2E5LQ

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2e5lQ00
1E1OA 2I5HA 3A0JA 1VQ7A 2BH2A 1DGSA 4LFCL 2N78A 1NMGA 5J3BA 4YHHQ 4QIWE 2PI2E 1I94Q 1G291 1CKOA 1S40A 4YHHL 4GKJQ 1FL0A 2OTJA 1I94L 4HJ8A 4GKJL 2KHIA 5IYBH 1Q12A 4HIKA 1PH9A 3F1ZA 3CQZH 2ES2A 5JEAG 1HJPA 3GTLH 1VQPA 1S3OA 4QQBX 1NY4A 4JI1Q 2R93G 3CW2C 1KHIA 3CC7A 3HOWG 4JI1L 1W2BA 1SROA 1LYLA 4P75A 1X55A 4A3DH 1L1OA 4NPSA 2JA5H 3M4OH 3H15A 4UY8C 4QL5A 1KD1C 3HOYG 2FXQA 2AKWB 3LGJA 4LUOA 3ICEA 4A93H 4LF6Q 4OO1G 1N36Q 3PF5A 2YTVA 3HKSA 2QGQA 1IBML 4LF9Q 4NB3A 4DNIA 1N36L 5BR8Q 5C4XH 1G51A 3HOXG 3CCJA 4LF9L 1IXRA 5BR8L 3OW2A 4GOPA 1YVCA 4OO1I 2MQHA 4A3BG 3PUVA 4DUZQ 2Q2UA 1BVSA 4DR7Q 3CD6A 4DUZL 3PUZA 2AMCB 1XNQQ 3I4MH 3CXCA 1X65A 3TS2A 1XNQL 4A3MH 3K7AH 3A5UA 1E7ZA 4NXNQ 3CF5A 3J80c 4NXNL 1UEBA 3J81j 2ZJRA 1Q1BA 1TWAH 2A8VA 2JJQA 3NEMA 4L5TA 1FVIA 4UP7A 1WOCA 2WFWA 3I2ZA 1AE2A 3JAMi 3EBEA 3B6YA 3PGZA 2VUMH 4IJLA 5FLMG 3CCQA 2PQAA 2Z6KC 4AIMA 4PZ7A 1E24A 4DV6Q 1YITA 4DV6L 1VQEA 4R4QA 4DV5Q 2R7ZH 4C2MH 2ZTCA 1PHJA 4JBKA 3H3VH 4DV5L 4LF5Q 1YJWA 4KHZA 1TWCH 1A8VA 2MO1A 4LF5L 2NVTH 3H0GG 2KBNA 5GAEC 1QUQA 3U4VA 2CKZB 3FKIH 3D31A 4QGUA 4DR1Q 2RHSB 2VL6A 1NBWA 1X6OA 1IBLQ 4DR1L 3I4NH 1OTCA 2K52A 4H02A 2CWPA 3S1QH 3L2PA 1Y14B 5C0XJ 3BU2A 1FJGQ 3TRZA 3K0XA 3AFQA 3UDXA 1FJGL 4R4OA 3G6EA 4R4IA 2K5NA 3BZKA 3KF6B 3E9HA 3OTOQ 5C4JH 1VQ6A 2HQLA 2V1CC 5FLXc 2K50A 3OTOL 4DUYQ 1K8GA 4JYAQ 5M3FH 1HR0W 2D62A 4DR5Q 1EIYB 4JYAL 4A3LG 4DUYL 1W3SA 1Y1WG 4DR5L 5IYCG 1VQCA 1VQAA 2YTXA 4KLKA 1TWFH 4XIGS 2YV5A 3PO3H 4A3GH 3HOUG 1UE5A 1Q46A 2KHJA 1WYDA 3I4OA 2NN6I 4HIMA 5M3MG 4OWWB 3I56A 4LWCA 1LUZA 3HKZE 4A3IG 4BA2I 2R6GA 5JJIA 1VQIA 2IHFA 4IPDA 1Q8KA 1GKHA 4GKKQ 1PVOA 2XTIA 3PF4A 4JI7Q 2ZJQA 2K75A 2Q2IA 1QZGA 3I55A 4GKKL 1LTLA 4A3CH 4YWLA 2Y0SE 5GROA 4JI7L 3S2DH 2KENA 4A4IA 1Q86C 1V43A 3RR5A 3M4QA 1Q1EA 4POGA 2PI2A 2WAQE 1JJ2A 2E2HH 1JJGA 1IYJB 4A3FG 1JB7A 1AH9A 3WWVA 3PO2G 1V9PA 2GVAA 1SRUA 1HR0Q 4GNXB 5K36G 3K8AA 1HR0L 4A3JG 2RF4A 3S14H 4DK3C 2YTYA 4MNOA 3G71A 3UE1A 5M5WH 1KXLA 1IBKQ 2IY5B 2R93H 1EUJA 3AYHB 3HOWH 1IBKL 4ME3A 3K80C 5FJ8G 3HOZG 3J7ZC 5C3EG 1JMCA 3S1MH 2I5LX 1NJIC 2YU9H 3J80i 1Y1VG 3HOYH 1AE3A 2UUCQ 3PV0A 4LFCQ 2UUCL 1X3GA 3NELA 1Z47A 3GD7A 1QZHA 2Z6KA 1CUKA 2PMZE 3HOXH 1ASZA 2OQKA 4LFAQ 2UXBQ 3F2DA 4Y7NH 1PV4A 1UE7A 4LFAL 2UXBL 4A3BH 1PFSA 1EQRA 2H5XA 1CKNB 3U4ZA 3PCOB 1TWGH 4LUVA 1YHQA 4DV2Q 4OWXB 3TREA 1X3FA 2R92G 3BZCA 2OWOA 2BH8A 4DV2L 4LFBQ 4DR6Q 2MO0A 3ERSX 2EIFA 5M5YH 2K5HA 3MEFA 4LFBL 4YCWA 4DR6L 3KOJA 2JA7G 3RLNA 5JJKA 3E9IA 1MJEA 2VY3A 1Z9FA 3J81c 4X6AH 1IBMQ 4GLXA 5FLMH 4LF4Q 2B3GA 2JEBI 2ZTDA 1YJNA 3U50C 4LF4L 2ZM6L 3M85A 5IP9H 1H95A 4BBRG 3GO5A 2CFMA 3HOVG 4JI6Q 3NBHB 4B3RQ 4DV7Q 2JA8G 1E22A 4JI6L 5JJLA 4B3RL 3H0GH 2D0OA 4DV7L 1KQSA 1VS0A 2WP8J 2VW9A 1HNXQ 1ASYA 1HNXL 5JEAJ 2EQSA 1NTGA 2F4VQ 3KYHC 1Q7YC 1N32Q 1V1QA 2F4VL 2IX0A 3AFPA 4PZ8A 1C9OA 3DLLA 1N32L 1VQBA 3KDFA 1K3RA 3CCLA 1QVCA 1CKMA 4YWMA 4AYBG 4QJFA 1RL2A 3RLFA 4C3JH 4GS3A 1VQDA 2BA0A 4BY1G 2JK8A 1CSPA 1D7QA 1X56A 3PIPA 3EN2A 4POFA 2K14A 1GD7A 3FP9A 3L0OA 1HNWQ 4DV3Q 4JCVE 4HJAA 1YBYA 5HGQA 2GVBA 1YJ9A 4DV3L 4A3LH 1HNWL 1I5FA 1Y1WH 5IYCH 3IRBA 3S1RH 1M1KC 5IE8A 1N34L 1U5KA 1YNXA 3HOUH 1I50H 5M5XH 3CCRA 1SFOH 1UE1A 3GTPH 5M3MH 4A3EG 1MKHA 4A3IH 4IJHA 1T9HA 1XPRA 1PH5A 1JT8A 4GN5A 4WJ4A 3W1BA 5HY6A 3CCMA 1EQQA 4K0KQ 2LXJA 1MIUA 4K0KL 5C4XG 2UXDQ 2IT1A 4JI2Q 3RLOA 2UXDL 4JI2L 4DAYB 2NVYH 5E7NA 1PYBA 2NZHA 3RZOH 3EIVA 2F3IA 3AQQA 4A3FH 1NE3A 2NN6G 4ALPA 3I4MG 2MNAA 4IFDG 4A3KG 3PO2H 1MJCA 1PH1A 4IPHA 3CMAA 1VQ9A 2I5MX 2AWOA 2WB1G 2A19A 1PH6A 4IFDI 3TS0A 2IX1A 2K4KA 4P72A 4A3JH 3G4SA 2AHOB 4GLVB 2ATWA 4PG3A 3UDFA 4BA1I 3J7A5 2VUMG 1YEZA 1PH2A 1L1OB 4L5RC 2E5LQ 4JI5Q 2E5LL 3ULJA 5H1SE 1WFQA 4JI5L 1VQ8A 2I0QA 4YY3Q 1Q81C 5FJ8H 5LMNQ 3HOZH 4YY3L 5C3EH 1SMXA 1K0RA 1WJJA 3UDIA 5LMNL 4GOPB 3GTKH 2LSSA 4GNXC 4B3MQ 1VQ4A 3AEVA 1KL9A 3UE0A 1Y1VH 4JV5Q 1B7YB 4B3ML 1PH8A 2ID0A 3SGIA 4JV5L 3A5ZB 1C0AA 3CC4A 1OXUA 1XPUA 5AJ3Q 3J81i 1J6QA 2CWAA 2AWNA 5C44G 3W1GA 4DR3Q 5AJ3L 3HFZB 1VQNA 4DR3L 3RN2A 1PYSB 1L0WA 3KJOA 2ZJPA 4L5QA 4RMFA 4APVA 4HIOA 1PH7A 2DGYA 2JE6I 2UXCQ 1YIJA 2NZOA 1VQ5A 4LF8Q 2R92H 1BKBA 2UXCL 5IT9c 4P73A 4GN3B 4DPGA 4X66Q 4LF8L 2PQAB 2L15A 4IPGA 2OTLA 1NMFA 2B63H 4X66L 1I6HH 3GTGH 4R4TA 2KCMA 1FGUA 2IHEA 1VCIA 2JA7H 2VZAA 4C3IH 2JA6G 4DAMA 2DUDA 1HZ9A 3U58A 4KI0A 4YCVA 4AH6A 1Q82C 4KHPL 2QA4A 1HNZQ 1O7IA 2JQOA 2YYZA 1VQOA 4L5SA 3TEHB 1HNZL 3GTOH 2D0PA 1JJCB 2HIXA 2RCNA 2UUAQ 1EIFA 3S24A 1GO3E 4BBRH 4FDBA 1VQHA 4O0AA 4R1JA 4TQUS 3RNUA 2UUAL 2NVXH 2RHQB 3W5OA 2XGTA 3HOVH 2HHHQ 4B3TQ 1PH4A 4LUZA 2HHHL 4B3TL 4LF7Q 4JBMA 2VS1A 5IYDG 1SN8A 4LF7L 3KLWA 4IOAA 1WCMG 1KRSA 1XJVA 4MZ9A 4JOIC 4X65Q 3K7UC 4HJ7A 1N9WA 1XMQQ 2A1AA 3GTMH 4P71A 4X65L 1XMQL 2ZTEA 1TXYA 3CAMA 2Z0SA 3KF6A 4BY1H 2OQ0A 1VQLA 2N49A 4HIDA 3MXNB 4X64Q 2ZM6Q 4TVAB 4X64L 1OXVA 1K83H 1XNRQ 4JBJA 5IP7G 4JI0Q 2R7DA 4JI4Q 4BY7G 3T1YQ 3ZJYC 4A75A 4JI0L 1XNRL 4JI4L 2MFIA 3T1YL 1I3QH 3OYYA 4B3SQ 4DR2Q 3CCSA 3S16H 3PIOA 4B3SL 1X54A 4HJ5A 2OCEA 4IO9A 3M4PA 4X62Q 3CPWA 4DR2L 2KCTA 1KIXA 4UP9A 4X62L 4A3EH 1M90C 4BBSG 1KAWA 1BBWA 2Q2HA 3F8TA 2B63G 4BXXG 1X9NA 2VQFQ 1XMOQ 3FHWA 3CCUA 1VQFA 2GN5A 3CPFA 2VQFL 3CC2A 1XMOL 4LF6L 1VQGA 4AQYQ 1U0LA 2ALYB 4HJ9A 1UE6A 4IPCA 3G48A 4AQYL 3GDEA 2QEXA 3M7NA 3KJPA 4QY7A 1SLJA 4RG1A 1HZCA 1YZ6A 4UPAA 1EFWA 3PUYA 2VNUD 3S17H 5IYBG 1A63A 1PH3A 1SR3A 1YHAA 2HIVA 1QVGA 4GNXA 1HZAA 3K81C 4DR7L 5GAHC 3DM3A 1N34Q 1P16A 4DKAC 3F2CA 4DV0Q 4A3KH 1J5EQ 4WJ3M 1A0IA 4DV0L 4JI8Q 3S15H 3A74A 1J5EL 5C0XG 4JI8L 4DK6C 1TWHH 1XTDA 2R7FA 4A3DG 2JA5G 1VQKA 1B70B 4JI3Q 3M3YH 4JC0A 3F2BA 1VQMA 4A93G 5C0XI 3Q8DA 4JI3L 3HKZG 1L2FA 4O2DA 5LMNW 2ASBA 1P8LA 4Y52H 3CMEA 1OXXK 1K9MC 1X3EA 1XPOA 2Q2TA 1PA6A 3E0EA 5IP9G 3S2HH 3CCEA 4GN4B 4YCUA 1OXTA 1D8LA 3STBC 4C3HH 4OXPA 2Y0SG 1WI5A 1SE8A 5LMUQ 1GVPA 3UDGA 2CQOA 1HZBA 3PUWA 5LMUL 2WAQG 4A3MG 4AYBE 3S1NH 3PSIA 2N3SA 4A76A 1YI2A 5C44H 1CKNA 1IBLL 1L1OC 4MTNA 5IWAQ 1C7YA 4LW1A 4DV4Q 5IWAL 1EYGA 4XTCS 3CCVA 2JA9A 4R4CA 4DV4L 4OONA 1IZ6A 2NVQH 2VQEQ 1E3PA 1S72A 4DR4Q 1CSQA 3JC66 2VQEL 3D0FA 4GOPC 1EWIA 4DR4L 1E1TA 1N8RC 2R7ZG 1KRTA 4EQ5A 4JOIA 2LXKA 3RN5A 4NXMQ 4NXML 1K8AC 2JA6H 2E2IH 3H3VI 2UU9Q 3FKIG 5GAGC 4IFDJ 3STBD 2UU9L 1G6PA 3M9BA 2B29A 3I4NG 3JAMc 1A62A 3L7ZC 5GQOA 3PUXA 4UP8A 4PMWA 3ER0A 4IOCA 3I7FA 1YHBA 2F52A 3T1HQ 3TQYA 5EAYA 2UUBQ 1QVFA 3T1HL 3KDFB 2EXDA 1GM5A 2UUBL 2C35B 4PZ6A 1BBUA 3GTQH 1IL2A 5IYDH 1LM0A 5M3FG 3KFUA 1WCMH 2N8NA 2E8GA 1KC8C 3BJUA 2BA1A 2WB1E 2CCZA 3ULLA 1HH2P 4EX5A 5ELOA 4KHPQ 3PO3G 4A3GG 2HT1A 4LNQA 1EOVA 3NENA 4P74A 5ELNA 1K73C 4GLAC 1RIPA 4J15A 1QUQB 3KF8B 5DLQE 4JG2A 5IP7H 2K5VA 4BY7H 3CP0A 5IY0A 1N33Q 1B8AA 3GTJH 2JEAI 1OXSC 1UWVA 1N33L 2JA8H 4DV1Q 4A3CG 1VQJA 3VDYA 2PNHA 4JBWA 5GADC 4DV1L 4OX9Q 3RZDH 4OX9L 4OWTB 1JE5A 4BBSH 1R9TH 3ULPA 4BXXH 2E2JH 4YWKA
chains in the Genus database with same CATH superfamily
4ZCKA 4IUQA 4DAYA 1I4XA 2K33A 4QIWE 2FHTA 2PI2E 1Y1WB 4YHHL 1I94L 4GKJL 3K58A 1Q12A 4EGVA 1PH9A 2A68C 3VYSA 3GTPB 1VQPA 4QQBX 3CW2C 3EROA 1IYUA 4JI1L 3MA2B 2PO4A 3KBXA 1VDZA 2QCPX 1X55A 4J6HA 1L1OA 4DK0A 2LS01 2KOLA 3J7YW 4A93H 4LUOA 4LF6Q 2QGQA 4NB3A 3VA7A 5BR8Q 3RZOB 3J80L 4OO1I 2MQHA 1DJRD 3EFXD 4DF7A 3PUZA 3I4MH 3CXCA 1I4RA 3TP8A 4A3MH 3K7AH 4A3JB 4NXNQ 4M8AA 3CF5A 3J80c 3X3NA 3J81j 2PPBC 5KNBA 4L5TA 1ET6A 1FVIA 4UP7A 4ZRZA 5IGDA 4MHEA 3OOCA 4X3KA 1RDPD 2DJFC 3CCQA 2PQAA 2Z6KC 4AIMA 4PZ7A 4DV6Q 1YITA 3GTKB 5J22A 1Y1VB 4UAIA 4C2MH 3ERQA 1PHJA 4KHZA 1TWCH 1GUWA 3H0GG 4XDXA 4FXDA 2AQ3B 4P2CB 1QUQA 5JAVA 1SEBD 2CKZB 3FKIH 5FLXL 2O2LD 2RHSB 2VL6A 1NBWA 3A7AB 1YNNC 1OTCA 2K52A 5CC4A 1MSGA 3DEPA 2JSOA 2KVMA 3AFQA 2R92B 4R4OA 3Q23A 1SE2A 3P75A 2ZT9C 3OTOQ 2F0FA 4B08A 3GV6A 5C4JH 1HA5A 4C56C 5FLXc 2K50A 4DUYQ 1STHA 4L6TB 1EIYB 4JYAL 2H1EA 1W3SA 5IYCG 4O1NA 3A8KE 4X3TA 3HOUG 2KHJA 1WYDA 5M3MG 3I56A 4BBRB 3HOVB 5I2XA 2R6GA 1AZPA 1VQIA 1DD2A 1Q8KA 4OGQC 3C1EA 3VR5A 3PF4A 3P1HA 1FNVA 2BCOA 1D5XC 1EYDA 4YWLA 1Y8OB 1PTOF 2KENA 2NTSA 4AYBB 4A3FG 1XYIA 2Z8LA 1EZ8A 4HN7A 3WWVA 3W3AA 2X69A 3PO2G 2D9UA 1SRUA 1A2UA 5IT9L 4GNXB 5K36G 1HR0L 2CW0D 1AFPA 2RF4A 3LX0A 4DNRB 4ZQ3A 2NB0A 1H9JA 4DK3C 4MNOA 3G71A 4HR7B 2VXWA 4K8JA 4ME3A 4ZUJA 2X6LA 2F0WA 3T53B 3HS0C 5E4WC 2I5LX 1R4PB 1NJIC 2WINB 1AE3A 2UUCQ 1HUNA 1X3GA 4PMCA 3GD7A 1QZHA 1K8MA 4TKOB 1ASZA 2OQKA 1UE7A 2WV6D 3BDCA 4IZ8A 4LFAL 3BDLA 1PFSA 4I7AA 2H5XA 4KMUC 5JVH3 4JK1C 4LUVA 2FJ2A 3TREA 2A5HA 2OWOA 5CYUA 4LFBQ 5NUCA 4DR6Q 3MEFA 2XN9C 5KEEA 5ELFA 2JA7G 3E9IA 4C3IG 1JOOA 1Z9FA 2VY3A 3S2HB 4GLXA 4LF4Q 4NDXA 1BO0A 5IP9H 2K32A 3KK7A 4JI6L 3H0GH 1HNXQ 3TBIB 2ZXOA 2Q8IB 5C44B 1JC7A 2F4VQ 1F2YA 1A3TA 3K0YA 1Q7YC 1N32Q 2IX0A 2KJXA 2NVQB 1VQBA 3R2IA 4L63B 4YWMA 3CCLA 4QJFA 1VQDA 4BY1G 2ZXPA 1HUMA 1X56A 5C3XA 1HNWQ 5JOBA 4DV3Q 1YBYA 2F3WA 5IYCH 3NP8A 1IW7C 3S1RH 2Z4HA 1S5BD 1N34L 3HOUH 1I50H 4XT1B 5M5XH 5M3MH 4LAAA 1PH5A 4N8FA 3F2UA 3QJYA 4WJ4A 1EQQA 4K0KQ 4OIKA 4LJZC 2UXDQ 2F0IA 3N6RA 1SYEA 1J8IA 2B8GA 4JI2L 3P20A 1DM0B 2NZHA 2F3IA 1PFNA 3MC0B 4A3FH 1NE3A 4CJ2C 2OEOA 3A8JE 2OT2A 3PO2H 1BUVT 1PH1A 2B2UC 4KY5A 2AUJD 3T56B 5K36H 4QCLA 3SDZA 1BQQT 2K4KA 4P72A 1PXUA 1PYWD 2V4DA 2MJ8A 1YEZA 1KDAA 1EQTA 3BYYB 2K5WA 1WFQA 1R9TB 2XRSD 