2E5LM

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
122
structure length
122
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 21
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2e5lM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2e5lM02
3T1HM 4MB7A 3GQ5A 4JI3M 1HNWM 2F5SA 3TWMA 4PCZA 5ITUA 2OQ4A 2ZM6M 4DV4M 2XZFA 1K82A 3TWKA 2F5PA 4DV2M 4B3SM 4NXMM 4YY3M 4G4OA 4GKJM 3J81S 3VK7A 5ITQA 3GQ4A 4OX9M 4JV5M 4G4NA 4DR7M 3J7AS 4LF6M 1HNZM 2OPFA 3U6SA 3A42A 3A45A 1XC8A 1NNJA 3GPXA 2UXCM 1N36M 1IBKM 5IT9S 1PJJA 4DUYM 1FJGM 3SBJA 4LFBM 4YHHM 1N32M 4AQYM 2UUCM 1IBLM 4G4RA 4DR4M 4KHPM 1TDZA 4JI7M 4X65M 1N33M 4B3MM 1MU5A 4CISA 2HKJA 1K3WA 1XMOM 5A2QS 1IBMM 4ITQA 3VK8A 2ZBKB 4DR6M 3GPUA 3JR5A 4DV5M 4DR1M 3J80S 1PM5A 1L2BA 3C58A 3SAWA 4JI1M 3GP1A 1XMQM 2EA0A 3GO8A 4LF5M 3U6OA 2VQEM 1MX0A 2E5LM 2UU9M 3OTOM 1I94M 1Q39A 5ITTA 4DR2M 4B3TM 1XNQM 2VQFM 4NXNM 4X62M 5IWAM 1J5EM 4GKKM 4X64M 4JI6M 1EE8A 3U6MA 4JI5M 1L2CA 1HR0M 4LF8M 4B3RM 1Z5AA 5FLXS 5ITXE 4DV3M 3SARA 4DR3M 4DV7M 4NRVA 4PDIA 1PJIA 1K3XA 4JI0M 3T1YM 4JI2M 4LF7M 4PD2A 3A46A 5ITXA 4DV0M 2F5OA 3U6DA 2HHHM 4DR5M 3SASA 3DOAA 4JI8M 3SAUA 3GPYA 4LF9M 3W0FA 3TWLA 5ITYA 4LF4M 4DUZM 3U6LA 3U6QA 2F5QA 2UUAM 4LFCM 1XNRM 1Q3CA 5ITRA 2F4VM 2UXDM 3JR4A 1Z59A 1R2YA 1HNXM 4PDGA 3SATA 3U6CA 1L1ZA 4LFAM 4K0KM 2F5NA 2UUBM 3U6PA 1Q3BA 4G4QA 1Z5BA 3SAVA 2XZUA 1KFVA 4JI4M 3GPPA 4NRWA 2Q2EB 1N34M 5LMNM 3JAMS 3GQ3A 1R2ZA 3U6EA 2UXBM 1Z5CA 1L1TA 4X66M 1L2DA 4DV1M 4DV6M 5LMUM 5BR8M 1TDHA 4JYAM
chains in the Genus database with same CATH superfamily
2R0IA 4MB7A 4JI3M 2QZ4A 3GLFA 1PJSA 2DWNA 4DV4M 2KZSA 2WSFF 2FNAA 4OW0A 1E9RA 1YLAA 3UK6A 5FTLA 2DVWB 2KNZA 4BLCA 4W5WA 3AKZA 1ZMUA 3IG8A 2D7GA 3J81S 3VK7A 4OVZA 4PT5A 1AUAA 1OKSA 4JV5M 5FTMA 4LF6M 4GC5A 5KO3A 1ZQ9A 4CGYB 3AOGA 4AG6A 3K1JA 4FW9A 2CV2A 5EP4A 3FE3A 3SHGB 1N36M 5IT9S 2AHMA 1UM8A 2LVQD 3KP0E 3PXGA 2LVNC 4L6V6 4AI6A 3HU1A 1FJGM 3D8LA 3M6AA 1YE9A 4GIPA 1N75A 3M7GA 2I7NA 5E26A 4AQYM 4HEOA 1NSFA 3IHPA 3ZCBB 4G4RA 3FYDA 1TDZA 1TH2A 2L4EA 3RGSA 4JI7M 3MHVC 4AZFA 4G6ZA 4OVZB 1A5TA 2CE7A 4B3MM 4D82A 2DKLA 2CHVA 1ZAEA 3PNVA 4D80A 2GQFA 2DAMA 3V76A 2CP8A 2M60A 2R65A 4DV5M 4GRIA 2QSFX 4NSOB 1IQPA 4Y28F 4GH9A 2D7HA 4MGKE 3L2AA 4RNAA 2OOAA 1L2BA 1C7YA 3GLFB 3EIHA 3SAWA 4JI1M 2CEAA 1L8QA 2KNAA 3GO8A 3LW5F 2QENA 2L2DA 3U6OA 1OIZA 3AOEA 2YR0A 1C1KA 3GLHA 3GRUA 1I94M 1Q39A 4I81A 1XNQM 2VQFM 3KS8A 2L6OA 3EIEA 2R4EA 1VEKA 2KZUA 5IWAM 1SXJE 2O01F 4GKKM 4X64M 4JI6M 4MGZE 5JI3E 2C9CA 3KXEC 1HQCA 4B3RM 1E94E 1QVRA 1SXJD 4R3DA 5FLXS 1QZEA 4I4LA 3HWSA 2HCBA 1D0KA 2JZ1A 4PDIA 3HHXA 3T1YM 2R6FA 4LF7M 4PD2A 4HLQA 3L27A 4DV0M 2LNHC 3U6DA 4DR5M 3SASA 2EKFA 3DOAA 4WP2A 3GPYA 4LF9M 2MJ5B 1WJ7A 3FYCA 1D0LA 3U5ZB 3MJ5A 1RU3A 2JY6B 5FTNA 3E9SA 2QNJA 3KW6A 3UJNA 3U6LA 4IBKA 3GLGA 3HHZA 3W67A 3U61A 4IBJA 3C9PA 3B7QA 4M9XA 3JR4A 1HNXM 3FTEA 3FTCA 2XGNA 4PDGA 2JY8A 1CUKA 2XFTA 3U6CA 4NOOB 4Q7JA 3W0LB 1NO1A 2DZNB 4LJ9A 2CV0A 1DO0A 1Q02A 1Z5BA 2EKKA 4F2LA 3SAVA 1G71A 5LMNM 4CHTB 1NY6A 2JWSA 3VFDA 2RRUA 4LGYA 5DFLA 1QQWA 2DAIA 4CIZA 3E46A 2HAKA 3VLFB 2I7PA 1VDDA 1TTEA 1OTRA 3T15A 4DR1M 4QNMA 2DAGA 3GQ5A 2L7IA 1GVNA 2DI0A 4EIWA 3T1HM 1HNWM 2F5SA 2QPAA 2K47A 2LTUA 2ZM6M 2DWMA 2V6ZM 3DA1A 4LRTA 3ZC7B 1OIPA 2JP7A 1K82A 3TWKA 5DYGA 3GLIE 1DGBA 4BBAA 2DAEA 3HU2A 1FNNA 3FKEA 2J7NA 2KXEA 4G4OA 4GKJM 3B9PA 2QBYB 5ITQA 4LJAA 3NBIA 1WR1B 2G5GX 3K2LA 4G4NA 4DR7M 1EIJA 1HNZM 1V92A 2J7OA 3U6SA 2APLA 5E6JA 1IXRC 1ZV1A 2VF7A 2C96A 1WIVA 3VDPA 1GL7A 2D7EA 3MK6A 3FTDA 3R8FA 1X37A 3BBZA 1LTMA 4JXJA 3SBJA 1G4AE 2L09A 4LFBM 4YHHM 1R4GA 4QOZC 2KRUA 4M0DA 2CWBA 3GLGE 4DR4M 5H37D 2X8AA 2LHCA 4FCWA 4XGIA 1OAIA 2GNOA 3H4JA 1G59A 1IXZA 1VEGA 2HKJA 4LZZA 1K3WA 1MN3A 5A2QS 1DO2A 4FD2A 2NQ8C 4XBOA 3I4VA 4KODA 4ITQA 2C99A 1TH4A 1JB0F 3D8BA 3B74A 4WURA 2DZOB 2ZTDA 3B89A 1KSFX 1TF0B 3C58A 4CJ6A 2BNKA 1IN4A 4F1IA 3AFHA 1V33A 3K8ZA 3NBXX 