3U6DA 1K3WA 5ITYA 4B3RM 4PDIA 3U6PA 4DV4M 1L1TA 5ITXE 1HR0M 4DR7M 4X62M 3GO8A 3C58A 4NRVA 2OQ4A 4LFCM 3JR5A 4LF5M 4LF7M 4G4QA 3SATA 5LMNM 4AQYM 1R2YA 1IBLM 1IBKM 2EA0A 4ITQA 4DR6M 3W0FA 3SAUA 4G4RA 1Z5CA 2UUBM 4B3SM 1MU5A 2E5LM 3J7AS 1IBMM 3SARA 5ITTA 3DOAA 3TWKA 1L2BA 1J5EM 3GPYA 4CISA 4JI0M 1Q3CA 3U6OA 3A46A 4LF9M 1XMOM 4YHHM 3U6CA 3J80S 4NRWA 4DV0M 2VQEM 4G4OA 2F5QA 1XNQM 4DUYM 1XC8A 5ITQA 4JI1M 5BR8M 2F5PA 2UXCM 3GQ5A 3TWLA 3SAWA 1EE8A 4DV1M 3U6EA 4DR2M 1L2DA 5ITRA 4NXMM 2ZBKB 4OX9M 5IWAM 4DV6M 1Q3BA 4PCZA 3VK7A 4LF6M 1Z5BA 4X66M 2UUAM 1FJGM 4JYAM 1HNZM 4DV5M 1Z59A 2F5OA 1L2CA 4JI2M 2Q2EB 2UXBM 3JR4A 1PJJA 1N32M 2UXDM 1HNWM 4NXNM 4DR1M 4DR4M 2UU9M 1N33M 4JI7M 4KHPM 1Q39A 4GKKM 1KFVA 4X65M 1N36M 4LF8M 3JAMS 2XZFA 1K82A 2UUCM 4DR3M 4YY3M 5ITUA 1PJIA 4MB7A 4LFBM 2F5NA 3A42A 3TWMA 2OPFA 1N34M 3GPPA 3GPXA 4JI3M 3U6QA 4DV2M 4B3TM 2F5SA 4K0KM 4GKJM 1R2ZA 4G4NA 4JV5M 3GPUA 2HKJA 3GP1A 4JI8M 3GQ3A 3VK8A 3SASA
chains in the Genus database with same CATH superfamily
2LNHC 3FTCA 4GITA 2ERCA 2JNHA 2M60A 4PDGA 3NBIA 1JQJC 1H6UA 2MJ5B 3EIEA 4WW0A 2DWMA 2EKFA 3MK6A 1TDZA 2X49A 2ZAMA 3T15A 3J81S 2R18A 1QAOA 1IN8A 1GJTA 1OQYA 2K6BA 2LVNC 4MH0E 3GLFE 3DFZA 3KVWA 4PD2A 3B7ZA 3OTOM 3A45A 2CHGA 4IJEA 4ANRA 4LRSA 1TH3A 2QSFX 3H4JA 3HJSA 1XXHE 2XSZD 3BBZA 3L25A 3RGSA 1G59A 3HKPA 4I8OA 4LF4M 1IFYA 1NNJA 3I01M 3B7NA 3M7GA 1V92A 4JI4M 1XWIA 1IN4A 3TE6A 1TTEA 4QOSA 5C18A 3T1HM 4IIWA 3TL4X 5KPTA 5A2QS 2ZM6M 2JZ0A 3K1JA 4LRTA 3RFWA 3KDSE 1NJGA 1K3WA 3L29A 4XGIA 4B3RM 1C1KA 4IBGA 3B89A 3U6PA 1PRBA 1L1TA 1ZV1A 4L6V6 3RGPA 1W5TA 1PGYA 2HL7A 3PFIA 4AG6A 2QP9X 4QNRA 2D7EA 4X62M 4LJ6A 2X8AA 3DZDA 4LFCM 1JR3D 3FRHA 3HJ8A 1G8PA 5LMNM 1OIPA 2YNMD 4FWHA 3W0FA 2RRUA 1Z5CA 4G6ZA 3HX3A 5KQ8A 3A98B 1MU5A 3J7AS 2C9OA 4R71A 4R3DA 3RE8A 1W5SA 1TH2A 3DOAA 3W0LB 3TWKA 5EQTA 3KOWE 3ZH9B 2D7GA 3H4MA 4CISA 1S3SA 4JI0M 1Q3CA 2BJWA 2L4FA 1QYRA 3R9XB 3A46A 4LF9M 1IY0A 3U60B 2HCBA 4L78A 1DV0A 1UFZA 2O25A 3J80S 1EIJA 3FRIA 1HT2E 2XGNA 4LJ8A 2VQEM 3LQQA 2F5QA 1XNQM 2UXCM 3QYBA 3UZUA 1SXJD 1VDDA 3HY5A 4RNAA 3WHLA 1F4IA 5EXPA 1VQ1A 3R8FA 3I4YA 1BVSA 2A5YB 2KRUA 4AKIA 2VIIA 3VK7A 1Z5BA 2F5SA 1FJGM 2ZTCA 2V6ZM 4JYAM 2DENA 4DV5M 1IY2A 1N75A 2R46A 2WSCF 4RF1A 2F5OA 2XF3A 3L26A 2C5RA 3SYKA 2UXBM 3QYEA 2R6FA 2LWXA 4NXNM 4DR4M 3FD9A 3NBXX 1OIZA 2DAIA 4CIZA 2OOAA 5KPZA 2DZOB 1Y8GA 1WR1B 1WXQA 2C96A 4OVZB 4OU7A 1QANA 2CFOA 2DWZB 1KYIA 2UUCM 4M0WA 2JY5A 3U60A 2F5NA 2Y20A 1GJSA 4MM3B 2DAMA 3VKGA 4BBAA 5EP3A 2Z4RA 4REZA 1IN6A 1EFUB 4IBKA 1N77A 1QDTA 3C9PA 4JI8M 2HKJA 3Q8GA 4AG5A 4D81A 2QPAA 3ZQJA 3LCUA 2QCUA 3MHVC 4DV3M 2C99A 3KOXE 2CRUA 1NY6A 3W67A 4MGHA 3ILKA 1PJSA 4JI6M 4EIWA 3U6MA 5JI2E 4LJ4A 1QUSA 4DV7M 1IN5A 4BB9A 5EXXA 4AKHA 4DUZM 2JUJA 3B74A 2WSFF 5E26A 3U6SA 3SBJA 2KW0A 4CJ6A 1AUAA 2R62A 2G5GX 1HNXM 3GRYA 5LMUM 4IBEA 7CATA 3GQ4A 2Z8YM 4LFAM 3HWSA 4MGYE 2JP7A 3BXWA 4JI5M 3I04M 3CF0A 1DGBA 3FUXA 2DXIA 1GO5A 4L15A 5ITYA 4RKUF 5EP1A 3GLGA 2DHYA 3K9PA 2C98A 3PNYA 4DV4M 2R0IA 1HR0M 4DR7M 2DAEA 2H5XA 2OOBA 1R5LA 1TH4A 4IBCA 3C58A 2OQ4A 2L09A 2FNAA 1NV8A 3JR5A 3GLIB 3SATA 1TGUA 3I4VA 1HJPA 1IBLM 1NY5A 1A5TA 2EA0A 3KP0E 3FTFA 2JZ1A 1T6OA 5DYIA 3C3DA 3TPZA 3CF6E 1VDLA 2DI0A 2UUBM 3MMPA 4B3SM 2KNVA 2E5LM 3J7BA 2BJVA 4WP2A 1E9SA 3FYDA 1HQCA 5KO3A 3SARA 2YR0A 3FTDA 3K92A 2V1UA 3FE3A 3D8LA 4LG2A 1IQPA 4I81A 3GLGE 5FTJA 3L27A 3LMMA 3FTEA 3HGIA 2P5TA 3FUTA 4GC5A 3E21A 4G4OA 5C1BA 3HJQA 2EO2A 5ITQA 4JN6A 4NOOB 5BR8M 4JI1M 1QZEA 3SAWA 1VEKA 4GEWA 3KOYE 4IBDA 3TWLA 4GHLA 3AL0C 1L2DA 2XLJA 4OX9M 3HU1A 5IWAM 4DV6M 1GKIA 2DAGA 2QZ4A 2L4EA 4LF6M 3AV0A 4HL4A 2MH8A 4S12A 1GL7A 1Z59A 1MN3A 2Z3XA 1L2CA 4JI2M 2GNOA 5DYGA 1PJJA 4IBIA 1N32M 1AIPC 2XH9A 3HU2A 4IBFA 3SHGB 2XFSA 2L7HA 1Q39A 3CF2A 4W5WA 1IXRC 4M0DA 4X65M 4LF8M 2K47A 4M9ZA 2DWLA 4LJ5A 1NHGC 4FD2A 1NSFA 5EP4A 4DR3M 