4YY3Q 1YNJC 5LMNQ 3UDIA 3AEVA 1KL9A 1ILPA 1EIHA 4K5VA 4B3ML 1PH8A 4JV5L 3A5ZB 2LKVA 1WTQA 1XPUA 1F9SA 2OXPA 1JWSD 1VQNA 2HDLA 4L5QA 3FPPA 5JEAH 1FNUA 1PRTC 1BR9A 2NZOA 4HCSA 3M4OB 1NMFA 3GTGH 1H9MA 2RSNA 2JA7H 2VZAA 4C3IH 2CHBD 2F0MA 2K28A 4KHPL 4KI0A 1O7IA 3LNNA 1VQOA 1JCKB 2D0PA 1JJCB 4X3UA 4KK7A 2UUAQ 1D1IA 3RNUA 4FDBA 2KEEA 4ABNA 4OL7A 1PH4A 4H13C 4DNTB 2HHHL 5ELEA 4IOAA 1WCMG 4X65Q 2B2TA 5EQ0A 3GTMH 3WOFA 4KKTA 4XQNA 3CAMA 3NTIA 5LL6X 3NWTA 1XMQL 2QEJC 3JAME 3CKIB 4BY1H 1EU4A 4ME5A 4HIDA 3MXNB 4X64Q 2R7ZB 4R8IA 1PTOD 2I46A 4JI0Q 4BY7G 1XNRL 1KLGD 2MFIA 3T1YL 3OYYA 3NXWA 4B3SL 1X54A 4DR2L 3CPWA 2KCTA 2WIIB 2F0EA 2LMCB 1BBWA 4BXXG 5FK9C 5D3IB 1X9NA 2VQFQ 1UEAB 3FHWA 4H0LC 1EYAA 2GN5A 3CPFA 1VQGA 4N9PA 1U0LA 5M3FB 2ALYB 4IPCA 3G48A 4AQYL 3GDEA 3KJPA 4QY7A 4RG1A 3S9WA 2EYFA 1A63A 4GNXA 1N34Q 4DV0Q 3F2CA 4WJ3M 1CI3M 1MHWC 1TWHH 2NZ1D 1G2TA 3K57A 2JA5G 1SNQA 2F0GA 3E6ZX 1VQMA 4KD4A 5C0XI 3Q8DA 4JI3L 3HKZG 1CHQD 2MPMA 5CORA 1P8LA 3I90A 5M9OA 1EWHA 1NCVA 3R3OA 1K9MC 2F0JA 2Q2TA 1SSOA 3E0EA 3QO2A 4N9TA 4YCUA 1OXTA 2O5IC 3VR2A 3U9OA 5EPJA 2K5QA 1B9MA 1WI5A 1SE8A 3E0JA 1GVPA 3QB3A 5LMUQ 3VA5A 1S4ZA 3PUWA 2WAQG 2K04A 1KDCA 1XX8A 2RDFA 4A76A 2N3SA 1SMYC 1YI2A 5FO7B 5M5WB 2R93B 2J0TD 3KLSX 5E3FA 1II3A 2MHVA 2NWGA 1U4PA 1CSQA 5J39A 1NUCA 3DWPA 4NXMQ 2D5DA 4DN4M 3HOXB 2E2IH 3NTKA 4G7ZC 4A3BB 2B29A 3I4NG 4OELB 3L7ZC 3OIPA 3QIAA 5GQOA 4PMWA 3I7FA 1NNXA 1YHBA 2NBFA 4XXEA 3T1HQ 3TQYA 5EAYA 5ISRA 3K59A 4PZ6A 3NBIA 4KJNA 1BCPD 1HPCA 1WCMH 1PZJD 1CTMA 4MTKA 4UHVA 5ELOA 4KHPQ 3PO3G 1B53A 2K03A 4P74A 1RIPA 4J15A 1QUQB 3KF8B 3NWSA 5DLQE 4JG2A 2DY7A 3D4DA 4BY7H 5IY0A 5JPNC 1N33Q 1B8AA 2JA8H 1Q90A 3C46A 1VQJA 4DV1L 1JWUD 3RZDH 4OX9L 2SEBD 3FPUB 2L1BA 4BXXH 1FD7D 3H3VC 1W6JA 1X3QA 2I5HA 3A0JA 1VQ7A 2BH2A 1STBA 5CV8A 4KN4C 4RHRA 2Z1CA 2OTJA 4HJ8A 3O13A 4WFN3 4HIKA 2ES2A 3GTLH 3CQZH 1SFOB 1D7QA 3IL8A 3E5SA 3OWFA 4F8MA 4P75A 2L0CA 1Z7TA 4NPSA 2JA5H 1VF7A 3HOYG 2L5TA 4OO1G 1N36Q 4LF9Q 4DNIA 5C4XH 1G51A 3CCJA 5T1IA 1L0XB 5BR8L 1VF5C 1YVCA 1MD2D 1BVSA 2EDGA 3S1NB 1XNQQ 1X65A 4X3SA 1STNA 1HHVA 1RODA 3A5UA 1HXYD 4NXNL 1UEBA 1VMCA 1RCVD 2JJQA 4CKEA 3MVVA 3JAMi 2VUMH 4IJLA 3HOZB 2F0NA 5C3EB 1E24A 5EGTA 4DV6L 3R2TA 5JPMC 4LF5Q 2XIWA 2MO1A 4M1UB 2NVTH 3NTHA 5F2DA 2A69C 4RHSA 4KD3A 1L0YB 1X6OA 3J81E 3I4NH 3HEJA 4RWSC 4BS9A 1A3UA 3S1QH 3BU2A 2VB3X 1AEXA 3DHQA 1I4HA 3UDXA 4EQNA 4I65A 1SNPA 2F0OA 4R4IA 3KF6B 3E9HA 1HFNA 3OTOL 2V1CC 1EY7A 4IUTA 4XYQA 3FMCA 1K8GA 1HR0W 2D62A 4DR5Q 1V1PB 4DUYL 1STEA 2IL8A 1Y1WG 1VQCA 1AW7A 4KKSA 1TWFH 4CKCA 3L3OC 3MXNA 3PO3H 3SK8A 1UE5A 2ZXRA 4OWWB 2NN6I 2MGSA 4LWCA 1LUZA 2NVXB 5JJIA 1RJTA 2M9VA 4IPDA 1GKHA 4GKKQ 4JI7Q 2ZJQA 2K75A 1HQMC 2F3VA 2Y0SE 2TSSA 1ZKOA 1Q86C 3M4QA 1Q1EA 1WTXA 2E2HH 1JJGA 2Z9HA 1JB7A 1A2TA 2GVAA 2XWBB 4WJWA 5CBEE 2QDLA 1JOQA 1D5MC 4A3JG 1I3QB 3S14H 2HCIA 3S16B 2YTYA 4A3EB 4DXGA 1IBKQ 1EUJA 2EYOA 5EKKA 1CM9A 3J7ZC 1QNKA 1Y1VG 3HOYH 3PV0A 4O42A 4OO1H 2UUCL 1JR0D 1Z47A 2Z6KA 3S17B 4DU9A 3OMCA 3F2DA 4Y7NH 3I4MB 4GZYC 3M4YA 4A3KB 4PQXA 2FINB 3KBGA 2XNAC 3U4ZA 3Q0AA 2JN4A 1LO5D 3S15B 1TWGH 4DV2Q 2R92G 2BH8A 1X3PA 3D3RA 5M5YH 3ERSX 2K5HA 4LFBL 4DR6L 1CZWA 2EYJA 2JYOA 1BOSA 1I6VC 1E2WA 1ENCA 1YJNA 4HCEA 4UDUC 4LF4L 4C3HB 4Q0FA 2ZM6L 3EA6A 1H95A 3PMFA 3SR1A 4BBRG 2CFMA 3HOVG 1KQSA 2D0OA 1ASYA 1HNXL 2EQSA 1V1QA 2F4VL 4Q5VA 4PZ8A 1N32L 1GUOA 4U673 4AYBG 3RLFA 1B2TA 1CSPA 5L37A 3EN2A 2L55A 1AZQA 3FP9A 4HSPA 2GVBA 1HNWL 4DV3L 1Y1WH 1S5ED 1PFBA 1QNUA 3KF8A 3CCRA 1UE1A 3GTPH 1HTLD 1CFMA 3SK4A 1JT8A 1QCBD 3QR8A 4LK1C 5D14A 3LWEA 3GTQB 3NPPA 4K0KL 3RLOA 2UXDL 2B8FA 2AQ1B 5E7NA 4ZK9B 3RZOH 3T51B 3L9AX 4ALPA 3DMUA 1QWYA 4HMJA 1SNMA 1VQ9A 3C2PA 3DWQA 1PH6A 4A3JH 3GTJB 3KLSA 2ATWA 2E5LQ 3MEHA 2KHSA 4RA8A 2EY6A 4YY3L 4DXFA 1K0RA 3MTSA 5LMNL 3GTKH 2PZTA 2OF1A 2A74C 1VQ4A 1IHZA 3UE0A 1Y1VH 2B2WA 3T4AC 5A2QE 3CC4A 3IFTA 5AJ3Q 2O4XA 3J81i 5C44G 3W1GA 2F0SA 1AN8A 1LLRD 2FFKB 2K5DA 4G7OC 4HIOA 3I73A 3OSOA 2DGYA 3CRLC 3QG1A 2R92H 4A3DB 5IT9c 1ICWA 4X66Q 4DPGA 2A6HD 4V190 2L15A 4PNYA 2OTLA 1I6HH 4R4TA 1PTOC 4HAEA 2B39A 2IHEA 1J9OA 1HFGA 1LTGD 2JP1A 5DAUA 4K6DA 5I9PA 4IQZA 1EZ6A 1HZ9A 2DUDA 4RH6A 4YCVA 1Q82C 4QUFA 5C4ZA 1A6XA 2JQOA 3BVZA 2Y0SB 3K5NA 2RCNA 2EJFC 1EIFA 4XT3B 3S24A 4BBRH 2UUAL 1VQHA 3HOVH 3GQBA 1TWAB 4CGYB 4LF7Q 1FGBD 3KLWA 1KRSA 4JOIC 2HDMA 3K7UC 2BE5C 1N9WA 4HJ7A 3RUZA 4X65L 3URYA 1XTCD 3KF6A 2F4IA 1VQLA 3MHBA 5BN4A 1IL8A 1RHPA 2D2CC 3ND9A 1V1PA 2ZM6Q 1E2ZA 4X64L 1EY5A 1OXVA 2EY5A 4C1NI 1LTBD 3ZJYC 4JI0L 3BYTB 5M5XB 2CH4A 3H94A 4XQQA 1H9SB 2TMPA 3Q6SA 1O7ZA 3MZ5A 2B2UA 2OCEA 3M4PA 4UP9A 5EBDA 5CV5A 3NHHA 2EOTA 3V2TA 3F8TA 4QIWB 2F0LA 1XMOQ 3CCUA 1VQFA 2VQFL 3QWNA 1UE6A 1XXGA 3TN2A 2QEXA 3M7NA 1FYCA 1SLJA 2PYKA 1YZ6A 5IYBG 4A3GB 1SR3A 4ZKCB 1HZAA 4DR7L 1F9PA 3N52A 1TS2A 3DM3A 1A0IA 4DV0L 4JI8Q 3MAQA 2CVRA 1BCPF 5C0XG 2A68D 5G3LD 2EE1A 3PQIA 1L2FA 2ASBA 1A15A 1B50A 4ZYSA 1XPOA 3S2HH 1F77A 1ZYRD 4GN4B 5D3DA 1D8LA 3BDOA 4OXPA 2M2LA 5C5MA 2XRQD 5LMUL 4JPBW 5IGFA 5C44H 4RGMA 1C7YA 1F2LA 4LW1A 4KV6A 5LL6S 4DV4Q 1EYGA 3CCVA 2JA9A 3NQIA 3HOWB 4U68A 1SYCA 1IZ6A 2NVQH 2VQEQ 3EQLC 3S1MB 1S72A 3JC66 3D0FA 4GOPC 3MFYA 5COYA 1E1TA 2YU9B 1G91A 1WTOA 2R7ZG 2K7VA 3RN5A 1PMRA 2LXKA 1I4QA 4NXML 3J80E 5BN3A 1K8AC 4DK1A 2EYHA 3H3VI 1FNWA 1G6PA 2RKSA 3M9BA 2XSCA 3FVQA 5C4HA 2AQ2B 2F52A 2UUBQ 1O80A 1QVFA 3G6JB 4FP5D 3KDFB 1YNND 3T1HL 2GA4B 3QOJA 1LM0A 5M3FG 3KFUA 3BVGA 2N8NA 1SNCA 1SYDA 2WB1E 4EX5A 4G57A 3IFDA 2HT1A 3NENA 5ELNA 1LT3D 3OWEB 2K5VA 2KA7A 4RGNA 1RTOA 2IW3A 5FLXE 2JEAI 1N33L 4A3CG 1GXDC 1BBXC 1D2BA 2PNHA 4JBWA 4C1NK 1MBYA 2SNSA 4RKBA 1BF4A 4OWTB 2I07B 1TVXA 4C3JB 3ULPA 1R9TH 4FF1A 4F87A 1E1OA 4PV1C 4LFCL 4LMQD 5C5LA 3A55A 2PCFB 3DUZA 2X6GA 1G291 1CKOA 1OO9B 4OEMB 2F0KA 1QJOA 4DAPA 2KHIA 2CQAA 5IYBH 3F1ZA 4FF2A 1HJPA 1E0BA 4A3IB 2R93G 4B9XA 1KHIA 1W2BA 1LYLA 2PQEA 1EY8A 4FF3A 3HP3A 3I70A 3M4OH 4QL5A 1KD1C 3ICEA 3LGJA 5CGKA 3PF5A 2YTVA 3HKSA 2NVYB 4K6LA 1IBML 1N36L 3HOXG 1TS3A 1DZ1A 4LF9L 3OW2A 2N55A 4A3BG 3FRPB 3EJIA 3PUVA 2B2VA 4DUZQ 2Q2UA 4DR7Q 3TP7A 2AMCB 3TDQA 1XNQL 4KN7C 2ZJRA 1RF2D 1UNSA 1EU3A 3MFGA 1WOCA 2VB2X 3I2ZA 3EBEA 3B6YA 3PGZA 1GHJA 3D8GA 4R4QA 4DV5Q 2R7ZH 2ZTCA 4JBKA 1T5EA 1QILA 3CHBD 4LF5L 2F03A 2KBNA 1DYQA 2QILA 2WKCA 4QGUA 4DR1Q 1EYCA 3K5MA 1DONA 1T5XD 2B2TC 3TRZA 5C0XJ 1FJGQ 3TZUA 1SAPA 3G6EA 4S3SA 2K5NA 3BZKA 3EVQA 3KUPA 5M3FH 2A6EC 1CA6A 1ESRA 1A3VA 4DR5L 4KLKA 4XIGS 5DEHA 5EBCA 2YV5A 1LTID 3GTOB 1V8QA 3I4OA 4KTAA 1D6EC 1IW7D 4BA2I 1WTHA 2JA8B 2IHFA 1WD1A 1H9SA 2XTIA 4IUPA 2ICEC 2IWHA 4GKKL 1BDOA 1QZGA 4A3CH 4JI7L 3S2DH 1U4MA 5GROA 3I72A 1V43A 2DN8A 5CV4A 2PI2A 1JJ2A 1TU2B 1IYJB 3I91A 1V9PA 4K5WA 1K83B 2PZWA 1QB5D 1JQYD 4CJ0B 1Z6HA 1S5FD 3UE1A 5M5WH 1KXLA 2RQXA 2R93H 3AYHB 1IBKL 2KEDA 3U9SA 3K80C 3HOZG 5C3EG 1BXTA 5C4XB 5DNFA 3J80i 4LFCQ 1YNJD 1S5CD 4Z9CB 1PTOB 3NELA 1CUKA 3HOXH 3MXUA 2UXBQ 1G8ZD 2IPKD 1PV4A 2WACA 1TT2A 4A3BH 1EQRA 3UI2A 1CKNB 1ZXTA 3PCOB 2WB1B 1U4RA 2BDNA 1TY0A 3HG9A 1V1OA 3VR3A 4DV2L 3M3YB 2MO0A 2E74C 2EIFA 4YCWA 1MI2A 1CQVA 1STAA 1LABA 3RLNA 4IUVA 1IBMQ 2B3GA 1CHPD 1PFMA 5ELDA 4HMIA 3BVMA 4NKLA 2IX3A 2RBMA 3GO5A 3D6WA 3A8IE 3NBHB 4B3RQ 4DV7Q 5JJLA 1VS0A 3S1QB 4IUUA 1TS4A 3KYHC 3OW7A 1U4LA 1C9OA 2NUCA 3KDFA 1QVCA 1RL2A 3V05A 4EVOA 4POFA 2QDBA 3K5LA 3L0OA 2R3ZA 4HJAA 2JA6B 4F88A 1SE3A 1I5FA 3DXJC 3IRBA 1M1KC 5IE8A 1BNZA 1YNXA 1SFOH 4A3EG 5I4DA 2HQEA 1SYBA 1XPRA 5HY6A 3CCMA 1STYA 4RFBA 1F9QA 3NSWA 1PYBA 4JW0A 2K6AA 3NE5B 2CW0C 3I4MG 1CZGA 4A3KG 1MJCA 2MP1A 1FR3A 4IPHA 3CMAA 1EIGA 4IFDI 2IX1A 2EYMA 1IKLA 2AHOB 4GLVB 4PG3A 4NMZA 3UDFA 3SVMA 1QE6A 5LHY1 1C4QA 4L5RC 3LWUA 5EKLA 4JI5Q 2E5LL 1WTPA 3H91A 4BBSB 1VQ8A 3NQTA 1B1ZA 2B63B 2E2JB 2L4NA 2EJGC 4ZLTF 1CT1D 5C3EH 3HOZH 4C3HG 4GOPB 4H44C 3RD4A 2LSSA 3MXPA 2FMMA 3ONAB 4G7HC 1C0AA 3TP5A 1OXUA 3NUCA 2ICIA 2F0DA 2CWAA 3CU7A 4DR3Q 1ET9A 5AJ3L 4EQOA 3RN2A 1L0WA 3RMHA 3TMEA 2G9HD 4RMFA 2PW5A 1PH7A 1SMYD 4PMBA 2JE6I 2UXCQ 1YIJA 4LF8Q 1BKBA 2KCNA 4P73A 3DM1A 4GN3B 4JVZA 4IPGA 2MUYA 3PIO3 3ND8A 4A93B 4X66L 1PRTB 1EY4A 3Q24A 2KCMA 3CRKC 1VCIA 2EY2A 2Z4IA 4DAMA 2KECA 4AH6A 2QA4A 1HNZQ 5CV7A 2YYZA 4L5SA 3TEHB 1TS5A 5G3LF 1GO3E 4FYDA 4K14A 2DNCA 4TQUS 4A3MB 3K7AB 5CR3A 2EZVA 2RHQB 3T16A 3W5OA 1CA5A 2NVXH 4B3TQ 2E2DC 2R61A 2VS1A 4JBMA 3OHXC 4LF7L 1RKNA 1XJVA 1B3QA 3OPOA 4P71A 3A7LA 1NSNS 2OQ0A 2N49A 4C2MB 3TP6A 1LT6D 2B2YC 4TVAB 1TWCB 4JBJA 3WDNA 4JI4Q 2R7DA 1AP0A 1CQFA 2K01A 2RDGA 1I3QH 1SXTA 3FKIB 5FOBB 3D4WA 3WOEA 1WTRA 2Q8RE 2E76C 3CCSA 4J1MA 1O7YA 3PIOA 3S16H 4IO9A 4X62Q 1KIXA 4A3EH 5DM63 4L8JA 1KAWA 2Q2HA 1O78A 2BOSA 5C4JB 1ZYRC 5A35A 5CBAE 1XMOL 4HJ9A 2DNEA 1PZID 5E1FA 2KUMA 1EFWA 1HZCA 1F9RA 5CMDA 2VNUD 3S17H 2RA4A 3I4LA 5EPKA 1YHAA 2HIVA 1QVGA 4A3KH 1J5EQ 1B4OA 2KQ3A 1H9RA 1LACA 3S15H 3A74A 5T1GA 4TSSA 4JI8L 4DK6C 2R7FA 4A3DG 4WORA 1B70B 1TQOA 4JC0A 3VR4A 3F2BA 1PZKD 5KIXA 1K28A 4QMGA 4Y52H 3CMEA 3A56A 5IP9G 2EPBA 4RGTA 4C3HH 1K8OA 2Y0SG 1HRJA 1MGSA 1EFID 3IAYA 4R8NA 2E75C 2AUKA 4DGZA 3VYRA 1IBLL 1CKNA 1L1OC 4MTNA 4RAUC 5C3WA 5IWAQ 4EQPA 4XTCS 4R4CA 4DV4L 4OONA 1EY9A 1I6HB 5KNDA 1E3PA 4DR4Q 2VQEL 3JAML 4JOIA 1STGA 3H6MA 4NW2A 2RDHA 1TY2A 2KCCA 2UU9Q 3STBD 3JAMc 1A62A 3NBHA 3PUXA 1RD9D 4ILWA 3ER0A 4DA2A 5ELBA 2A69D 2UUBL 2HD3A 2C35B 5FO9B 3GTQH 