3CF6E 2EA0A 3KOWE 3E21A 4KLNA 2VQEM 4FWHA 1IN6A 3KSJA 2KRKA 1WGLA 4A3VB 1E9SA 1OQYA 3KFUG 3KOYE 3J27B 1VQ1A 4L16A 4DR2M 3KVWA 4X62M 2Z4RA 1W5SA 2MH8A 2Y21A 4IBFA 1PGYA 2VDBB 2QHOB 3QWLA 2KA6B 7CATA 3WHLA 1Y8GA 1HR0M 1HQYE 4R71A 4FCVA 5ITXE 2CUZA 3VDUA 4DV7M 4NRVA 3B7NA 1IXSA 1QAQA 2C9OA 4FWDA 1JR3E 4JI0M 3T6PA 4JI2M 3A46A 5ITXA 2G3QA 4LJ4A 1GLNA 4RKUF 8CATA 2HHHM 3LCVB 4L15A 2DZLA 2R44A 3U60B 3TL4X 5F3WA 5EXTA 2YNMD 3TWLA 4IBGA 1SG9A 2B3TA 4I8OA 2C98A 5IREB 4OU7A 1J09A 1XNRM 4QHSA 4MH0E 3HX3A 3UZUA 5ITRA 2UXDM 1Z59A 4MGYE 4LG2A 3SATA 1XXHB 5EP2A 4LFAM 4S12A 4K0KM 4P16A 3U6PA 1Q3BA 4G4QA 3QYBA 1KFVA 1BVSA 2RGOA 3THGA 3GPPA 2Z8YM 3H4MA 4P17A 2A5YB 3JAMS 3SMPA 2CHQA 1IN5A 1L1TA 2ZAMA 1QUTA 4IBDA 2LHGA 4GEWA 2ZAOA 2JNHA 2JY5A 5L8RF 3BXWA 4DV6M 1XXHE 3AV0A 4ZPXA 5BR8M 2Y20A 1Z6TA 4JYAM 3HHYA 4NL4H 2CRUA 1IXSB 2O25A 4PCZA 4GHAA 1W5TA 4AKHA 5KPRA 3GLFE 2FE8A 4LJ8A 1XHBA 2QP9X 4L78A 4JN6A 1HT2E 3HKPA 2BWEA 1EFUB 3KS4A 1QZMA 4DV2M 3R9XB 5EXSA 4YY3M 5BPVA 2ERCA 3DZDA 3GQ4A 1OJLA 4OX9M 1YSYA 2DAKA 3AJIB 3J7AS 1GL6A 2YQZA 5C1BA 4GHLA 4GC9A 2OPFA 3A45A 4Z8XA 2Z7JA 1NNJA 3GPXA 1QUSA 4FCTA 3FUXA 2CHGA 3C3EA 1OFHA 4MGIE 4R7GA 3CTWB 3NWLA 2C5RA 1IBKM 3FTFA 1SXJB 3GLIA 1IY1A 4LZJA 3FUWA 3KP1E 2JY7A 5IZ7D 4AG5A 1PJTA 3LCUA 1IN7A 1LV7A 2J5YA 2UUCM 4QHTA 3SMSA 2W82A 1N33M 4L4UA 4X65M 3ZQJA 1MU5A 4CISA 1HT1E 3CF0A 1VG5A 1IBMM 1VDLA 2DHRA 2ZBKB 3FUVA 3I4YA 4DR6M 1T6OA 2N35A 3AOEC 3GPUA 3J80S 2KHHA 1DGHA 4M9ZA 4MM3B 1MJGM 3FUTA 1NJGA 1R5LA 1S3SA 1OFIA 3HJ8A 2WZJA 3HJSA 3GRVA 3PFIA 1NV9A 4HL4A 1YUBA 1XMQM 2XEPA 3HZJA 4IJFA 2JZ0A 3J2PB 1E32A 4FVMA 2E5LM 1MX0A 4LCBA 3OTOM 2V1UA 2JA2A 3LVVA 2DNAA 2XF3A 1DGHB 5EP3A 4RF1A 4NXNM 4AKGA 2HWJA 1J5EM 1NJFA 3A98B 4RF0A 1EE8A 3U6MA 2LH0A 2DWLA 4LGMA 4TUWA 4JI5M 4LF8M 1QAOA 4AKIA 1R6BX 3SFZA 3SARA 2M5ZA 1VEJA 3ZH9B 3HJQA 1K3XA 2H5XA 1ZMWA 3GLIB 3ILKA 4IBBA 2FH0A 1SXJA 3E4RA 1IM2A 1PRBA 3FD9A 2FFJA 2EJSA 2R46A 3SAUA 3U60A 2X49A 1NV8A 4LJ6A 1J7KA 3W0FA 4LF4M 1GABA 2F5QA 2UUAM 4LFCM 1QANA 2MROB 2HL7A 2L4FA 4B7HA 1WHCA 3IG5A 1KYIA 3PVSA 1R2YA 1AIPC 2Z3XA 1L1ZA 1DGFA 2CFOA 3GRRA 5FTJA 3RGPA 2XZUA 4JI4M 3FRIA 2WSEF 1D2NA 5DYIA 1NNUC 1ZMVA 4FWGA 3I04M 2Q2EB 1V34A 3KDSE 1N34M 2KNVA 3B7ZA 3KOZE 3HU3A 1NY5A 3CF2A 3Q8GA 1JR3A 5FSWA 3GLGB 3U61B 1N77A 3L28A 4NSRA 2XLJA 5LMUM 3I51A 2DXIA 1QDRA 1NVMA 1XWIA 1DGGA 1TDHA 1I4WA 2XSZD 1SXJC 1IN8A 3AL0C 3TWMA 2XSZA 2DENA 5ITUA 2OQ4A 4M9SA 2DHYA 2FS1A 2OOBA 4KO8A 4MGHA 2XZFA 3F92A 5C18A 2F5PA 4ANRA 1P3QQ 2R45A 5EJCA 4WW0A 2KW0A 1JR3D 2LVAA 4XK8F 4B3SM 4NXMM 2ZANA 3IECA 4IBIA 2QQ8A 5JI2E 5EXPA 1XB2B 1OAOC 4Z6YA 3VKGA 1T3TA 3KOXE 2EUCA 2R4JA 3HGIA 3HHWA 2K6BA 3A42A 3GLHB 2BWBA 2DWZB 2X4AA 1XC8A 4II7A 2UXCM 3LMMA 4I5SA 3W68A 5EQTA 3SYLA 1PJJA 2K9DA 4UN2B 4DUYM 3K9OA 4BB9A 4LRSA 1N32M 3BOSA 4REZA 3LVWA 2LBCA 1GKIA 3J7BA 3UMMA 1IBLM 4KHPM 1T43A 3CGWA 2K0BX 1HJPA 1UFZA 3VKHA 4LY6A 1GJSA 3SC3A 3L25A 1TGUA 1XMOM 1QDTA 2ZTCA 3VK8A 2YFQA 3L26A 2XFSA 3K9PA 2G8LA 4GMQA 4IJEA 4QOSA 3M0EA 3JR5A 4DBGB 5EXXA 1PM5A 3LQQA 5DNYA 3MMPA 2P5TA 3GLHE 3TPZA 1R7RA 3TE6A 3C3DA 2EO2A 1ORYB 1G41A 3GP1A 4LJ5A 1QYRA 1TR8A 1G8PA 4GITA 4LF5M 3WHKA 1WXQA 4G3OA 2VIIA 5EP1A 2UU9M 2XH9A 4IBEA 4LJ7A 3T38A 2OO9A 5ITTA 2VF8A 2V1CA 2JUJA 2RKOA 4B3TM 2LWXA 4M0WA 4AW4A 3QYEA 3FUUA 2BJWA 2QCUA 4B7GA 5GKNA 2JXNA 3L29A 1JQJC 4QNRA 4L8RC 2O5RA 1L2CA 4IIWA 1Z5AA 3LQRA 1GO5A 2Y0TA 1NHGC 5KPTA 1GJTA 4B08A 2LXEA 4DV3M 4DR3M 1PJIA 3SHFA 3FRHA 2F5OA 4NC6A 1G3IA 3KSXA 3U5ZA 4KT0F 5FTKA 1D0MA 1PJQA 2L7HA 3GRYA 1TH3A 2LVOC 4JI8M 3PNYA 2KEBA 3I01M 1QAMA 5ITYA 3Q8XA 2R62A 1NHWC 4DUZM 3K92A 3U6QA 3QAUA 3UGJA 2MGWA 2FOIC 3DFZA 2QBYA 2KDLA 1Q3CA 1F4IA 2H1RA 2F4VM 1H6UA 1DV0A 2BJVA 2WSCF 3TQSA 2Z4SA 3HY5A 5KQDA 2F5NA 2UUBM 1XXHA 5KQ8A 3RE8A 1N78A 2MR9A 1IY0A 4NRWA 4IBCA 3GQ3A 1R2ZA 3U6EA 2UXBM 1IFYA 2CV1A 1Z5CA 4X66M 5KPZA 2LVPC 1WGNA 2Y0QA 4D81A 3RFWA 1L2DA 4DV1M 4B7FA 3SYKA 2RGHA 1IY2A 2R18A
