2E5LQ

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
104
structure length
104
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2e5lQ00
4LWCA 1KL9A 1KIXA 3CC2A 3I7FA 2MFIA 3H0GH 4DR6L 2KCMA 3HOZH 1PH9A 4R1JA 4AQYQ 3AEVA 2VZAA 2XTIA 4DR2L 2ASBA 3T1YL 4DV3L 2PI2E 1GD7A 1PV4A 2YU9H 4IO9A 2YV5A 1PH8A 3G48A 2D62A 1VQMA 1YHBA 4LF6Q 3CCQA 1IYJB 4XIGS 2E2HH 3CMAA 4A3IG 5IP9H 3UDGA 2UUBL 2K75A 2NVTH 1A63A 3PF4A 3S16H 3GTJH 3STBC 3PO3G 4A3DG 1XNRQ 3D0FA 4DKAC 5M5WH 1SE8A 1EUJA 4DUZL 1Q86C 4Y52H 3FKIH 1BBWA 5IYDH 1JB7A 1VQ8A 3J7ZC 2VUMH 4A3GH 2CFMA 3MXNB 3J81i 3UE1A 5GAGC 1PH2A 2A8VA 3M7NA 4DK3C 1CKNB 5JJKA 2K4KA 2UUCQ 1L2FA 4LW1A 2R7ZG 2WAQE 2JA8H 1K83H 4A3GG 1N33L 3CCJA 3KF8B 2UXBQ 4IJLA 3I2ZA 4QL5A 1GM5A 3E9HA 1IBKQ 3PF5A 4JI0Q 5C4XG 1VQ4A 3M3YH 4YWMA 1Q82C 1T9HA 3PSIA 1YIJA 3EBEA 4HJ5A 2D0OA 1WI5A 3CCMA 3S1RH 2C35B 2RHSB 1U0LA 1I50H 4YCUA 4X66L 2BH2A 3S14H 3PO2G 1NE3A 1VQEA 4A3LG 2MO1A 1SROA 1UEBA 1VQPA 1B7YB 5H1SE 3TREA 3I4MH 1N36Q 1MKHA 4JYAL 1DGSA 4HJAA 3S1QH 1PH7A 4GLXA 3A5ZB 2PMZE 1P8LA 2R7FA 1TWCH 1V43A 4GN4B 5IT9c 5JJIA 4P71A 2IT1A 2UXBL 1QUQB 4KLKA 4DUYL 2ZTDA 4BBRH 1IBKL 4JI0L 1Y1WG 2MO0A 3KF6A 4PG3A 4DR3Q 3J80c 4K0KL 3A74A 2NZOA 4C3HH 3U58A 2QA4A 4JBMA 3HOUG 1YZ6A 4DPGA 3ULLA 4OONA 4LNQA 3IRBA 2GVBA 4R4IA 4NXNL 3PUVA 1FGUA 2JE6I 2K52A 4MNOA 4KHZA 2R6GA 4O0AA 4X64L 3KOJA 4UP9A 3PUZA 3F2BA 2Q2TA 1I94L 4JG2A 4A3FH 1QZGA 1IBLL 3HOWG 2UXCQ 3K81C 4GS3A 4JI5Q 4OX9L 4OWWB 2H5XA 3PGZA 2VY3A 4DV6Q 3RNUA 1E1OA 3KF6B 2YTXA 1HNXL 1VQOA 4LFCL 2Y0SE 2VQEQ 1HR0L 4BY1G 1CUKA 1NMFA 2N3SA 1VQHA 3I55A 3RN5A 4A3CH 2F52A 2LSSA 1EYGA 5FJ8G 3CQZH 4JI7Q 3H15A 5E7NA 2CWPA 3M4QA 1KD1C 5LMNW 1WJJA 3M4PA 2RHQB 3U4VA 2Y0SG 4JV5L 1PYBA 1SR3A 2JA9A 4KI0A 4DK6C 3SGIA 2JA5H 3S2HH 4GKJQ 2NVYH 4TQUS 5M3MG 1HH2P 3F2CA 4JI5L 1TXYA 2BA1A 5EAYA 1OTCA 4IFDJ 2Q2UA 1SMXA 4C3IH 3K8AA 3VDYA 1C7YA 3UDIA 4B3SQ 1VQ9A 1NBWA 4RG1A 2JA5G 1AH9A 2F4VQ 1RL2A 3W1BA 2RF4A 3OTOQ 3F2DA 3GTQH 3I4OA 4B3RQ 4DV2L 1OXTA 3PUXA 4JBKA 3HOVG 2R93H 4R4TA 1V1QA 2IX0A 5IY0A 4MTNA 2KBNA 2GVAA 3RN2A 4IPHA 4L5RC 2K5HA 3MEFA 4JI8Q 3KJOA 1L1OA 1N34L 3G71A 2UXDL 3GTKH 4X65Q 1PH3A 1E22A 5FLMH 3JAMc 4JI3L 1PH4A 1JJGA 4A3KG 3CCUA 4P74A 3ICEA 2JA6H 4A3EH 4YCVA 1Z9FA 4EQ5A 3J81j 1YVCA 5M3FG 4BY7H 4HJ8A 2HHHQ 1A8VA 3RZOH 4B3SL 1B70B 3PV0A 4IJHA 3I4NG 2OWOA 3DLLA 2HT1A 1V9PA 3A0JA 5C3EH 1QZHA 4BY7G 1X9NA 1KQSA 4P72A 4DR1L 3H3VI 4R4QA 5IE8A 5IWAQ 4IPGA 1XNQQ 5M5YH 1HR0W 2BA0A 3H0GG 2ID0A 3HOXH 1OXVA 1VQGA 3CPWA 3HOZG 4DV1Q 4JI4L 2DUDA 3KDFA 4PZ8A 4QGUA 1NTGA 4JOIA 5ELNA 4X6AH 1VQAA 4X65L 1QVCA 2CWAA 1Q81C 1K9MC 3A5UA 3HOXG 1VQ7A 1JJCB 2JEBI 2R92H 4LUZA 2B29A 4JI6L 1KRSA 3GTMH 3ULJA 4LF9L 2I5LX 4KHPQ 2VNUD 5IP9G 3RLFA 4BA2I 4IFDG 2ZTEA 1WOCA 2JQOA 1CKMA 4GNXC 1YJ9A 4AQYL 2K5NA 3CCLA 1I5FA 1M90C 4LFBQ 1K8AC 3M9BA 3FKIG 3KDFB 5IYDG 5C0XI 1VQCA 1P16A 4OWXB 2ZJPA 2VUMG 4DV7Q 2UUAQ 2ZTCA 4LF6L 4H02A 4AH6A 1X56A 3M4OH 5LMNQ 4NXMQ 2N8NA 2HIXA 2NN6G 1CSPA 2JA8G 1XPOA 1S40A 1JJ2A 1XMQQ 2VQFQ 1PFSA 1SRUA 2EXDA 3JC66 3L0OA 4JC0A 1S72A 5LMUQ 1XNRL 3KLWA 3AFPA 4POGA 3S15H 3CC4A 2DGYA 3PIOA 4GNXA 3GTLH 2NZHA 1VQ5A 3B6YA 4A4IA 1I3QH 3ULPA 4BXXH 1YJNA 4HIDA 4DV0Q 4UY8C 2UUCL 5HGQA 3GO5A 1IBMQ 3L2PA 4DR4Q 1Q1EA 1AE2A 1Z47A 1LYLA 2B63H 1M1KC 3I4MG 2N49A 2NVQH 4X62Q 5GAHC 1KC8C 3BU2A 4B3MQ 5IYBH 4L5SA 4NXML 2EQSA 3GTOH 3S1NH 5HY6A 1KRTA 3M85A 3AYHB 4HJ7A 2OQKA 2B63G 2AWOA 1VQIA 1X6OA 1X55A 2PI2A 3AQQA 2V1CC 3L7ZC 4BBRG 5LMUL 5BR8Q 4Y7NH 4DR7Q 1IL2A 1VQFA 1UE6A 1TWGH 3CPFA 4IPCA 4J15A 1PA6A 4B3TQ 1HNZQ 4DV5Q 3RLNA 3H3VH 1TWHH 4LF8Q 1WCMH 1N36L 4A3JH 3JAMi 2QGQA 1J5EQ 2FXQA 3UE0A 4DV0L 3W5OA 5GAEC 4GKKQ 1W3SA 1GVPA 4LFAQ 2Q2IA 4A3FG 4JI2Q 4R4OA 1PYSB 2GN5A 4BBSH 2IHEA 3PCOB 2Z6KC 4DR3L 4LF5Q 4TVAB 1EIFA 1UE5A 1PH5A 3CCVA 2CCZA 3CF5A 3KFUA 2JK8A 3TRZA 1K0RA 