4ODGA 1IL2A 4XQJA 3BJUA 2CCZA 3ULLA 4HEDA 4A3GG 4LNQA 1D5ZC 1KDBA 1Y8PB 2F0VA 4GLAC 1K73C 5FO8B 3H0GB 3CP0A 3GTJH 4FO2A 4YIJA 1PDQA 3DEOA 5KNCA 3J7AV 5GADC 1O7LA 1I4GA 4V0BA 5CV6A 4YWKA 1H9KA 4HTHA 1DGSA 1SNOA 2N78A 1NMGA 5J3BA 3I8ZA 4YHHQ 1HQRD 1I94Q 1S40A 4GKJQ 1FL0A 1B9NA 3S1RB 5KRUA 1KTKA 3HOUB 1I50B 5JEAG 5M3MB 1S3OA 1NY4A 4JI1Q 4BWGB 3CC7A 3HOWG 1SROA 1WD0A 5JVG3 2LFNA 3DWAA 3SHLA 4A3DH 2B2WC 3H15A 4UY8C 2L11A 2FXQA 2AKWB 2SDFA 2M00A 2J4XA 2IJ0A 1U9RA 1GUGA 1IXRA 4A3FB 5AFWA 4GOPA 3PO2B 2F0PA 1WTVA 3CD6A 4DUZL 2EYPA 3TS2A 2K1BA 1E7ZA 1SJHD 1Q1BA 1TWAH 1C8CA 2JXMB 2A8VA 3NEMA 1KNEA 1K0SA 1DCZA 2WFWA 3FDTA 2ENBA 1AE2A 4FXGC 1ESFA 5FLMG 1Q8IA 5IGCA 4OIJA 2PZUA 2NTTA 2J7ZA 4ZAIA 5IODA 1VQEA 1HTPA 1LTSD 4QUCA 3H3VH 2BDOA 4CDDC 1GUNA 4DV5L 1YJWA 4CHTB 1A8VA 2RSOA 5GAEC 4IALA 2LY7A 3U4VA 2P5ZX 3D31A 1I4PA 1IBLQ 3K6OA 3V96A 4DR1L 1NAPA 4H02A 2CWPA 3L2PA 1Y14B 1M8AA 3K0XA 4XYOA 1BCPC 1FJGL 3QOLA 4C3JG 5I6WA 1EL0A 3GTGB 2F0QA 1VQ6A 1KLUD 2HQLA 2XWJB 4JYAQ 3X3MA 2JA7B 4C3IB 4A3LG 1SE4A 4G4KA 2YTXA 1VQAA 4E6IA 4A3GH 1Q46A 4I7ZC 1IKMA 4HIMA 3ITPA 3HKZE 4A3IG 1TR5A 4CDFC 2EXZA 1PRTF 2F1MA 1GUTA 1PVOA 2Q2IA 3I55A 1LTLA 1Q3LA 4A4IA 4WRDA 3RR5A 3GTMB 4POGA 2WAQE 3SXHA 3K5OA 3KLRA 3VYTA 4BY1B 4ZUIA 1AH9A 5I6YA 2EY1A 4K5XA 5KYLA 5IOCA 1HR0Q 1EWCA 4ZKBB 3K8AA 3OIQA 1UUPA 3C1FA 3HRZC 1VMPA 1EY0A 4KKUA 2IY5B 3AU7A 1Y69U 4KHVA 3HOWH 2C9OA 3SEBA 5FJ8G 1KABA 2G5DA 1JMCA 5KGUA 3S1MH 2QF7A 4FNFA 2YU9H 3VYUA 1SNDA 4QF4A 2PMZE 2SOBA 3P7JA 4LFAQ 1S5DD 2HCCA 3PIP3 4RKLA 2EVBA 1SJED 2UXBL 2WKDA 4F7XA 3HGBA 3J81L 1LV9A 1G2SA 2H4OA 1G6ZA 3SE0A 1JICA 1TWHB 1Y8NB 1YHQA 4OWXB 1X3FA 5C6AA 3BZCA 1JOKA 5C0XH 1LT5D 4IUNA 5EJWA 3KOJA 1JE4A 5JJKA 3GP7A 1MJEA 3J81c 4X6AH 5FLMH 2JEBI 2ZTDA 3J7AF 3U50C 1CK1A 3M85A 1TIID 4JI6Q 2JA8G 1E22A 4J8QA 5IT9E 2O5JC 4B3RL 4DV7L 2WP8J 2VW9A 4DAVA 5JEAJ 1NTGA 1ILQA 1GUSA 3AFPA 1NR2A 1GOZA 3DLLA 2F0UA 1K3RA 1CKMA 2EJMA 4DKAC 4C3JH 4GS3A 2BA0A 1ZEQX 2JK8A 1D1KA 2BE5D 4MN3A 1RTNA 3PIPA 4FVMA 2K14A 1GD7A 1ML0D 4JCVE 5HGQA 1DOLA 1YJ9A 3A54A 5EPLA 4A3LH 2E2IB 5IGEA 1U5KA 3AB9A 4H7BA 1MKHA 1ICFB 4A3IH 4IJHA 1T9HA 4IURA 1LTAD 4CDEC 1SBBB 4GN5A 3S2DB 3W1BA 1K3BC 2LXJA 1MIUA 3G7LA 5C4XG 1WCMB 2IT1A 4JI2Q 4DAYB 2NVYH 5IGBA 3EIVA 4FXKC 3AQQA 2NN6G 1HA6A 3MXGA 2MNAA 4IFDG 1ENFA 2EYLA 4K2KA 4RCOA 2I5MX 2AWOA 4BY7B 2WB1G 2A19A 1XWEA 3TS0A 3MWYW 4FF4A 2F0HA 1UAPA 3G4SA 2PW7A 1SYFA 4BA1I 3J7A5 2VUMG 1PH2A 1L1OB 4HSVA 3RZDB 3ULJA 5H1SE 1W6KA 4JI5L 2I0QA 3AMUA 1ONLA 1Q81C 5FJ8H 1B3AA 2B2VC 1SMXA 1WJJA 2PNRC 1PLFA 2QW7A 4GNXC 4B3MQ 4JV5Q 1B7YB 2L9HA 5KYIA 2ID0A 3SGIA 1NR4A 1TKWB 1SYGA 1J6QA 3IKJA 2AWNA 3GTLB 3CQZB 3HFZB 1LT4D 4DR3L 1PYSB 1C48A 1EY6A 3KJOA 2ZJPA 5J1ZA 4APVA 4ID6A 1VQ5A 2UXCL 2JA5B 4LF8L 1JORA 1SDFA 2PQAB 1WTWA 2B63H 3TZDA 1EOTA 3TSSA 3HKZB 4K2LA 1FGUA 2DY8A 2JA6G 1GJXA 1WVLA 4IN3A 1MSHA 2HUGA 3U58A 1HNZL 4MIUA 2QKIC 3GTOH 2HIXA 2Z6BA 3I3CA 1DXMA 3BG3A 4O0AA 4R1JA 2WAQB 2NYZD 1B44D 1EEID 2XGTA 5E4XA 2HHHQ 3FEWX 4LUZA 1KNAA 4B3TL 5IYDG 1DOKA 1SN8A 2G9DA 4MZ9A 1LTRD 2VUMB 4KJOA 1XMQQ 2A1AA 1PRTD 1TXYA 2ZTEA 4B9WA 2Z0SA 2SNMA 5DM73 2A73B 3SK5A 1K83H 1XNRQ 2NVTB 5IP7G 2L12A 3T1YQ 1JB3A 4A75A 4JI4L 4B3SQ 4DR2Q 3I4NB 4KY6A 4HJ5A 1JWMD 1R4QB 4X62L 1M90C 4BBSG 2B63G 2PMZB 1QOHA 3HZXA 1DOMA 1QG7A 1HCZA 3CC2A 1IYVA 1LTTD 4LF6L 3D4RA 4AQYQ 5HGTA 4CJ1B 4K8IA 5A2QL 5IIFA 5FKAC 1TWFB 1PTOH 1EEFD 4UPAA 3PUYA 3PO3B 1PH3A 1X32A 2NN6H 3VR6A 3K81C 5K5PA 4IFDH 5GAHC 3C3LA 1P16A 5JJZA 4CKBA 1J5EL 4RGOS 4KY7A 1XTDA 1E2VA 1M4VA 4R9WA 1VQKA 4JI3Q 3M3YH 4A93G 5HURA 5IGGA 4O2DA 5LMNW 2K05A 3D6CA 3T13A 2E2HB 3M7GA 1OXXK 3SK6A 1X3EA 1PA6A 3CCEA 5EKIA 3STBC 4ULLA 3UDGA 2CQOA 1HZBA 3ZYYX 4A3MG 3S14B 4AYBE 3S1NH 1EQVA 3W2DA 3PSIA 1F2ZA 4DFAA 2DJGC 5IWAL 2A6HC 5TSSA 3BS1A 1BCPB 1EWIA 2N88A 4DR4L 1N8RC 1KRTA 3HOYB 4TRDA 4EQ5A 3H09A 5I9OA 1ENAA 2JA6H 4OHJA 4QB4A 3FKIG 5GAGC 4Y7NB 1KAAA 1F2MA 4IFDJ 2UU9L 2CH4W 2B2YA 4N8X1 2RCFA 4UP8A 4CDCC 4IOCA 3GV3A 3R8BA 1TWGB 3E3XA 3Q22A 2EXDA 1GM5A 5M5YB 5CV9A 1BBUA 2RVLA 3BZDB 1GHKA 5IYDH 2FMCA 2E8GA 1KC8C 2Q8TA 2BA1A 1HH2P 4RCNA 2A6ED 1EOVA 5D65A 2C5CA 3R93A 2XVSA 4NP5A 5IP7H 4CBVA 5BN5A 3NK9A 3OMGA 1OXSC 1UWVA 4DV1Q 5I2YA 3VDYA 4OX9Q 2F0TA 5ELCA 1JE5A 4BBSH 2E2JH
chains in the Genus database with same CATH topology
1E1OA 2I5HA 3A0JA 1VQ7A 2BH2A 1DGSA 4LFCL 2N78A 1NMGA 5J3BA 4YHHQ 4QIWE 2PI2E 1I94Q 1G291 1CKOA 1S40A 4YHHL 4GKJQ 1FL0A 2OTJA 1I94L 4HJ8A 4GKJL 2KHIA 5IYBH 1Q12A 4HIKA 1PH9A 3F1ZA 3CQZH 2ES2A 5JEAG 1HJPA 3GTLH 1VQPA 1S3OA 4QQBX 1NY4A 4JI1Q 2R93G 3CW2C 1KHIA 3CC7A 3HOWG 4JI1L 1W2BA 1SROA 1LYLA 4P75A 1X55A 4A3DH 1L1OA 4NPSA 2JA5H 3M4OH 3H15A 4UY8C 4QL5A 1KD1C 3HOYG 2FXQA 2AKWB 3LGJA 4LUOA 3ICEA 4A93H 4LF6Q 4OO1G 1N36Q 3PF5A 2YTVA 3HKSA 2QGQA 1IBML 4LF9Q 4NB3A 4DNIA 1N36L 5BR8Q 5C4XH 1G51A 3HOXG 3CCJA 4LF9L 1IXRA 5BR8L 3OW2A 4GOPA 1YVCA 4OO1I 2MQHA 4A3BG 3PUVA 4DUZQ 2Q2UA 1BVSA 4DR7Q 3CD6A 4DUZL 3PUZA 2AMCB 1XNQQ 3I4MH 3CXCA 1X65A 3TS2A 1XNQL 4A3MH 3K7AH 3A5UA 1E7ZA 4NXNQ 3CF5A 3J80c 4NXNL 1UEBA 3J81j 2ZJRA 1Q1BA 1TWAH 2A8VA 2JJQA 3NEMA 4L5TA 1FVIA 4UP7A 1WOCA 2WFWA 3I2ZA 1AE2A 3JAMi 3EBEA 3B6YA 3PGZA 2VUMH 4IJLA 5FLMG 3CCQA 2PQAA 2Z6KC 4AIMA 4PZ7A 1E24A 4DV6Q 1YITA 4DV6L 1VQEA 4R4QA 4DV5Q 2R7ZH 4C2MH 2ZTCA 1PHJA 4JBKA 3H3VH 4DV5L 4LF5Q 1YJWA 4KHZA 1TWCH 1A8VA 2MO1A 4LF5L 2NVTH 3H0GG 2KBNA 5GAEC 1QUQA 3U4VA 2CKZB 3FKIH 3D31A 4QGUA 4DR1Q 2RHSB 2VL6A 1NBWA 1X6OA 1IBLQ 4DR1L 3I4NH 1OTCA 2K52A 4H02A 2CWPA 3S1QH 3L2PA 1Y14B 5C0XJ 3BU2A 1FJGQ 3TRZA 3K0XA 3AFQA 3UDXA 1FJGL 4R4OA 3G6EA 4R4IA 2K5NA 3BZKA 3KF6B 3E9HA 3OTOQ 5C4JH 1VQ6A 2HQLA 2V1CC 5FLXc 2K50A 3OTOL 4DUYQ 1K8GA 4JYAQ 5M3FH 1HR0W 2D62A 4DR5Q 1EIYB 4JYAL 4A3LG 4DUYL 1W3SA 1Y1WG 4DR5L 5IYCG 1VQCA 1VQAA 2YTXA 4KLKA 1TWFH 4XIGS 2YV5A 3PO3H 4A3GH 3HOUG 1UE5A 1Q46A 2KHJA 1WYDA 3I4OA 2NN6I 4HIMA 5M3MG 4OWWB 3I56A 4LWCA 1LUZA 3HKZE 4A3IG 4BA2I 2R6GA 5JJIA 1VQIA 2IHFA 4IPDA 1Q8KA 1GKHA 4GKKQ 1PVOA 2XTIA 3PF4A 4JI7Q 2ZJQA 2K75A 2Q2IA 1QZGA 3I55A 4GKKL 1LTLA 4A3CH 4YWLA 2Y0SE 5GROA 4JI7L 3S2DH 2KENA 4A4IA 1Q86C 1V43A 3RR5A 3M4QA 1Q1EA 4POGA 2PI2A 2WAQE 1JJ2A 2E2HH 1JJGA 1IYJB 4A3FG 1JB7A 1AH9A 3WWVA 3PO2G 1V9PA 2GVAA 1SRUA 1HR0Q 4GNXB 5K36G 3K8AA 1HR0L 4A3JG 2RF4A 3S14H 4DK3C 2YTYA 4MNOA 3G71A 3UE1A 5M5WH 1KXLA 1IBKQ 2IY5B 2R93H 1EUJA 3AYHB 3HOWH 1IBKL 4ME3A 3K80C 5FJ8G 3HOZG 3J7ZC 5C3EG 1JMCA 3S1MH 2I5LX 1NJIC 2YU9H 3J80i 1Y1VG 3HOYH 1AE3A 2UUCQ 3PV0A 4LFCQ 2UUCL 1X3GA 3NELA 1Z47A 3GD7A 1QZHA 2Z6KA 1CUKA 2PMZE 3HOXH 1ASZA 2OQKA 4LFAQ 2UXBQ 3F2DA 4Y7NH 1PV4A 1UE7A 4LFAL 2UXBL 4A3BH 1PFSA 1EQRA 2H5XA 1CKNB 3U4ZA 3PCOB 1TWGH 4LUVA 1YHQA 4DV2Q 4OWXB 3TREA 1X3FA 2R92G 3BZCA 2OWOA 2BH8A 4DV2L 4LFBQ 4DR6Q 2MO0A 3ERSX 2EIFA 5M5YH 2K5HA 3MEFA 4LFBL 4YCWA 4DR6L 3KOJA 2JA7G 3RLNA 5JJKA 3E9IA 1MJEA 2VY3A 1Z9FA 3J81c 4X6AH 1IBMQ 4GLXA 5FLMH 4LF4Q 2B3GA 2JEBI 2ZTDA 1YJNA 3U50C 4LF4L 2ZM6L 3M85A 5IP9H 1H95A 4BBRG 3GO5A 2CFMA 3HOVG 4JI6Q 3NBHB 4B3RQ 4DV7Q 2JA8G 1E22A 4JI6L 5JJLA 4B3RL 3H0GH 2D0OA 4DV7L 1KQSA 1VS0A 2WP8J 2VW9A 1HNXQ 1ASYA 1HNXL 5JEAJ 2EQSA 1NTGA 2F4VQ 3KYHC 1Q7YC 1N32Q 1V1QA 2F4VL 2IX0A 3AFPA 4PZ8A 1C9OA 3DLLA 1N32L 1VQBA 3KDFA 1K3RA 3CCLA 1QVCA 1CKMA 4YWMA 4AYBG 4QJFA 1RL2A 3RLFA 4C3JH 4GS3A 1VQDA 2BA0A 4BY1G 2JK8A 1CSPA 1D7QA 1X56A 3PIPA 3EN2A 4POFA 2K14A 1GD7A 3FP9A 3L0OA 1HNWQ 4DV3Q 4JCVE 4HJAA 1YBYA 5HGQA 2GVBA 1YJ9A 4DV3L 4A3LH 1HNWL 1I5FA 1Y1WH 5IYCH 3IRBA 3S1RH 1M1KC 5IE8A 1N34L 1U5KA 1YNXA 3HOUH 1I50H 5M5XH 3CCRA 1SFOH 1UE1A 3GTPH 5M3MH 4A3EG 1MKHA 4A3IH 4IJHA 1T9HA 1XPRA 1PH5A 1JT8A 4GN5A 4WJ4A 3W1BA 5HY6A 3CCMA 1EQQA 4K0KQ 2LXJA 1MIUA 4K0KL 5C4XG 2UXDQ 2IT1A 4JI2Q 3RLOA 2UXDL 4JI2L 4DAYB 2NVYH 5E7NA 1PYBA 2NZHA 3RZOH 3EIVA 2F3IA 3AQQA 4A3FH 1NE3A 2NN6G 4ALPA 3I4MG 2MNAA 4IFDG 4A3KG 3PO2H 1MJCA 1PH1A 4IPHA 3CMAA 1VQ9A 2I5MX 2AWOA 2WB1G 2A19A 1PH6A 4IFDI 3TS0A 2IX1A 2K4KA 4P72A 4A3JH 3G4SA 2AHOB 4GLVB 2ATWA 4PG3A 3UDFA 4BA1I 3J7A5 2VUMG 1YEZA 1PH2A 1L1OB 4L5RC 2E5LQ 4JI5Q 2E5LL 3ULJA 5H1SE 1WFQA 4JI5L 1VQ8A 2I0QA 4YY3Q 1Q81C 5FJ8H 5LMNQ 3HOZH 4YY3L 5C3EH 1SMXA 1K0RA 1WJJA 3UDIA 5LMNL 4GOPB 3GTKH 2LSSA 4GNXC 4B3MQ 1VQ4A 3AEVA 1KL9A 3UE0A 1Y1VH 4JV5Q 1B7YB 4B3ML 1PH8A 2ID0A 3SGIA 4JV5L 3A5ZB 1C0AA 3CC4A 1OXUA 1XPUA 5AJ3Q 3J81i 1J6QA 2CWAA 2AWNA 5C44G 3W1GA 4DR3Q 5AJ3L 3HFZB 1VQNA 4DR3L 3RN2A 1PYSB 1L0WA 3KJOA 2ZJPA 4L5QA 4RMFA 4APVA 4HIOA 1PH7A 2DGYA 2JE6I 2UXCQ 1YIJA 2NZOA 1VQ5A 4LF8Q 2R92H 1BKBA 2UXCL 5IT9c 4P73A 4GN3B 4DPGA 4X66Q 4LF8L 2PQAB 2L15A 4IPGA 2OTLA 1NMFA 2B63H 4X66L 1I6HH 3GTGH 4R4TA 2KCMA 1FGUA 2IHEA 1VCIA 2JA7H 2VZAA 4C3IH 2JA6G 4DAMA 2DUDA 1HZ9A 3U58A 4KI0A 4YCVA 4AH6A 1Q82C 4KHPL 2QA4A 1HNZQ 1O7IA 2JQOA 2YYZA 1VQOA 4L5SA 3TEHB 1HNZL 3GTOH 2D0PA 1JJCB 2HIXA 2RCNA 2UUAQ 1EIFA 3S24A 1GO3E 4BBRH 4FDBA 1VQHA 4O0AA 4R1JA 4TQUS 3RNUA 2UUAL 2NVXH 2RHQB 3W5OA 2XGTA 3HOVH 2HHHQ 4B3TQ 1PH4A 4LUZA 2HHHL 4B3TL 4LF7Q 4JBMA 2VS1A 5IYDG 1SN8A 4LF7L 3KLWA 4IOAA 1WCMG 1KRSA 1XJVA 4MZ9A 4JOIC 4X65Q 3K7UC 4HJ7A 1N9WA 1XMQQ 2A1AA 3GTMH 4P71A 4X65L 1XMQL 2ZTEA 1TXYA 3CAMA 2Z0SA 3KF6A 4BY1H 2OQ0A 1VQLA 2N49A 4HIDA 3MXNB 4X64Q 2ZM6Q 4TVAB 4X64L 1OXVA 1K83H 1XNRQ 4JBJA 5IP7G 4JI0Q 2R7DA 4JI4Q 4BY7G 3T1YQ 3ZJYC 4A75A 4JI0L 1XNRL 4JI4L 2MFIA 3T1YL 1I3QH 3OYYA 4B3SQ 