chains in the Genus database with same CATH topology
4MB7A 4JI3M 2QZ4A 3GLFA 2DWNA 4DV4M 2KZSA 2FNAA 4OW0A 1E9RA 3UK6A 5FTLA 2DVWB 4BLCA 4W5WA 3AKZA 3IG8A 2D7GA 3J81S 3VK7A 4OVZA 4PT5A 4JV5M 5FTMA 4LF6M 4GC5A 5KO3A 1ZQ9A 4CGYB 3AOGA 4AG6A 3K1JA 4FW9A 2CV2A 5EP4A 1N36M 3SHGB 5IT9S 2AHMA 1UM8A 3KP0E 3PXGA 4AI6A 3HU1A 1FJGM 3D8LA 3M6AA 1YE9A 4GIPA 1N75A 3M7GA 2I7NA 5E26A 4AQYM 1NSFA 3ZCBB 4G4RA 3FYDA 1TDZA 1TH2A 3RGSA 4JI7M 3MHVC 4AZFA 4G6ZA 4OVZB 2CE7A 4B3MM 4D82A 2CHVA 1ZAEA 3PNVA 4D80A 2M60A 2R65A 4DV5M 4GRIA 4NSOB 1IQPA 4GH9A 2D7HA 4MGKE 3L2AA 4RNAA 1L2BA 3GLFB 3EIHA 3SAWA 4JI1M 2CEAA 1L8QA 3GO8A 2QENA 3U6OA 3AOEA 2YR0A 1C1KA 3GLHA 3GRUA 1I94M 1Q39A 4I81A 1XNQM 2VQFM 3KS8A 2L6OA 3EIEA 2R4EA 2KZUA 5IWAM 1SXJE 4GKKM 4X64M 4JI6M 4MGZE 5JI3E 2C9CA 3KXEC 1HQCA 4B3RM 1E94E 1QVRA 1SXJD 4R3DA 5FLXS 4I4LA 3HWSA 2HCBA 4PDIA 3HHXA 3T1YM 4LF7M 4PD2A 4HLQA 3L27A 4DV0M 2LNHC 3U6DA 4DR5M 3SASA 3DOAA 3GPYA 4LF9M 3FYCA 3U5ZB 3MJ5A 5FTNA 3E9SA 3KW6A 3UJNA 3U6LA 4IBKA 3GLGA 3HHZA 3U61A 4IBJA 4M9XA 3JR4A 1HNXM 3FTEA 3FTCA 2XGNA 4PDGA 2XFTA 3U6CA 4NOOB 3W0LB 2DZNB 4LJ9A 2CV0A 1DO0A 1Z5BA 3SAVA 5LMNM 4CHTB 1NY6A 3VFDA 4LGYA 1QQWA 3VLFB 2I7PA 1VDDA 3T15A 4DR1M 4QNMA 3T1HM 3GQ5A 2L7IA 1GVNA 4EIWA 1HNWM 2F5SA 2QPAA 2K47A 2ZM6M 2DWMA 2V6ZM 3DA1A 4LRTA 3ZC7B 1K82A 3TWKA 5DYGA 1DGBA 4BBAA 3HU2A 1FNNA 3FKEA 2J7NA 2KXEA 4G4OA 4GKJM 3B9PA 2QBYB 5ITQA 4LJAA 3NBIA 2G5GX 3K2LA 4G4NA 4DR7M 1HNZM 2J7OA 3U6SA 3VDPA 5E6JA 1IXRC 2C96A 1GL7A 2D7EA 3MK6A 3FTDA 3R8FA 1X37A 4JXJA 3SBJA 1G4AE 2L09A 4LFBM 4YHHM 4QOZC 2KRUA 4M0DA 4DR4M 5H37D 2X8AA 4FCWA 4XGIA 1G59A 1IXZA 4LZZA 2HKJA 1K3WA 4ITQA 5A2QS 1DO2A 4FD2A 2NQ8C 4XBOA 3I4VA 4KODA 2C99A 1TH4A 3D8BA 4WURA 2DZOB 1KSFX 3C58A 2BNKA 1IN4A 3AFHA 3K8ZA 2EA0A 3CF6E 3KOWE 4KLNA 2VQEM 4FWHA 1IN6A 3KSJA 2KRKA 4A3VB 1E9SA 3KFUG 3KOYE 3J27B 4DR2M 4L16A 3KVWA 4X62M 2Z4RA 1W5SA 2Y21A 4IBFA 3QWLA 2KA6B 7CATA 3WHLA 1HR0M 1HQYE 4FCVA 5ITXE 2CUZA 3VDUA 4DV7M 4NRVA 4JI0M 1QAQA 2C9OA 4FWDA 4JI2M 3A46A 5ITXA 4LJ4A 1GLNA 8CATA 2HHHM 4L15A 3U60B 5F3WA 3TL4X 5EXTA 2YNMD 3TWLA 4IBGA 4I8OA 2C98A 5IREB 4OU7A 1J09A 1XNRM 4QHSA 4MH0E 3UZUA 5ITRA 2UXDM 1Z59A 4MGYE 4LG2A 3SATA 1XXHB 5EP2A 4LFAM 4S12A 4K0KM 4P16A 3U6PA 1Q3BA 4G4QA 1KFVA 2RGOA 3THGA 3GPPA 3H4MA 2A5YB 3JAMS 3SMPA 2CHQA 1IN5A 1L1TA 2ZAMA 4IBDA 2ZAOA 4DV6M 3AV0A 5BR8M 4ZPXA 2Y20A 1Z6TA 4JYAM 3HHYA 4NL4H 1IXSB 4PCZA 4GHAA 1W5TA 4AKHA 5KPRA 2FE8A 4LJ8A 1XHBA 2QP9X 4L78A 4JN6A 1HT2E 3HKPA 3KS4A 1QZMA 4DV2M 3R9XB 5EXSA 4YY3M 5BPVA 2ERCA 3DZDA 3GQ4A 1OJLA 4OX9M 1YSYA 3AJIB 3J7AS 1GL6A 2YQZA 5C1BA 4GHLA 4GC9A 2OPFA 3A45A 4Z8XA 2Z7JA 1NNJA 3GPXA 4FCTA 2C5RA 3FUXA 2CHGA 4MGIE 1OFHA 4R7GA 1IBKM 3CTWB 3NWLA 3FTFA 1SXJB 3GLIA 1IY1A 4LZJA 3FUWA 3KP1E 5IZ7D 4AG5A 1IN7A 1LV7A 2UUCM 4QHTA 3SMSA 2W82A 1N33M 4L4UA 4X65M 1MU5A 4CISA 1HT1E 3CF0A 1IBMM 2ZBKB 2DHRA 3FUVA 3I4YA 4DR6M 3AOEC 3GPUA 3J80S 1DGHA 4M9ZA 4MM3B 3FUTA 1NJGA 1S3SA 3HJ8A 1OFIA 3HJSA 3GRVA 3PFIA 4HL4A 1YUBA 1XMQM 2XEPA 4IJFA 3J2PB 1E32A 4FVMA 2E5LM 1MX0A 4LCBA 3OTOM 2V1UA 2JA2A 3LVVA 2XF3A 1DGHB 5EP3A 4RF1A 4NXNM 4AKGA 1J5EM 1NJFA 3A98B 4RF0A 1EE8A 3U6MA 2LH0A 2DWLA 4LGMA 4TUWA 4JI5M 4LF8M 1QAOA 4AKIA 1R6BX 3SFZA 3SARA 2M5ZA 3ZH9B 3HJQA 1K3XA 3GLIB 3ILKA 4IBBA 1SXJA 3E4RA 1IM2A 3FD9A 2FFJA 2R46A 3SAUA 3U60A 2X49A 4LJ6A 1J7KA 3W0FA 4LF4M 2F5QA 2UUAM 4LFCM 1QANA 2HL7A 4B7HA 3IG5A 1KYIA 3PVSA 1R2YA 2Z3XA 1L1ZA 1DGFA 2CFOA 3GRRA 5FTJA 3RGPA 2XZUA 4JI4M 5DYIA 1D2NA 1NNUC 4FWGA 2Q2EB 1N34M 3KDSE 3KOZE 3HU3A 1NY5A 3CF2A 3U61B 1JR3A 5FSWA 3GLGB 1N77A 3L28A 4NSRA 2XLJA 5LMUM 3I51A 2DXIA 1NVMA 1XWIA 1DGGA 1TDHA 1I4WA 2XSZD 1SXJC 1IN8A 3AL0C 3TWMA 2XSZA 5ITUA 2OQ4A 4M9SA 4KO8A 4MGHA 2XZFA 5C18A 2F5PA 2R45A 5EJCA 4WW0A 2KW0A 1JR3D 4B3SM 4NXMM 2ZANA 4IBIA 5JI2E 5EXPA 4Z6YA 3VKGA 1T3TA 3KOXE 2EUCA 2R4JA 3HGIA 3HHWA 3A42A 3GLHB 2DWZB 1XC8A 2X4AA 4II7A 2UXCM 3LMMA 