2ALYB 1YNXA 4L5TA 1L1OC 1D8LA 3J81c 3NEMA 4ALPA 4LF7Q 4A3CG 4HIOA 3DM3A 4B3TL 2KHJA 1HNZL 3WWVA 5DLQE 3S17H 1HNWQ 1EIYB 3J7A5 2UXCL 4GN3B 3TEHB 4GN5A 2XGTA 5GADC 3K7UC 4A3BH 4DV6L 1VQKA 3HFZB 4YHHQ 2A1AA 4LFAL 3PUWA 1NMGA 4AYBE 3CW2C 5IP7H 2VQEL 2MNAA 4IOAA 2WB1G 2Z6KA 2PQAA 5AJ3Q 2K5VA 5IYCH 2BH8A 4A3BG 1N32Q 4JI7L 3ZJYC 1XMOQ 1Y1VH 2LXJA 2AMCB 2OQ0A 4GLVB 2IY5B 1KXLA 1LM0A 3FP9A 4NPSA 2K14A 3CXCA 1PH6A 3GTPH 3HOYH 1O7IA 4O2DA 5C44H 2UU9Q 4JBJA 2R93G 4WJ3M 2LXKA 1Q1BA 3FHWA 4LF7L 5IYCG 4WJ4A 4JOIC 4AYBG 4A75A 4A3MH 3TS2A 1WFQA 1E3PA 3CP0A 4P73A 1VCIA 1SFOH 1E7ZA 4GKJL 1J6QA 1GO3E 1HZBA 1HNWL 3HOYG 1Q8KA 5C44G 4OO1I 3T1HQ 2R7DA 1VQJA 4L5QA 3PUYA 1N9WA 2KENA 5FLMG 1YJWA 2JA7H 1PHJA 1HJPA 4DR6Q 2Q2HA 4YHHL 5FLXc 2KHIA 3KJPA 2F4VL 4DAMA 4DR2Q 3T1YQ 5J3BA 4YWKA 3OTOL 4A3EG 2JA6G 1N8RC 1VS0A 4B3RL 5AJ3L 3CAMA 3U4ZA 2B3GA 3GTGH 3TQYA 1L1OB 3K80C 1XMOL 3CD6A 5JEAJ 2ZJRA 1MIUA 4PZ7A 1AE3A 1OXXK 1X3FA 2Z0SA 4JI8L 5C3EG 3NELA 3GDEA 1IZ6A 1SLJA 3RZDH 1XTDA 4HIMA 2UUBQ 3GD7A 4OWTB 1E1TA 2OTLA 3AFQA 4AIMA 3CCEA 3J80i 1K3RA 1W2BA 3HKZE 3T1HL 1EFWA 4DUZQ 4OXPA 1PVOA 2HHHL 2E8GA 2WFWA 4EX5A 2VW9A 2R92G 1A0IA 4LUOA 1XPUA 1C9OA 1HZCA 1FJGQ 1VQ6A 1MJCA 1Q46A 1QVFA 4A3IH 4LUVA 1FVIA 2AWNA 5IWAL 1YITA 1XJVA 3HKZG 1XNQL 1A62A 1CKNA 1N33Q 3PO3H 1YI2A 1Q7YC 1GKHA 1E24A 4UPAA 3UDFA 4DV1L 4A3DH 1FL0A 4NB3A 2I5MX 2HIVA 2ZJQA 2YYZA 4UP7A 3G4SA 1RIPA 1S3OA 4C3JH 4X66Q 1NJIC 1VQLA 1LUZA 1VQNA 2R7ZH 3Q8DA 4KHPL 1JT8A 2AHOB 4HIKA 4R4CA 4JYAQ 1FJGL 5C4XH 3EIVA 4PZ6A 1EQRA 3U50C 3EN2A 3S1MH 4LFBL 2EIFA 2L15A 3BZKA 4ME3A 5C0XJ 4YWLA 1Q12A 2I0QA 3F8TA 1KHIA 4DV7L 1X3GA 1I6HH 4DUYQ 1MJEA 2UUAL 4QIWE 3OYYA 4BXXG 1L0WA 4DR5Q 2NVXH 2ES2A 5JEAG 4K0KQ 3PO2H 3D31A 5LMNL 4A3LH 1QUQA 2KCTA 3LGJA 1SN8A 3W1GA 1G6PA 1X65A 2WAQG 1XMQL 4MZ9A 2VQFL 4GNXB 1YBYA 4NXNQ 5IYBG 2MQHA 4X64Q 3STBD 4OO1G 1NY4A 3BZCA 1XPRA 1IXRA 1ASYA 5JJLA 1I94Q 1IBLQ 1B8AA 3RLOA 4UP8A 4OX9Q 1Y1WH 4A93H 2JJQA 1UE1A 1IBML 1K73C 1UWVA 2PNHA 1G291 3E9IA 1HNXQ 3HOUH 4DR4L 4LFCQ 1D7QA 2IHFA 1HR0Q 1WCMG 1HZ9A 1EWIA 4A3JG 4X62L 2JEAI 4DR5L 4A93G 5M5XH 2D0PA 4B3ML 3HKSA 3OW2A 3G6EA 3K0XA 4DNIA 4GOPC 3HOWH 1R9TH 1VQDA 2YTVA 5BR8L 1EQQA 4BBSG 4DR7L 4JI1Q 1UE7A 4DAYB 4JV5Q 1YHAA 4JCVE 2ZM6Q 1BKBA 4IOCA 4DV5L 1PH1A 1CSQA 2WB1E 1HZAA 4IPDA 4A76A 4BY1H 4LF8L 1H95A 4IFDI 1Y14B 4HJ9A 1X54A 1J5EL 5K36G 1TWFH 2F3IA 2OTJA 4C2MH 4YY3Q 1JMCA 4GKKL 3UDXA 5FJ8H 1BVSA 4RMFA 3K7AH 1QVGA 2YTYA 3E0EA 3NENA 5C0XG 4LF4Q 2ATWA 4DV2Q 4JI2L 1ASZA 4LF5L 4GOPA 1EOVA 2N78A 5M3MH 1N34Q 3KYHC 5IP7G 2UXDQ 2QEXA 3CMEA 2NN6I 3CC7A 3CCSA 1TWAH 4JI1L 2HQLA 2E5LQ 1KAWA 4JI3Q 2ZM6L 4XTCS 5GROA 2WP8J 1Y1VG 1OXUA 2K50A 2A19A 4BA1I 2VS1A 3BJUA 3I56A 3CCRA 4PMWA 4DV4Q 3HOVH 3S2DH 4YY3L 4APVA 3F1ZA 4A3MG 4QY7A 3RR5A 1K8GA 4P75A 5C4JH 2PQAB 1JE5A 4QJFA 4LF4L 2E2JH 4GOPB 2OCEA 4DV3Q 4DR1Q 2E2IH 2IX1A 4QQBX 1OXSC 4YCWA 2JA7G 2CQOA 3ERSX 1N32L 5GQOA 3PIPA 4FDBA 4A3KH 1LTLA 2RCNA 3NBHB 4JI4Q 1VQBA 1X3EA 4JBWA 2AKWB 1C0AA 5M3FH 2UU9L 1G51A 3S24A 1U5KA 1WYDA 1CKOA 3ER0A 4POFA 2E5LL 1BBUA 3I4NH 1YHQA 5ELOA 1YEZA 2CKZB 2I5HA 4JI6Q 4DV4L 2VL6A 4LF9Q 3TS0A 4GLAC
chains in the Genus database with same CATH superfamily
4LWCA 3I7FA 4NW2A 5FLXL 4QB4A 3HOZH 4H0LC 3AEVA 5C5LA 3D4RA 1A15A 1PV4A 3MXNA 4DK1A 3K7AB 2YV5A 5LL6X 3BVGA 4H13C 4OGQC 1VQMA 2D62A 1EY0A 4IALA 5M9OA 4KJOA 2E2HH 3MAQA 1BCPD 2EJGC 4IFDH 1Q3LA 2RVLA 3EA6A 4HN7A 1ESFA 5M3MB 3S16H 3GTJH 3D0FA 3OMGA 4FO2A 4FXGC 4BS9A 2X69A 4O42A 5DEHA 1VQ8A 3J7ZC 1KLUD 1TKWB 3Q22A 1HRJA 2CFMA 1ET9A 2LS01 3I91A 3MXNB 3J81i 1PH2A 1F2MA 4KV6A 2UUCQ 1L2FA 4K8IA 4LW1A 3J81E 3CCJA 3HG9A 2UXBQ 5CGKA 2F03A 5I9PA 4HSPA 1CTMA 4KY5A 1T9HA 1Q82C 4HJ5A 4ZAIA 1WI5A 3S1RH 2PZUA 2RHSB 4DAPA 4YCUA 3I4NB 3PO2G 1NE3A 1VQEA 4PMCA 5H1SE 2WKCA 4HJAA 1DM0B 4RH6A 4X3KA 3EROA 3OW7A 