4DR2Q 3CCSA 3S16H 3PIOA 4B3SL 1X54A 4HJ5A 2OCEA 4IO9A 3M4PA 4X62Q 3CPWA 4DR2L 2KCTA 1KIXA 4UP9A 4X62L 4A3EH 1M90C 4BBSG 1KAWA 1BBWA 2Q2HA 3F8TA 2B63G 4BXXG 1X9NA 2VQFQ 1XMOQ 3FHWA 3CCUA 1VQFA 2GN5A 3CPFA 2VQFL 3CC2A 1XMOL 4LF6L 1VQGA 4AQYQ 1U0LA 2ALYB 4HJ9A 1UE6A 4IPCA 3G48A 4AQYL 3GDEA 2QEXA 3M7NA 3KJPA 4QY7A 1SLJA 4RG1A 1HZCA 1YZ6A 4UPAA 1EFWA 3PUYA 2VNUD 3S17H 5IYBG 1A63A 1PH3A 1SR3A 1YHAA 2HIVA 1QVGA 4GNXA 1HZAA 3K81C 4DR7L 5GAHC 3DM3A 1N34Q 1P16A 4DKAC 3F2CA 4DV0Q 4A3KH 1J5EQ 4WJ3M 1A0IA 4DV0L 4JI8Q 3S15H 3A74A 1J5EL 5C0XG 4JI8L 4DK6C 1TWHH 1XTDA 2R7FA 4A3DG 2JA5G 1VQKA 1B70B 4JI3Q 3M3YH 4JC0A 3F2BA 1VQMA 4A93G 5C0XI 3Q8DA 4JI3L 3HKZG 1L2FA 4O2DA 5LMNW 2ASBA 1P8LA 4Y52H 3CMEA 1OXXK 1K9MC 1X3EA 1XPOA 2Q2TA 1PA6A 3E0EA 5IP9G 3S2HH 3CCEA 4GN4B 4YCUA 1OXTA 1D8LA 3STBC 4C3HH 4OXPA 2Y0SG 1WI5A 1SE8A 5LMUQ 1GVPA 3UDGA 2CQOA 1HZBA 3PUWA 5LMUL 2WAQG 4A3MG 4AYBE 3S1NH 3PSIA 2N3SA 4A76A 1YI2A 5C44H 1CKNA 1IBLL 1L1OC 4MTNA 5IWAQ 1C7YA 4LW1A 4DV4Q 5IWAL 1EYGA 4XTCS 3CCVA 2JA9A 4R4CA 4DV4L 4OONA 1IZ6A 2NVQH 2VQEQ 1E3PA 1S72A 4DR4Q 1CSQA 3JC66 2VQEL 3D0FA 4GOPC 1EWIA 4DR4L 1E1TA 1N8RC 2R7ZG 1KRTA 4EQ5A 4JOIA 2LXKA 3RN5A 4NXMQ 4NXML 1K8AC 2JA6H 2E2IH 3H3VI 2UU9Q 3FKIG 5GAGC 4IFDJ 3STBD 2UU9L 1G6PA 3M9BA 2B29A 3I4NG 3JAMc 1A62A 3L7ZC 5GQOA 3PUXA 4UP8A 4PMWA 3ER0A 4IOCA 3I7FA 1YHBA 2F52A 3T1HQ 3TQYA 5EAYA 2UUBQ 1QVFA 3T1HL 3KDFB 2EXDA 1GM5A 2UUBL 2C35B 4PZ6A 1BBUA 3GTQH 1IL2A 5IYDH 1LM0A 5M3FG 3KFUA 1WCMH 2N8NA 2E8GA 1KC8C 3BJUA 2BA1A 2WB1E 2CCZA 3ULLA 1HH2P 4EX5A 5ELOA 4KHPQ 3PO3G 4A3GG 2HT1A 4LNQA 1EOVA 3NENA 4P74A 5ELNA 1K73C 4GLAC 1RIPA 4J15A 1QUQB 3KF8B 5DLQE 4JG2A 5IP7H 2K5VA 4BY7H 3CP0A 5IY0A 1N33Q 1B8AA 3GTJH 2JEAI 1OXSC 1UWVA 1N33L 2JA8H 4DV1Q 4A3CG 1VQJA 3VDYA 2PNHA 4JBWA 5GADC 4DV1L 4OX9Q 3RZDH 4OX9L 4OWTB 1JE5A 4BBSH 1R9TH 3ULPA 4BXXH 2E2JH 4YWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E1O A;  2I5H A;  3A0J A;  1VQ7 A;  2BH2 A;  1DGS A;  4LFC L;  2N78 A;  1NMG A;  5J3B A;  4YHH Q;  4QIW E;  2PI2 E;  1I94 Q;  1G29 1;  1CKO A;  1S40 A;  4YHH L;  4GKJ Q;  1FL0 A;  2OTJ A;  1I94 L;  4HJ8 A;  4GKJ L;  2KHI A;  5IYB H;  1Q12 A;  4HIK A;  1PH9 A;  3F1Z A;  3CQZ H;  2ES2 A;  5JEA G;  1HJP A;  3GTL H;  1VQP A;  1S3O A;  4QQB X;  1NY4 A;  4JI1 Q;  2R93 G;  3CW2 C;  1KHI A;  3CC7 A;  3HOW G;  4JI1 L;  1W2B A;  1SRO A;  1LYL A;  4P75 A;  1X55 A;  4A3D H;  1L1O A;  4NPS A;  2JA5 H;  3M4O H;  3H15 A;  4UY8 C;  4QL5 A;  1KD1 C;  3HOY G;  2FXQ A;  2AKW B;  3LGJ A;  4LUO A;  3ICE A;  4A93 H;  4LF6 Q;  4OO1 G;  1N36 Q;  3PF5 A;  2YTV A;  3HKS A;  2QGQ A;  1IBM L;  4LF9 Q;  4NB3 A;  4DNI A;  1N36 L;  5BR8 Q;  5C4X H;  1G51 A;  3HOX G;  3CCJ A;  4LF9 L;  1IXR A;  5BR8 L;  3OW2 A;  4GOP A;  1YVC A;  4OO1 I;  2MQH A;  4A3B G;  3PUV A;  4DUZ Q;  2Q2U A;  1BVS A;  4DR7 Q;  3CD6 A;  4DUZ L;  3PUZ A;  2AMC B;  1XNQ Q;  3I4M H;  3CXC A;  1X65 A;  3TS2 A;  1XNQ L;  4A3M H;  3K7A H;  3A5U A;  1E7Z A;  4NXN Q;  3CF5 A;  3J80 c;  4NXN L;  1UEB A;  3J81 j;  2ZJR A;  1Q1B A;  1TWA H;  2A8V A;  2JJQ A;  3NEM A;  4L5T A;  1FVI A;  4UP7 A;  1WOC A;  2WFW A;  3I2Z A;  1AE2 A;  3JAM i;  3EBE A;  3B6Y A;  3PGZ A;  2VUM H;  4IJL A;  5FLM G;  3CCQ A;  2PQA A;  2Z6K C;  4AIM A;  4PZ7 A;  1E24 A;  4DV6 Q;  1YIT A;  4DV6 L;  1VQE A;  4R4Q A;  4DV5 Q;  2R7Z H;  4C2M H;  2ZTC A;  1PHJ A;  4JBK A;  3H3V H;  4DV5 L;  4LF5 Q;  1YJW A;  4KHZ A;  1TWC H;  1A8V A;  2MO1 A;  4LF5 L;  2NVT H;  3H0G G;  2KBN A;  5GAE C;  1QUQ A;  3U4V A;  2CKZ B;  3FKI H;  3D31 A;  4QGU A;  4DR1 Q;  2RHS B;  2VL6 A;  1NBW A;  1X6O A;  1IBL Q;  4DR1 L;  3I4N H;  1OTC A;  2K52 A;  4H02 A;  2CWP A;  3S1Q H;  3L2P A;  1Y14 B;  5C0X J;  3BU2 A;  1FJG Q;  3TRZ A;  3K0X A;  3AFQ A;  3UDX A;  1FJG L;  4R4O A;  3G6E A;  4R4I A;  2K5N A;  3BZK A;  3KF6 B;  3E9H A;  3OTO Q;  5C4J H;  1VQ6 A;  2HQL A;  2V1C C;  5FLX c;  2K50 A;  3OTO L;  4DUY Q;  1K8G A;  4JYA Q;  5M3F H;  1HR0 W;  2D62 A;  4DR5 Q;  1EIY B;  4JYA L;  4A3L G;  4DUY L;  1W3S A;  1Y1W G;  4DR5 L;  5IYC G;  1VQC A;  1VQA A;  2YTX A;  4KLK A;  1TWF H;  4XIG S;  2YV5 A;  3PO3 H;  4A3G H;  3HOU G;  1UE5 A;  1Q46 A;  2KHJ A;  1WYD A;  3I4O A;  2NN6 I;  4HIM A;  5M3M G;  4OWW B;  3I56 A;  4LWC A;  1LUZ A;  3HKZ E;  4A3I G;  4BA2 I;  2R6G A;  5JJI A;  1VQI A;  2IHF A;  4IPD A;  1Q8K A;  1GKH A;  4GKK Q;  1PVO A;  2XTI A;  3PF4 A;  4JI7 Q;  2ZJQ A;  2K75 A;  2Q2I A;  1QZG A;  3I55 A;  4GKK L;  1LTL A;  4A3C H;  4YWL A;  2Y0S E;  5GRO A;  4JI7 L;  3S2D H;  2KEN A;  4A4I A;  1Q86 C;  1V43 A;  3RR5 A;  3M4Q A;  1Q1E A;  4POG A;  2PI2 A;  2WAQ E;  1JJ2 A;  2E2H H;  1JJG A;  1IYJ B;  4A3F G;  1JB7 A;  1AH9 A;  3WWV A;  3PO2 G;  1V9P A;  2GVA A;  1SRU A;  1HR0 Q;  4GNX B;  5K36 G;  3K8A A;  1HR0 L;  4A3J G;  2RF4 A;  3S14 H;  4DK3 C;  2YTY A;  4MNO A;  3G71 A;  3UE1 A;  5M5W H;  1KXL A;  1IBK Q;  2IY5 B;  2R93 H;  1EUJ A;  3AYH B;  3HOW H;  1IBK L;  4ME3 A;  3K80 C;  5FJ8 G;  3HOZ G;  3J7Z C;  5C3E G;  1JMC A;  3S1M H;  2I5L X;  1NJI C;  2YU9 H;  3J80 i;  1Y1V G;  3HOY H;  1AE3 A;  2UUC Q;  3PV0 A;  4LFC Q;  2UUC L;  1X3G A;  3NEL A;  1Z47 A;  3GD7 A;  1QZH A;  2Z6K A;  1CUK A;  2PMZ E;  3HOX H;  1ASZ A;  2OQK A;  4LFA Q;  2UXB Q;  3F2D A;  4Y7N H;  1PV4 A;  1UE7 A;  4LFA L;  2UXB L;  4A3B H;  1PFS A;  1EQR A;  2H5X A;  1CKN B;  3U4Z A;  3PCO B;  1TWG H;  4LUV A;  1YHQ A;  4DV2 Q;  4OWX B;  3TRE A;  1X3F A;  2R92 G;  3BZC A;  2OWO A;  2BH8 A;  4DV2 L;  4LFB Q;  4DR6 Q;  2MO0 A;  3ERS X;  2EIF A;  5M5Y H;  2K5H A;  3MEF A;  4LFB L;  4YCW A;  4DR6 L;  3KOJ A;  2JA7 G;  3RLN A;  5JJK A;  3E9I A;  1MJE A;  2VY3 A;  1Z9F A;  3J81 c;  4X6A H;  1IBM Q;  4GLX A;  5FLM H;  4LF4 Q;  2B3G A;  2JEB I;  2ZTD A;  1YJN A;  3U50 C;  4LF4 L;  2ZM6 L;  3M85 A;  5IP9 H;  1H95 A;  4BBR G;  3GO5 A;  2CFM A;  3HOV G;  4JI6 Q;  3NBH B;  4B3R Q;  4DV7 Q;  2JA8 G;  1E22 A;  4JI6 L;  5JJL A;  4B3R L;  3H0G H;  2D0O A;  4DV7 L;  1KQS A;  1VS0 A;  2WP8 J;  2VW9 A;  1HNX Q;  1ASY A;  1HNX L;  5JEA J;  2EQS A;  1NTG A;  2F4V Q;  3KYH C;  1Q7Y C;  1N32 Q;  1V1Q A;  2F4V L;  2IX0 A;  3AFP A;  4PZ8 A;  1C9O A;  3DLL A;  1N32 L;  1VQB A;  3KDF A;  1K3R A;  3CCL A;  1QVC A;  1CKM A;  4YWM A;  4AYB G;  4QJF A;  1RL2 A;  3RLF A;  4C3J H;  4GS3 A;  1VQD A;  2BA0 A;  4BY1 G;  2JK8 A;  1CSP A;  1D7Q A;  1X56 A;  3PIP A;  3EN2 A;  4POF A;  2K14 A;  1GD7 A;  3FP9 A;  3L0O A;  1HNW Q;  4DV3 Q;  4JCV E;  4HJA A;  1YBY A;  5HGQ A;  2GVB A;  1YJ9 A;  4DV3 L;  4A3L H;  1HNW L;  1I5F A;  1Y1W H;  5IYC H;  3IRB A;  3S1R H;  1M1K C;  5IE8 A;  1N34 L;  1U5K A;  1YNX A;  3HOU H;  1I50 H;  5M5X H;  3CCR A;  1SFO H;  1UE1 A;  3GTP H;  5M3M H;  4A3E G;  1MKH A;  4A3I H;  4IJH A;  1T9H A;  1XPR A;  1PH5 A;  1JT8 A;  4GN5 A;  4WJ4 A;  3W1B A;  5HY6 A;  3CCM A;  1EQQ A;  4K0K Q;  2LXJ A;  1MIU A;  4K0K L;  5C4X G;  2UXD Q;  2IT1 A;  4JI2 Q;  3RLO A;  2UXD L;  4JI2 L;  4DAY B;  2NVY H;  5E7N A;  1PYB A;  2NZH A;  3RZO H;  3EIV A;  2F3I A;  3AQQ A;  4A3F H;  1NE3 A;  2NN6 G;  4ALP A;  3I4M G;  2MNA A;  4IFD G;  4A3K G;  3PO2 H;  1MJC A;  1PH1 A;  4IPH A;  3CMA A;  1VQ9 A;  2I5M X;  2AWO A;  2WB1 G;  2A19 A;  1PH6 A;  4IFD I;  3TS0 A;  2IX1 A;  2K4K A;  4P72 A;  4A3J H;  3G4S A;  2AHO B;  4GLV B;  2ATW A;  4PG3 A;  3UDF A;  4BA1 I;  3J7A 5;  2VUM G;  1YEZ A;  1PH2 A;  1L1O B;  4L5R C;  2E5L Q;  4JI5 Q;  2E5L L;  3ULJ A;  5H1S E;  1WFQ A;  4JI5 L;  1VQ8 A;  2I0Q A;  4YY3 Q;  1Q81 C;  5FJ8 H;  5LMN Q;  3HOZ H;  4YY3 L;  5C3E H;  1SMX A;  1K0R A;  1WJJ A;  3UDI A;  5LMN L;  4GOP B;  3GTK H;  2LSS A;  4GNX C;  4B3M Q;  1VQ4 A;  3AEV A;  1KL9 A;  3UE0 A;  1Y1V H;  4JV5 Q;  1B7Y B;  4B3M L;  1PH8 A;  2ID0 A;  3SGI A;  4JV5 L;  3A5Z B;  1C0A A;  3CC4 A;  1OXU A;  1XPU A;  5AJ3 Q;  3J81 i;  1J6Q A;  2CWA A;  2AWN A;  5C44 G;  3W1G A;  4DR3 Q;  5AJ3 L;  3HFZ B;  1VQN A;  4DR3 L;  3RN2 A;  1PYS B;  1L0W A;  3KJO A;  2ZJP A;  4L5Q A;  4RMF A;  4APV A;  4HIO A;  1PH7 A;  2DGY A;  2JE6 I;  2UXC Q;  1YIJ A;  2NZO A;  1VQ5 A;  4LF8 Q;  2R92 H;  1BKB A;  2UXC L;  5IT9 c;  4P73 A;  4GN3 B;  4DPG A;  4X66 Q;  4LF8 L;  2PQA B;  2L15 A;  4IPG A;  2OTL A;  1NMF A;  2B63 H;  4X66 L;  1I6H H;  3GTG H;  4R4T A;  2KCM A;  1FGU A;  2IHE A;  1VCI A;  2JA7 H;  2VZA A;  4C3I H;  2JA6 G;  4DAM A;  2DUD A;  1HZ9 A;  3U58 A;  4KI0 A;  4YCV A;  4AH6 A;  1Q82 C;  4KHP L;  2QA4 A;  1HNZ Q;  1O7I A;  2JQO A;  2YYZ A;  1VQO A;  4L5S A;  3TEH B;  1HNZ L;  3GTO H;  2D0P A;  1JJC B;  2HIX A;  2RCN A;  2UUA Q;  1EIF A;  3S24 A;  1GO3 E;  4BBR H;  4FDB A;  1VQH A;  4O0A A;  4R1J A;  4TQU S;  3RNU A;  2UUA L;  2NVX H;  2RHQ B;  3W5O A;  2XGT A;  3HOV H;  2HHH Q;  4B3T Q;  1PH4 A;  4LUZ A;  2HHH L;  4B3T L;  4LF7 Q;  4JBM A;  2VS1 A;  5IYD G;  1SN8 A;  4LF7 L;  3KLW A;  4IOA A;  1WCM G;  1KRS A;  1XJV A;  4MZ9 A;  4JOI C;  4X65 Q;  3K7U C;  4HJ7 A;  1N9W A;  1XMQ Q;  2A1A A;  3GTM H;  4P71 A;  4X65 L;  1XMQ L;  2ZTE A;  1TXY A;  3CAM A;  2Z0S A;  3KF6 A;  4BY1 H;  2OQ0 A;  1VQL A;  2N49 A;  4HID A;  3MXN B;  4X64 Q;  2ZM6 Q;  4TVA B;  4X64 L;  1OXV A;  1K83 H;  1XNR Q;  4JBJ A;  5IP7 G;  4JI0 Q;  2R7D A;  4JI4 Q;  4BY7 G;  3T1Y Q;  3ZJY