2J5YA 4MB7A 4UN2B 3A42A 4OW0A 3PNVA 4HLQA 1N34M 2DKLA 4FVMA 3GPPA 1ZQ9A 2BNKA 4II7A 2KNZA 1TF0B 2M5ZA 1SXJC 3DA1A 1OTRA 4IBBA 1QDRA 4NSRA 2LHGA 4DV2M 4FCVA 3KXEC 4LZJA 3Q8XA 2WZJA 1R2ZA 2I7PA 1OAOC 1V33A 4G4NA 2VF8A 3E4RA 2G8LA 5JI3E 1PJQA 2Y0QA 4IBJA 3AKZA 4QHSA 4M9SA 3T6PA 3VDPA 1WIVA 5FTLA 3HHZA 2JXNA 1L1ZA 1QAQA 1IY1A 2VF7A 1V34A 2L2DA 3SAVA 1MX0A 2F4VM 1E32A 2X4AA 1L8QA 4Z8XA 1I94M 1G4AE 4KO8A 2JY6B 5IT9S 1TDHA 5EXTA 2QENA 4B3MM 4CHTB 1GABA 4AI6A 1X37A 2CHVA 3MJ5A 1IN7A 1XHBA 2YFQA 1WJ7A 3E46A 1T3TA 1ZMUA 3IHPA 4LJ9A 4NL4H 2YQZA 2HHHM 4XK8F 2LHCA 3AOGA 3PVSA 1SG9A 3ZC7B 1I4WA 5KPRA 3K2LA 4X64M 2EUCA 2OO9A 4P17A 1QAMA 4AZFA 4BLCA 4Z6YA 2BWBA 1K3XA 2DWNA 2LTUA 1LV7A 3E9SA 5IZ7D 2KHHA 4LJAA 4XBOA 3U61B 2R4JA 3LCVB 1VG5A 4AW4A 1DO0A 4HEOA 2LVQD 2J7OA 3SASA 3HHWA 3IG8A 1YUBA 3VDUA 1HT1E 2MR9A 3AOEC 1QUTA 3GLHB 1NJFA 1MJGM 2RKOA 2CUZA 3THGA 4F2LA 5FTMA 4AQYM 2MROB 5IREB 1R2YA 4OVZA 2MGWA 1ZMVA 2H1RA 1IBKM 1R4GA 1J7KA 3SAUA 3SFZA 1R7RA 4F1IA 4KODA 1G41A 4FCTA 1PJTA 4NC6A 3HHYA 1IBMM 2O5RA 5ITTA 3U5ZB 2JWSA 3KP1E 4A3VB 3T38A 3V76A 2K0BX 1J5EM 3B9PA 4L16A 3HU3A 1NNUC 2V1CA 1OJLA 1OFHA 1YSYA 1GLNA 2K9DA 4YHHM 3U61A 4DV0M 2XEPA 3UGJA 2RGOA 3UJNA 1VEJA 3M6AA 3LQRA 5FSWA 2DNAA 2KZSA 2R4EA 2BWEA 5F3WA 2LVPC 1XC8A 2F5PA 3LVVA 1YLAA 1EE8A 3U6EA 4DR2M 4NXMM 2KEBA 2ZBKB 3GLHA 4I4LA 4I5SA 3PXGA 4PCZA 3VKHA 4LGYA 3J27B 4X66M 1DGGA 2UUAM 1HNZM 3KFUG 1D0MA 1G71A 3IECA 1OFIA 3TQSA 3FUVA 4RF0A 2FS1A 2Q2EB 5EJCA 3JR4A 4QNMA 4GH9A 2VDBB 2KXEA 3QAUA 5DNYA 2UU9M 1N33M 3U5ZA 1T43A 4QOZC 1KFVA 1D2NA 4GHAA 1N36M 1K82A 4TUWA 4WURA 1SXJB 1OAIA 4IJFA 3TWMA 2GQFA 1JR3A 2FH0A 3FKEA 3GPXA 1LTMA 1NHWC 1D0KA 3FUWA 2DVWB 3GLHE 4KT0F 3AJIB 3GLIA 1Z6TA 2CEAA 4GKJM 1TR8A 2KNAA 1QQWA 3BOSA 5FTKA 3GRVA 2QNJA 5FTNA 4NSOB 3KSJA 3GQ3A 3SYLA 3VK8A 3FUUA 1R6BX 5FLXS 5EXSA 3CTWB 2L7IA 2EJSA 3AFHA 3K9OA 4JXJA 1NVMA 4B7FA 1J09A 2EKKA 4B7GA 4DBGB 4M9XA 1WHCA 3CGWA 2O01F 4AKGA 3M0EA 4B08A 2CWBA 1JB0F 5ITXA 2QQ8A 2Y21A 1XMQM 4D80A 1OKSA 1RU3A 2R44A 1CUKA 3VFDA 2ZAOA 1Z5AA 2W82A 2XFTA 3EIHA 4DR5M 1ZMWA 4L4UA 1JR3E 3T1YM 1NO1A 5E6JA 1PM5A 3WHKA 2KDLA 1SXJA 2ZTDA 2XZUA 1C7YA 5H37D 3U6LA 3NWLA 4GRIA 3GLIE 1XNRM 4G3OA 3VLFB 2I7NA 2KA6B 3KS8A 3KSXA 1IM2A 3HZJA 2VQFM 1XB2B 4LGMA 2N35A 4Q7JA 3HHXA 3L2AA 3B7QA 3KW6A 3U6DA 2CV1A 5DFLA 4P16A 3LW5F 2C9CA 2WSEF 4PDIA 1ZAEA 4B7HA 1YE9A 5BPVA 2DHRA 2NQ8C 3SC3A 2B3TA 3ZCBB 2L6OA 5ITXE 3GO8A 4ZPXA 3SHFA 4NRVA 3D8BA 3SMSA 3UMMA 3F92A 4LF5M 1NV9A 4LF7M 4G4QA 1IXSB 4LY6A 3KOZE 4QHTA 4ITQA 3W68A 4DR6M 1FNNA 1SXJE 4G4RA 1WGNA 3I51A 2G3QA 2LVAA 1Q02A 4FWGA 2FFJA 2DZLA 4GMQA 1ORYB 1UM8A 2CHQA 1L2BA 2R45A 3GPYA 1P3QQ 2Z7JA 3GLFB 1GVNA 5GKNA 1KSFX 3U6OA 2J7NA 3K8ZA 3AOEA 1XMOM 2CV2A 3FYCA 2LBCA 1N78A 2ZANA 3U6CA 4NRWA 3J2PB 3UK6A 3GRRA 2LH0A 1DGHB 2LVOC 3L28A 4D82A 1XXHB 4DUYM 1QVRA 8CATA 4L8RC 1DGFA 3C3EA 3GQ5A 2QHOB 4KLNA 4DV1M 1G3IA 2KZUA 4GC9A 5ITRA 2QBYB 2DZNB 1Q3BA 4FW9A 2FE8A 1IXSA 4MGZE 5L8RF 2AHMA 2RGHA 4PT5A 2D7HA 3GLGB 2HAKA 1IXZA 1GL6A 5KQDA 4MGIE 2UXDM 1HNWM 3LVWA 4DR1M 1E9RA 2JY8A 4JI7M 4KHPM 1E94E 4GKKM 1QZMA 3QWLA 2DAKA 3JAMS 3GLFA 2CP8A 2FOIC 2KRKA 2XZFA 4LJ7A 2HWJA 4FWDA 4YY3M 5ITUA 2Y0TA 1PJIA 4LFBM 3GRUA 4MGKE 4R7GA 4CGYB 2OPFA 1WGLA 3SMPA 1D0LA 1DGHA 4LCBA 4JI3M 1XXHA 3U6QA 2JY7A 4LZZA 2LXEA 2CE7A 2R65A 3KS4A 4B3TM 2CV0A 3IG5A 4FCWA 4K0KM 1HQYE 1DO2A 4JV5M 2XSZA 2Z4SA 5EP2A 3GPUA 2JA2A 4Y28F 3GP1A 4GIPA 2QBYA 2APLA 1VEGA
chains in the Genus database with same CATH topology