1A3TA 3HOZB 1CI3M 1M4VA 1TWCH 1V43A 1QJOA 2L4NA 4CJ1B 5JJIA 1IYVA 4DUYL 1IBKL 3HOXB 3A74A 3OHXC 3T53B 1I4QA 3U58A 3HOUG 2F3WA 3HS0C 4N9TA 1LLRD 4R4IA 1FGUA 1MD2D 1YNNC 2K52A 2BDOA 3S16B 1CT1D 1DONA 1I94L 3HOWG 4K5VA 3K81C 4OX9L 3NQTA 1Y8OB 1VF7A 2F0WA 4DV6Q 1E1OA 1TY0A 4JVZA 4FYDA 5KYLA 2QEJC 3CQZH 4IN3A 3V2TA 5E7NA 1W6KA 4K2KA 3DWPA 3U4VA 1PYBA 1SR3A 2NVYH 4TQUS 5M3MG 1HH2P 1GHKA 1RTOA 4J1MA 1B3AA 3P75A 4ZRZA 1VQ9A 2F4VQ 4K5XA 2MJ8A 4PNYA 5K5PA 2RF4A 3F2DA 3SEBA 4OEMB 4HSVA 3T51B 2B2YA 3M7GA 3HOVG 2B63B 3MEHA 1V1QA 2GVAA 4IPHA 3BS1A 2K5HA 4JI8Q 1BCPC 2K32A 1JJGA 4A3KG 4ZUIA 4A3EH 4EQ5A 1Z9FA 1YVCA 4BY7H 2EY1A 4B3SL 3MFGA 3I4NG 1V9PA 1HTLD 4K5WA 4DK0A 5C3EH 2SNMA 2VXWA 2Z1CA 1X9NA 5ELDA 3GQBA 2J0TD 4R4QA 3VR4A 3H3VI 1HR0W 3PQIA 2B2WA 4IZ8A 2K01A 1VQGA 5JPMC 3OOCA 3CPWA 3HOZG 4PZ8A 2VB2X 2RKSA 4X6AH 1VQAA 1JE4A 3HOXG 1VQ7A 2R92H 1JJCB 2LMCB 4FNFA 5D3IB 3D6CA 3ULJA 4CJ0B 4LF9L 2I5LX 4IFDG 5C4ZA 1EYAA 2NVYB 2EPBA 2F0KA 4AQYL 4C56C 2WB1B 2PW5A 1A3VA 3TP8A 1TT2A 4DV7Q 1LTBD 4K6DA 1Y8NB 2UUAQ 1GUSA 4LF6L 1DD2A 3MWYW 2N8NA 4NKLA 5F2DA 4RHSA 1EFID 1S40A 2KQ3A 2CVRA 4DXFA 1XMQQ 4BA2I 2EDGA 4TRDA 4A3EB 3B6YA 1YJNA 4DV0Q 5JEAH 5HGQA 2VB3X 1CQFA 1MGSA 3L2PA 5C3EB 3H09A 1STHA 2NVQH 3BU2A 4L5SA 1O7ZA 1K8MA 4ZCKA 2JXMB 3GTOH 2B63G 2R61A 2OQKA 2AWOA 1VQIA 3CRKC 4FP5D 1TWGH 3LNNA 4J15A 1PA6A 1F9PA 4DV5Q 4LF8Q 1WCMH 2EJFC 1SNCA 1C48A 1W3SA 1STAA 5T1GA 3CHBD 1RHPA 5IT9L 2A68D 3AMUA 2EY2A 4R4OA 5A2QL 5C3XA 3QG1A 4LF5Q 1EIFA 1PH5A 3CCVA 5BN5A 5K36H 2AQ3B 2ALYB 3NEMA 5DLQE 3S17H 2A6HD 1I4HA 5C0XH 3C46A 1EIYB 3J7A5 1E2VA 1I4RA 2WV6D 1LT5D 3K7UC 1MSHA 2EYOA 2PYKA 3V05A 3K59A 1I4XA 3HFZB 1VQKA 4LFAL 1GJXA 2IJ0A 2VQEL 3I90A 2MNAA 3S1MB 2WB1G 2EYFA 3NE5B 2K5VA 1M8AA 1EWCA 2BH8A 5IYCH 4JI7L 2WAQB 1XMOQ 2NVQB 1LM0A 3FP9A 5DM63 1PH6A 3GTPH 1O7IA 5C44H 3GTOB 3QWNA 4WJ4A 4LF7L 1PTOB 5DM73 3CP0A 3ND8A 3G7LA 1SSOA 1HNWL 2K5QA 4OO1I 2EVBA 1TWGB 1YJWA 5IGCA 2EYJA 1HJPA 2Q2HA 4YHHL 2SDFA 4DR2Q 3OTOL 4YWKA 4A3EG 1JWSD 5AJ3L 1L1OB 2DNCA 3CD6A 3VYRA 1OXXK 2Z0SA 5C3EG 3GP7A 2F0UA 1IZ6A 3BG3A 3JAML 1H9SB 1W2BA 1K3RA 4XQNA 3T1HL 5IT9E 1EFWA 2ZXRA 1MHWC 3SXHA 4C1NK 4CDDC 2PZWA 1CA6A 1LACA 1A0IA 2R92G 1XPUA 1HZCA 2L1BA 1VQ6A 1Q46A 1WTOA 3ZYYX 1XJVA 1XNQL 1CKNA 4ZKCB 1DOKA 1YI2A 1Q7YC 1GKHA 1E2WA 3UDFA 3RUZA 4DV1L 4A3DH 5IGBA 4NB3A 2I5MX 4UHVA 4UP7A 1HA6A 1HCZA 2WACA 1X3QA 3GTPB 1VQLA 1FR3A 2QCPX 2K1BA 2R7ZH 2X6LA 4V0BA 4RA8A 4JYAQ 5C4XH 3AU7A 4X3UA 3EIVA 1S5BD 3U50C 4LFBL 4KJNA 4IUUA 1KDCA 1X3GA 1QNKA 1WTHA 3K6OA 4KN7C 1L0WA 4DR5Q 3A7LA 2ES2A 5JEAG 5ELCA 4A3LH 3D31A 1B3QA 2N88A 3LGJA 1SN8A 1G6PA 1X65A 4CDFC 2F0NA 2WAQG 2V4DA 2KCCA 2L5TA 1PRTF 1U4RA 2IL8A 1PFMA 1Y1WH 2A6ED 5I9OA 1IBML 2TSSA 2PNHA 1G291 2Z8LA 4LFCQ 1HR0Q 2EJMA 1WCMG 5EBCA 1WTRA 1EWIA 2PQEA 4X62L 5M5XH 3HKSA 3NTIA 3J80L 1I6VC 1TS5A 2E74C 4OELB 4A3DB 1IKMA 4EQNA 5KEEA 1DZ1A 4GOPC 3MFYA 4DU9A 2XNAC 3T13A 5BR8L 2NVTB 5EQ0A 4JCVE 3BDLA 1BKBA 4RKLA 4A76A 4BY1H 5K36G 1TWFH 2R7ZB 2OTJA 4A3GB 3SK4A 1BVSA 1PYWD 1Z6HA 5C4XB 2YTYA 5C0XG 2JA8B 1LV9A 1KTKA 3Q6SA 1XX8A 4I7ZC 1TWAH 4JI1L 1SMYD 2OF1A 3KBGA 1B53A 5GROA 1EZ8A 2A74C 1I50B 2A19A 2VS1A 3BJUA 3FDTA 4DV4Q 3S2DH 3A56A 4P75A 5C4JH 3U9OA 1JE5A 1RCVD 1SYGA 3HZXA 1Y1WB 4LF4L 4ID6A 4DR1Q 2IX1A 4G7OC 3QB3A 4YCWA 2KUMA 5TSSA 3ERSX 1N32L 4FDBA 2RCNA 3NBHB 5JJZA 4JI4Q 4H44C 3C1EA 1G2TA 5M3FH 1XYIA 3F2UA 1U5KA 4C1NI 1YHQA 2K03A 2XWJB 2I5HA 4JI6Q 1LTGD 4DFAA 2GA4B 5DNFA 1SDFA 2EOTA 2BDNA 4DR6L 1PH9A 4BY1B 1SAPA 4R1JA 4ULLA 2XTIA 3T1YL 1B44D 1NR4A 2Z4IA 3WOFA 4DV3L 2NB0A 2HCCA 4IO9A 2YU9H 2F3VA 3NPPA 2MUYA 1G6ZA 1SNMA 1IYJB 3CCQA 2Y0SB 4XIGS 1TVXA 5IP9H 2UUBL 4RGMA 2SEBD 4A3DG 4FF3A 1EUJA 3DXJC 3FKIH 2JA5B 2K05A 1BBWA 3SDZA 1JB7A 2A6EC 1F2ZA 2JYOA 5GAGC 2A8VA 1DYQA 1CQVA 2PO4A 2XWBB 5C4JB 2R7ZG 2NN6H 4A3GG 2R93B 5IGFA 