4I5SA 5EQTA 3SYLA 1PJJA 4DUYM 4BB9A 4LRSA 1N32M 3BOSA 4REZA 3LVWA 1GKIA 3J7BA 3UMMA 1IBLM 4KHPM 3VKHA 4LY6A 3SC3A 3L25A 1TGUA 1XMOM 3VK8A 2YFQA 3L26A 2XFSA 2G8LA 4GMQA 4IJEA 4QOSA 3M0EA 3JR5A 1PM5A 5EXXA 3LQQA 5DNYA 2P5TA 3TPZA 1R7RA 3TE6A 2EO2A 1ORYB 1G41A 3GP1A 4LJ5A 1QYRA 4GITA 1G8PA 4LF5M 3WHKA 1WXQA 2VIIA 5EP1A 2UU9M 2XH9A 4IBEA 4LJ7A 3T38A 5ITTA 2V1CA 2RKOA 4B3TM 2LWXA 4M0WA 4AW4A 3FUUA 2BJWA 2QCUA 4B7GA 5GKNA 3L29A 1JQJC 4QNRA 4L8RC 2O5RA 1L2CA 4IIWA 1Z5AA 3LQRA 2Y0TA 1NHGC 5KPTA 4B08A 4DV3M 2LXEA 4DR3M 1PJIA 3SHFA 2F5OA 1G3IA 3KSXA 3U5ZA 5FTKA 2L7HA 3GRYA 1TH3A 4JI8M 3PNYA 2KEBA 1QAMA 5ITYA 3Q8XA 2R62A 1NHWC 4DUZM 3K92A 3U6QA 3QAUA 3UGJA 2FOIC 3DFZA 2QBYA 1Q3CA 2H1RA 2F4VM 1H6UA 2BJVA 3TQSA 2Z4SA 5KQDA 2F5NA 2UUBM 1XXHA 5KQ8A 3RE8A 1N78A 1IY0A 4NRWA 4IBCA 3GQ3A 1R2ZA 3U6EA 2UXBM 2CV1A 1Z5CA 4X66M 5KPZA 2Y0QA 4D81A 3RFWA 1L2DA 4DV1M 4B7FA 3SYKA 2RGHA 1IY2A 2R18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H M;  4MB7 A;  3GQ5 A;  4JI3 M;  1HNW M;  2F5S A;  3TWM A;  4PCZ A;  5ITU A;  2OQ4 A;  2ZM6 M;  4DV4 M;  2XZF A;  1K82 A;  3TWK A;  2F5P A;  4DV2 M;  4B3S M;  4NXM M;  4YY3 M;  4G4O A;  4GKJ M;  3J81 S;  3VK7 A;  5ITQ A;  3GQ4 A;  4OX9 M;  4JV5 M;  4G4N A;  4DR7 M;  3J7A S;  4LF6 M;  1HNZ M;  2OPF A;  3U6S A;  3A42 A;  3A45 A;  1XC8 A;  1NNJ A;  3GPX A;  2UXC M;  1N36 M;  1IBK M;  5IT9 S;  1PJJ A;  4DUY M;  1FJG M;  3SBJ A;  4LFB M;  4YHH M;  1N32 M;  4AQY M;  2UUC M;  1IBL M;  4G4R A;  4DR4 M;  4KHP M;  1TDZ A;  4JI7 M;  4X65 M;  1N33 M;  4B3M M;  1MU5 A;  4CIS A;  2HKJ A;  1K3W A;  1XMO M;  5A2Q S;  1IBM M;  4ITQ A;  3VK8 A;  2ZBK B;  4DR6 M;  3GPU A;  3JR5 A;  4DV5 M;  4DR1 M;  3J80 S;  1PM5 A;  1L2B A;  3C58 A;  3SAW A;  4JI1 M;  3GP1 A;  1XMQ M;  2EA0 A;  3GO8 A;  4LF5 M;  3U6O A;  2VQE M;  1MX0 A;  2E5L M;  2UU9 M;  3OTO M;  1I94 M;  1Q39 A;  5ITT A;  4DR2 M;  4B3T M;  1XNQ M;  2VQF M;  4NXN M;  4X62 M;  5IWA M;  1J5E M;  4GKK M;  4X64 M;  4JI6 M;  1EE8 A;  3U6M A;  4JI5 M;  1L2C A;  1HR0 M;  4LF8 M;  4B3R M;  1Z5A A;  5FLX S;  5ITX E;  4DV3 M;  3SAR A;  4DR3 M;  4DV7 M;  4NRV A;  4PDI A;  1PJI A;  1K3X A;  4JI0 M;  3T1Y M;  4JI2 M;  4LF7 M;  4PD2 A;  3A46 A;  5ITX A;  4DV0 M;  2F5O A;  3U6D A;  2HHH M;  4DR5 M;  3SAS A;  3DOA A;  4JI8 M;  3SAU A;  3GPY A;  4LF9 M;  3W0F A;  3TWL A;  5ITY A;  4LF4 M;  4DUZ M;  3U6L A;  3U6Q A;  2F5Q A;  2UUA M;  4LFC M;  1XNR M;  1Q3C A;  5ITR A;  2F4V M;  2UXD M;  3JR4 A;  1Z59 A;  1R2Y A;  1HNX M;  4PDG A;  3SAT A;  3U6C A;  1L1Z A;  4LFA M;  4K0K M;  2F5N A;  2UUB M;  3U6P A;  1Q3B A;  4G4Q A;  1Z5B A;  3SAV A;  2XZU A;  1KFV A;  4JI4 M;  3GPP A;  4NRW A;  2Q2E B;  1N34 M;  5LMN M;  3JAM S;  3GQ3 A;  1R2Z A;  3U6E A;  2UXB M;  1Z5C A;  1L1T A;  4X66 M;  1L2D A;  4DV1 M;  4DV6 M;  5LMU M;  5BR8 M;  1TDH A;  4JYA M; 
#chains in the Genus database with same CATH topology
 2R0I A;  4MB7 A;  4JI3 M;  2QZ4 A;  3GLF A;  1PJS A;  2DWN A;  4DV4 M;  2KZS A;  2WSF F;  2FNA A;  4OW0 A;  1E9R A;  1YLA A;  3UK6 A;  5FTL A;  2DVW B;  2KNZ A;  4BLC A;  4W5W A;  3AKZ A;  1ZMU A;  3IG8 A;  2D7G A;  3J81 S;  3VK7 A;  4OVZ A;  4PT5 A;  1AUA A;  1OKS A;  4JV5 M;  5FTM A;  4LF6 M;  4GC5 A;  5KO3 A;  1ZQ9 A;  4CGY B;  3AOG A;  4AG6 A;  3K1J A;  4FW9 A;  2CV2 A;  5EP4 A;  3FE3 A;  3SHG B;  1N36 M;  5IT9 S;  2AHM A;  1UM8 A;  2LVQ D;  3KP0 E;  3PXG A;  2LVN C;  4L6V 6;  4AI6 A;  3HU1 A;  1FJG M;  3D8L A;  3M6A A;  1YE9 A;  4GIP A;  1N75 A;  3M7G A;  2I7N A;  5E26 A;  4AQY M;  4HEO A;  1NSF A;  3IHP A;  3ZCB B;  4G4R A;  3FYD A;  1TDZ A;  1TH2 A;  2L4E A;  3RGS A;  4JI7 M;  3MHV C;  4AZF A;  4G6Z A;  4OVZ B;  1A5T A;  2CE7 A;  4B3M M;  4D82 A;  2DKL A;  2CHV A;  1ZAE A;  3PNV A;  4D80 A;  2GQF A;  2DAM A;  3V76 A;  2CP8 A;  2M60 A;  2R65 A;  4DV5 M;  4GRI A;  2QSF X;  4NSO B;  1IQP A;  4Y28 F;  4GH9 A;  2D7H A;  4MGK E;  