C;  4A75 A;  4JI0 L;  1XNR L;  4JI4 L;  2MFI A;  3T1Y L;  1I3Q H;  3OYY A;  4B3S Q;  4DR2 Q;  3CCS A;  3S16 H;  3PIO A;  4B3S L;  1X54 A;  4HJ5 A;  2OCE A;  4IO9 A;  3M4P A;  4X62 Q;  3CPW A;  4DR2 L;  2KCT A;  1KIX A;  4UP9 A;  4X62 L;  4A3E H;  1M90 C;  4BBS G;  1KAW A;  1BBW A;  2Q2H A;  3F8T A;  2B63 G;  4BXX G;  1X9N A;  2VQF Q;  1XMO Q;  3FHW A;  3CCU A;  1VQF A;  2GN5 A;  3CPF A;  2VQF L;  3CC2 A;  1XMO L;  4LF6 L;  1VQG A;  4AQY Q;  1U0L A;  2ALY B;  4HJ9 A;  1UE6 A;  4IPC A;  3G48 A;  4AQY L;  3GDE A;  2QEX A;  3M7N A;  3KJP A;  4QY7 A;  1SLJ A;  4RG1 A;  1HZC A;  1YZ6 A;  4UPA A;  1EFW A;  3PUY A;  2VNU D;  3S17 H;  5IYB G;  1A63 A;  1PH3 A;  1SR3 A;  1YHA A;  2HIV A;  1QVG A;  4GNX A;  1HZA A;  3K81 C;  4DR7 L;  5GAH C;  3DM3 A;  1N34 Q;  1P16 A;  4DKA C;  3F2C A;  4DV0 Q;  4A3K H;  1J5E Q;  4WJ3 M;  1A0I A;  4DV0 L;  4JI8 Q;  3S15 H;  3A74 A;  1J5E L;  5C0X G;  4JI8 L;  4DK6 C;  1TWH H;  1XTD A;  2R7F A;  4A3D G;  2JA5 G;  1VQK A;  1B70 B;  4JI3 Q;  3M3Y H;  4JC0 A;  3F2B A;  1VQM A;  4A93 G;  5C0X I;  3Q8D A;  4JI3 L;  3HKZ G;  1L2F A;  4O2D A;  5LMN W;  2ASB A;  1P8L A;  4Y52 H;  3CME A;  1OXX K;  1K9M C;  1X3E A;  1XPO A;  2Q2T A;  1PA6 A;  3E0E A;  5IP9 G;  3S2H H;  3CCE A;  4GN4 B;  4YCU A;  1OXT A;  1D8L A;  3STB C;  4C3H H;  4OXP A;  2Y0S G;  1WI5 A;  1SE8 A;  5LMU Q;  1GVP A;  3UDG A;  2CQO A;  1HZB A;  3PUW A;  5LMU L;  2WAQ G;  4A3M G;  4AYB E;  3S1N H;  3PSI A;  2N3S A;  4A76 A;  1YI2 A;  5C44 H;  1CKN A;  1IBL L;  1L1O C;  4MTN A;  5IWA Q;  1C7Y A;  4LW1 A;  4DV4 Q;  5IWA L;  1EYG A;  4XTC S;  3CCV A;  2JA9 A;  4R4C A;  4DV4 L;  4OON A;  1IZ6 A;  2NVQ H;  2VQE Q;  1E3P A;  1S72 A;  4DR4 Q;  1CSQ A;  3JC6 6;  2VQE L;  3D0F A;  4GOP C;  1EWI A;  4DR4 L;  1E1T A;  1N8R C;  2R7Z G;  1KRT A;  4EQ5 A;  4JOI A;  2LXK A;  3RN5 A;  4NXM Q;  4NXM L;  1K8A C;  2JA6 H;  2E2I H;  3H3V I;  2UU9 Q;  3FKI G;  5GAG C;  4IFD J;  3STB D;  2UU9 L;  1G6P A;  3M9B A;  2B29 A;  3I4N G;  3JAM c;  1A62 A;  3L7Z C;  5GQO A;  3PUX A;  4UP8 A;  4PMW A;  3ER0 A;  4IOC A;  3I7F A;  1YHB A;  2F52 A;  3T1H Q;  3TQY A;  5EAY A;  2UUB Q;  1QVF A;  3T1H L;  3KDF B;  2EXD A;  1GM5 A;  2UUB L;  2C35 B;  4PZ6 A;  1BBU A;  3GTQ H;  1IL2 A;  5IYD H;  1LM0 A;  5M3F G;  3KFU A;  1WCM H;  2N8N A;  2E8G A;  1KC8 C;  3BJU A;  2BA1 A;  2WB1 E;  2CCZ A;  3ULL A;  1HH2 P;  4EX5 A;  5ELO A;  4KHP Q;  3PO3 G;  4A3G G;  2HT1 A;  4LNQ A;  1EOV A;  3NEN A;  4P74 A;  5ELN A;  1K73 C;  4GLA C;  1RIP A;  4J15 A;  1QUQ B;  3KF8 B;  5DLQ E;  4JG2 A;  5IP7 H;  2K5V A;  4BY7 H;  3CP0 A;  5IY0 A;  1N33 Q;  1B8A A;  3GTJ H;  2JEA I;  1OXS C;  1UWV A;  1N33 L;  2JA8 H;  4DV1 Q;  4A3C G;  1VQJ A;  3VDY A;  2PNH A;  4JBW A;  5GAD C;  4DV1 L;  4OX9 Q;  3RZD H;  4OX9 L;  4OWT B;  1JE5 A;  4BBS H;  1R9T H;  3ULP A;  4BXX H;  2E2J H;  4YWK A; 
#chains in the Genus database with same CATH topology
 4ZCK A;  4IUQ A;  4DAY A;  1I4X A;  2K33 A;  4QIW E;  2FHT A;  2PI2 E;  1Y1W B;  4YHH L;  1I94 L;  4GKJ L;  3K58 A;  1Q12 A;  4EGV A;  1PH9 A;  2A68 C;  3VYS A;  3GTP B;  1VQP A;  4QQB X;  3CW2 C;  3ERO A;  1IYU A;  4JI1 L;  3MA2 B;  2PO4 A;  3KBX A;  1VDZ A;  2QCP X;  1X55 A;  4J6H A;  1L1O A;  4DK0 A;  2LS0 1;  2KOL A;  3J7Y W;  4A93 H;  4LUO A;  4LF6 Q;  2QGQ A;  4NB3 A;  3VA7 A;  5BR8 Q;  3RZO B;  3J80 L;  4OO1 I;  2MQH A;  1DJR D;  3EFX D;  4DF7 A;  3PUZ A;  3I4M H;  3CXC A;  1I4R A;  3TP8 A;  4A3M H;  3K7A H;  4A3J B;  4NXN Q;  4M8A A;  3CF5 A;  3J80 c;  3X3N A;  3J81 j;  2PPB C;  5KNB A;  4L5T A;  1ET6 A;  1FVI A;  4UP7 A;  4ZRZ A;  5IGD A;  4MHE A;  3OOC A;  4X3K A;  1RDP D;  2DJF C;  3CCQ A;  2PQA A;  2Z6K C;  4AIM A;  4PZ7 A;  4DV6 Q;  1YIT A;  3GTK B;  5J22 A;  1Y1V B;  4UAI A;  4C2M H;  3ERQ A;  1PHJ A;  4KHZ A;  1TWC H;  1GUW A;  3H0G G;  4XDX A;  4FXD A;  2AQ3 B;  4P2C B;  1QUQ A;  5JAV A;  1SEB D;  2CKZ B;  3FKI H;  5FLX L;  2O2L D;  2RHS B;  2VL6 A;  1NBW A;  3A7A B;  1YNN C;  1OTC A;  2K52 A;  5CC4 A;  1MSG A;  3DEP A;  2JSO A;  2KVM A;  3AFQ A;  2R92 B;  4R4O A;  3Q23 A;  1SE2 A;  3P75 A;  2ZT9 C;  3OTO Q;  2F0F A;  4B08 A;  3GV6 A;  5C4J H;  1HA5 A;  4C56 C;  5FLX c;  2K50 A;  4DUY Q;  1STH A;  4L6T B;  1EIY B;  4JYA L;  2H1E A;  1W3S A;  5IYC G;  4O1N A;  3A8K E;  4X3T A;  3HOU G;  2KHJ A;  1WYD A;  5M3M G;  3I56 A;  4BBR B;  3HOV B;  5I2X A;  2R6G A;  1AZP A;  1VQI A;  1DD2 A;  1Q8K A;  4OGQ C;  3C1E A;  3VR5 A;  3PF4 A;  3P1H A;  1FNV A;  2BCO A;  1D5X C;  1EYD A;  4YWL A;  1Y8O B;  1PTO F;  2KEN A;  2NTS A;  4AYB B;  4A3F G;  1XYI A;  2Z8L A;  1EZ8 A;  4HN7 A;  3WWV A;  3W3A A;  2X69 A;  3PO2 G;  2D9U A;  1SRU A;  1A2U A;  5IT9 L;  4GNX B;  5K36 G;  1HR0 L;  2CW0 D;  1AFP A;  2RF4 A;  3LX0 A;  4DNR B;  4ZQ3 A;  2NB0 A;  1H9J A;  4DK3 C;  4MNO A;  3G71 A;  4HR7 B;  2VXW A;  4K8J A;  4ME3 A;  4ZUJ A;  2X6L A;  2F0W A;  3T53 B;  3HS0 C;  5E4W C;  2I5L X;  1R4P B;  1NJI C;  2WIN B;  1AE3 A;  2UUC Q;  1HUN A;  1X3G A;  4PMC A;  3GD7 A;  1QZH A;  1K8M A;  4TKO B;  1ASZ A;  2OQK A;  1UE7 A;  2WV6 D;  3BDC A;  4IZ8 A;  4LFA L;  3BDL A;  1PFS A;  4I7A A;  2H5X A;  4KMU C;  5JVH 3;  4JK1 C;  4LUV A;  2FJ2 A;  3TRE A;  2A5H A;  2OWO A;  5CYU A;  4LFB Q;  5NUC A;  4DR6 Q;  3MEF A;  2XN9 C;  5KEE A;  5ELF A;  2JA7 G;  3E9I A;  4C3I G;  1JOO A;  1Z9F A;  2VY3 A;  3S2H B;  4GLX A;  4LF4 Q;  4NDX A;  1BO0 A;  5IP9 H;  2K32 A;  3KK7 A;  4JI6 L;  3H0G H;  1HNX Q;  3TBI B;  2ZXO A;  2Q8I B;  5C44 B;  1JC7 A;  2F4V Q;  1F2Y A;  1A3T A;  3K0Y A;  1Q7Y C;  1N32 Q;  2IX0 A;  2KJX A;  2NVQ B;  1VQB A;  3R2I A;  4L63 B;  4YWM A;  3CCL A;  4QJF A;  1VQD A;  4BY1 G;  2ZXP A;  1HUM A;  1X56 A;  5C3X A;  1HNW Q;  5JOB A;  4DV3 Q;  1YBY A;  2F3W A;  5IYC H;  3NP8 A;  1IW7 C;  3S1R H;  2Z4H A;  1S5B D;  1N34 L;  3HOU H;  1I50 H;  4XT1 B;  5M5X H;  5M3M H;  4LAA A;  1PH5 A;  4N8F A;  3F2U A;  3QJY A;  4WJ4 A;  1EQQ A;  4K0K Q;  4OIK A;  4LJZ C;  2UXD Q;  2F0I A;  3N6R A;  1SYE A;  1J8I A;  2B8G A;  4JI2 L;  3P20 A;  1DM0 B;  2NZH A;  2F3I A;  1PFN A;  3MC0 B;  4A3F H;  1NE3 A;  4CJ2 C;  2OEO A;  3A8J E;  2OT2 A;  3PO2 H;  1BUV T;  1PH1 A;  2B2U C;  4KY5 A;  2AUJ D;  3T56 B;  5K36 H;  4QCL A;  3SDZ A;  1BQQ T;  2K4K A;  4P72 A;  1PXU A;  1PYW D;  2V4D A;  2MJ8 A;  1YEZ A;  1KDA A;  1EQT A;  3BYY B;  2K5W A;  1WFQ A;  1R9T B;  2XRS D;  4YY3 Q;  1YNJ C;  5LMN Q;  3UDI A;  3AEV A;  1KL9 A;  1ILP A;  1EIH A;  4K5V A;  4B3M L;  1PH8 A;  4JV5 L;  3A5Z B;  2LKV A;  1WTQ A;  1XPU A;  1F9S A;  2OXP A;  1JWS D;  1VQN A;  2HDL A;  4L5Q A;  3FPP A;  5JEA H;  1FNU A;  1PRT C;  1BR9 A;  2NZO A;  4HCS A;  3M4O B;  1NMF A;  3GTG H;  1H9M A;  2RSN A;  2JA7 H;  2VZA A;  4C3I H;  2CHB D;  2F0M A;  2K28 A;  4KHP L;  4KI0 A;  1O7I A;  3LNN A;  1VQO A;  1JCK B;  2D0P A;  1JJC B;  4X3U A;  4KK7 A;  2UUA Q;  1D1I A;  3RNU A;  4FDB A;  2KEE A;  4ABN A;  4OL7 A;  1PH4 A;  4H13 C;  4DNT B;  2HHH L;  5ELE A;  4IOA A;  1WCM G;  4X65 Q;  2B2T A;  5EQ0 A;  3GTM H;  3WOF A;  4KKT A;  4XQN A;  3CAM A;  3NTI A;  5LL6 X;  3NWT A;  1XMQ L;  2QEJ C;  3JAM E;  3CKI B;  4BY1 H;  1EU4 A;  4ME5 A;  4HID A;  3MXN B;  4X64 Q;  2R7Z B;  4R8I A;  1PTO D;  2I46 A;  4JI0 Q;  4BY7 G;  1XNR L;  1KLG D;  2MFI A;  3T1Y L;  3OYY A;  3NXW A;  4B3S L;  1X54 A;  4DR2 L;  3CPW A;  2KCT A;  2WII B;  2F0E A;  2LMC B;  1BBW A;  4BXX G;  5FK9 C;  5D3I B;  1X9N A;  2VQF Q;  1UEA B;  3FHW A;  4H0L C;  1EYA A;  2GN5 A;  3CPF A;  1VQG A;  4N9P A;  1U0L A;  5M3F B;  2ALY B;  4IPC A;  3G48 A;  4AQY L;  3GDE A;  3KJP A;  4QY7 A;  4RG1 A;  3S9W A;  2EYF A;  1A63 A;  4GNX A;  1N34 Q;  4DV0 Q;  3F2C A;  4WJ3 M;  1CI3 M;  1MHW C;  1TWH H;  2NZ1 D;  1G2T A;  3K57 A;  2JA5 G;  1SNQ A;  2F0G A;  3E6Z X;  1VQM A;  4KD4 A;  5C0X I;  3Q8D A;  4JI3 L;  3HKZ G;  1CHQ D;  2MPM A;  5COR A;  1P8L A;  3I90 A;  5M9O A;  1EWH A;  1NCV A;  3R3O A;  1K9M C;  2F0J A;  2Q2T A;  1SSO A;  3E0E A;  3QO2 A;  4N9T A;  4YCU A;  1OXT A;  2O5I C;  3VR2 A;  3U9O A;  5EPJ A;  2K5Q A;  1B9M A;  1WI5 A;  1SE8 A;  3E0J A;  1GVP A;  3QB3 A;  5LMU Q;  3VA5 A;  1S4Z A;  3PUW A;  2WAQ G;  2K04 A;  1KDC A;  1XX8 A;  2RDF A;  4A76 A;  2N3S A;  1SMY C;  1YI2 A;  5FO7 B;  5M5W B;  2R93 B;  2J0T D;  3KLS X;  5E3F A;  1II3 A;  2MHV A;  2NWG A;  1U4P A;  1CSQ A;  5J39 A;  1NUC A;  3DWP A;  4NXM Q;  2D5D A;  4DN4 M;  3HOX B;  2E2I H;  3NTK A;  4G7Z C;  4A3B B;  2B29 A;  3I4N G;  4OEL B;  3L7Z C;  3OIP A;  3QIA A;  5GQO A;  4PMW A;  3I7F A;  1NNX A;  1YHB A;  2NBF A;  4XXE A;  3T1H Q;  3TQY A;  5EAY A;  5ISR A;  3K59 A;  4PZ6 A;  3NBI A;  4KJN A;  1BCP D;  1HPC A;  1WCM H;  1PZJ D;  1CTM A;  4MTK A;  4UHV A;  5ELO A;  4KHP Q;  3PO3 G;  1B53 A;  2K03 A;  4P74 A;  1RIP A;  4J15 A;  1QUQ B;  3KF8 B;  3NWS A;  5DLQ E;  4JG2 A;  2DY7 A;  3D4D A;  4BY7 H;  5IY0 A;  5JPN C;  1N33 Q;  1B8A A;  2JA8 H;  1Q90 A;  3C46 A;  1VQJ A;  4DV1 L;  1JWU D;  3RZD H;  4OX9 L;  2SEB D;  3FPU B;  2L1B A;  4BXX H;  1FD7 D;  3H3V C;  1W6J A;  1X3Q A;  2I5H A;  3A0J A;  1VQ7 A;  2BH2 A;  1STB A;  5CV8 A;  4KN4 C;  4RHR A;  2Z1C A;  2OTJ A;  4HJ8 A;  3O13 A;  4WFN 3;  4HIK A;  2ES2 A;  3GTL H;  3CQZ H;  1SFO B;  