4IJLA 3I2ZA 5C4XG 4JI0Q 1SE2A 3M3YH 3GV3A 3I72A 3PSIA 1NSNS 3CCMA 1ML0D 4X66L 3DEPA 4IQZA 4A3LG 1SROA 1Z7TA 3DM1A 1SBBB 1KDAA 3RZOB 1MKHA 4CBVA 1DGSA 3BDOA 3A8IE 4GLXA 1EQTA 3K5LA 4P2CB 4P71A 2UXBL 2H4OA 2RDFA 1QUQB 4KLKA 4QUFA 4RKBA 1Y1WG 2YU9B 4DGZA 1WVLA 4K0KL 3J80c 1LT3D 3E0JA 2L55A 4JBMA 1YZ6A 4DPGA 1SMYC 4LNQA 1PZKD 4RCOA 3IRBA 4NXNL 4OL7A 4X64L 2JE6I 2R6GA 3BVZA 4A3FH 1QZGA 2UXCQ 1EIGA 1EY6A 3QOLA 2K28A 3HKZB 2EXZA 2H5XA 1GHJA 2K33A 1HNXL 2BE5D 4BY1G 1VQHA 1L0XB 1LTSD 1RODA 3SK8A 2F52A 5E4XA 3M4OB 2CWPA 3M4QA 5JVG3 1KD1C 2Z6BA 3M3YB 3J81L 3M4PA 2RHQB 2Y0SG 2EY5A 1D2BA 2JA9A 4KI0A 4DK6C 3S2HH 3RD4A 4GKJQ 1AZQA 4CDEC 4IFDJ 2F0VA 5EAYA 1FNUA 3VDYA 2Q2UA 3K8AA 1GUWA 3UDIA 4ZKBB 4RG1A 2JA5G 5IGGA 3W1BA 4EVOA 1UNSA 3I4OA 1OXTA 1WTXA 4R4TA 2KBNA 2H1EA 3MZ5A 3RN2A 3KBXA 1N34L 3G71A 4QIWB 2UXDL 3J7YW 4ZUJA 4X65Q 5ELBA 4I65A 4JI3L 1PH4A 2CH4A 4FF1A 5M3FG 4HJ8A 2HHHQ 1A8VA 3DUZA 3FVQA 4EQPA 1B70B 3E6ZX 3DLLA 2HT1A 4A3FB 3LWEA 4DNRB 1QZHA 2NZ1D 4P72A 5M5YH 1ILPA 2BA0A 3HOXH 1H9MA 4RGTA 1OXVA 3CU7A 1BCPF 5ELNA 3FPPA 4JK1C 4KKSA 3TZUA 3IFDA 3TSSA 3NUCA 1WTQA 1ICWA 3S2HB 5IP9G 1YJ9A 1GXDC 1D1KA 2WIIB 4A3BB 1I5FA 3FKIG 3OMCA 4Q5VA 1P16A 4OWXB 3OWEB 2ZTCA 2OEOA 4H02A 4AH6A 4AYBB 5LMNQ 5CV6A 4NXMQ 4FF2A 2NN6G 1CSPA 2B2VC 1XPOA 3HOYB 2VQFQ 2EXDA 3L0OA 5FO7B 3JC66 5C6AA 1GUTA 4A3MB 5LMUQ 1S72A 5KRUA 1XNRL 1PZID 3AFPA 3S15H 3CC4A 2DY8A 4GNXA 3MXPA 2NZHA 3VA7A 3GTLH 3ULPA 1U9RA 4BXXH 4HIDA 2F0JA 1FNVA 1DOLA 1SYDA 2BE5C 3W3AA 4ODGA 4EGVA 3GO5A 4U673 4DR4Q 1HUNA 1Z47A 2B63H 5D14A 3TP7A 1M1KC 5E1FA 4B3MQ 3GTGB 4XT1B 4OO1H 5M5YB 4KY6A 2NUCA 5HY6A 3S1NH 1SYBA 1KRTA 4HJ7A 3IFTA 1GUOA 1X6OA 3AQQA 3L7ZC 2V1CC 5I4DA 5AFWA 4DR7Q 1ET6A 4BWGB 3CPFA 4B3TQ 1Q8IA 3K58A 4DAYA 1N36L 2Q8RE 3H91A 2FXQA 4DV0L 4B9XA 4KD3A 2A69D 3Q24A 2BOSA 2NTTA 4A3FG 4DR3L 4XXEA 5J22A 1ZYRC 3DHQA 3KLRA 2CCZA 1H9KA 2ZXPA 4L5TA 3J81c 1D8LA 4ALPA 2KHJA 3WWVA 4KTAA 5EKKA 5CV7A 1KABA 5G3LD 3S15B 5NUCA 3OWFA 3H94A 3GTLB 1ENFA 4O1NA 1NMGA 2L12A 2Z6KA 2PQAA 2K7VA 4X3SA 4A3BG 3PMFA 1ZEQX 2AMCB 1V1PA 2EY6A 2QW7A 3CXCA 5JVH3 1DOMA 2UU9Q 4WJ3M 3S1NB 5KNBA 1FD7D 4AYBG 4A75A 4P73A 1VCIA 1JORA 1E7ZA 3J7AV 2F0EA 4X3TA 3HOYG 2R7DA 1VQJA 2DJGC 3PUYA 1PHJA 5FLXc 1GOZA 5J3BA 2PZTA 1STGA 5T1IA 1N8RC 4B3RL 3U4ZA 2B3GA 1D5XC 1H9JA 1NUCA 1XMOL 5JEAJ 1EYCA 1B50A 3NELA 3URYA 5ISRA 4HCSA 1SLJA 4N8X1 2CQAA 4JPBW 4HMJA 2RDGA 2MHVA 3KLSX 4M8AA 1KAAA 4OXPA 5JOBA 2E8GA 2I46A 2ICIA 1C9OA 4CJ2C 3NBIA 1QVFA 3LX0A 4A3IH 4LUVA 2AWNA 5IWAL 4IUQA 1PFBA 1FNWA 1CK1A 5CYUA 3I3CA 3SK5A 3KF8A 3G4SA 2DY7A 2F0DA 3HRZC 1SNPA 4RCNA 1NJIC 4LJZC 3Q8DA 4KHPL 5FOBB 3Q23A 2AHOB 2FJ2A 2NTSA 2A69C 4PZ6A 5EBDA 3S1MH 1RTNA 4G7HC 3BZKA 2L15A 5C0XJ 1Q12A 5EGTA 2L11A 3SK6A 1S5DD 1I6HH 4DUYQ 1BO0A 3GV6A 4BXXG 3ITPA 4ZQ3A 1IW7D 1S4ZA 1TQOA 1VDZA 2RQXA 3A7AB 2KCTA 1YNJD 3W1GA 3VR6A 1PTOH 5IOCA 4MZ9A 1B9MA 4F88A 2MQHA 1CHPD 4OO1G 1ASYA 1I94Q 4OX9Q 2XSCA 4DF7A 1K73C 1T5XD 2NWGA 4IURA 1HUMA 4DNTB 2JEAI 4UDUC 4DR5L 4A3IB 1VF5C 1PRTB 2LY7A 1NCVA 2G9DA 3K0XA 4DNIA 1EYDA 1EU3A 2YTVA 3PIO3 3HGBA 4XDXA 2PPBC 4L63B 1YHAA 5M5WB 1HZAA 2F0MA 2RSNA 3C1FA 1H95A 4IFDI 1Y14B 2HQEA 1X54A 1J5EL 2F3IA 1RD9D 4YY3Q 4GKKL 2VUMB 1J8IA 5FJ8H 4CHTB 2AUKA 3NENA 1DXMA 4JI2L 3IL8A 1I6HB 1EOVA 5EJWA 5I6WA 4CDCC 1GUGA 1KNEA 4MTKA 3CC7A 2HQLA 1SE3A 1KAWA 1OXUA 3S14B 1JB3A 1EQVA 3TDQA 1F77A 4APVA 2NYZD 3F1ZA 2B2UA 3I4LA 5CC4A 2E2JH 1L0YB 3D4DA 1HA5A 3A54A 3R8BA 2OCEA 1Y8PB 2E2IH 2F0SA 1LTRD 1QOHA 2CQOA 5GQOA 4JBWA 2AKWB 4C3HB 1G51A 4LAAA 1CKOA 4OIJA 3L9AX 1YEZA 1B2TA 3EQLC 3W2DA 4DV4L 2VL6A 4LF9Q 4K2LA 1FYCA 2SNSA 4GLAC 2K5DA 1SEBD 3CC2A 2MFIA 4AQYQ 2B2TC 2VZAA 2ASBA 1GUNA 2PI2E 1GD7A 5HGTA 4LK1C 2DJFC 2JP1A 1PH8A 1PDQA 1IW7C 4DAVA 4LF6Q 4R8NA 1YHBA 1SYEA 4CKEA 4WFN3 4HMIA 1YNJC 3NK9A 4A3IG 1O7YA 3UDGA 2NVTH 3TP6A 