3L2A A;  4RNA A;  2OOA A;  1L2B A;  1C7Y A;  3GLF B;  3EIH A;  3SAW A;  4JI1 M;  2CEA A;  1L8Q A;  2KNA A;  3GO8 A;  3LW5 F;  2QEN A;  2L2D A;  3U6O A;  1OIZ A;  3AOE A;  2YR0 A;  1C1K A;  3GLH A;  3GRU A;  1I94 M;  1Q39 A;  4I81 A;  1XNQ M;  2VQF M;  3KS8 A;  2L6O A;  3EIE A;  2R4E A;  1VEK A;  2KZU A;  5IWA M;  1SXJ E;  2O01 F;  4GKK M;  4X64 M;  4JI6 M;  4MGZ E;  5JI3 E;  2C9C A;  3KXE C;  1HQC A;  4B3R M;  1E94 E;  1QVR A;  1SXJ D;  4R3D A;  5FLX S;  1QZE A;  4I4L A;  3HWS A;  2HCB A;  1D0K A;  2JZ1 A;  4PDI A;  3HHX A;  3T1Y M;  2R6F A;  4LF7 M;  4PD2 A;  4HLQ A;  3L27 A;  4DV0 M;  2LNH C;  3U6D A;  4DR5 M;  3SAS A;  2EKF A;  3DOA A;  4WP2 A;  3GPY A;  4LF9 M;  2MJ5 B;  1WJ7 A;  3FYC A;  1D0L A;  3U5Z B;  3MJ5 A;  1RU3 A;  2JY6 B;  5FTN A;  3E9S A;  2QNJ A;  3KW6 A;  3UJN A;  3U6L A;  4IBK A;  3GLG A;  3HHZ A;  3W67 A;  3U61 A;  4IBJ A;  3C9P A;  3B7Q A;  4M9X A;  3JR4 A;  1HNX M;  3FTE A;  3FTC A;  2XGN A;  4PDG A;  2JY8 A;  1CUK A;  2XFT A;  3U6C A;  4NOO B;  4Q7J A;  3W0L B;  1NO1 A;  2DZN B;  4LJ9 A;  2CV0 A;  1DO0 A;  1Q02 A;  1Z5B A;  2EKK A;  4F2L A;  3SAV A;  1G71 A;  5LMN M;  4CHT B;  1NY6 A;  2JWS A;  3VFD A;  2RRU A;  4LGY A;  5DFL A;  1QQW A;  2DAI A;  4CIZ A;  3E46 A;  2HAK A;  3VLF B;  2I7P A;  1VDD A;  1TTE A;  1OTR A;  3T15 A;  4DR1 M;  4QNM A;  2DAG A;  3GQ5 A;  2L7I A;  1GVN A;  2DI0 A;  4EIW A;  3T1H M;  1HNW M;  2F5S A;  2QPA A;  2K47 A;  2LTU A;  2ZM6 M;  2DWM A;  2V6Z M;  3DA1 A;  4LRT A;  3ZC7 B;  1OIP A;  2JP7 A;  1K82 A;  3TWK A;  5DYG A;  3GLI E;  1DGB A;  4BBA A;  2DAE A;  3HU2 A;  1FNN A;  3FKE A;  2J7N A;  2KXE A;  4G4O A;  4GKJ M;  3B9P A;  2QBY B;  5ITQ A;  4LJA A;  3NBI A;  1WR1 B;  2G5G X;  3K2L A;  4G4N A;  4DR7 M;  1EIJ A;  1HNZ M;  1V92 A;  2J7O A;  3U6S A;  2APL A;  5E6J A;  1IXR C;  1ZV1 A;  2VF7 A;  2C96 A;  1WIV A;  3VDP A;  1GL7 A;  2D7E A;  3MK6 A;  3FTD A;  3R8F A;  1X37 A;  3BBZ A;  1LTM A;  4JXJ A;  3SBJ A;  1G4A E;  2L09 A;  4LFB M;  4YHH M;  1R4G A;  4QOZ C;  2KRU A;  4M0D A;  2CWB A;  3GLG E;  4DR4 M;  5H37 D;  2X8A A;  2LHC A;  4FCW A;  4XGI A;  1OAI A;  2GNO A;  3H4J A;  1G59 A;  1IXZ A;  1VEG A;  2HKJ A;  4LZZ A;  1K3W A;  1MN3 A;  5A2Q S;  1DO2 A;  4FD2 A;  2NQ8 C;  4XBO A;  3I4V A;  4KOD A;  4ITQ A;  2C99 A;  1TH4 A;  1JB0 F;  3D8B A;  3B74 A;  4WUR A;  2DZO B;  2ZTD A;  3B89 A;  1KSF X;  1TF0 B;  3C58 A;  4CJ6 A;  2BNK A;  1IN4 A;  4F1I A;  3AFH A;  1V33 A;  3K8Z A;  3NBX X;  3CF6 E;  2EA0 A;  3KOW E;  3E21 A;  4KLN A;  2VQE M;  4FWH A;  1IN6 A;  3KSJ A;  2KRK A;  1WGL A;  4A3V B;  1E9S A;  1OQY A;  3KFU G;  3KOY E;  3J27 B;  1VQ1 A;  4L16 A;  4DR2 M;  3KVW A;  4X62 M;  2Z4R A;  1W5S A;  2MH8 A;  2Y21 A;  4IBF A;  1PGY A;  2VDB B;  2QHO B;  3QWL A;  2KA6 B;  7CAT A;  3WHL A;  1Y8G A;  1HR0 M;  1HQY E;  4R71 A;  4FCV A;  5ITX E;  2CUZ A;  3VDU A;  4DV7 M;  4NRV A;  3B7N A;  1IXS A;  1QAQ A;  2C9O A;  4FWD A;  1JR3 E;  4JI0 M;  3T6P A;  4JI2 M;  3A46 A;  5ITX A;  2G3Q A;  4LJ4 A;  1GLN A;  4RKU F;  8CAT A;  2HHH M;  3LCV B;  4L15 A;  2DZL A;  2R44 A;  3U60 B;  3TL4 X;  5F3W A;  5EXT A;  2YNM D;  3TWL A;  4IBG A;  1SG9 A;  2B3T A;  4I8O A;  2C98 A;  5IRE B;  4OU7 A;  1J09 A;  1XNR M;  4QHS A;  4MH0 E;  3HX3 A;  3UZU A;  5ITR A;  2UXD M;  1Z59 A;  4MGY E;  4LG2 A;  3SAT A;  1XXH B;  5EP2 A;  4LFA M;  4S12 A;  4K0K M;  4P16 A;  3U6P A;  1Q3B A;  4G4Q A;  3QYB A;  1KFV A;  1BVS A;  2RGO A;  3THG A;  3GPP A;  2Z8Y M;  3H4M A;  4P17 A;  2A5Y B;  3JAM S;  3SMP A;  2CHQ A;  1IN5 A;  1L1T A;  2ZAM A;  1QUT A;  4IBD A;  2LHG A;  4GEW A;  2ZAO A;  2JNH A;  2JY5 A;  5L8R F;  3BXW A;  4DV6 M;  1XXH E;  3AV0 A;  4ZPX A;  5BR8 M;  2Y20 A;  1Z6T A;  4JYA M;  3HHY A;  4NL4 H;  2CRU A;  1IXS B;  2O25 A;  4PCZ A;  4GHA A;  1W5T A;  4AKH A;  5KPR A;  3GLF E;  2FE8 A;  4LJ8 A;  1XHB A;  2QP9 X;  4L78 A;  4JN6 A;  1HT2 E;  