1D7Q A;  3IL8 A;  3E5S A;  3OWF A;  4F8M A;  4P75 A;  2L0C A;  1Z7T A;  4NPS A;  2JA5 H;  1VF7 A;  3HOY G;  2L5T A;  4OO1 G;  1N36 Q;  4LF9 Q;  4DNI A;  5C4X H;  1G51 A;  3CCJ A;  5T1I A;  1L0X B;  5BR8 L;  1VF5 C;  1YVC A;  1MD2 D;  1BVS A;  2EDG A;  3S1N B;  1XNQ Q;  1X65 A;  4X3S A;  1STN A;  1HHV A;  1ROD A;  3A5U A;  1HXY D;  4NXN L;  1UEB A;  1VMC A;  1RCV D;  2JJQ A;  4CKE A;  3MVV A;  3JAM i;  2VUM H;  4IJL A;  3HOZ B;  2F0N A;  5C3E B;  1E24 A;  5EGT A;  4DV6 L;  3R2T A;  5JPM C;  4LF5 Q;  2XIW A;  2MO1 A;  4M1U B;  2NVT H;  3NTH A;  5F2D A;  2A69 C;  4RHS A;  4KD3 A;  1L0Y B;  1X6O A;  3J81 E;  3I4N H;  3HEJ A;  4RWS C;  4BS9 A;  1A3U A;  3S1Q H;  3BU2 A;  2VB3 X;  1AEX A;  3DHQ A;  1I4H A;  3UDX A;  4EQN A;  4I65 A;  1SNP A;  2F0O A;  4R4I A;  3KF6 B;  3E9H A;  1HFN A;  3OTO L;  2V1C C;  1EY7 A;  4IUT A;  4XYQ A;  3FMC A;  1K8G A;  1HR0 W;  2D62 A;  4DR5 Q;  1V1P B;  4DUY L;  1STE A;  2IL8 A;  1Y1W G;  1VQC A;  1AW7 A;  4KKS A;  1TWF H;  4CKC A;  3L3O C;  3MXN A;  3PO3 H;  3SK8 A;  1UE5 A;  2ZXR A;  4OWW B;  2NN6 I;  2MGS A;  4LWC A;  1LUZ A;  2NVX B;  5JJI A;  1RJT A;  2M9V A;  4IPD A;  1GKH A;  4GKK Q;  4JI7 Q;  2ZJQ A;  2K75 A;  1HQM C;  2F3V A;  2Y0S E;  2TSS A;  1ZKO A;  1Q86 C;  3M4Q A;  1Q1E A;  1WTX A;  2E2H H;  1JJG A;  2Z9H A;  1JB7 A;  1A2T A;  2GVA A;  2XWB B;  4WJW A;  5CBE E;  2QDL A;  1JOQ A;  1D5M C;  4A3J G;  1I3Q B;  3S14 H;  2HCI A;  3S16 B;  2YTY A;  4A3E B;  4DXG A;  1IBK Q;  1EUJ A;  2EYO A;  5EKK A;  1CM9 A;  3J7Z C;  1QNK A;  1Y1V G;  3HOY H;  3PV0 A;  4O42 A;  4OO1 H;  2UUC L;  1JR0 D;  1Z47 A;  2Z6K A;  3S17 B;  4DU9 A;  3OMC A;  3F2D A;  4Y7N H;  3I4M B;  4GZY C;  3M4Y A;  4A3K B;  4PQX A;  2FIN B;  3KBG A;  2XNA C;  3U4Z A;  3Q0A A;  2JN4 A;  1LO5 D;  3S15 B;  1TWG H;  4DV2 Q;  2R92 G;  2BH8 A;  1X3P A;  3D3R A;  5M5Y H;  3ERS X;  2K5H A;  4LFB L;  4DR6 L;  1CZW A;  2EYJ A;  2JYO A;  1BOS A;  1I6V C;  1E2W A;  1ENC A;  1YJN A;  4HCE A;  4UDU C;  4LF4 L;  4C3H B;  4Q0F A;  2ZM6 L;  3EA6 A;  1H95 A;  3PMF A;  3SR1 A;  4BBR G;  2CFM A;  3HOV G;  1KQS A;  2D0O A;  1ASY A;  1HNX L;  2EQS A;  1V1Q A;  2F4V L;  4Q5V A;  4PZ8 A;  1N32 L;  1GUO A;  4U67 3;  4AYB G;  3RLF A;  1B2T A;  1CSP A;  5L37 A;  3EN2 A;  2L55 A;  1AZQ A;  3FP9 A;  4HSP A;  2GVB A;  1HNW L;  4DV3 L;  1Y1W H;  1S5E D;  1PFB A;  1QNU A;  3KF8 A;  3CCR A;  1UE1 A;  3GTP H;  1HTL D;  1CFM A;  3SK4 A;  1JT8 A;  1QCB D;  3QR8 A;  4LK1 C;  5D14 A;  3LWE A;  3GTQ B;  3NPP A;  4K0K L;  3RLO A;  2UXD L;  2B8F A;  2AQ1 B;  5E7N A;  4ZK9 B;  3RZO H;  3T51 B;  3L9A X;  4ALP A;  3DMU A;  1QWY A;  4HMJ A;  1SNM A;  1VQ9 A;  3C2P A;  3DWQ A;  1PH6 A;  4A3J H;  3GTJ B;  3KLS A;  2ATW A;  2E5L Q;  3MEH A;  2KHS A;  4RA8 A;  2EY6 A;  4YY3 L;  4DXF A;  1K0R A;  3MTS A;  5LMN L;  3GTK H;  2PZT A;  2OF1 A;  2A74 C;  1VQ4 A;  1IHZ A;  3UE0 A;  1Y1V H;  2B2W A;  3T4A C;  5A2Q E;  3CC4 A;  3IFT A;  5AJ3 Q;  2O4X A;  3J81 i;  5C44 G;  3W1G A;  2F0S A;  1AN8 A;  1LLR D;  2FFK B;  2K5D A;  4G7O C;  4HIO A;  3I73 A;  3OSO A;  2DGY A;  3CRL C;  3QG1 A;  2R92 H;  4A3D B;  5IT9 c;  1ICW A;  4X66 Q;  4DPG A;  2A6H D;  4V19 0;  2L15 A;  4PNY A;  2OTL A;  1I6H H;  4R4T A;  1PTO C;  4HAE A;  2B39 A;  2IHE A;  1J9O A;  1HFG A;  1LTG D;  2JP1 A;  5DAU A;  4K6D A;  5I9P A;  4IQZ A;  1EZ6 A;  1HZ9 A;  2DUD A;  4RH6 A;  4YCV A;  1Q82 C;  4QUF A;  5C4Z A;  1A6X A;  2JQO A;  3BVZ A;  2Y0S B;  3K5N A;  2RCN A;  2EJF C;  1EIF A;  4XT3 B;  3S24 A;  4BBR H;  2UUA L;  1VQH A;  3HOV H;  3GQB A;  1TWA B;  4CGY B;  4LF7 Q;  1FGB D;  3KLW A;  1KRS A;  4JOI C;  2HDM A;  3K7U C;  2BE5 C;  1N9W A;  4HJ7 A;  3RUZ A;  4X65 L;  3URY A;  1XTC D;  3KF6 A;  2F4I A;  1VQL A;  3MHB A;  5BN4 A;  1IL8 A;  1RHP A;  2D2C C;  3ND9 A;  1V1P A;  2ZM6 Q;  1E2Z A;  4X64 L;  1EY5 A;  1OXV A;  2EY5 A;  4C1N I;  1LTB D;  3ZJY C;  4JI0 L;  3BYT B;  5M5X B;  2CH4 A;  3H94 A;  4XQQ A;  1H9S B;  2TMP A;  3Q6S A;  1O7Z A;  3MZ5 A;  2B2U A;  2OCE A;  3M4P A;  4UP9 A;  5EBD A;  5CV5 A;  3NHH A;  2EOT A;  3V2T A;  3F8T A;  4QIW B;  2F0L A;  1XMO Q;  3CCU A;  1VQF A;  2VQF L;  3QWN A;  1UE6 A;  1XXG A;  3TN2 A;  2QEX A;  3M7N A;  1FYC A;  1SLJ A;  2PYK A;  1YZ6 A;  5IYB G;  4A3G B;  1SR3 A;  4ZKC B;  1HZA A;  4DR7 L;  1F9P A;  3N52 A;  1TS2 A;  3DM3 A;  1A0I A;  4DV0 L;  4JI8 Q;  3MAQ A;  2CVR A;  1BCP F;  5C0X G;  2A68 D;  5G3L D;  2EE1 A;  3PQI A;  1L2F A;  2ASB A;  1A15 A;  1B50 A;  4ZYS A;  1XPO A;  3S2H H;  1F77 A;  1ZYR D;  4GN4 B;  5D3D A;  1D8L A;  3BDO A;  4OXP A;  2M2L A;  5C5M A;  2XRQ D;  5LMU L;  4JPB W;  5IGF A;  5C44 H;  4RGM A;  1C7Y A;  1F2L A;  4LW1 A;  4KV6 A;  5LL6 S;  4DV4 Q;  1EYG A;  3CCV A;  2JA9 A;  3NQI A;  3HOW B;  4U68 A;  1SYC A;  1IZ6 A;  2NVQ H;  2VQE Q;  3EQL C;  3S1M B;  1S72 A;  3JC6 6;  3D0F A;  4GOP C;  3MFY A;  5COY A;  1E1T A;  2YU9 B;  1G91 A;  1WTO A;  2R7Z G;  2K7V A;  3RN5 A;  1PMR A;  2LXK A;  1I4Q A;  4NXM L;  3J80 E;  5BN3 A;  1K8A C;  4DK1 A;  2EYH A;  3H3V I;  1FNW A;  1G6P A;  2RKS A;  3M9B A;  2XSC A;  3FVQ A;  5C4H A;  2AQ2 B;  2F52 A;  2UUB Q;  1O80 A;  1QVF A;  3G6J B;  4FP5 D;  3KDF B;  1YNN D;  3T1H L;  2GA4 B;  3QOJ A;  1LM0 A;  5M3F G;  3KFU A;  3BVG A;  2N8N A;  1SNC A;  1SYD A;  2WB1 E;  4EX5 A;  4G57 A;  3IFD A;  2HT1 A;  3NEN A;  5ELN A;  1LT3 D;  3OWE B;  2K5V A;  2KA7 A;  4RGN A;  1RTO A;  2IW3 A;  5FLX E;  2JEA I;  1N33 L;  4A3C G;  1GXD C;  1BBX C;  1D2B A;  2PNH A;  4JBW A;  4C1N K;  1MBY A;  2SNS A;  4RKB A;  1BF4 A;  4OWT B;  2I07 B;  1TVX A;  4C3J B;  3ULP A;  1R9T H;  4FF1 A;  4F87 A;  1E1O A;  4PV1 C;  4LFC L;  4LMQ D;  5C5L A;  3A55 A;  2PCF B;  3DUZ A;  2X6G A;  1G29 1;  1CKO A;  1OO9 B;  4OEM B;  2F0K A;  1QJO A;  4DAP A;  2KHI A;  2CQA A;  5IYB H;  3F1Z A;  4FF2 A;  1HJP A;  1E0B A;  4A3I B;  2R93 G;  4B9X A;  1KHI A;  1W2B A;  1LYL A;  2PQE A;  1EY8 A;  4FF3 A;  3HP3 A;  3I70 A;  3M4O H;  4QL5 A;  1KD1 C;  3ICE A;  3LGJ A;  5CGK A;  3PF5 A;  2YTV A;  3HKS A;  2NVY B;  4K6L A;  1IBM L;  1N36 L;  3HOX G;  1TS3 A;  1DZ1 A;  4LF9 L;  3OW2 A;  2N55 A;  4A3B G;  3FRP B;  3EJI A;  3PUV A;  2B2V A;  4DUZ Q;  2Q2U A;  4DR7 Q;  3TP7 A;  2AMC B;  3TDQ A;  1XNQ L;  4KN7 C;  2ZJR A;  1RF2 D;  1UNS A;  1EU3 A;  3MFG A;  1WOC A;  2VB2 X;  3I2Z A;  3EBE A;  3B6Y A;  3PGZ A;  1GHJ A;  3D8G A;  4R4Q A;  4DV5 Q;  2R7Z H;  2ZTC A;  4JBK A;  1T5E A;  1QIL A;  3CHB D;  4LF5 L;  2F03 A;  2KBN A;  1DYQ A;  2QIL A;  2WKC A;  4QGU A;  4DR1 Q;  1EYC A;  3K5M A;  1DON A;  1T5X D;  2B2T C;  3TRZ A;  5C0X J;  1FJG Q;  3TZU A;  1SAP A;  3G6E A;  4S3S A;  2K5N A;  3BZK A;  3EVQ A;  3KUP A;  5M3F H;  2A6E C;  1CA6 A;  1ESR A;  1A3V A;  4DR5 L;  4KLK A;  4XIG S;  5DEH A;  5EBC A;  2YV5 A;  1LTI D;  3GTO B;  1V8Q A;  3I4O A;  4KTA A;  1D6E C;  1IW7 D;  4BA2 I;  1WTH A;  2JA8 B;  2IHF A;  1WD1 A;  1H9S A;  2XTI A;  4IUP A;  2ICE C;  2IWH A;  4GKK L;  1BDO A;  1QZG A;  4A3C H;  4JI7 L;  3S2D H;  1U4M A;  5GRO A;  3I72 A;  1V43 A;  2DN8 A;  5CV4 A;  2PI2 A;  1JJ2 A;  1TU2 B;  1IYJ B;  3I91 A;  1V9P A;  4K5W A;  1K83 B;  2PZW A;  1QB5 D;  1JQY D;  4CJ0 B;  1Z6H A;  1S5F D;  3UE1 A;  5M5W H;  1KXL A;  2RQX A;  2R93 H;  3AYH B;  1IBK L;  2KED A;  3U9S A;  3K80 C;  3HOZ G;  5C3E G;  1BXT A;  5C4X B;  5DNF A;  3J80 i;  4LFC Q;  1YNJ D;  1S5C D;  4Z9C B;  1PTO B;  3NEL A;  1CUK A;  3HOX H;  3MXU A;  2UXB Q;  1G8Z D;  2IPK D;  1PV4 A;  2WAC A;  1TT2 A;  4A3B H;  1EQR A;  3UI2 A;  1CKN B;  1ZXT A;  3PCO B;  2WB1 B;  1U4R A;  2BDN A;  1TY0 A;  3HG9 A;  1V1O A;  3VR3 A;  4DV2 L;  3M3Y B;  2MO0 A;  2E74 C;  2EIF A;  4YCW A;  1MI2 A;  1CQV A;  1STA A;  1LAB A;  3RLN A;  4IUV A;  1IBM Q;  2B3G A;  1CHP D;  1PFM A;  5ELD A;  4HMI A;  3BVM A;  4NKL A;  2IX3 A;  2RBM A;  3GO5 A;  3D6W A;  3A8I E;  3NBH B;  4B3R Q;  4DV7 Q;  5JJL A;  1VS0 A;  3S1Q B;  4IUU A;  1TS4 A;  3KYH C;  3OW7 A;  1U4L A;  1C9O A;  2NUC A;  3KDF A;  1QVC A;  1RL2 A;  3V05 A;  4EVO A;  4POF A;  2QDB A;  3K5L A;  3L0O A;  2R3Z A;  4HJA A;  2JA6 B;  4F88 A;  1SE3 A;  1I5F A;  3DXJ C;  3IRB A;  1M1K C;  5IE8 A;  1BNZ A;  1YNX A;  1SFO H;  4A3E G;  5I4D A;  2HQE A;  1SYB A;  1XPR A;  5HY6 A;  3CCM A;  1STY A;  4RFB A;  1F9Q A;  3NSW A;  1PYB A;  4JW0 A;  2K6A A;  3NE5 B;  2CW0 C;  3I4M G;  1CZG A;  4A3K G;  1MJC A;  2MP1 A;  1FR3 A;  4IPH A;  3CMA A;  1EIG A;  4IFD I;  2IX1 A;  2EYM A;  1IKL A;  2AHO B;  4GLV B;  4PG3 A;  4NMZ A;  3UDF A;  3SVM A;  1QE6 A;  5LHY 1;  1C4Q A;  4L5R C;  3LWU A;  5EKL A;  4JI5 Q;  2E5L L;  1WTP A;  3H91 A;  4BBS B;  1VQ8 A;  3NQT A;  1B1Z A;  2B63 B;  2E2J B;  2L4N A;  2EJG C;  4ZLT F;  1CT1 D;  5C3E H;  3HOZ H;  4C3H G;  4GOP B;  4H44 C;  3RD4 A;  2LSS A;  3MXP A;  2FMM A;  3ONA B;  4G7H C;  1C0A A;  3TP5 A;  1OXU A;  3NUC A;  2ICI A;  2F0D A;  2CWA A;  3CU7 A;  4DR3 Q;  1ET9 A;  5AJ3 L;  4EQO A;  3RN2 A;  1L0W A;  3RMH A;  3TME A;  2G9H D;  4RMF A;  2PW5 A;  1PH7 A;  1SMY D;  4PMB A;  2JE6 I;  2UXC Q;  1YIJ A;  4LF8 Q;  1BKB A;  2KCN A;  4P73 A;  3DM1 A;  4GN3 B;  4JVZ A;  4IPG A;  2MUY A;  3PIO 3;  3ND8 A;  4A93 B;  4X66 L;  1PRT B;  1EY4 A;  3Q24 A;  2KCM A;  3CRK C;  1VCI