4DKAC 1SE8A 4DUZL 1Q86C 2KOLA 5IYDH 4A3GH 4C3IB 1IKLA 1CKNB 4DK3C 5JJKA 3A55A 3VYSA 1K28A 5CBAE 2RBMA 1TR5A 3EFXD 2JA8H 1N33L 4MHEA 1JCKB 3S9WA 2E2JB 2E2IB 3E9HA 3PF5A 1ESRA 2Q8TA 1VQ4A 4YWMA 5C5MA 1A2UA 4J8QA 2D0OA 2ZXOA 1SNOA 2C35B 1I50H 1A3UA 1UEBA 3G6JB 1VQPA 3TREA 1Q90A 2FMCA 3S1QH 1PH7A 1C8CA 3A5ZB 5I2YA 2PMZE 2KHSA 1P8LA 2R7FA 3QR8A 4GN4B 4L8JA 5IT9c 2WKDA 4HTHA 2ZTDA 2IWHA 4JI0L 3VR2A 2EYLA 4PG3A 2B2VA 1SE4A 1EY9A 3K5OA 2QA4A 3ULLA 1HXYD 1BNZA 4OONA 1SJED 2PCFB 2GVBA 4KHZA 1S5FD 4O0AA 3TMEA 3F2BA 3PUZA 1IBLL 4JG2A 2EYMA 1QCBD 4JI5Q 3PGZA 3IKJA 2RDHA 1LTTD 2YTXA 5FK9C 1VQOA 2Y0SE 2VQEQ 1UAPA 3WDNA 3U9SA 3RN5A 2B2YC 2LSSA 4JI7Q 5FJ8G 3H15A 2F0TA 3A8KE 5EPLA 5LMNW 1WJJA 1G8ZD 4JV5L 4PMBA 3SGIA 2QDBA 2JA5H 1JWMD 4PQXA 3KLSA 1TXYA 2BA1A 1LO5D 3NTKA 3OIPA 1QE6A 1NBWA 1PTOD 1AH9A 1RL2A 3TZDA 2A73B 3OTOQ 3GTQH 3S1QB 1RJTA 4DV2L 2R93H 2IX0A 1CHQD 3VR5A 3X3NA 2B2WC 3TBIB 1PH3A 5FLMH 3JAMc 5C3WA 1EEID 3T56B 4YCVA 3J81j 2BCOA 3V96A 5BN3A 3RZOH 3BYTB 1TWHB 4IJHA 3FRPB 3ONAB 3A0JA 4ABNA 1R4QB 1KQSA 1EOTA 4IPGA 1XNQQ 3WOEA 1EY4A 1QB5D 3VR3A 3K5NA 4DV1Q 2DUDA 1BXTA 2AQ1B 4X65L 2CWAA 1Q81C 2RSOA 5LL6S 2JEBI 2B29A 1KRSA 2XRSD 3GTMH 2IX3A 1JOQA 3RLFA 1E2ZA 5EKLA 1F9QA 2ZTEA 2JQOA 1CKMA 2KCNA 1BCPB 1M90C 4LFBQ 2E2DC 3M9BA 1K8AC 5IYDG 3VYTA 1VQCA 5C0XI 2ZJPA 3GTQB 4DN4M 2RA4A 1V1OA 3M4OH 1D5MC 2WINB 1Y1VB 2HIXA 4EQOA 2JA8G 2J4XA 1JJ2A 4RHRA 4KHVA 4DA2A 3H6MA 3PIOA 2J7ZA 3T4AC 1I3QH 3CRLC 2E76C 2M00A 3P7JA 2UUCL 1IBMQ 5LHY1 1LYLA 4NP5A 4X62Q 5GAHC 4NXML 1JC7A 3AYHB 1QG7A 5E3FA 5LMUL 3OSOA 5BR8Q 4Y7NH 1WTWA 2MP1A 1SYCA 3EVQA 3Q0AA 3K5MA 1HNZQ 1II3A 3H3VH 2HUGA 3GTMB 1PTOC 1EIHA 4N8FA 5JPNC 1PYSB 1HFNA 3MVVA 1NAPA 1UE5A 2CW0C 2FHTA 5CV8A 1ILQA 2D5DA 1K0RA 1A6XA 1YNXA 1L1OC 3NWSA 4HIOA 3DM3A 2I07B 4B3TL 2KVMA 2HDMA 2KA7A 4CGYB 1S5CD 3TEHB 1LABA 5GADC 4XQQA 4A3BH 4DV6L 1I3QB 2A1AA 4AYBE 3CW2C 4IUVA 4IOAA 1VMPA 3DEOA 1MBYA 4MN3A 1N32Q 3ZJYC 2D2CC 1JR0D 2LXJA 2IY5B 2OQ0A 4GLVB 1KXLA 3PO2B 3HOYH 1EU4A 2R93G 1Q1BA 3KK7A 4JOIC 1ZYRD 4A3MH 3TS2A 2LFNA 1WFQA 1E3PA 1SFOH 3QO2A 1J6QA 4TKOB 1HZBA 4Y7NB 2F4IA 1AEXA 1KLGD 1KNAA 3D6WA 5FLMG 4DR6Q 1SNQA 3KJPA 4A93B 2F4VL 3T1YQ 3ND9A 3CAMA 2K6AA 3A8JE 3MTSA 3GTGH 3K80C 1MI2A 1RF2D 3LWUA 1MIUA 2B8FA 2SOBA 4JI8L 4KD4A 3GDEA 4G57A 3RZDH 2UUBQ 2KEEA 3GD7A 4OWTB 1E1TA 5EKIA 2OTLA 4AIMA 3KUPA 5I2XA 1PVOA 2IPKD 4PV1C 4C2MB 1FJGQ 4TSSA 1MJCA 3AB9A 3RMHA 2FMMA 3P20A 3HKZG 1A62A 2HCIA 1CFMA 3NP8A 3PO3H 2OT2A 4UPAA 1HPCA 1FL0A 3MHBA 4QCLA 2HIVA 4JW0A 5CR3A 4C3JH 4X66Q 2FFKB 2K04A 1LUZA 1XTCD 1SFOB 5CV9A 2B2TA 3FMCA 3VA5A 5KYIA 3HEJA 3HOVB 1TU2B 2N55A 1FGBD 4ME3A 4YWLA 3F8TA 2F0IA 1KHIA 4DV7L 2K5WA 1MJEA 2UUAL 3OYYA 5KNCA 4K0KQ 4A3KB 3VYUA 1W6JA 1XMQL 1C4QA 2D9UA 1YBYA 4GNXB 3RZDB 4X64Q 4NXNQ 3STBD 3BZCA 5FO9B 1IXRA 1K0SA 4IUNA 1HQMC 2JJQA 1IL8A 3P1HA 1UWVA 1HNXQ 1DJRD 3E9IA 2IHFA 1HZ9A 4A93G 4RGNA 5ELFA 3OW2A 1CZGA 1STYA 3BYYB 1EZ6A 3PO3B 4FF4A 2E2HB 1D1IA 5FLXE 4GZYC 1VQDA 1EQQA 1UE7A 4DAYB 4CKBA 3GTJB 5D3DA 1XXGA 3FPUB 5G3LF 4C3JB 2ZM6Q 4DV5L 4IOCA 2WB1E 4IPDA 4LF8L 2QKIC 3MXUA 2QILA 1UEAB 4RMFA 1G91A 3E0EA 2RCFA 5FO8B 4LF5L 4GOPA 2N78A 1N34Q 3KYHC 3J7AF 2QEXA 3CMEA 2ICEC 2NN6I 2UXDQ 1EY8A 3S1RB 2E5LQ 4JI3Q 4XTCS 2WP8J 4XQJA 4BA1I 2TMPA 4PMWA 2O5IC 2F0QA 4YY3L 3MA2B 4A3MG 3RR5A 1Y69U 1K8GA 2PQAB 4QJFA 4KKTA 4GOPB 1BOSA 1TWCB 1V1PB 1I4PA 1X3EA 1C0AA 5FKAC 3S24A 5I6YA 3ER0A 4POFA 1LTID 4HAEA 3BVMA 4LMQD 3TS0A 1D7QA 3OPOA 1NNXA 4Q0FA 1KL9A 1KIXA 3H0GH 2G9HD 2KCMA 2Z4HA 2F0HA 4DR2L 1JOKA 2F0LA 1EL0A 4DXGA 3G48A 1AFPA 4HCEA 1AN8A 3CQZB 3CMAA 2HD3A 4N9PA 5ELEA 2K75A 4XT3B 2XIWA 3PF4A 2B8GA 1A63A 3STBC 3PO3G 1XNRQ 4H7BA 5M5WH 3MXGA 4Y52H 5CMDA 2VUMH 3I8ZA 3UE1A 4C3JG 3M7NA 2C5CA 1E0BA 1DCZA 2K4KA 1SNDA 4RAUC 2WAQE 1JWUD 1K83H 2QDLA 3NHHA 1EY5A 3KF8B 4QL5A 1GM5A 