3HKP A;  2BWE A;  1EFU B;  3KS4 A;  1QZM A;  4DV2 M;  3R9X B;  5EXS A;  4YY3 M;  5BPV A;  2ERC A;  3DZD A;  3GQ4 A;  1OJL A;  4OX9 M;  1YSY A;  2DAK A;  3AJI B;  3J7A S;  1GL6 A;  2YQZ A;  5C1B A;  4GHL A;  4GC9 A;  2OPF A;  3A45 A;  4Z8X A;  2Z7J A;  1NNJ A;  3GPX A;  1QUS A;  4FCT A;  3FUX A;  2CHG A;  3C3E A;  1OFH A;  4MGI E;  4R7G A;  3CTW B;  3NWL A;  2C5R A;  1IBK M;  3FTF A;  1SXJ B;  3GLI A;  1IY1 A;  4LZJ A;  3FUW A;  3KP1 E;  2JY7 A;  5IZ7 D;  4AG5 A;  1PJT A;  3LCU A;  1IN7 A;  1LV7 A;  2J5Y A;  2UUC M;  4QHT A;  3SMS A;  2W82 A;  1N33 M;  4L4U A;  4X65 M;  3ZQJ A;  1MU5 A;  4CIS A;  1HT1 E;  3CF0 A;  1VG5 A;  1IBM M;  1VDL A;  2DHR A;  2ZBK B;  3FUV A;  3I4Y A;  4DR6 M;  1T6O A;  2N35 A;  3AOE C;  3GPU A;  3J80 S;  2KHH A;  1DGH A;  4M9Z A;  4MM3 B;  1MJG M;  3FUT A;  1NJG A;  1R5L A;  1S3S A;  1OFI A;  3HJ8 A;  2WZJ A;  3HJS A;  3GRV A;  3PFI A;  1NV9 A;  4HL4 A;  1YUB A;  1XMQ M;  2XEP A;  3HZJ A;  4IJF A;  2JZ0 A;  3J2P B;  1E32 A;  4FVM A;  2E5L M;  1MX0 A;  4LCB A;  3OTO M;  2V1U A;  2JA2 A;  3LVV A;  2DNA A;  2XF3 A;  1DGH B;  5EP3 A;  4RF1 A;  4NXN M;  4AKG A;  2HWJ A;  1J5E M;  1NJF A;  3A98 B;  4RF0 A;  1EE8 A;  3U6M A;  2LH0 A;  2DWL A;  4LGM A;  4TUW A;  4JI5 M;  4LF8 M;  1QAO A;  4AKI A;  1R6B X;  3SFZ A;  3SAR A;  2M5Z A;  1VEJ A;  3ZH9 B;  3HJQ A;  1K3X A;  2H5X A;  1ZMW A;  3GLI B;  3ILK A;  4IBB A;  2FH0 A;  1SXJ A;  3E4R A;  1IM2 A;  1PRB A;  3FD9 A;  2FFJ A;  2EJS A;  2R46 A;  3SAU A;  3U60 A;  2X49 A;  1NV8 A;  4LJ6 A;  1J7K A;  3W0F A;  4LF4 M;  1GAB A;  2F5Q A;  2UUA M;  4LFC M;  1QAN A;  2MRO B;  2HL7 A;  2L4F A;  4B7H A;  1WHC A;  3IG5 A;  1KYI A;  3PVS A;  1R2Y A;  1AIP C;  2Z3X A;  1L1Z A;  1DGF A;  2CFO A;  3GRR A;  5FTJ A;  3RGP A;  2XZU A;  4JI4 M;  3FRI A;  2WSE F;  1D2N A;  5DYI A;  1NNU C;  1ZMV A;  4FWG A;  3I04 M;  2Q2E B;  1V34 A;  3KDS E;  1N34 M;  2KNV A;  3B7Z A;  3KOZ E;  3HU3 A;  1NY5 A;  3CF2 A;  3Q8G A;  1JR3 A;  5FSW A;  3GLG B;  3U61 B;  1N77 A;  3L28 A;  4NSR A;  2XLJ A;  5LMU M;  3I51 A;  2DXI A;  1QDR A;  1NVM A;  1XWI A;  1DGG A;  1TDH A;  1I4W A;  2XSZ D;  1SXJ C;  1IN8 A;  3AL0 C;  3TWM A;  2XSZ A;  2DEN A;  5ITU A;  2OQ4 A;  4M9S A;  2DHY A;  2FS1 A;  2OOB A;  4KO8 A;  4MGH A;  2XZF A;  3F92 A;  5C18 A;  2F5P A;  4ANR A;  1P3Q Q;  2R45 A;  5EJC A;  4WW0 A;  2KW0 A;  1JR3 D;  2LVA A;  4XK8 F;  4B3S M;  4NXM M;  2ZAN A;  3IEC A;  4IBI A;  2QQ8 A;  5JI2 E;  5EXP A;  1XB2 B;  1OAO C;  4Z6Y A;  3VKG A;  1T3T A;  3KOX E;  2EUC A;  2R4J A;  3HGI A;  3HHW A;  2K6B A;  3A42 A;  3GLH B;  2BWB A;  2DWZ B;  2X4A A;  1XC8 A;  4II7 A;  2UXC M;  3LMM A;  4I5S A;  3W68 A;  5EQT A;  3SYL A;  1PJJ A;  2K9D A;  4UN2 B;  4DUY M;  3K9O A;  4BB9 A;  4LRS A;  1N32 M;  3BOS A;  4REZ A;  3LVW A;  2LBC A;  1GKI A;  3J7B A;  3UMM A;  1IBL M;  4KHP M;  1T43 A;  3CGW A;  2K0B X;  1HJP A;  1UFZ A;  3VKH A;  4LY6 A;  1GJS A;  3SC3 A;  3L25 A;  1TGU A;  1XMO M;  1QDT A;  2ZTC A;  3VK8 A;  2YFQ A;  3L26 A;  2XFS A;  3K9P A;  2G8L A;  4GMQ A;  4IJE A;  4QOS A;  3M0E A;  3JR5 A;  4DBG B;  5EXX A;  1PM5 A;  3LQQ A;  5DNY A;  3MMP A;  2P5T A;  3GLH E;  3TPZ A;  1R7R A;  3TE6 A;  3C3D A;  2EO2 A;  1ORY B;  1G41 A;  3GP1 A;  4LJ5 A;  1QYR A;  1TR8 A;  1G8P A;  4GIT A;  4LF5 M;  3WHK A;  1WXQ A;  4G3O A;  2VII A;  5EP1 A;  2UU9 M;  2XH9 A;  4IBE A;  4LJ7 A;  3T38 A;  2OO9 A;  5ITT A;  2VF8 A;  2V1C A;  2JUJ A;  2RKO A;  4B3T M;  2LWX A;  4M0W A;  4AW4 A;  3QYE A;  3FUU A;  2BJW A;  2QCU A;  4B7G A;  5GKN A;  2JXN A;  3L29 A;  1JQJ C;  4QNR A;  4L8R C;  2O5R A;  1L2C A;  4IIW A;  1Z5A A;  3LQR A;  1GO5 A;  2Y0T A;  1NHG C;  5KPT A;  1GJT A;  4B08 A;  2LXE A;  4DV3 M;  4DR3 M;  1PJI A;  3SHF A;  3FRH A;  2F5O A;  4NC6 A;  1G3I A;  3KSX A;  3U5Z A;  4KT0 F;  5FTK A;  1D0M A;  1PJQ A;  2L7H A;  3GRY A;  1TH3 A;  2LVO C;  4JI8 M;  3PNY A;  2KEB A;  3I01 M;  1QAM A;  5ITY A;  3Q8X A;  2R62 A;  1NHW C;  4DUZ M;  3K92 A;  3U6Q A;  3QAU A;  3UGJ A;  2MGW A;  2FOI C;  3DFZ A;  2QBY A;  2KDL A;  1Q3C A;  1F4I A;  2H1R A;  2F4V M;  1H6U A;  1DV0 A;  2BJV A;  2WSC F;  3TQS A;  2Z4S A;  3HY5 A;  5KQD A;  2F5N A;  2UUB M;  1XXH A;  5KQ8 A;  3RE8 A;  1N78 A;  2MR9 A;  1IY0 A;  4NRW A;  4IBC A;  3GQ3 A;  1R2Z A;  3U6E A;  2UXB M;  1IFY A;  2CV1 A;  1Z5C A;  4X66 M;  5KPZ A;  2LVP C;  1WGN A;  2Y0Q A;  4D81 A;  3RFW A;  1L2D A;  4DV1 M;  4B7F A;  3SYK A;  2RGH A;  1IY2 A;  2R18 A; 