2LNHC 3FTCA 4GITA 2ERCA 4PDGA 2M60A 3NBIA 1JQJC 1H6UA 3EIEA 4WW0A 2DWMA 3MK6A 1TDZA 2X49A 2ZAMA 3T15A 3J81S 2R18A 1QAOA 1IN8A 4MH0E 3DFZA 3KVWA 4PD2A 3OTOM 3A45A 2CHGA 4IJEA 4LRSA 1TH3A 3HJSA 3L25A 2XSZD 3RGSA 1G59A 3HKPA 4I8OA 4LF4M 1NNJA 3M7GA 4JI4M 1XWIA 1IN4A 3TE6A 4QOSA 5C18A 3T1HM 4IIWA 3TL4X 5KPTA 5A2QS 2ZM6M 3K1JA 4LRTA 3RFWA 3KDSE 1NJGA 1K3WA 3L29A 4XGIA 4B3RM 1C1KA 4IBGA 3U6PA 1L1TA 3RGPA 4AG6A 4X62M 1W5TA 2HL7A 3PFIA 4OU7A 2QP9X 4QNRA 2D7EA 4LJ6A 2X8AA 3DZDA 4LFCM 1JR3D 3HJ8A 1G8PA 5LMNM 2YNMD 4FWHA 3W0FA 4G6ZA 1Z5CA 5KQ8A 3A98B 1MU5A 3J7AS 2C9OA 4R3DA 3RE8A 1W5SA 1TH2A 3DOAA 3W0LB 3TWKA 5EQTA 3KOWE 3ZH9B 2D7GA 3H4MA 4CISA 1S3SA 4JI0M 1Q3CA 2BJWA 1QYRA 3R9XB 3A46A 4LF9M 1IY0A 3U60B 2HCBA 4L78A 3J80S 1HT2E 2XGNA 4LJ8A 2VQEM 3LQQA 2F5QA 1XNQM 2UXCM 3UZUA 1SXJD 1VDDA 4RNAA 3WHLA 5EXPA 3R8FA 3I4YA 2A5YB 2KRUA 4AKIA 2VIIA 3VK7A 1Z5BA 1FJGM 2V6ZM 4JYAM 4DV5M 1IY2A 1N75A 2R46A 2F5OA 4RF1A 2XF3A 3L26A 2C5RA 3SYKA 2UXBM 2LWXA 4NXNM 4DR4M 3FD9A 5KPZA 2DZOB 1WXQA 2C96A 4OVZB 1QANA 2CFOA 2DWZB 1KYIA 2UUCM 4M0WA 3U60A 2F5NA 2Y20A 4MM3B 3VKGA 4BBAA 5EP3A 2Z4RA 4REZA 1IN6A 4IBKA 1N77A 4JI8M 2HKJA 4AG5A 4D81A 2QPAA 2QCUA 3MHVC 4DV3M 2C99A 3KOXE 1NY6A 4MGHA 3ILKA 4JI6M 4EIWA 3U6MA 5JI2E 4LJ4A 4DV7M 1IN5A 4BB9A 5EXXA 4AKHA 4DUZM 5E26A 3SBJA 3U6SA 2KW0A 2R62A 2G5GX 1HNXM 3GRYA 5LMUM 4IBEA 7CATA 3GQ4A 4LFAM 3HWSA 4MGYE 4JI5M 3CF0A 1DGBA 3FUXA 2DXIA 4L15A 5ITYA 5EP1A 3GLGA 3PNYA 2C98A 4DV4M 1HR0M 4DR7M 3C58A 1TH4A 4IBCA 2OQ4A 2L09A 2FNAA 3JR5A 3GLIB 3SATA 1TGUA 3I4VA 1IBLM 1NY5A 2EA0A 3KP0E 3FTFA 5DYIA 3TPZA 3CF6E 2UUBM 4B3SM 2E5LM 3J7BA 2BJVA 1E9SA 3FYDA 1HQCA 5KO3A 3SARA 2YR0A 3FTDA 3K92A 2V1UA 3D8LA 4LG2A 1IQPA 4I81A 5FTJA 3L27A 3LMMA 3FTEA 3HGIA 2P5TA 3FUTA 4GC5A 4G4OA 5C1BA 3HJQA 2EO2A 5ITQA 4JN6A 4NOOB 5BR8M 4JI1M 3SAWA 4IBDA 3TWLA 3KOYE 4GHLA 3AL0C 1L2DA 2XLJA 4OX9M 3HU1A 5IWAM 4DV6M 1GKIA 2QZ4A 4LF6M 3AV0A 4HL4A 4S12A 1GL7A 1Z59A 2Z3XA 1L2CA 4JI2M 1N32M 5DYGA 1PJJA 4IBIA 2XH9A 3HU2A 4IBFA 3SHGB 2XFSA 2L7HA 1Q39A 3CF2A 4W5WA 1IXRC 4M0DA 4X65M 4LF8M 2K47A 4M9ZA 2DWLA 4LJ5A 1NHGC 4FD2A 1NSFA 5EP4A 4DR3M 4MB7A 3A42A 4OW0A 3PNVA 4HLQA 1N34M 4FVMA 3GPPA 1ZQ9A 2BNKA 4II7A 2M5ZA 3DA1A 1SXJC 4IBBA 4NSRA 4DV2M 4FCVA 3KXEC 4LZJA 3Q8XA 1R2ZA 2F5SA 2I7PA 4G4NA 3E4RA 2G8LA 5JI3E 4IBJA 2Y0QA 3AKZA 4QHSA 4M9SA 3VDPA 5FTLA 3HHZA 1L1ZA 1QAQA 1IY1A 3SAVA 1MX0A 2F4VM 1E32A 2X4AA 1L8QA 4Z8XA 1I94M 4KO8A 5IT9S 1TDHA 5EXTA 2QENA 4B3MM 4CHTB 4AI6A 1X37A 2CHVA 3MJ5A 1IN7A 1XHBA 2YFQA 4NL4H 1T3TA 4LJ9A 2YQZA 2HHHM 3AOGA 3PVSA 3ZC7B 5KPRA 1I4WA 4X64M 3K2LA 2EUCA 4AZFA 1QAMA 4BLCA 4Z6YA 1K3XA 2DWNA 1LV7A 3E9SA 4LJAA 4XBOA 3U61B 2R4JA 4AW4A 1DO0A 2J7OA 3HHWA 3IG8A 1YUBA 3VDUA 1HT1E 3AOEC 3GLHB 1NJFA 2RKOA 2CUZA 3THGA 4AQYM 5FTMA 1R2YA 5IREB 4OVZA 2H1RA 1IBKM 1J7KA 3SAUA 3SFZA 1R7RA 4KODA 1G41A 4FCTA 3HHYA 1IBMM 2O5RA 5ITTA 3U5ZB 3KP1E 4A3VB 3T38A 1J5EM 3B9PA 4L16A 3HU3A 1NNUC 2V1CA 1OJLA 1OFHA 1YSYA 1GLNA 4YHHM 3U61A 4DV0M 2XEPA 3UGJA 2RGOA 3UJNA 3M6AA 1XC8A 3LQRA 5FSWA 2R4EA 2KZSA 5F3WA 2F5PA 3LVVA 1EE8A 3U6EA 4DR2M 4NXMM 2KEBA 2ZBKB 3GLHA 4I4LA 4I5SA 3PXGA 4PCZA 3VKHA 4LGYA 3J27B 4X66M 1DGGA 2UUAM 1HNZM 3KFUG 1OFIA 3TQSA 3FUVA 4RF0A 2Q2EB 5EJCA 3JR4A 4QNMA 4GH9A 2KXEA 3QAUA 5DNYA 2UU9M 1N33M 3U5ZA 4QOZC 1KFVA 1D2NA 4GHAA 1N36M 1K82A 4TUWA 4WURA 1SXJB 4IJFA 3TWMA 1JR3A 3FKEA 3GPXA 1NHWC 3FUWA 2DVWB 3AJIB 3GLIA 1Z6TA 2CEAA 4GKJM 1QQWA 3BOSA 5FTKA 3GRVA 5FTNA 3GQ3A 4NSOB 3KSJA 3VK8A 3SYLA 3FUUA 1R6BX 5FLXS 5EXSA 3CTWB 2L7IA 4JXJA 3AFHA 4B7FA 4B7GA 1NVMA 4B08A 1J09A 4AKGA 4M9XA 3M0EA 5ITXA 2Y21A 1XMQM 4D80A 3VFDA 2ZAOA 1Z5AA 2W82A 2XFTA 3EIHA 4DR5M 4L4UA 3T1YM 5E6JA 1PM5A 3WHKA 1SXJA 2XZUA 5H37D 3U6LA 3NWLA 4GRIA 1XNRM 3VLFB 2I7NA 2KA6B 3KS8A 3KSXA 1IM2A 2VQFM 4LGMA 3HHXA 3L2AA 3U6DA 3KW6A 2CV1A 4P16A 2C9CA 4PDIA 1ZAEA 4B7HA 1YE9A 5BPVA 2DHRA 2NQ8C 3SC3A 3ZCBB 5ITXE 2L6OA 3GO8A 4ZPXA 3SHFA 4NRVA 3D8BA 3SMSA 3UMMA 4LF5M 4LF7M 4G4QA 1IXSB 4LY6A 3KOZE 4QHTA 4ITQA 4DR6M 1FNNA 1SXJE 4G4RA 3I51A 4FWGA 2FFJA 4GMQA 1ORYB 1UM8A 2CHQA 1L2BA 2R45A 3GPYA 2Z7JA 3GLFB 1GVNA 5GKNA 1KSFX 3U6OA 2J7NA 3K8ZA 3AOEA 1XMOM 2CV2A 3FYCA 1N78A 2ZANA 3U6CA 4NRWA 3J2PB 3UK6A 