2HDLA 1IBKQ 1YIJA 3EBEA 1ONLA 4WJWA 3TP5A 3D3RA 1PMRA 5EPKA 1U0LA 2BH2A 3S14H 1QNUA 1K8OA 2MO1A 4MIUA 3MC0B 3I4MH 1B7YB 5CV5A 4K8JA 1N36Q 4BY7B 4JYAL 2ENBA 4WORA 3H0GB 3HP3A 1IYUA 2IT1A 2M2LA 4BBRH 1WD1A 5IGDA 2MO0A 3KF6A 4DR3Q 4C3HH 2NZOA 1EWHA 4QF4A 2KJXA 4FXKC 1TS3A 1SXTA 2G5DA 1BUVT 1B1ZA 3PUVA 2R92B 4MNOA 1V8QA 3E5SA 3KOJA 4UP9A 2Q2TA 1X3PA 3M4YA 1RDPD 4GS3A 4U68A 4OWWB 1HQRD 2VY3A 3RNUA 2DN8A 3KF6B 4LFCL 1HR0L 1CUKA 1NMFA 2N3SA 4R9WA 3I55A 3H3VC 4F87A 1S5ED 4A3CH 1K83B 1EYGA 1JICA 1X32A 3R3OA 1PZJD 2P5ZX 2F0PA 3K57A 5CORA 2XVSA 4K14A 5EPJA 3NTHA 5HURA 1LT4D 1OTCA 4JI5L 1SMXA 4C3IH 1AZPA 1B9NA 1G2SA 4OHJA 1C7YA 4B3SQ 3I4MB 4B3RQ 3PUXA 4JBKA 5IY0A 1QILA 1BQQT 4MTNA 5E4WC 4F7XA 4KY7A 4L5RC 2X6GA 3NXWA 4BBRB 3MEFA 3KJOA 3IAYA 1L1OA 2F1MA 4XYQA 3GTKH 4I7AA 1E22A 3CCUA 4ZYSA 4P74A 3ICEA 2JA6H 1H9SA 3PV0A 1WCMB 2OWOA 5KIXA 2EZVA 3D4WA 3N52A 2ZT9C 1U4LA 4BY7G 4DR1L 5IWAQ 4IUTA 5IE8A 3R2TA 3C3LA 3H0GG 4S3SA 2ID0A 1I4GA 2EE1A 4QMGA 4JI4L 4QGUA 3KDFA 1NTGA 4JOIA 1QVCA 1BBXC 1K9MC 3A5UA 1ENAA 4LUZA 4JI6L 4J6HA 5D65A 3S17B 4KHPQ 2VNUD 1R4PB 2O5JC 1HTPA 5A2QE 1WOCA 4GNXC 1BDOA 2K5NA 5J1ZA 3CCLA 4B9WA 3PIP3 1CZWA 1PFNA 1UUPA 3KDFB 1SJHD 4XYOA 2A5HA 2VUMG 1VMCA 5KGUA 1O80A 1F2LA 1X56A 1STEA 3OIQA 1CM9A 1TS2A 3T16A 2B39A 1PLFA 5C44B 5COYA 1PFSA 1SRUA 5C4HA 4JC0A 3GTKB 3R2IA 3DWQA 1RKNA 3KLWA 4POGA 2DGYA 2CH4W 1EEFD 1QWYA 2JA6B 1VQ5A 4A4IA 2PW7A 1KDBA 5DAUA 2A68C 1A2TA 2M9VA 4ILWA 4UY8C 3ERQA 1Q1EA 1AE2A 3I4MG 2N49A 1KC8C 5IYBH 2AUJD 2EQSA 4E6IA 3M85A 1X55A 2PI2A 3O13A 4BBRG 2A6HC 4NDXA 3NWTA 1VQFA 1UE6A 2KECA 1IL2A 5CV4A 4C3HG 4IPCA 3I73A 1STBA 3RLNA 1TWHH 1PRTD 1BF4A 4A3JH 3JAMi 2QGQA 1J5EQ 3UE0A 3W5OA 5GAEC 4GKKQ 1LTAD 1GVPA 4LFAQ 3E3XA 3JAME 2Q2IA 3NQIA 4JI2Q 2GN5A 4BBSH 2IHEA 3PCOB 2Z6KC 4TVAB 2MPMA 4ZK9B 3CF5A 3KFUA 2JK8A 5IGEA 3TRZA 4LF7Q 4A3CG 4KK7A 1HNZL 3NSWA 4KMUC 1HNWQ 1WTPA 2UXCL 4GN3B 1PTOF 1AW7A 4GN5A 2XGTA 3I70A 4YHHQ 2PNRC 3PUWA 5IODA 5IP7H 4NMZA 5AJ3Q 4C3IG 1HFGA 5BN4A 1Y1VH 4RFBA 2R3ZA 4NPSA 2JSOA 2K14A 3K0YA 4O2DA 1EY7A 4JBJA 3NBHA 2LXKA 3FHWA 2CW0D 4F8MA 2DNEA 5IYCG 2JN4A 3QIAA 3DMUA 4GKJL 1GO3E 1HHVA 1Q8KA 5C44G 4IUPA 1JOOA 3T1HQ 2CHBD 4L5QA 2JA7H 1N9WA 2KENA 2KHIA 4A3JB 1WD0A 4DAMA 2JA6G 1VS0A 1BR9A 4FVMA 3TQYA 1MSGA 2PMZB 4OIKA 2ZJRA 4PZ7A 5M5XB 3L3OC 1AE3A 1X3FA 4BBSB 2L0CA 5J39A 1XTDA 4HIMA 2FINB 2O4XA 3AFQA 3N6RA 3CCEA 3J80i 3HKZE 1D5ZC 4DUZQ 5L37A 2HHHL 1AP0A 2WFWA 4L6TB 1OO9B 1T5EA 4EX5A 2VW9A 4ME5A 4LUOA 3BDCA 3J80E 1TWFB 1ICFB 2L9HA 4K6LA 1FVIA 2EYPA 4YIJA 1YITA 2AQ2B 1ZXTA 2IW3A 1JQYD 1N33Q 3DWAA 1E24A 4R8IA 1J9OA 5A35A 2ZJQA 2YYZA 2KEDA 1S3OA 1CA5A 2XRQD 2F0FA 2QF7A 1TWAB 2EYHA 1PRTC 5CBEE 4FXDA 4ZLTF 1VQNA 3QJYA 1JT8A 4HIKA 3UI2A 4R4CA 3S2DB 1LT6D 2F0GA 1FJGL 2JA7B 1EQRA 1U4MA 3EN2A 1U4PA 2EIFA 2I0QA 3EJIA 4RWSC 1F2YA 4QIWE 4WRDA 1WTVA 2NVXH 3PO2H 1TY2A 5LMNL 1QUQA 4G7ZC 2Z9HA 4V190 5JAVA 1B4OA 5M3FB 3R93A 2VQFL 1TS4A 5IYBG 2XN9C 1NY4A 1TIID 1XPRA 1O78A 5JJLA 1IBLQ 2LKVA 1B8AA 4UAIA 3RLOA 4UP8A 4A93H 2OXPA 1ZKOA 1UE1A 3CKIB 1ENCA 4DR4L 3HOUH 4HR7B 4A3JG 1SYFA 2D0PA 4B08A 4B3ML 4HEDA 3SE0A 3G6EA 3TN2A 3HOWH 2E75C 1R9TH 1K3BC 1XWEA 4DR7L 4BBSG 4JI1Q 4JV5Q 3SVMA 1PH1A 1CSQA 3FKIB 4HJ9A 4KKUA 2C9OA 2NBFA 4C2MH 1JMCA 3C2PA 3UDXA 3K7AH 2B2UC 1QVGA 1F9RA 4LF4Q 2ATWA 3D8GA 1H9RA 1PXUA 3SHLA 3X3MA 4DV2Q 1ASZA 2O2LD 4G4KA 2F0OA 1NR2A 3FEWX 5M3MH 2MGSA 2NVXB 5IP7G 4M1UB 3CCSA 2ZM6L 1Y1VG 2K50A 1YNND 3I56A 3CCRA 3HOVH 3BZDB 4Z9CB 1O7LA 4QY7A 2Q8IB 3QOJA 4DV3Q 4QQBX 1OXSC 3HOUB 2JA7G 1STNA 1IHZA 4CKCA 3PIPA 4A3KH 1LTLA 1VQBA 2UU9L 1WYDA 2E5LL 5KNDA 1BBUA 3I4NH 5ELOA 2CKZB 3HOWB 1D6EC 1R9TB 3SR1A 4RGOS 4KN4C 1RIPA 4QUCA 1F9SA 5IIFA 3F2CA
chains in the Genus database with same CATH topology