A;  2EY2 A;  2Z4I A;  4DAM A;  2KEC A;  4AH6 A;  2QA4 A;  1HNZ Q;  5CV7 A;  2YYZ A;  4L5S A;  3TEH B;  1TS5 A;  5G3L F;  1GO3 E;  4FYD A;  4K14 A;  2DNC A;  4TQU S;  4A3M B;  3K7A B;  5CR3 A;  2EZV A;  2RHQ B;  3T16 A;  3W5O A;  1CA5 A;  2NVX H;  4B3T Q;  2E2D C;  2R61 A;  2VS1 A;  4JBM A;  3OHX C;  4LF7 L;  1RKN A;  1XJV A;  1B3Q A;  3OPO A;  4P71 A;  3A7L A;  1NSN S;  2OQ0 A;  2N49 A;  4C2M B;  3TP6 A;  1LT6 D;  2B2Y C;  4TVA B;  1TWC B;  4JBJ A;  3WDN A;  4JI4 Q;  2R7D A;  1AP0 A;  1CQF A;  2K01 A;  2RDG A;  1I3Q H;  1SXT A;  3FKI B;  5FOB B;  3D4W A;  3WOE A;  1WTR A;  2Q8R E;  2E76 C;  3CCS A;  4J1M A;  1O7Y A;  3PIO A;  3S16 H;  4IO9 A;  4X62 Q;  1KIX A;  4A3E H;  5DM6 3;  4L8J A;  1KAW A;  2Q2H A;  1O78 A;  2BOS A;  5C4J B;  1ZYR C;  5A35 A;  5CBA E;  1XMO L;  4HJ9 A;  2DNE A;  1PZI D;  5E1F A;  2KUM A;  1EFW A;  1HZC A;  1F9R A;  5CMD A;  2VNU D;  3S17 H;  2RA4 A;  3I4L A;  5EPK A;  1YHA A;  2HIV A;  1QVG A;  4A3K H;  1J5E Q;  1B4O A;  2KQ3 A;  1H9R A;  1LAC A;  3S15 H;  3A74 A;  5T1G A;  4TSS A;  4JI8 L;  4DK6 C;  2R7F A;  4A3D G;  4WOR A;  1B70 B;  1TQO A;  4JC0 A;  3VR4 A;  3F2B A;  1PZK D;  5KIX A;  1K28 A;  4QMG A;  4Y52 H;  3CME A;  3A56 A;  5IP9 G;  2EPB A;  4RGT A;  4C3H H;  1K8O A;  2Y0S G;  1HRJ A;  1MGS A;  1EFI D;  3IAY A;  4R8N A;  2E75 C;  2AUK A;  4DGZ A;  3VYR A;  1IBL L;  1CKN A;  1L1O C;  4MTN A;  4RAU C;  5C3W A;  5IWA Q;  4EQP A;  4XTC S;  4R4C A;  4DV4 L;  4OON A;  1EY9 A;  1I6H B;  5KND A;  1E3P A;  4DR4 Q;  2VQE L;  3JAM L;  4JOI A;  1STG A;  3H6M A;  4NW2 A;  2RDH A;  1TY2 A;  2KCC A;  2UU9 Q;  3STB D;  3JAM c;  1A62 A;  3NBH A;  3PUX A;  1RD9 D;  4ILW A;  3ER0 A;  4DA2 A;  5ELB A;  2A69 D;  2UUB L;  2HD3 A;  2C35 B;  5FO9 B;  3GTQ H;  4ODG A;  1IL2 A;  4XQJ A;  3BJU A;  2CCZ A;  3ULL A;  4HED A;  4A3G G;  4LNQ A;  1D5Z C;  1KDB A;  1Y8P B;  2F0V A;  4GLA C;  1K73 C;  5FO8 B;  3H0G B;  3CP0 A;  3GTJ H;  4FO2 A;  4YIJ A;  1PDQ A;  3DEO A;  5KNC A;  3J7A V;  5GAD C;  1O7L A;  1I4G A;  4V0B A;  5CV6 A;  4YWK A;  1H9K A;  4HTH A;  1DGS A;  1SNO A;  2N78 A;  1NMG A;  5J3B A;  3I8Z A;  4YHH Q;  1HQR D;  1I94 Q;  1S40 A;  4GKJ Q;  1FL0 A;  1B9N A;  3S1R B;  5KRU A;  1KTK A;  3HOU B;  1I50 B;  5JEA G;  5M3M B;  1S3O A;  1NY4 A;  4JI1 Q;  4BWG B;  3CC7 A;  3HOW G;  1SRO A;  1WD0 A;  5JVG 3;  2LFN A;  3DWA A;  3SHL A;  4A3D H;  2B2W C;  3H15 A;  4UY8 C;  2L11 A;  2FXQ A;  2AKW B;  2SDF A;  2M00 A;  2J4X A;  2IJ0 A;  1U9R A;  1GUG A;  1IXR A;  4A3F B;  5AFW A;  4GOP A;  3PO2 B;  2F0P A;  1WTV A;  3CD6 A;  4DUZ L;  2EYP A;  3TS2 A;  2K1B A;  1E7Z A;  1SJH D;  1Q1B A;  1TWA H;  1C8C A;  2JXM B;  2A8V A;  3NEM A;  1KNE A;  1K0S A;  1DCZ A;  2WFW A;  3FDT A;  2ENB A;  1AE2 A;  4FXG C;  1ESF A;  5FLM G;  1Q8I A;  5IGC A;  4OIJ A;  2PZU A;  2NTT A;  2J7Z A;  4ZAI A;  5IOD A;  1VQE A;  1HTP A;  1LTS D;  4QUC A;  3H3V H;  2BDO A;  4CDD C;  1GUN A;  4DV5 L;  1YJW A;  4CHT B;  1A8V A;  2RSO A;  5GAE C;  4IAL A;  2LY7 A;  3U4V A;  2P5Z X;  3D31 A;  1I4P A;  1IBL Q;  3K6O A;  3V96 A;  4DR1 L;  1NAP A;  4H02 A;  2CWP A;  3L2P A;  1Y14 B;  1M8A A;  3K0X A;  4XYO A;  1BCP C;  1FJG L;  3QOL A;  4C3J G;  5I6W A;  1EL0 A;  3GTG B;  2F0Q A;  1VQ6 A;  1KLU D;  2HQL A;  2XWJ B;  4JYA Q;  3X3M A;  2JA7 B;  4C3I B;  4A3L G;  1SE4 A;  4G4K A;  2YTX A;  1VQA A;  4E6I A;  4A3G H;  1Q46 A;  4I7Z C;  1IKM A;  4HIM A;  3ITP A;  3HKZ E;  4A3I G;  1TR5 A;  4CDF C;  2EXZ A;  1PRT F;  2F1M A;  1GUT A;  1PVO A;  2Q2I A;  3I55 A;  1LTL A;  1Q3L A;  4A4I A;  4WRD A;  3RR5 A;  3GTM B;  4POG A;  2WAQ E;  3SXH A;  3K5O A;  3KLR A;  3VYT A;  4BY1 B;  4ZUI A;  1AH9 A;  5I6Y A;  2EY1 A;  4K5X A;  5KYL A;  5IOC A;  1HR0 Q;  1EWC A;  4ZKB B;  3K8A A;  3OIQ A;  1UUP A;  3C1F A;  3HRZ C;  1VMP A;  1EY0 A;  4KKU A;  2IY5 B;  3AU7 A;  1Y69 U;  4KHV A;  3HOW H;  2C9O A;  3SEB A;  5FJ8 G;  1KAB A;  2G5D A;  1JMC A;  5KGU A;  3S1M H;  2QF7 A;  4FNF A;  2YU9 H;  3VYU A;  1SND A;  4QF4 A;  2PMZ E;  2SOB A;  3P7J A;  4LFA Q;  1S5D D;  2HCC A;  3PIP 3;  4RKL A;  2EVB A;  1SJE D;  2UXB L;  2WKD A;  4F7X A;  3HGB A;  3J81 L;  1LV9 A;  1G2S A;  2H4O A;  1G6Z A;  3SE0 A;  1JIC A;  1TWH B;  1Y8N B;  1YHQ A;  4OWX B;  1X3F A;  5C6A A;  3BZC A;  1JOK A;  5C0X H;  1LT5 D;  4IUN A;  5EJW A;  3KOJ A;  1JE4 A;  5JJK A;  3GP7 A;  1MJE A;  3J81 c;  4X6A H;  5FLM H;  2JEB I;  2ZTD A;  3J7A F;  3U50 C;  1CK1 A;  3M85 A;  1TII D;  4JI6 Q;  2JA8 G;  1E22 A;  4J8Q A;  5IT9 E;  2O5J C;  4B3R L;  4DV7 L;  2WP8 J;  2VW9 A;  4DAV A;  5JEA J;  1NTG A;  1ILQ A;  1GUS A;  3AFP A;  1NR2 A;  1GOZ A;  3DLL A;  2F0U A;  1K3R A;  1CKM A;  2EJM A;  4DKA C;  4C3J H;  4GS3 A;  2BA0 A;  1ZEQ X;  2JK8 A;  1D1K A;  2BE5 D;  4MN3 A;  1RTN A;  3PIP A;  4FVM A;  2K14 A;  1GD7 A;  1ML0 D;  4JCV E;  5HGQ A;  1DOL A;  1YJ9 A;  3A54 A;  5EPL A;  4A3L H;  2E2I B;  5IGE A;  1U5K A;  3AB9 A;  4H7B A;  1MKH A;  1ICF B;  4A3I H;  4IJH A;  1T9H A;  4IUR A;  1LTA D;  4CDE C;  1SBB B;  4GN5 A;  3S2D B;  3W1B A;  1K3B C;  2LXJ A;  1MIU A;  3G7L A;  5C4X G;  1WCM B;  2IT1 A;  4JI2 Q;  4DAY B;  2NVY H;  5IGB A;  3EIV A;  4FXK C;  3AQQ A;  2NN6 G;  1HA6 A;  3MXG A;  2MNA A;  4IFD G;  1ENF A;  2EYL A;  4K2K A;  4RCO A;  2I5M X;  2AWO A;  4BY7 B;  2WB1 G;  2A19 A;  1XWE A;  3TS0 A;  3MWY W;  4FF4 A;  2F0H A;  1UAP A;  3G4S A;  2PW7 A;  1SYF A;  4BA1 I;  3J7A 5;  2VUM G;  1PH2 A;  1L1O B;  4HSV A;  3RZD B;  3ULJ A;  5H1S E;  1W6K A;  4JI5 L;  2I0Q A;  3AMU A;  1ONL A;  1Q81 C;  5FJ8 H;  1B3A A;  2B2V C;  1SMX A;  1WJJ A;  2PNR C;  1PLF A;  2QW7 A;  4GNX C;  4B3M Q;  4JV5 Q;  1B7Y B;  2L9H A;  5KYI A;  2ID0 A;  3SGI A;  1NR4 A;  1TKW B;  1SYG A;  1J6Q A;  3IKJ A;  2AWN A;  3GTL B;  3CQZ B;  3HFZ B;  1LT4 D;  4DR3 L;  1PYS B;  1C48 A;  1EY6 A;  3KJO A;  2ZJP A;  5J1Z A;  4APV A;  4ID6 A;  1VQ5 A;  2UXC L;  2JA5 B;  4LF8 L;  1JOR A;  1SDF A;  2PQA B;  1WTW A;  2B63 H;  3TZD A;  1EOT A;  3TSS A;  3HKZ B;  4K2L A;  1FGU A;  2DY8 A;  2JA6 G;  1GJX A;  1WVL A;  4IN3 A;  1MSH A;  2HUG A;  3U58 A;  1HNZ L;  4MIU A;  2QKI C;  3GTO H;  2HIX A;  2Z6B A;  3I3C A;  1DXM A;  3BG3 A;  4O0A A;  4R1J A;  2WAQ B;  2NYZ D;  1B44 D;  1EEI D;  2XGT A;  5E4X A;  2HHH Q;  3FEW X;  4LUZ A;  1KNA A;  4B3T L;  5IYD G;  1DOK A;  1SN8 A;  2G9D A;  4MZ9 A;  1LTR D;  2VUM B;  4KJO A;  1XMQ Q;  2A1A A;  1PRT D;  1TXY A;  2ZTE A;  4B9W A;  2Z0S A;  2SNM A;  5DM7 3;  2A73 B;  3SK5 A;  1K83 H;  1XNR Q;  2NVT B;  5IP7 G;  2L12 A;  3T1Y Q;  1JB3 A;  4A75 A;  4JI4 L;  4B3S Q;  4DR2 Q;  3I4N B;  4KY6 A;  4HJ5 A;  1JWM D;  1R4Q B;  4X62 L;  1M90 C;  4BBS G;  2B63 G;  2PMZ B;  1QOH A;  3HZX A;  1DOM A;  1QG7 A;  1HCZ A;  3CC2 A;  1IYV A;  1LTT D;  4LF6 L;  3D4R A;  4AQY Q;  5HGT A;  4CJ1 B;  4K8I A;  5A2Q L;  5IIF A;  5FKA C;  1TWF B;  1PTO H;  1EEF D;  4UPA A;  3PUY A;  3PO3 B;  1PH3 A;  1X32 A;  2NN6 H;  3VR6 A;  3K81 C;  5K5P A;  4IFD H;  5GAH C;  3C3L A;  1P16 A;  5JJZ A;  4CKB A;  1J5E L;  4RGO S;  4KY7 A;  1XTD A;  1E2V A;  1M4V A;  4R9W A;  1VQK A;  4JI3 Q;  3M3Y H;  4A93 G;  5HUR A;  5IGG A;  4O2D A;  5LMN W;  2K05 A;  3D6C A;  3T13 A;  2E2H B;  3M7G A;  1OXX K;  3SK6 A;  1X3E A;  1PA6 A;  3CCE A;  5EKI A;  3STB C;  4ULL A;  3UDG A;  2CQO A;  1HZB A;  3ZYY X;  4A3M G;  3S14 B;  4AYB E;  3S1N H;  1EQV A;  3W2D A;  3PSI A;  1F2Z A;  4DFA A;  2DJG C;  5IWA L;  2A6H C;  5TSS A;  3BS1 A;  1BCP B;  1EWI A;  2N88 A;  4DR4 L;  1N8R C;  1KRT A;  3HOY B;  4TRD A;  4EQ5 A;  3H09 A;  5I9O A;  1ENA A;  2JA6 H;  4OHJ A;  4QB4 A;  3FKI G;  5GAG C;  4Y7N B;  1KAA A;  1F2M A;  4IFD J;  2UU9 L;  2CH4 W;  2B2Y A;  4N8X 1;  2RCF A;  4UP8 A;  4CDC C;  4IOC A;  3GV3 A;  3R8B A;  1TWG B;  3E3X A;  3Q22 A;  2EXD A;  1GM5 A;  5M5Y B;  5CV9 A;  1BBU A;  2RVL A;  3BZD B;  1GHK A;  5IYD H;  2FMC A;  2E8G A;  1KC8 C;  2Q8T A;  2BA1 A;  1HH2 P;  4RCN A;  2A6E D;  1EOV A;  5D65 A;  2C5C A;  3R93 A;  2XVS A;  4NP5 A;  5IP7 H;  4CBV A;  5BN5 A;  3NK9 A;  3OMG A;  1OXS C;  1UWV A;  4DV1 Q;  5I2Y A;  3VDY A;  4OX9 Q;  2F0T A;  5ELC A;  1JE5 A;  4BBS H;  2E2J H; 
#chains in the Genus database with same CATH homology