3GRRA 2LH0A 1DGHB 3L28A 4D82A 1XXHB 4DUYM 1QVRA 8CATA 4L8RC 1DGFA 3GQ5A 4KLNA 4DV1M 1G3IA 2KZUA 4GC9A 5ITRA 2QBYB 2DZNB 1Q3BA 4FW9A 2FE8A 4MGZE 2AHMA 2RGHA 4PT5A 2D7HA 3GLGB 1IXZA 1GL6A 5KQDA 4MGIE 2UXDM 1HNWM 3LVWA 4DR1M 1E9RA 4JI7M 4KHPM 1E94E 4GKKM 1QZMA 3QWLA 3JAMS 3GLFA 2FOIC 2XZFA 2KRKA 4LJ7A 4FWDA 4YY3M 5ITUA 1PJIA 2Y0TA 4LFBM 3GRUA 4MGKE 4R7GA 4CGYB 2OPFA 3SMPA 1DGHA 4LCBA 4JI3M 1XXHA 3U6QA 4LZZA 2LXEA 2CE7A 2R65A 3KS4A 4B3TM 2CV0A 3IG5A 4FCWA 4K0KM 1HQYE 1DO2A 4JV5M 2XSZA 2Z4SA 5EP2A 3GPUA 2JA2A 3GP1A 2QBYA 4GIPA 3SASA 1G4AE 5IZ7D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX S;  4PDG A;  4DV3 M;  1L1Z A;  3SAV A;  1MX0 A;  2F4V M;  1TDZ A;  5ITX A;  4JI6 M;  1XMQ M;  3J81 S;  3U6M A;  1I94 M;  5IT9 S;  1TDH A;  4DV7 M;  4B3M M;  4PD2 A;  3OTO M;  3A45 A;  1Z5A A;  4DUZ M;  4DR5 M;  3SBJ A;  3U6S A;  3T1Y M;  1PM5 A;  2HHH M;  2XZU A;  3U6L A;  4LF4 M;  1HNX M;  4X64 M;  1NNJ A;  1XNR M;  5LMU M;  4JI4 M;  3GQ4 A;  1K3X A;  4LFA M;  3T1H M;  2VQF M;  2ZM6 M;  4JI5 M;  5A2Q S;  3U6D A;  1K3W A;  5ITY A;  4B3R M;  4PDI A;  3U6P A;  4DV4 M;  1L1T A;  5ITX E;  1HR0 M;  4DR7 M;  4X62 M;  3GO8 A;  3C58 A;  4NRV A;  2OQ4 A;  4LFC M;  3JR5 A;  4LF5 M;  4LF7 M;  4G4Q A;  3SAT A;  5LMN M;  4AQY M;  1R2Y A;  1IBL M;  1IBK M;  2EA0 A;  4ITQ A;  4DR6 M;  3W0F A;  3SAU A;  4G4R A;  1Z5C A;  2UUB M;  4B3S M;  1MU5 A;  2E5L M;  3J7A S;  1IBM M;  3SAR A;  5ITT A;  3DOA A;  3TWK A;  1L2B A;  1J5E M;  3GPY A;  4CIS A;  4JI0 M;  1Q3C A;  3U6O A;  3A46 A;  4LF9 M;  1XMO M;  4YHH M;  3U6C A;  3J80 S;  4NRW A;  4DV0 M;  2VQE M;  4G4O A;  2F5Q A;  1XNQ M;  4DUY M;  1XC8 A;  5ITQ A;  4JI1 M;  5BR8 M;  2F5P A;  2UXC M;  3GQ5 A;  3TWL A;  3SAW A;  1EE8 A;  4DV1 M;  3U6E A;  4DR2 M;  1L2D A;  5ITR A;  4NXM M;  2ZBK B;  4OX9 M;  5IWA M;  4DV6 M;  1Q3B A;  4PCZ A;  3VK7 A;  4LF6 M;  1Z5B A;  4X66 M;  2UUA M;  1FJG M;  4JYA M;  1HNZ M;  4DV5 M;  1Z59 A;  2F5O A;  1L2C A;  4JI2 M;  2Q2E B;  2UXB M;  3JR4 A;  1PJJ A;  1N32 M;  2UXD M;  1HNW M;  4NXN M;  4DR1 M;  4DR4 M;  2UU9 M;  1N33 M;  4JI7 M;  4KHP M;  1Q39 A;  4GKK M;  1KFV A;  4X65 M;  1N36 M;  4LF8 M;  3JAM S;  2XZF A;  1K82 A;  2UUC M;  4DR3 M;  4YY3 M;  5ITU A;  1PJI A;  4MB7 A;  4LFB M;  2F5N A;  3A42 A;  3TWM A;  2OPF A;  1N34 M;  3GPP A;  3GPX A;  4JI3 M;  3U6Q A;  4DV2 M;  4B3T M;  2F5S A;  4K0K M;  4GKJ M;  1R2Z A;  4G4N A;  4JV5 M;  3GPU A;  2HKJ A;  3GP1 A;  4JI8 M;  3GQ3 A;  3VK8 A;  3SAS A; 
#chains in the Genus database with same CATH topology
 2LNH C;  3FTC A;  4GIT A;  2ERC A;  2JNH A;  2M60 A;  4PDG A;  3NBI A;  1JQJ C;  1H6U A;  2MJ5 B;  3EIE A;  4WW0 A;  2DWM A;  2EKF A;  3MK6 A;  1TDZ A;  2X49 A;  2ZAM A;  3T15 A;  3J81 S;  2R18 A;  1QAO A;  1IN8 A;  1GJT A;  1OQY A;  2K6B A;  2LVN C;  4MH0 E;  3GLF E;  3DFZ A;  3KVW A;  4PD2 A;  3B7Z A;  3OTO M;  3A45 A;  2CHG A;  4IJE A;  4ANR A;  4LRS A;  1TH3 A;  2QSF X;  3H4J A;  3HJS A;  1XXH E;  2XSZ D;  3BBZ A;  3L25 A;  3RGS A;  1G59 A;  3HKP A;  4I8O A;  4LF4 M;  1IFY A;  1NNJ A;  3I01 M;  3B7N A;  3M7G A;  1V92 A;  4JI4 M;  1XWI A;  1IN4 A;  3TE6 A;  1TTE A;  4QOS A;  5C18 A;  3T1H M;  4IIW A;  3TL4 X;  5KPT A;  5A2Q S;  2ZM6 M;  2JZ0 A;  3K1J A;  4LRT A;  3RFW A;  3KDS E;  1NJG A;  1K3W A;  3L29 A;  4XGI A;  4B3R M;  1C1K A;  4IBG A;  3B89 A;  3U6P A;  1PRB A;  1L1T A;  1ZV1 A;  4L6V 6;  3RGP A;  1W5T A;  1PGY A;  2HL7 A;  3PFI A;  4AG6 A;  2QP9 X;  4QNR A;  2D7E A;  4X62 M;  4LJ6 A;  2X8A A;  3DZD A;  4LFC M;  1JR3 D;  3FRH A;  3HJ8 A;  1G8P A;  5LMN M;  1OIP A;  2YNM D;  4FWH A;  3W0F A;  2RRU A;  1Z5C A;  4G6Z A;  3HX3 A;  5KQ8 A;  3A98 B;  1MU5 A;  3J7A S;  2C9O A;  4R71 A;  4R3D A;  3RE8 A;  1W5S A;  1TH2 A;  3DOA A;  3W0L B;  3TWK A;  5EQT A;  3KOW E;  3ZH9 B;  2D7G A;  3H4M A;  