4LWCA 1KL9A 1KIXA 3CC2A 3I7FA 2MFIA 3H0GH 4DR6L 2KCMA 3HOZH 1PH9A 4R1JA 4AQYQ 3AEVA 2VZAA 2XTIA 4DR2L 2ASBA 3T1YL 4DV3L 2PI2E 1GD7A 1PV4A 2YU9H 4IO9A 2YV5A 1PH8A 3G48A 2D62A 1VQMA 1YHBA 4LF6Q 3CCQA 1IYJB 4XIGS 2E2HH 3CMAA 4A3IG 5IP9H 3UDGA 2UUBL 2K75A 2NVTH 1A63A 3PF4A 3S16H 3GTJH 3STBC 3PO3G 4A3DG 1XNRQ 3D0FA 4DKAC 5M5WH 1SE8A 1EUJA 4DUZL 1Q86C 4Y52H 3FKIH 1BBWA 5IYDH 1JB7A 1VQ8A 3J7ZC 2VUMH 4A3GH 2CFMA 3MXNB 3J81i 3UE1A 5GAGC 1PH2A 2A8VA 3M7NA 4DK3C 1CKNB 5JJKA 2K4KA 2UUCQ 1L2FA 4LW1A 2R7ZG 2WAQE 2JA8H 1K83H 4A3GG 1N33L 3CCJA 3KF8B 2UXBQ 4IJLA 3I2ZA 4QL5A 1GM5A 3E9HA 1IBKQ 3PF5A 4JI0Q 5C4XG 1VQ4A 3M3YH 4YWMA 1Q82C 1T9HA 3PSIA 1YIJA 3EBEA 4HJ5A 2D0OA 1WI5A 3CCMA 3S1RH 2C35B 2RHSB 1U0LA 1I50H 4YCUA 4X66L 2BH2A 3S14H 3PO2G 1NE3A 1VQEA 4A3LG 2MO1A 1SROA 1UEBA 1VQPA 1B7YB 5H1SE 3TREA 3I4MH 1N36Q 1MKHA 4JYAL 1DGSA 4HJAA 3S1QH 1PH7A 4GLXA 3A5ZB 2PMZE 1P8LA 2R7FA 1TWCH 1V43A 4GN4B 5IT9c 5JJIA 4P71A 2IT1A 2UXBL 1QUQB 4KLKA 4DUYL 2ZTDA 4BBRH 1IBKL 4JI0L 1Y1WG 2MO0A 3KF6A 4PG3A 4DR3Q 3J80c 4K0KL 3A74A 2NZOA 4C3HH 3U58A 2QA4A 4JBMA 3HOUG 1YZ6A 4DPGA 3ULLA 4OONA 4LNQA 3IRBA 2GVBA 4R4IA 4NXNL 3PUVA 1FGUA 2JE6I 2K52A 4MNOA 4KHZA 2R6GA 4O0AA 4X64L 3KOJA 4UP9A 3PUZA 3F2BA 2Q2TA 1I94L 4JG2A 4A3FH 1QZGA 1IBLL 3HOWG 2UXCQ 3K81C 4GS3A 4JI5Q 4OX9L 4OWWB 2H5XA 3PGZA 2VY3A 4DV6Q 3RNUA 1E1OA 3KF6B 2YTXA 1HNXL 1VQOA 4LFCL 2Y0SE 2VQEQ 1HR0L 4BY1G 1CUKA 1NMFA 2N3SA 1VQHA 3I55A 3RN5A 4A3CH 2F52A 2LSSA 1EYGA 5FJ8G 3CQZH 4JI7Q 3H15A 5E7NA 2CWPA 3M4QA 1KD1C 5LMNW 1WJJA 3M4PA 2RHQB 3U4VA 2Y0SG 4JV5L 1PYBA 1SR3A 2JA9A 4KI0A 4DK6C 3SGIA 2JA5H 3S2HH 4GKJQ 2NVYH 4TQUS 5M3MG 1HH2P 3F2CA 4JI5L 1TXYA 2BA1A 5EAYA 1OTCA 4IFDJ 2Q2UA 1SMXA 4C3IH 3K8AA 3VDYA 1C7YA 3UDIA 4B3SQ 1VQ9A 1NBWA 4RG1A 2JA5G 1AH9A 2F4VQ 1RL2A 3W1BA 2RF4A 3OTOQ 3F2DA 3GTQH 3I4OA 4B3RQ 4DV2L 1OXTA 3PUXA 4JBKA 3HOVG 2R93H 4R4TA 1V1QA 2IX0A 5IY0A 4MTNA 2KBNA 2GVAA 3RN2A 4IPHA 4L5RC 2K5HA 3MEFA 4JI8Q 3KJOA 1L1OA 1N34L 3G71A 2UXDL 3GTKH 4X65Q 1PH3A 1E22A 5FLMH 3JAMc 4JI3L 1PH4A 1JJGA 4A3KG 3CCUA 4P74A 3ICEA 2JA6H 4A3EH 4YCVA 1Z9FA 4EQ5A 3J81j 1YVCA 5M3FG 4BY7H 4HJ8A 2HHHQ 1A8VA 3RZOH 4B3SL 1B70B 3PV0A 4IJHA 3I4NG 2OWOA 3DLLA 2HT1A 1V9PA 3A0JA 5C3EH 1QZHA 4BY7G 1X9NA 1KQSA 4P72A 4DR1L 3H3VI 4R4QA 5IE8A 5IWAQ 4IPGA 1XNQQ 5M5YH 1HR0W 2BA0A 3H0GG 2ID0A 3HOXH 1OXVA 1VQGA 3CPWA 3HOZG 4DV1Q 4JI4L 2DUDA 3KDFA 4PZ8A 4QGUA 1NTGA 4JOIA 5ELNA 4X6AH 1VQAA 4X65L 1QVCA 2CWAA 1Q81C 1K9MC 3A5UA 3HOXG 1VQ7A 1JJCB 2JEBI 2R92H 4LUZA 2B29A 4JI6L 1KRSA 3GTMH 3ULJA 4LF9L 2I5LX 4KHPQ 2VNUD 5IP9G 3RLFA 4BA2I 4IFDG 2ZTEA 1WOCA 2JQOA 1CKMA 4GNXC 1YJ9A 4AQYL 2K5NA 3CCLA 1I5FA 1M90C 4LFBQ 1K8AC 3M9BA 3FKIG 3KDFB 5IYDG 5C0XI 1VQCA 1P16A 4OWXB 2ZJPA 2VUMG 4DV7Q 2UUAQ 2ZTCA 4LF6L 4H02A 4AH6A 1X56A 3M4OH 5LMNQ 4NXMQ 2N8NA 2HIXA 2NN6G 1CSPA 2JA8G 1XPOA 1S40A 1JJ2A 1XMQQ 2VQFQ 1PFSA 1SRUA 2EXDA 3JC66 3L0OA 4JC0A 1S72A 5LMUQ 1XNRL 3KLWA 3AFPA 4POGA 3S15H 3CC4A 2DGYA 3PIOA 4GNXA 3GTLH 2NZHA 1VQ5A 3B6YA 4A4IA 1I3QH 3ULPA 4BXXH 1YJNA 4HIDA 4DV0Q 4UY8C 2UUCL 5HGQA 3GO5A 1IBMQ 3L2PA 4DR4Q 1Q1EA 1AE2A 1Z47A 1LYLA 2B63H 1M1KC 3I4MG 2N49A 2NVQH 4X62Q 5GAHC 1KC8C 3BU2A 4B3MQ 5IYBH 4L5SA 4NXML 2EQSA 3GTOH 3S1NH 5HY6A 1KRTA 3M85A 3AYHB 4HJ7A 2OQKA 2B63G 2AWOA 1VQIA 1X6OA 1X55A 2PI2A 3AQQA 2V1CC 3L7ZC 4BBRG 5LMUL 5BR8Q 4Y7NH 4DR7Q 1IL2A 1VQFA 1UE6A 1TWGH 3CPFA 4IPCA 4J15A 1PA6A 4B3TQ 1HNZQ 4DV5Q 3RLNA 3H3VH 1TWHH 4LF8Q 1WCMH 1N36L 4A3JH 3JAMi 2QGQA 1J5EQ 2FXQA 3UE0A 4DV0L 3W5OA 5GAEC 4GKKQ 1W3SA 1GVPA 4LFAQ 2Q2IA 4A3FG 4JI2Q 4R4OA 1PYSB 2GN5A 4BBSH 2IHEA 3PCOB 2Z6KC 4DR3L 4LF5Q 4TVAB 1EIFA 1UE5A 1PH5A 3CCVA 2CCZA 3CF5A 3KFUA 2JK8A 3TRZA 1K0RA 2ALYB 1YNXA 4L5TA 1L1OC 1D8LA 3J81c 3NEMA 4ALPA 4LF7Q 4A3CG 4HIOA 3DM3A 4B3TL 2KHJA 1HNZL 3WWVA 5DLQE 3S17H 1HNWQ 1EIYB 3J7A5 2UXCL 4GN3B 3TEHB 4GN5A 2XGTA 5GADC 3K7UC 4A3BH 4DV6L 1VQKA 3HFZB 4YHHQ 2A1AA 4LFAL 3PUWA 1NMGA 