#chains in the Genus database with same CATH homology
 4MB7 A;  4JI3 M;  2QZ4 A;  3GLF A;  2DWN A;  4DV4 M;  2KZS A;  2FNA A;  4OW0 A;  1E9R A;  3UK6 A;  5FTL A;  2DVW B;  4BLC A;  4W5W A;  3AKZ A;  3IG8 A;  2D7G A;  3J81 S;  3VK7 A;  4OVZ A;  4PT5 A;  4JV5 M;  5FTM A;  4LF6 M;  4GC5 A;  5KO3 A;  1ZQ9 A;  4CGY B;  3AOG A;  4AG6 A;  3K1J A;  4FW9 A;  2CV2 A;  5EP4 A;  1N36 M;  3SHG B;  5IT9 S;  2AHM A;  1UM8 A;  3KP0 E;  3PXG A;  4AI6 A;  3HU1 A;  1FJG M;  3D8L A;  3M6A A;  1YE9 A;  4GIP A;  1N75 A;  3M7G A;  2I7N A;  5E26 A;  4AQY M;  1NSF A;  3ZCB B;  4G4R A;  3FYD A;  1TDZ A;  1TH2 A;  3RGS A;  4JI7 M;  3MHV C;  4AZF A;  4G6Z A;  4OVZ B;  2CE7 A;  4B3M M;  4D82 A;  2CHV A;  1ZAE A;  3PNV A;  4D80 A;  2M60 A;  2R65 A;  4DV5 M;  4GRI A;  4NSO B;  1IQP A;  4GH9 A;  2D7H A;  4MGK E;  3L2A A;  4RNA A;  1L2B A;  3GLF B;  3EIH A;  3SAW A;  4JI1 M;  2CEA A;  1L8Q A;  3GO8 A;  2QEN A;  3U6O A;  3AOE A;  2YR0 A;  1C1K A;  3GLH A;  3GRU A;  1I94 M;  1Q39 A;  4I81 A;  1XNQ M;  2VQF M;  3KS8 A;  2L6O A;  3EIE A;  2R4E A;  2KZU A;  5IWA M;  1SXJ E;  4GKK M;  4X64 M;  4JI6 M;  4MGZ E;  5JI3 E;  2C9C A;  3KXE C;  1HQC A;  4B3R M;  1E94 E;  1QVR A;  1SXJ D;  4R3D A;  5FLX S;  4I4L A;  3HWS A;  2HCB A;  4PDI A;  3HHX A;  3T1Y M;  4LF7 M;  4PD2 A;  4HLQ A;  3L27 A;  4DV0 M;  2LNH C;  3U6D A;  4DR5 M;  3SAS A;  3DOA A;  3GPY A;  4LF9 M;  3FYC A;  3U5Z B;  3MJ5 A;  5FTN A;  3E9S A;  3KW6 A;  3UJN A;  3U6L A;  4IBK A;  3GLG A;  3HHZ A;  3U61 A;  4IBJ A;  4M9X A;  3JR4 A;  1HNX M;  3FTE A;  3FTC A;  2XGN A;  4PDG A;  2XFT A;  3U6C A;  4NOO B;  3W0L B;  2DZN B;  4LJ9 A;  2CV0 A;  1DO0 A;  1Z5B A;  3SAV A;  5LMN M;  4CHT B;  1NY6 A;  3VFD A;  4LGY A;  1QQW A;  3VLF B;  2I7P A;  1VDD A;  3T15 A;  4DR1 M;  4QNM A;  3T1H M;  3GQ5 A;  2L7I A;  1GVN A;  4EIW A;  1HNW M;  2F5S A;  2QPA A;  2K47 A;  2ZM6 M;  2DWM A;  2V6Z M;  3DA1 A;  4LRT A;  3ZC7 B;  1K82 A;  3TWK A;  5DYG A;  1DGB A;  4BBA A;  3HU2 A;  1FNN A;  3FKE A;  2J7N A;  2KXE A;  4G4O A;  4GKJ M;  3B9P A;  2QBY B;  5ITQ A;  4LJA A;  3NBI A;  2G5G X;  3K2L A;  4G4N A;  4DR7 M;  1HNZ M;  2J7O A;  3U6S A;  3VDP A;  5E6J A;  1IXR C;  2C96 A;  1GL7 A;  2D7E A;  3MK6 A;  3FTD A;  3R8F A;  1X37 A;  4JXJ A;  3SBJ A;  1G4A E;  2L09 A;  4LFB M;  4YHH M;  4QOZ C;  2KRU A;  4M0D A;  4DR4 M;  5H37 D;  2X8A A;  4FCW A;  4XGI A;  1G59 A;  1IXZ A;  4LZZ A;  2HKJ A;  1K3W A;  4ITQ A;  5A2Q S;  1DO2 A;  4FD2 A;  2NQ8 C;  4XBO A;  3I4V A;  4KOD A;  2C99 A;  1TH4 A;  3D8B A;  4WUR A;  2DZO B;  1KSF X;  3C58 A;  2BNK A;  1IN4 A;  3AFH A;  3K8Z A;  2EA0 A;  3CF6 E;  3KOW E;  4KLN A;  2VQE M;  4FWH A;  1IN6 A;  3KSJ A;  2KRK A;  4A3V B;  1E9S A;  3KFU G;  3KOY E;  3J27 B;  4DR2 M;  4L16 A;  3KVW A;  4X62 M;  2Z4R A;  1W5S A;  2Y21 A;  4IBF A;  3QWL A;  2KA6 B;  7CAT A;  3WHL A;  1HR0 M;  1HQY E;  4FCV A;  5ITX E;  2CUZ A;  3VDU A;  4DV7 M;  4NRV A;  4JI0 M;  1QAQ A;  2C9O A;  4FWD A;  4JI2 M;  3A46 A;  5ITX A;  4LJ4 A;  1GLN A;  8CAT A;  2HHH M;  4L15 A;  3U60 B;  5F3W A;  3TL4 X;  5EXT A;  2YNM D;  3TWL A;  4IBG A;  4I8O A;  2C98 A;  5IRE B;  4OU7 A;  1J09 A;  1XNR M;  4QHS A;  4MH0 E;  3UZU A;  5ITR A;  2UXD M;  1Z59 A;  4MGY E;  4LG2 A;  3SAT A;  1XXH B;  5EP2 A;  4LFA M;  4S12 A;  4K0K M;  4P16 A;  3U6P A;  1Q3B