4CIS A;  1S3S A;  4JI0 M;  1Q3C A;  2BJW A;  2L4F A;  1QYR A;  3R9X B;  3A46 A;  4LF9 M;  1IY0 A;  3U60 B;  2HCB A;  4L78 A;  1DV0 A;  1UFZ A;  2O25 A;  3J80 S;  1EIJ A;  3FRI A;  1HT2 E;  2XGN A;  4LJ8 A;  2VQE M;  3LQQ A;  2F5Q A;  1XNQ M;  2UXC M;  3QYB A;  3UZU A;  1SXJ D;  1VDD A;  3HY5 A;  4RNA A;  3WHL A;  1F4I A;  5EXP A;  1VQ1 A;  3R8F A;  3I4Y A;  1BVS A;  2A5Y B;  2KRU A;  4AKI A;  2VII A;  3VK7 A;  1Z5B A;  2F5S A;  1FJG M;  2ZTC A;  2V6Z M;  4JYA M;  2DEN A;  4DV5 M;  1IY2 A;  1N75 A;  2R46 A;  2WSC F;  4RF1 A;  2F5O A;  2XF3 A;  3L26 A;  2C5R A;  3SYK A;  2UXB M;  3QYE A;  2R6F A;  2LWX A;  4NXN M;  4DR4 M;  3FD9 A;  3NBX X;  1OIZ A;  2DAI A;  4CIZ A;  2OOA A;  5KPZ A;  2DZO B;  1Y8G A;  1WR1 B;  1WXQ A;  2C96 A;  4OVZ B;  4OU7 A;  1QAN A;  2CFO A;  2DWZ B;  1KYI A;  2UUC M;  4M0W A;  2JY5 A;  3U60 A;  2F5N A;  2Y20 A;  1GJS A;  4MM3 B;  2DAM A;  3VKG A;  4BBA A;  5EP3 A;  2Z4R A;  4REZ A;  1IN6 A;  1EFU B;  4IBK A;  1N77 A;  1QDT A;  3C9P A;  4JI8 M;  2HKJ A;  3Q8G A;  4AG5 A;  4D81 A;  2QPA A;  3ZQJ A;  3LCU A;  2QCU A;  3MHV C;  4DV3 M;  2C99 A;  3KOX E;  2CRU A;  1NY6 A;  3W67 A;  4MGH A;  3ILK A;  1PJS A;  4JI6 M;  4EIW A;  3U6M A;  5JI2 E;  4LJ4 A;  1QUS A;  4DV7 M;  1IN5 A;  4BB9 A;  5EXX A;  4AKH A;  4DUZ M;  2JUJ A;  3B74 A;  2WSF F;  5E26 A;  3U6S A;  3SBJ A;  2KW0 A;  4CJ6 A;  1AUA A;  2R62 A;  2G5G X;  1HNX M;  3GRY A;  5LMU M;  4IBE A;  7CAT A;  3GQ4 A;  2Z8Y M;  4LFA M;  3HWS A;  4MGY E;  2JP7 A;  3BXW A;  4JI5 M;  3I04 M;  3CF0 A;  1DGB A;  3FUX A;  2DXI A;  1GO5 A;  4L15 A;  5ITY A;  4RKU F;  5EP1 A;  3GLG A;  2DHY A;  3K9P A;  2C98 A;  3PNY A;  4DV4 M;  2R0I A;  1HR0 M;  4DR7 M;  2DAE A;  2H5X A;  2OOB A;  1R5L A;  1TH4 A;  4IBC A;  3C58 A;  2OQ4 A;  2L09 A;  2FNA A;  1NV8 A;  3JR5 A;  3GLI B;  3SAT A;  1TGU A;  3I4V A;  1HJP A;  1IBL M;  1NY5 A;  1A5T A;  2EA0 A;  3KP0 E;  3FTF A;  2JZ1 A;  1T6O A;  5DYI A;  3C3D A;  3TPZ A;  3CF6 E;  1VDL A;  2DI0 A;  2UUB M;  3MMP A;  4B3S M;  2KNV A;  2E5L M;  3J7B A;  2BJV A;  4WP2 A;  1E9S A;  3FYD A;  1HQC A;  5KO3 A;  3SAR A;  2YR0 A;  3FTD A;  3K92 A;  2V1U A;  3FE3 A;  3D8L A;  4LG2 A;  1IQP A;  4I81 A;  3GLG E;  5FTJ A;  3L27 A;  3LMM A;  3FTE A;  3HGI A;  2P5T A;  3FUT A;  4GC5 A;  3E21 A;  4G4O A;  5C1B A;  3HJQ A;  2EO2 A;  5ITQ A;  4JN6 A;  4NOO B;  5BR8 M;  4JI1 M;  1QZE A;  3SAW A;  1VEK A;  4GEW A;  3KOY E;  4IBD A;  3TWL A;  4GHL A;  3AL0 C;  1L2D A;  2XLJ A;  4OX9 M;  3HU1 A;  5IWA M;  4DV6 M;  1GKI A;  2DAG A;  2QZ4 A;  2L4E A;  4LF6 M;  3AV0 A;  4HL4 A;  2MH8 A;  4S12 A;  1GL7 A;  1Z59 A;  1MN3 A;  2Z3X A;  1L2C A;  4JI2 M;  2GNO A;  5DYG A;  1PJJ A;  4IBI A;  1N32 M;  1AIP C;  2XH9 A;  3HU2 A;  4IBF A;  3SHG B;  2XFS A;  2L7H A;  1Q39 A;  3CF2 A;  4W5W A;  1IXR C;  4M0D A;  4X65 M;  4LF8 M;  2K47 A;  4M9Z A;  2DWL A;  4LJ5 A;  1NHG C;  4FD2 A;  1NSF A;  5EP4 A;  4DR3 M;  2J5Y A;  4MB7 A;  4UN2 B;  3A42 A;  4OW0 A;  3PNV A;  4HLQ A;  1N34 M;  2DKL A;  4FVM A;  3GPP A;  1ZQ9 A;  2BNK A;  4II7 A;  2KNZ A;  1TF0 B;  2M5Z A;  1SXJ C;  3DA1 A;  1OTR A;  4IBB A;  1QDR A;  4NSR A;  2LHG A;  4DV2 M;  4FCV A;  3KXE C;  4LZJ A;  3Q8X A;  2WZJ A;  1R2Z A;  2I7P A;  1OAO C;  1V33 A;  4G4N A;  2VF8 A;  3E4R A;  2G8L A;  5JI3 E;  1PJQ A;  2Y0Q A;  4IBJ A;  3AKZ A;  4QHS A;  4M9S A;  3T6P A;  3VDP A;  1WIV A;  5FTL A;  3HHZ A;  2JXN A;  1L1Z A;  1QAQ A;  1IY1 A;  2VF7 A;  1V34 A;  2L2D A;  3SAV A;  1MX0 A;  2F4V M;  1E32 A;  2X4A A;  1L8Q A;  4Z8X A;  1I94 M;  1G4A E;  4KO8 A;  2JY6 B;  5IT9 S;  1TDH A;  5EXT A;  2QEN A;  4B3M M;  4CHT B;  1GAB A;  4AI6 A;  1X37 A;  2CHV A;  3MJ5 A;  1IN7 A;  1XHB A;  2YFQ A;  1WJ7 A;  3E46 A;  1T3T A;  1ZMU A;  3IHP A;  4LJ9 A;  4NL4 H;  2YQZ A;  2HHH M;  4XK8 F;  2LHC A;  3AOG A;  3PVS