 1E1O A;  2I5H A;  3A0J A;  1VQ7 A;  2BH2 A;  1DGS A;  4LFC L;  2N78 A;  1NMG A;  5J3B A;  4YHH Q;  4QIW E;  2PI2 E;  1I94 Q;  1G29 1;  1CKO A;  1S40 A;  4YHH L;  4GKJ Q;  1FL0 A;  2OTJ A;  1I94 L;  4HJ8 A;  4GKJ L;  2KHI A;  5IYB H;  1Q12 A;  4HIK A;  1PH9 A;  3F1Z A;  3CQZ H;  2ES2 A;  5JEA G;  1HJP A;  3GTL H;  1VQP A;  1S3O A;  4QQB X;  1NY4 A;  4JI1 Q;  2R93 G;  3CW2 C;  1KHI A;  3CC7 A;  3HOW G;  4JI1 L;  1W2B A;  1SRO A;  1LYL A;  4P75 A;  1X55 A;  4A3D H;  1L1O A;  4NPS A;  2JA5 H;  3M4O H;  3H15 A;  4UY8 C;  4QL5 A;  1KD1 C;  3HOY G;  2FXQ A;  2AKW B;  3LGJ A;  4LUO A;  3ICE A;  4A93 H;  4LF6 Q;  4OO1 G;  1N36 Q;  3PF5 A;  2YTV A;  3HKS A;  2QGQ A;  1IBM L;  4LF9 Q;  4NB3 A;  4DNI A;  1N36 L;  5BR8 Q;  5C4X H;  1G51 A;  3HOX G;  3CCJ A;  4LF9 L;  1IXR A;  5BR8 L;  3OW2 A;  4GOP A;  1YVC A;  4OO1 I;  2MQH A;  4A3B G;  3PUV A;  4DUZ Q;  2Q2U A;  1BVS A;  4DR7 Q;  3CD6 A;  4DUZ L;  3PUZ A;  2AMC B;  1XNQ Q;  3I4M H;  3CXC A;  1X65 A;  3TS2 A;  1XNQ L;  4A3M H;  3K7A H;  3A5U A;  1E7Z A;  4NXN Q;  3CF5 A;  3J80 c;  4NXN L;  1UEB A;  3J81 j;  2ZJR A;  1Q1B A;  1TWA H;  2A8V A;  2JJQ A;  3NEM A;  4L5T A;  1FVI A;  4UP7 A;  1WOC A;  2WFW A;  3I2Z A;  1AE2 A;  3JAM i;  3EBE A;  3B6Y A;  3PGZ A;  2VUM H;  4IJL A;  5FLM G;  3CCQ A;  2PQA A;  2Z6K C;  4AIM A;  4PZ7 A;  1E24 A;  4DV6 Q;  1YIT A;  4DV6 L;  1VQE A;  4R4Q A;  4DV5 Q;  2R7Z H;  4C2M H;  2ZTC A;  1PHJ A;  4JBK A;  3H3V H;  4DV5 L;  4LF5 Q;  1YJW A;  4KHZ A;  1TWC H;  1A8V A;  2MO1 A;  4LF5 L;  2NVT H;  3H0G G;  2KBN A;  5GAE C;  1QUQ A;  3U4V A;  2CKZ B;  3FKI H;  3D31 A;  4QGU A;  4DR1 Q;  2RHS B;  2VL6 A;  1NBW A;  1X6O A;  1IBL Q;  4DR1 L;  3I4N H;  1OTC A;  2K52 A;  4H02 A;  2CWP A;  3S1Q H;  3L2P A;  1Y14 B;  5C0X J;  3BU2 A;  1FJG Q;  3TRZ A;  3K0X A;  3AFQ A;  3UDX A;  1FJG L;  4R4O A;  3G6E A;  4R4I A;  2K5N A;  3BZK A;  3KF6 B;  3E9H A;  3OTO Q;  5C4J H;  1VQ6 A;  2HQL A;  2V1C C;  5FLX c;  2K50 A;  3OTO L;  4DUY Q;  1K8G A;  4JYA Q;  5M3F H;  1HR0 W;  2D62 A;  4DR5 Q;  1EIY B;  4JYA L;  4A3L G;  4DUY L;  1W3S A;  1Y1W G;  4DR5 L;  5IYC G;  1VQC A;  1VQA A;  2YTX A;  4KLK A;  1TWF H;  4XIG S;  2YV5 A;  3PO3 H;  4A3G H;  3HOU G;  1UE5 A;  1Q46 A;  2KHJ A;  1WYD A;  3I4O A;  2NN6 I;  4HIM A;  5M3M G;  4OWW B;  3I56 A;  4LWC A;  1LUZ A;  3HKZ E;  4A3I G;  4BA2 I;  2R6G A;  5JJI A;  1VQI A;  2IHF A;  4IPD A;  1Q8K A;  1GKH A;  4GKK Q;  1PVO A;  2XTI A;  3PF4 A;  4JI7 Q;  2ZJQ A;  2K75 A;  2Q2I A;  1QZG A;  3I55 A;  4GKK L;  1LTL A;  4A3C H;  4YWL A;  2Y0S E;  5GRO A;  4JI7 L;  3S2D H;  2KEN A;  4A4I A;  1Q86 C;  1V43 A;  3RR5 A;  3M4Q A;  1Q1E A;  4POG A;  2PI2 A;  2WAQ E;  1JJ2 A;  2E2H H;  1JJG A;  1IYJ B;  4A3F G;  1JB7 A;  1AH9 A;  3WWV A;  3PO2 G;  1V9P A;  2GVA A;  1SRU A;  1HR0 Q;  4GNX B;  5K36 G;  3K8A A;  1HR0 L;  4A3J G;  2RF4 A;  3S14 H;  4DK3 C;  2YTY A;  4MNO A;  3G71 A;  3UE1 A;  5M5W H;  1KXL A;  1IBK Q;  2IY5 B;  2R93 H;  1EUJ A;  3AYH B;  3HOW H;  1IBK L;  4ME3 A;  3K80 C;  5FJ8 G;  3HOZ G;  3J7Z C;  5C3E G;  1JMC A;  3S1M H;  2I5L X;  1NJI C;  2YU9 H;  3J80 i;  1Y1V G;  3HOY H;  1AE3 A;  2UUC Q;  3PV0 A;  4LFC Q;  2UUC L;  1X3G A;  3NEL A;  1Z47 A;  3GD7 A;  1QZH A;  2Z6K A;  1CUK A;  2PMZ E;  3HOX H;  1ASZ A;  2OQK A;  4LFA Q;  2UXB Q;  3F2D A;  4Y7N H;  1PV4 A;  1UE7 A;  4LFA L;  2UXB L;  4A3B H;  1PFS A;  1EQR A;  2H5X A;  1CKN B;  3U4Z A;  3PCO B;  1TWG H;  4LUV A;  1YHQ A;  4DV2 Q;  4OWX B;  3TRE A;  1X3F A;  2R92 G;  3BZC A;  2OWO A;  2BH8 A;  4DV2 L;  4LFB Q;  4DR6 Q;  2MO0 A;  3ERS X;  2EIF A;  5M5Y H;  2K5H A;  3MEF A;  4LFB L;  4YCW A;  4DR6 L;  3KOJ A;  2JA7 G;  3RLN A;  5JJK A;  3E9I A;  1MJE A;  2VY3 A;  1Z9F A;  3J81 c;  4X6A H;  1IBM Q;  4GLX A;  5FLM H;  4LF4 Q;  2B3G A;  2JEB I;  2ZTD A;  1YJN A;  3U50 C;  4LF4 L;  2ZM6 L;  3M85 A;  5IP9 H;  1H95 A;  4BBR G;  3GO5 A;  2CFM A;  3HOV G;  4JI6 Q;  3NBH B;  4B3R Q;  4DV7 Q;  2JA8 G;  1E22 A;  4JI6 L;  5JJL A;  4B3R L;  3H0G H;  2D0O A;  4DV7 L;  1KQS A;  1VS0 A;  2WP8 J;  2VW9 A;  1HNX Q;  1ASY A;  1HNX L;  5JEA J;  2EQS A;  1NTG A;  2F4V Q;  3KYH C;  1Q7Y C;  1N32 Q;  1V1Q A;  2F4V L;  2IX0 A;  3AFP A;  4PZ8 A;  1C9O A;  3DLL A;  1N32 L;  1VQB A;  3KDF A;  1K3R A;  3CCL A;  1QVC A;  1CKM A;  4YWM A;  4AYB G;  4QJF A;  1RL2 A;  3RLF A;  4C3J H;  4GS3 A;  1VQD A;  2BA0 A;  4BY1 G;  2JK8 A;  1CSP A;  1D7Q A;  1X56 A;  3PIP A;  3EN2 A;  4POF A;  2K14 A;  1GD7 A;  3FP9 A;  3L0O A;  1HNW Q;  4DV3 Q;  4JCV E;  4HJA A;  1YBY A;  5HGQ A;  2GVB A;  1YJ9 A;  4DV3 L;  4A3L H;  1HNW L;  1I5F A;  1Y1W H;  5IYC H;  3IRB A;  3S1R H;  1M1K C;  5IE8 A;  1N34 L;  1U5K A;  1YNX A;  3HOU H;  1I50 H;  5M5X H;  3CCR A;  1SFO H;  1UE1 A;  3GTP H;  5M3M H;  4A3E G;  1MKH A;  4A3I H;  4IJH A;  1T9H A;  1XPR A;  1PH5 A;  1JT8 A;  4GN5 A;  4WJ4 A;  3W1B A;  5HY6 A;  3CCM A;  1EQQ A;  4K0K Q;  2LXJ A;  1MIU A;  4K0K L;  5C4X G;  2UXD Q;  2IT1 A;  4JI2 Q;  3RLO A;  2UXD L;  4JI2 L;  4DAY B;  2NVY H;  5E7N A;  1PYB A;  2NZH A;  3RZO H;  3EIV A;  2F3I A;  3AQQ A;  4A3F H;  1NE3 A;  2NN6 G;  4ALP A;  3I4M G;  2MNA A;  4IFD G;  4A3K G;  3PO2 H;  1MJC A;  1PH1 A;  4IPH A;  3CMA A;  1VQ9 A;  2I5M X;  2AWO A;  2WB1 G;  2A19 A;  1PH6 A;  4IFD I;  3TS0 A;  2IX1 A;  2K4K A;  4P72 A;  4A3J H;  3G4S A;  2AHO B;  4GLV B;  2ATW A;  4PG3 A;  3UDF A;  4BA1 I;  3J7A 5;  2VUM G;  1YEZ A;  1PH2 A;  1L1O B;  4L5R C;  2E5L Q;  4JI5 Q;  2E5L L;  3ULJ A;  5H1S E;  1WFQ A;  4JI5 L;  1VQ8 A;  2I0Q A;  4YY3 Q;  1Q81 C;  5FJ8 H;  5LMN Q;  3HOZ H;  4YY3 L;  5C3E H;  1SMX A;  1K0R A;  1WJJ A;  3UDI A;  5LMN L;  4GOP B;  3GTK H;  2LSS A;  4GNX C;  4B3M Q;  1VQ4 A;  3AEV A;  1KL9 A;  3UE0 A;  1Y1V H;  4JV5 Q;  1B7Y B;  4B3M L;  1PH8 A;  2ID0 A;  3SGI A;  4JV5 L;  3A5Z B;  1C0A A;  3CC4 A;  1OXU A;  1XPU A;  5AJ3 Q;  3J81 i;  1J6Q A;  2CWA A;  2AWN A;  5C44 G;  3W1G A;  4DR3 Q;  5AJ3 L;  3HFZ B;  1VQN A;  4DR3 L;  3RN2 A;  1PYS B;  1L0W A;  3KJO A;  2ZJP A;  4L5Q A;  4RMF A;  4APV A;  4HIO A;  1PH7 A;  2DGY A;  2JE6 I;  2UXC Q;  1YIJ A;  2NZO A;  1VQ5 A;  4LF8 Q;  2R92 H;  1BKB A;  2UXC L;  5IT9 c;  4P73 A;  4GN3 B;  4DPG A;  4X66 Q;  4LF8 L;  2PQA B;  2L15 A;  4IPG A;  2OTL A;  1NMF A;  2B63 H;  4X66 L;  1I6H H;  3GTG H;  4R4T A;  2KCM A;  1FGU A;  2IHE A;  1VCI A;  2JA7 H;  2VZA A;  4C3I H;  2JA6 G;  4DAM A;  2DUD A;  1HZ9 A;  3U58 A;  4KI0 A;  4YCV A;  4AH6 A;  1Q82 C;  4KHP L;  2QA4 A;  1HNZ Q;  1O7I A;  2JQO A;  2YYZ A;  1VQO A;  4L5S A;  3TEH B;  1HNZ L;  3GTO H;  2D0P A;  1JJC B;  2HIX A;  2RCN A;  2UUA Q;  1EIF A;  3S24 A;  1GO3 E;  4BBR H;  4FDB A;  1VQH A;  4O0A A;  4R1J A;  4TQU S;  3RNU A;  2UUA L;  2NVX H;  2RHQ B;  3W5O A;  2XGT A;  3HOV H;  2HHH Q;  4B3T Q;  1PH4 A;  4LUZ A;  2HHH L;  4B3T L;  4LF7 Q;  4JBM A;  2VS1 A;  5IYD G;  1SN8 A;  4LF7 L;  3KLW A;  4IOA A;  1WCM G;  1KRS A;  1XJV A;  4MZ9 A;  4JOI C;  4X65 Q;  3K7U C;  4HJ7 A;  1N9W A;  1XMQ Q;  2A1A A;  3GTM H;  4P71 A;  4X65 L;  1XMQ L;  2ZTE A;  1TXY A;  3CAM A;  2Z0S A;  3KF6 A;  4BY1 H;  2OQ0 A;  1VQL A;  2N49 A;  4HID A;  3MXN B;  4X64 Q;  2ZM6 Q;  4TVA B;  4X64 L;  1OXV A;  1K83 H;  1XNR Q;  4JBJ A;  5IP7 G;  4JI0 Q;  2R7D A;  4JI4 Q;  4BY7 G;  3T1Y Q;  3ZJY C;  4A75 A;  4JI0 L;  1XNR L;  4JI4 L;  2MFI A;  3T1Y L;  1I3Q H;  3OYY A;  4B3S Q;  4DR2 Q;  3CCS A;  3S16 H;  3PIO A;  4B3S L;  1X54 A;  4HJ5 A;  2OCE A;  4IO9 A;  3M4P A;  4X62 Q;  3CPW A;  4DR2 L;  2KCT A;  1KIX A;  4UP9 A;  4X62 L;  4A3E H;  1M90 C;  4BBS G;  1KAW A;  1BBW A;  2Q2H A;  3F8T A;  2B63 G;  4BXX G;  1X9N A;  2VQF Q;  1XMO Q;  3FHW A;  3CCU A;  1VQF A;  2GN5 A;  3CPF A;  2VQF L;  3CC2 A;  1XMO L;  4LF6 L;  1VQG A;  4AQY Q;  1U0L A;  2ALY B;  4HJ9 A;  1UE6 A;  4IPC A;  3G48 A;  4AQY L;  3GDE A;  2QEX A;  3M7N A;  3KJP A;  4QY7 A;  1SLJ A;  4RG1 A;  1HZC A;  1YZ6 A;  4UPA A;  1EFW A;  3PUY A;  2VNU D;  3S17 H;  5IYB G;  1A63 A;  1PH3 A;  1SR3 A;  1YHA A;  2HIV A;  1QVG A;  4GNX A;  1HZA A;  3K81 C;  4DR7 L;  5GAH C;  3DM3 A;  1N34 Q;  1P16 A;  4DKA C;  3F2C A;  4DV0 Q;  4A3K H;  1J5E Q;  4WJ3 M;  1A0I A;  4DV0 L;  4JI8 Q;  3S15 H;  3A74 A;  1J5E L;  5C0X G;  4JI8 L;  4DK6 C;  1TWH H;  1XTD A;  2R7F A;  4A3D G;  2JA5 G;  1VQK A;  1B70 B;  4JI3 Q;  3M3Y H;  4JC0 A;  3F2B A;  1VQM A;  4A93 G;  5C0X I;  3Q8D A;  4JI3 L;  3HKZ G;  1L2F A;  4O2D A;  5LMN W;  2ASB A;  1P8L A;  4Y52 H;  3CME A;  1OXX K;  1K9M C;  1X3E A;  1XPO A;  2Q2T A;  1PA6 A;  3E0E A;  5IP9 G;  3S2H H;  3CCE A;  4GN4 B;  4YCU A;  1OXT A;  1D8L A;  3STB C;  4C3H H;  4OXP A;  2Y0S G;  1WI5 A;  1SE8 A;  5LMU Q;  1GVP A;  3UDG A;  2CQO A;  1HZB A;  3PUW A;  5LMU L;  2WAQ G;  4A3M G;  4AYB E;  3S1N H;  3PSI A;  2N3S A;  4A76 A;  1YI2 A;  5C44 H;  1CKN A;  1IBL L;  1L1O C;  4MTN A;  5IWA Q;  1C7Y A;  4LW1 A;  4DV4 Q;  5IWA L;  1EYG A;  4XTC S;  3CCV A;  2JA9 A;  4R4C A;  4DV4 L;  4OON A;  1IZ6 A;  2NVQ H;  2VQE Q;  1E3P A;  1S72 A;  4DR4 Q;  1CSQ A;  3JC6 6;  2VQE L;  3D0F A;  4GOP C;  1EWI A;  4DR4 L;  1E1T A;  1N8R C;  2R7Z G;  1KRT A;  4EQ5 A;  4JOI A;  2LXK A;  3RN5 A;  4NXM Q;  4NXM L;  1K8A C;  2JA6 H;  2E2I H;  3H3V I;  2UU9 Q;  3FKI G;  5GAG C;  4IFD J;  3STB D;  2UU9 L;  1G6P A;  3M9B A;  2B29 A;  3I4N G;  3JAM c;  1A62 A;  3L7Z C;  5GQO A;  3PUX A;  4UP8 A;  4PMW A;  3ER0 A;  4IOC A;  3I7F A;  1YHB A;  2F52 A;  3T1H Q;  3TQY A;  5EAY A;  2UUB Q;  1QVF A;  3T1H L;  3KDF B;  2EXD A;  1GM5 A;  2UUB L;  2C35 B;  4PZ6 A;  1BBU A;  3GTQ H;  1IL2 A;  5IYD H;  1LM0 A;  5M3F G;  3KFU A;  1WCM H;  2N8N A;  2E8G A;  1KC8 C;  3BJU A;  2BA1 A;  2WB1 E;  2CCZ A;  3ULL A;  1HH2 P;  4EX5 A;  5ELO A;  4KHP Q;  3PO3 G;  4A3G G;  2HT1 A;  4LNQ A;  1EOV A;  3NEN A;  4P74 A;  5ELN A;  1K73 C;  4GLA C;  1RIP A;  4J15 A;  1QUQ B;  3KF8 B;  5DLQ E;  4JG2 A;  5IP7 H;  2K5V A;  4BY7 H;  3CP0 A;  5IY0 A;  1N33 Q;  1B8A A;  3GTJ H;  2JEA I;  1OXS C;  1UWV A;  1N33 L;  2JA8 H;  4DV1 Q;  4A3C G;  1VQJ A;  3VDY A;  2PNH A;  4JBW A;  5GAD C;  4DV1 L;  4OX9 Q;  3RZD H;  4OX9 L;  4OWT B;  1JE5 A;  4BBS H;  1R9T H;  3ULP A;  4BXX H;  2E2J H;  4YWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...