A;  4G4Q A;  1KFV A;  2RGO A;  3THG A;  3GPP A;  3H4M A;  2A5Y B;  3JAM S;  3SMP A;  2CHQ A;  1IN5 A;  1L1T A;  2ZAM A;  4IBD A;  2ZAO A;  4DV6 M;  3AV0 A;  5BR8 M;  4ZPX A;  2Y20 A;  1Z6T A;  4JYA M;  3HHY A;  4NL4 H;  1IXS B;  4PCZ A;  4GHA A;  1W5T A;  4AKH A;  5KPR A;  2FE8 A;  4LJ8 A;  1XHB A;  2QP9 X;  4L78 A;  4JN6 A;  1HT2 E;  3HKP A;  3KS4 A;  1QZM A;  4DV2 M;  3R9X B;  5EXS A;  4YY3 M;  5BPV A;  2ERC A;  3DZD A;  3GQ4 A;  1OJL A;  4OX9 M;  1YSY A;  3AJI B;  3J7A S;  1GL6 A;  2YQZ A;  5C1B A;  4GHL A;  4GC9 A;  2OPF A;  3A45 A;  4Z8X A;  2Z7J A;  1NNJ A;  3GPX A;  4FCT A;  2C5R A;  3FUX A;  2CHG A;  4MGI E;  1OFH A;  4R7G A;  1IBK M;  3CTW B;  3NWL A;  3FTF A;  1SXJ B;  3GLI A;  1IY1 A;  4LZJ A;  3FUW A;  3KP1 E;  5IZ7 D;  4AG5 A;  1IN7 A;  1LV7 A;  2UUC M;  4QHT A;  3SMS A;  2W82 A;  1N33 M;  4L4U A;  4X65 M;  1MU5 A;  4CIS A;  1HT1 E;  3CF0 A;  1IBM M;  2ZBK B;  2DHR A;  3FUV A;  3I4Y A;  4DR6 M;  3AOE C;  3GPU A;  3J80 S;  1DGH A;  4M9Z A;  4MM3 B;  3FUT A;  1NJG A;  1S3S A;  3HJ8 A;  1OFI A;  3HJS A;  3GRV A;  3PFI A;  4HL4 A;  1YUB A;  1XMQ M;  2XEP A;  4IJF A;  3J2P B;  1E32 A;  4FVM A;  2E5L M;  1MX0 A;  4LCB A;  3OTO M;  2V1U A;  2JA2 A;  3LVV A;  2XF3 A;  1DGH B;  5EP3 A;  4RF1 A;  4NXN M;  4AKG A;  1J5E M;  1NJF A;  3A98 B;  4RF0 A;  1EE8 A;  3U6M A;  2LH0 A;  2DWL A;  4LGM A;  4TUW A;  4JI5 M;  4LF8 M;  1QAO A;  4AKI A;  1R6B X;  3SFZ A;  3SAR A;  2M5Z A;  3ZH9 B;  3HJQ A;  1K3X A;  3GLI B;  3ILK A;  4IBB A;  1SXJ A;  3E4R A;  1IM2 A;  3FD9 A;  2FFJ A;  2R46 A;  3SAU A;  3U60 A;  2X49 A;  4LJ6 A;  1J7K A;  3W0F A;  4LF4 M;  2F5Q A;  2UUA M;  4LFC M;  1QAN A;  2HL7 A;  4B7H A;  3IG5 A;  1KYI A;  3PVS A;  1R2Y A;  2Z3X A;  1L1Z A;  1DGF A;  2CFO A;  3GRR A;  5FTJ A;  3RGP A;  2XZU A;  4JI4 M;  5DYI A;  1D2N A;  1NNU C;  4FWG A;  2Q2E B;  1N34 M;  3KDS E;  3KOZ E;  3HU3 A;  1NY5 A;  3CF2 A;  3U61 B;  1JR3 A;  5FSW A;  3GLG B;  1N77 A;  3L28 A;  4NSR A;  2XLJ A;  5LMU M;  3I51 A;  2DXI A;  1NVM A;  1XWI A;  1DGG A;  1TDH A;  1I4W A;  2XSZ D;  1SXJ C;  1IN8 A;  3AL0 C;  3TWM A;  2XSZ A;  5ITU A;  2OQ4 A;  4M9S A;  4KO8 A;  4MGH A;  2XZF A;  5C18 A;  2F5P A;  2R45 A;  5EJC A;  4WW0 A;  2KW0 A;  1JR3 D;  4B3S M;  4NXM M;  2ZAN A;  4IBI A;  5JI2 E;  5EXP A;  4Z6Y A;  3VKG A;  1T3T A;  3KOX E;  2EUC A;  2R4J A;  3HGI A;  3HHW A;  3A42 A;  3GLH B;  2DWZ B;  1XC8 A;  2X4A A;  4II7 A;  2UXC M;  3LMM A;  4I5S A;  5EQT A;  3SYL A;  1PJJ A;  4DUY M;  4BB9 A;  4LRS A;  1N32 M;  3BOS A;  4REZ A;  3LVW A;  1GKI A;  3J7B A;  3UMM A;  1IBL M;  4KHP M;  3VKH A;  4LY6 A;  3SC3 A;  3L25 A;  1TGU A;  1XMO M;  3VK8 A;  2YFQ A;  3L26 A;  2XFS A;  2G8L A;  4GMQ A;  4IJE A;  4QOS A;  3M0E A;  3JR5 A;  1PM5 A;  5EXX A;  3LQQ A;  5DNY A;  2P5T A;  3TPZ A;  1R7R A;  3TE6 A;  2EO2 A;  1ORY B;  1G41 A;  3GP1 A;  4LJ5 A;  1QYR A;  4GIT A;  1G8P A;  4LF5 M;  3WHK A;  1WXQ A;  2VII A;  5EP1 A;  2UU9 M;  2XH9 A;  4IBE A;  4LJ7 A;  3T38 A;  5ITT A;  2V1C A;  2RKO A;  4B3T M;  2LWX A;  4M0W A;  4AW4 A;  3FUU A;  2BJW A;  2QCU A;  4B7G A;  5GKN A;  3L29 A;  1JQJ C;  4QNR A;  4L8R C;  2O5R A;  1L2C A;  4IIW A;  1Z5A A;  3LQR A;  2Y0T A;  1NHG C;  5KPT A;  4B08 A;  4DV3 M;  2LXE A;  4DR3 M;  1PJI A;  3SHF A;  2F5O A;  1G3I A;  3KSX A;  3U5Z A;  5FTK A;  2L7H A;  3GRY A;  1TH3 A;  4JI8 M;  3PNY A;  2KEB A;  1QAM A;  5ITY A;  3Q8X A;  2R62 A;  1NHW C;  4DUZ M;  3K92 A;  3U6Q A;  3QAU A;  3UGJ A;  2FOI C;  3DFZ A;  2QBY A;  1Q3C A;  2H1R A;  2F4V M;  1H6U A;  2BJV A;  3TQS A;  2Z4S A;  5KQD A;  2F5N A;  2UUB M;  1XXH A;  5KQ8 A;  3RE8 A;  1N78 A;  1IY0 A;  4NRW A;  4IBC A;  3GQ3 A;  1R2Z A;  3U6E A;  2UXB M;  2CV1 A;  1Z5C A;  4X66 M;  5KPZ A;  2Y0Q A;  4D81 A;  3RFW A;  1L2D A;  4DV1 M;  4B7F A;  3SYK A;  2RGH A;  1IY2 A;  2R18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...