A;  1SG9 A;  3ZC7 B;  1I4W A;  5KPR A;  3K2L A;  4X64 M;  2EUC A;  2OO9 A;  4P17 A;  1QAM A;  4AZF A;  4BLC A;  4Z6Y A;  2BWB A;  1K3X A;  2DWN A;  2LTU A;  1LV7 A;  3E9S A;  5IZ7 D;  2KHH A;  4LJA A;  4XBO A;  3U61 B;  2R4J A;  3LCV B;  1VG5 A;  4AW4 A;  1DO0 A;  4HEO A;  2LVQ D;  2J7O A;  3SAS A;  3HHW A;  3IG8 A;  1YUB A;  3VDU A;  1HT1 E;  2MR9 A;  3AOE C;  1QUT A;  3GLH B;  1NJF A;  1MJG M;  2RKO A;  2CUZ A;  3THG A;  4F2L A;  5FTM A;  4AQY M;  2MRO B;  5IRE B;  1R2Y A;  4OVZ A;  2MGW A;  1ZMV A;  2H1R A;  1IBK M;  1R4G A;  1J7K A;  3SAU A;  3SFZ A;  1R7R A;  4F1I A;  4KOD A;  1G41 A;  4FCT A;  1PJT A;  4NC6 A;  3HHY A;  1IBM M;  2O5R A;  5ITT A;  3U5Z B;  2JWS A;  3KP1 E;  4A3V B;  3T38 A;  3V76 A;  2K0B X;  1J5E M;  3B9P A;  4L16 A;  3HU3 A;  1NNU C;  2V1C A;  1OJL A;  1OFH A;  1YSY A;  1GLN A;  2K9D A;  4YHH M;  3U61 A;  4DV0 M;  2XEP A;  3UGJ A;  2RGO A;  3UJN A;  1VEJ A;  3M6A A;  3LQR A;  5FSW A;  2DNA A;  2KZS A;  2R4E A;  2BWE A;  5F3W A;  2LVP C;  1XC8 A;  2F5P A;  3LVV A;  1YLA A;  1EE8 A;  3U6E A;  4DR2 M;  4NXM M;  2KEB A;  2ZBK B;  3GLH A;  4I4L A;  4I5S A;  3PXG A;  4PCZ A;  3VKH A;  4LGY A;  3J27 B;  4X66 M;  1DGG A;  2UUA M;  1HNZ M;  3KFU G;  1D0M A;  1G71 A;  3IEC A;  1OFI A;  3TQS A;  3FUV A;  4RF0 A;  2FS1 A;  2Q2E B;  5EJC A;  3JR4 A;  4QNM A;  4GH9 A;  2VDB B;  2KXE A;  3QAU A;  5DNY A;  2UU9 M;  1N33 M;  3U5Z A;  1T43 A;  4QOZ C;  1KFV A;  1D2N A;  4GHA A;  1N36 M;  1K82 A;  4TUW A;  4WUR A;  1SXJ B;  1OAI A;  4IJF A;  3TWM A;  2GQF A;  1JR3 A;  2FH0 A;  3FKE A;  3GPX A;  1LTM A;  1NHW C;  1D0K A;  3FUW A;  2DVW B;  3GLH E;  4KT0 F;  3AJI B;  3GLI A;  1Z6T A;  2CEA A;  4GKJ M;  1TR8 A;  2KNA A;  1QQW A;  3BOS A;  5FTK A;  3GRV A;  2QNJ A;  5FTN A;  4NSO B;  3KSJ A;  3GQ3 A;  3SYL A;  3VK8 A;  3FUU A;  1R6B X;  5FLX S;  5EXS A;  3CTW B;  2L7I A;  2EJS A;  3AFH A;  3K9O A;  4JXJ A;  1NVM A;  4B7F A;  1J09 A;  2EKK A;  4B7G A;  4DBG B;  4M9X A;  1WHC A;  3CGW A;  2O01 F;  4AKG A;  3M0E A;  4B08 A;  2CWB A;  1JB0 F;  5ITX A;  2QQ8 A;  2Y21 A;  1XMQ M;  4D80 A;  1OKS A;  1RU3 A;  2R44 A;  1CUK A;  3VFD A;  2ZAO A;  1Z5A A;  2W82 A;  2XFT A;  3EIH A;  4DR5 M;  1ZMW A;  4L4U A;  1JR3 E;  3T1Y M;  1NO1 A;  5E6J A;  1PM5 A;  3WHK A;  2KDL A;  1SXJ A;  2ZTD A;  2XZU A;  1C7Y A;  5H37 D;  3U6L A;  3NWL A;  4GRI A;  3GLI E;  1XNR M;  4G3O A;  3VLF B;  2I7N A;  2KA6 B;  3KS8 A;  3KSX A;  1IM2 A;  3HZJ A;  2VQF M;  1XB2 B;  4LGM A;  2N35 A;  4Q7J A;  3HHX A;  3L2A A;  3B7Q A;  3KW6 A;  3U6D A;  2CV1 A;  5DFL A;  4P16 A;  3LW5 F;  2C9C A;  2WSE F;  4PDI A;  1ZAE A;  4B7H A;  1YE9 A;  5BPV A;  2DHR A;  2NQ8 C;  3SC3 A;  2B3T A;  3ZCB B;  2L6O A;  5ITX E;  3GO8 A;  4ZPX A;  3SHF A;  4NRV A;  3D8B A;  3SMS A;  3UMM A;  3F92 A;  4LF5 M;  1NV9 A;  4LF7 M;  4G4Q A;  1IXS B;  4LY6 A;  3KOZ E;  4QHT A;  4ITQ A;  3W68 A;  4DR6 M;  1FNN A;  1SXJ E;  4G4R A;  1WGN A;  3I51 A;  2G3Q A;  2LVA A;  1Q02 A;  4FWG A;  2FFJ A;  2DZL A;  4GMQ A;  1ORY B;  1UM8 A;  2CHQ A;  1L2B A;  2R45 A;  3GPY A;  1P3Q Q;  2Z7J A;  3GLF B;  1GVN A;  5GKN A;  1KSF X;  3U6O A;  2J7N A;  3K8Z A;  3AOE A;  1XMO M;  2CV2 A;  3FYC A;  2LBC A;  1N78 A;  2ZAN A;  3U6C A;  4NRW A;  3J2P B;  3UK6 A;  3GRR A;  2LH0 A;  1DGH B;  2LVO C;  3L28 A;  4D82 A;  1XXH B;  4DUY M;  1QVR A;  8CAT A;  4L8R C;  1DGF A;  3C3E A;  3GQ5 A;  2QHO B;  4KLN A;  4DV1 M;  1G3I A;  2KZU A;  4GC9 A;  5ITR A;  2QBY B;  2DZN B;  1Q3B A;  4FW9 A;  2FE8 A;  1IXS A;  4MGZ E;  5L8R F;  2AHM A;  2RGH A;  4PT5 A;  2D7H A;  3GLG B;  2HAK A;  1IXZ A;  1GL6 A;  5KQD A;  4MGI E;  2UXD M;  1HNW M;  3LVW A;  4DR1 M;  1E9R A;  2JY8 A;  4JI7 M;  4KHP M;  1E94 E;  4GKK M;  1QZM A;  3QWL A;  2DAK A;  3JAM S;  3GLF A;  2CP8 A;  2FOI C;  2KRK A;  2XZF A;  4LJ7 A;  2HWJ A;  4FWD A;  4YY3 M;  5ITU A;  2Y0T A;  1PJI A;  4LFB M;  3GRU A;  4MGK E;  4R7G A;  4CGY B;  2OPF A;  1WGL A;  3SMP A;  1D0L A;  1DGH A;  4LCB A;  4JI3 M;  1XXH A;  3U6Q A;  2JY7 A;  4LZZ A;  2LXE A;  2CE7 A;  2R65 A;  3KS4 A;  4B3T M;  2CV0 A;  3IG5 A;  4FCW A;  4K0K M;  1HQY E;  1DO2 A;  4JV5 M;  2XSZ A;  2Z4S A;  5EP2 A;  3GPU A;  2JA2 A;  4Y28 F;  3GP1 A;  4GIP A;  2QBY A;  2APL A;  1VEG A; 
#chains in the Genus database with same CATH homology
 2LNH C;  3FTC A;  4GIT A;  2ERC A;  4PDG A;  2M60 A;  3NBI A;  1JQJ C;  1H6U A;  3EIE A;  4WW0 A;  2DWM A;  3MK6 A;  1TDZ A;  2X49 A;  2ZAM A;  3T15 A;  3J81 S;  2R18 A;  1QAO A;  1IN8 A;  4MH0 E;  3DFZ A;  3KVW A;  4PD2 A;  3OTO M;  3A45 A;  2CHG A;  4IJE A;  4LRS A;  1TH3 A;  3HJS A;  3L25 A;  2XSZ D;  3RGS A;  1G59 A;  3HKP A;  4I8O A;  4LF4 M;  1NNJ A;  3M7G A;  4JI4 M;  1XWI A;  1IN4 A;  3TE6 A;  4QOS A;  5C18 A;  3T1H M;  4IIW A;  3TL4 X;  5KPT A;  5A2Q S;  2ZM6 M;  3K1J A;  4LRT A;  3RFW A;  3KDS E;  1NJG A;  1K3W A;  3L29 A;  4XGI A;  4B3R M;  1C1K A;  4IBG A;  3U6P A;  1L1T A;  3RGP A;  4AG6 A;  4X62 M;  1W5T A;  2HL7 A;  3PFI A;  4OU7 A;  2QP9 X;  4QNR A;  2D7E A;  4LJ6 A;  2X8A A;  3DZD A;  4LFC M;  1JR3 D;  3HJ8 A;  1G8P A;  5LMN M;  2YNM D;  4FWH A;  3W0F A;  4G6Z A;  1Z5C A;  5KQ8 A;  3A98 B;  1MU5 A;  3J7A S;  2C9O A;  4R3D A;  3RE8 A;  1W5S A;  1TH2 A;  3DOA A;  3W0L B;  3TWK A;  5EQT A;  3KOW E;  3ZH9 B;  2D7G A;  3H4M A;  4CIS A;  1S3S A;  4JI0 M;  1Q3C A;  2BJW A;  1QYR A;  3R9X B;  3A46 A;  4LF9 M;  1IY0 A;  3U60 B;  2HCB A;  4L78 A;  3J80 S;  1HT2 E;  2XGN A;  4LJ8 A;  2VQE M;  3LQQ A;  2F5Q A;  1XNQ M;  2UXC M;  3UZU A;  1SXJ D;  1VDD A;  4RNA A;  3WHL A;  5EXP A;  3R8F A;  3I4Y A;  2A5Y B;  2KRU A;  4AKI A;  2VII A;  3VK7 A;  1Z5B A;  1FJG M;  2V6Z M;  4JYA M;  4DV5 M;  1IY2 A;  1N75 A;  2R46 A;  2F5O A;  4RF1 A;  2XF3 A;  3L26 A;  2C5R A;  3SYK A;  2UXB M;  2LWX A;  4NXN M;  4DR4 M;  3FD9 A;  5KPZ A;  2DZO B;  1WXQ A;  2C96 A;  4OVZ B;  1QAN A;  2CFO A;  2DWZ B;  1KYI A;  2UUC M;  4M0W A;  3U60 A;  2F5N A;  2Y20 A;  4MM3 B;  3VKG A;  4BBA A;  5EP3 A;  2Z4R A;  4REZ A;  1IN6 A;  4IBK A;  1N77 A;  4JI8 M;  2HKJ A;  4AG5 A;  4D81 A;  2QPA A;  2QCU A;  3MHV C;  4DV3 M;  2C99 A;  3KOX E;  1NY6 A;  4MGH A;  3ILK A;  4JI6 M;  4EIW A;  3U6M A;  5JI2 E;  4LJ4 A;  4DV7 M;  1IN5 A;  4BB9 A;  5EXX A;  4AKH A;  4DUZ M;  5E26 A;  3SBJ A;  3U6S A;  2KW0 A;  2R62 A;  2G5G X;  1HNX M;  3GRY A;  5LMU M;  4IBE A;  7CAT A;  3GQ4 A;  4LFA M;  3HWS A;  4MGY E;  4JI5 M;  3CF0 A;  1DGB A;  3FUX A;  2DXI A;  4L15 A;  5ITY A;  5EP1 A;  3GLG A;  3PNY A;  2C98 A;  4DV4 M;  1HR0 M;  4DR7 M;  3C58 A;  1TH4 A;  4IBC A;  2OQ4 A;  2L09 A;  2FNA A;  3JR5 A;  3GLI B;  3SAT A;  1TGU A;  3I4V A;  1IBL M;  1NY5 A;  2EA0 A;  3KP0 E;  3FTF A;  5DYI A;  3TPZ A;  3CF6 E;  2UUB M;  4B3S M;  2E5L M;  3J7B A;  2BJV A;  1E9S A;  3FYD A;  1HQC A;  5KO3 A;  3SAR A;  2YR0 A;  3FTD A;  3K92 A;  2V1U A;  3D8L A;  4LG2 A;  1IQP A;  4I81 A;  5FTJ A;  3L27 A;  3LMM A;  3FTE A;  3HGI A;  2P5T A;  3FUT A;  4GC5 A;  4G4O A;  5C1B A;  3HJQ A;  2EO2 A;  5ITQ A;  4JN6 A;  4NOO B;  5BR8 M;  4JI1 M;  3SAW A;  4IBD A;  3TWL A;  3KOY E;  4GHL A;  3AL0 C;  1L2D A;  2XLJ A;  4OX9 M;  3HU1 A;  5IWA M;  4DV6 M;  1GKI A;  2QZ4 A;  4LF6 M;  3AV0 A;  4HL4 A;  4S12 A;  1GL7 A;  1Z59 A;  2Z3X A;  1L2C A;  4JI2 M;  1N32 M;  5DYG A;  1PJJ A;  4IBI A;  2XH9 A;  3HU2 A;  4IBF A;  3SHG B;  2XFS A;  2L7H A;  1Q39 A;  3CF2 A;  4W5W A;  1IXR C;  4M0D A;  4X65 M;  4LF8 M;  2K47 A;  4M9Z A;  2DWL A;  4LJ5 A;  1NHG C;  4FD2 A;  1NSF A;  5EP4 A;  4DR3 M;  4MB7 A;  3A42 A;  4OW0 A;  3PNV A;  4HLQ A;  1N34 M;  4FVM A;  3GPP A;  1ZQ9 A;  2BNK A;  4II7 A;  2M5Z A;  3DA1 A;  1SXJ C;  4IBB A;  4NSR A;  4DV2 M;  4FCV A;  3KXE C;  4LZJ A;  3Q8X A;  1R2Z A;  2F5S A;  2I7P A;  4G4N A;  3E4R A;  2G8L A;  5JI3 E;  4IBJ A;  2Y0Q A;  3AKZ A;  4QHS A;  4M9S A;  3VDP A;  5FTL A;  3HHZ A;  1L1Z A;  1QAQ A;  1IY1 A;  3SAV A;  1MX0 A;  2F4V M;  1E32 A;  2X4A A;  1L8Q A;  4Z8X A;  1I94 M;  4KO8 A;  5IT9 S;  1TDH A;  5EXT A;  2QEN A;  4B3M M;  4CHT B;  4AI6 A;  1X37 A;  2CHV A;  3MJ5 A;  1IN7 A;  1XHB A;  2YFQ A;  4NL4 H;  1T3T A;  4LJ9 A;  2YQZ A;  2HHH M;  3AOG A;  3PVS A;  3ZC7 B;  5KPR A;  1I4W A;  4X64 M;  3K2L A;  2EUC A;  4AZF A;  1QAM A;  4BLC A;  4Z6Y A;  1K3X A;  2DWN A;  1LV7 A;  3E9S A;  4LJA A;  4XBO A;  3U61 B;  2R4J A;  4AW4 A;  1DO0 A;  2J7O A;  3HHW A;  3IG8 A;  1YUB A;  3VDU A;  1HT1 E;  3AOE C;  3GLH B;  1NJF A;  2RKO A;  2CUZ A;  3THG A;  4AQY M;  5FTM A;  1R2Y A;  5IRE B;  4OVZ A;  2H1R A;  1IBK M;  1J7K A;  3SAU A;  3SFZ A;  1R7R A;  4KOD A;  1G41 A;  4FCT A;  3HHY A;  1IBM M;  2O5R A;  5ITT A;  3U5Z B;  3KP1 E;  4A3V B;  3T38 A;  1J5E M;  3B9P A;  4L16 A;  3HU3 A;  1NNU C;  2V1C A;  1OJL A;  1OFH A;  1YSY A;  1GLN A;  4YHH M;  3U61 A;  4DV0 M;  2XEP A;  3UGJ A;  2RGO A;  3UJN A;  3M6A A;  1XC8 A;  3LQR A;  5FSW A;  2R4E A;  2KZS A;  5F3W A;  2F5P A;  3LVV A;  1EE8 A;  3U6E A;  4DR2 M;  4NXM M;  2KEB A;  2ZBK B;  3GLH A;  4I4L A;  4I5S A;  3PXG A;  4PCZ A;  3VKH A;  4LGY A;  3J27 B;  4X66 M;  1DGG A;  2UUA M;  1HNZ M;  3KFU G;  1OFI A;  3TQS A;  3FUV A;  4RF0 A;  2Q2E B;  5EJC A;  3JR4 A;  4QNM A;  4GH9 A;  2KXE A;  3QAU A;  5DNY A;  2UU9 M;  1N33 M;  3U5Z A;  4QOZ C;  1KFV A;  1D2N A;  4GHA A;  1N36 M;  1K82 A;  4TUW A;  4WUR A;  1SXJ B;  4IJF A;  3TWM A;  1JR3 A;  3FKE A;  3GPX A;  1NHW C;  3FUW A;  2DVW B;  3AJI B;  3GLI A;  1Z6T A;  2CEA A;  4GKJ M;  1QQW A;  3BOS A;  5FTK A;  3GRV A;  5FTN A;  3GQ3 A;  4NSO B;  3KSJ A;  3VK8 A;  3SYL A;  3FUU A;  1R6B X;  5FLX S;  5EXS A;  3CTW B;  2L7I A;  4JXJ A;  3AFH A;  4B7F A;  4B7G A;  1NVM A;  4B08 A;  1J09 A;  4AKG A;  4M9X A;  3M0E A;  5ITX A;  2Y21 A;  1XMQ M;  4D80 A;  3VFD A;  2ZAO A;  1Z5A A;  2W82 A;  2XFT A;  3EIH A;  4DR5 M;  4L4U A;  3T1Y M;  5E6J A;  1PM5 A;  3WHK A;  1SXJ A;  2XZU A;  5H37 D;  3U6L A;  3NWL A;  4GRI A;  1XNR M;  3VLF B;  2I7N A;  2KA6 B;  3KS8 A;  3KSX A;  1IM2 A;  2VQF M;  4LGM A;  3HHX A;  3L2A A;  3U6D A;  3KW6 A;  2CV1 A;  4P16 A;  2C9C A;  4PDI A;  1ZAE A;  4B7H A;  1YE9 A;  5BPV A;  2DHR A;  2NQ8 C;  3SC3 A;  3ZCB B;  5ITX E;  2L6O A;  3GO8 A;  4ZPX A;  3SHF A;  4NRV A;  3D8B A;  3SMS A;  3UMM A;  4LF5 M;  4LF7 M;  4G4Q A;  1IXS B;  4LY6 A;  3KOZ E;  4QHT A;  4ITQ A;  4DR6 M;  1FNN A;  1SXJ E;  4G4R A;  3I51 A;  4FWG A;  2FFJ A;  4GMQ A;  1ORY B;  1UM8 A;  2CHQ A;  1L2B A;  2R45 A;  3GPY A;  2Z7J A;  3GLF B;  1GVN A;  5GKN A;  1KSF X;  3U6O A;  2J7N A;  3K8Z A;  3AOE A;  1XMO M;  2CV2 A;  3FYC A;  1N78 A;  2ZAN A;  3U6C A;  4NRW A;  3J2P B;  3UK6 A;  3GRR A;  2LH0 A;  1DGH B;  3L28 A;  4D82 A;  1XXH B;  4DUY M;  1QVR A;  8CAT A;  4L8R C;  1DGF A;  3GQ5 A;  4KLN A;  4DV1 M;  1G3I A;  2KZU A;  4GC9 A;  5ITR A;  2QBY B;  2DZN B;  1Q3B A;  4FW9 A;  2FE8 A;  4MGZ E;  2AHM A;  2RGH A;  4PT5 A;  2D7H A;  3GLG B;  1IXZ A;  1GL6 A;  5KQD A;  4MGI E;  2UXD M;  1HNW M;  3LVW A;  4DR1 M;  1E9R A;  4JI7 M;  4KHP M;  1E94 E;  4GKK M;  1QZM A;  3QWL A;  3JAM S;  3GLF A;  2FOI C;  2XZF A;  2KRK A;  4LJ7 A;  4FWD A;  4YY3 M;  5ITU A;  1PJI A;  2Y0T A;  4LFB M;  3GRU A;  4MGK E;  4R7G A;  4CGY B;  2OPF A;  3SMP A;  1DGH A;  4LCB A;  4JI3 M;  1XXH A;  3U6Q A;  4LZZ A;  2LXE A;  2CE7 A;  2R65 A;  3KS4 A;  4B3T M;  2CV0 A;  3IG5 A;  4FCW A;  4K0K M;  1HQY E;  1DO2 A;  4JV5 M;  2XSZ A;  2Z4S A;  5EP2 A;  3GPU A;  2JA2 A;  3GP1 A;  2QBY A;  4GIP A;  3SAS A;  1G4A E;  5IZ7 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...