4AYBE 3CW2C 5IP7H 2VQEL 2MNAA 4IOAA 2WB1G 2Z6KA 2PQAA 5AJ3Q 2K5VA 5IYCH 2BH8A 4A3BG 1N32Q 4JI7L 3ZJYC 1XMOQ 1Y1VH 2LXJA 2AMCB 2OQ0A 4GLVB 2IY5B 1KXLA 1LM0A 3FP9A 4NPSA 2K14A 3CXCA 1PH6A 3GTPH 3HOYH 1O7IA 4O2DA 5C44H 2UU9Q 4JBJA 2R93G 4WJ3M 2LXKA 1Q1BA 3FHWA 4LF7L 5IYCG 4WJ4A 4JOIC 4AYBG 4A75A 4A3MH 3TS2A 1WFQA 1E3PA 3CP0A 4P73A 1VCIA 1SFOH 1E7ZA 4GKJL 1J6QA 1GO3E 1HZBA 1HNWL 3HOYG 1Q8KA 5C44G 4OO1I 3T1HQ 2R7DA 1VQJA 4L5QA 3PUYA 1N9WA 2KENA 5FLMG 1YJWA 2JA7H 1PHJA 1HJPA 4DR6Q 2Q2HA 4YHHL 5FLXc 2KHIA 3KJPA 2F4VL 4DAMA 4DR2Q 3T1YQ 5J3BA 4YWKA 3OTOL 4A3EG 2JA6G 1N8RC 1VS0A 4B3RL 5AJ3L 3CAMA 3U4ZA 2B3GA 3GTGH 3TQYA 1L1OB 3K80C 1XMOL 3CD6A 5JEAJ 2ZJRA 1MIUA 4PZ7A 1AE3A 1OXXK 1X3FA 2Z0SA 4JI8L 5C3EG 3NELA 3GDEA 1IZ6A 1SLJA 3RZDH 1XTDA 4HIMA 2UUBQ 3GD7A 4OWTB 1E1TA 2OTLA 3AFQA 4AIMA 3CCEA 3J80i 1K3RA 1W2BA 3HKZE 3T1HL 1EFWA 4DUZQ 4OXPA 1PVOA 2HHHL 2E8GA 2WFWA 4EX5A 2VW9A 2R92G 1A0IA 4LUOA 1XPUA 1C9OA 1HZCA 1FJGQ 1VQ6A 1MJCA 1Q46A 1QVFA 4A3IH 4LUVA 1FVIA 2AWNA 5IWAL 1YITA 1XJVA 3HKZG 1XNQL 1A62A 1CKNA 1N33Q 3PO3H 1YI2A 1Q7YC 1GKHA 1E24A 4UPAA 3UDFA 4DV1L 4A3DH 1FL0A 4NB3A 2I5MX 2HIVA 2ZJQA 2YYZA 4UP7A 3G4SA 1RIPA 1S3OA 4C3JH 4X66Q 1NJIC 1VQLA 1LUZA 1VQNA 2R7ZH 3Q8DA 4KHPL 1JT8A 2AHOB 4HIKA 4R4CA 4JYAQ 1FJGL 5C4XH 3EIVA 4PZ6A 1EQRA 3U50C 3EN2A 3S1MH 4LFBL 2EIFA 2L15A 3BZKA 4ME3A 5C0XJ 4YWLA 1Q12A 2I0QA 3F8TA 1KHIA 4DV7L 1X3GA 1I6HH 4DUYQ 1MJEA 2UUAL 4QIWE 3OYYA 4BXXG 1L0WA 4DR5Q 2NVXH 2ES2A 5JEAG 4K0KQ 3PO2H 3D31A 5LMNL 4A3LH 1QUQA 2KCTA 3LGJA 1SN8A 3W1GA 1G6PA 1X65A 2WAQG 1XMQL 4MZ9A 2VQFL 4GNXB 1YBYA 4NXNQ 5IYBG 2MQHA 4X64Q 3STBD 4OO1G 1NY4A 3BZCA 1XPRA 1IXRA 1ASYA 5JJLA 1I94Q 1IBLQ 1B8AA 3RLOA 4UP8A 4OX9Q 1Y1WH 4A93H 2JJQA 1UE1A 1IBML 1K73C 1UWVA 2PNHA 1G291 3E9IA 1HNXQ 3HOUH 4DR4L 4LFCQ 1D7QA 2IHFA 1HR0Q 1WCMG 1HZ9A 1EWIA 4A3JG 4X62L 2JEAI 4DR5L 4A93G 5M5XH 2D0PA 4B3ML 3HKSA 3OW2A 3G6EA 3K0XA 4DNIA 4GOPC 3HOWH 1R9TH 1VQDA 2YTVA 5BR8L 1EQQA 4BBSG 4DR7L 4JI1Q 1UE7A 4DAYB 4JV5Q 1YHAA 4JCVE 2ZM6Q 1BKBA 4IOCA 4DV5L 1PH1A 1CSQA 2WB1E 1HZAA 4IPDA 4A76A 4BY1H 4LF8L 1H95A 4IFDI 1Y14B 4HJ9A 1X54A 1J5EL 5K36G 1TWFH 2F3IA 2OTJA 4C2MH 4YY3Q 1JMCA 4GKKL 3UDXA 5FJ8H 1BVSA 4RMFA 3K7AH 1QVGA 2YTYA 3E0EA 3NENA 5C0XG 4LF4Q 2ATWA 4DV2Q 4JI2L 1ASZA 4LF5L 4GOPA 1EOVA 2N78A 5M3MH 1N34Q 3KYHC 5IP7G 2UXDQ 2QEXA 3CMEA 2NN6I 3CC7A 3CCSA 1TWAH 4JI1L 2HQLA 2E5LQ 1KAWA 4JI3Q 2ZM6L 4XTCS 5GROA 2WP8J 1Y1VG 1OXUA 2K50A 2A19A 4BA1I 2VS1A 3BJUA 3I56A 3CCRA 4PMWA 4DV4Q 3HOVH 3S2DH 4YY3L 4APVA 3F1ZA 4A3MG 4QY7A 3RR5A 1K8GA 4P75A 5C4JH 2PQAB 1JE5A 4QJFA 4LF4L 2E2JH 4GOPB 2OCEA 4DV3Q 4DR1Q 2E2IH 2IX1A 4QQBX 1OXSC 4YCWA 2JA7G 2CQOA 3ERSX 1N32L 5GQOA 3PIPA 4FDBA 4A3KH 1LTLA 2RCNA 3NBHB 4JI4Q 1VQBA 1X3EA 4JBWA 2AKWB 1C0AA 5M3FH 2UU9L 1G51A 3S24A 1U5KA 1WYDA 1CKOA 3ER0A 4POFA 2E5LL 1BBUA 3I4NH 1YHQA 5ELOA 1YEZA 2CKZB 2I5HA 4JI6Q 4DV4L 2VL6A 4LF9Q 3TS0A 4GLAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LWC A;  1KL9 A;  1KIX A;  3CC2 A;  3I7F A;  2MFI A;  3H0G H;  4DR6 L;  2KCM A;  3HOZ H;  1PH9 A;  4R1J A;  4AQY Q;  3AEV A;  2VZA A;  2XTI A;  4DR2 L;  2ASB A;  3T1Y L;  4DV3 L;  2PI2 E;  1GD7 A;  1PV4 A;  2YU9 H;  4IO9 A;  2YV5 A;  1PH8 A;  3G48 A;  2D62 A;  1VQM A;  1YHB A;  4LF6 Q;  3CCQ A;  1IYJ B;  4XIG S;  2E2H H;  3CMA A;  4A3I G;  5IP9 H;  3UDG A;  2UUB L;  2K75 A;  2NVT H;  1A63 A;  3PF4 A;  3S16 H;  3GTJ H;  3STB C;  3PO3 G;  4A3D G;  1XNR Q;  3D0F A;  4DKA C;  5M5W H;  1SE8 A;  1EUJ A;  4DUZ L;  1Q86 C;  4Y52 H;  3FKI H;  1BBW A;  5IYD H;  1JB7 A;  1VQ8 A;  3J7Z C;  2VUM H;  4A3G H;  2CFM A;  3MXN B;  3J81 i;  3UE1 A;  5GAG C;  1PH2 A;  2A8V A;  3M7N A;  4DK3 C;  1CKN B;  5JJK A;  2K4K A;  2UUC Q;  1L2F A;  4LW1 A;  2R7Z G;  2WAQ E;  2JA8 H;  1K83 H;  4A3G G;  1N33 L;  3CCJ A;  3KF8 B;  2UXB Q;  4IJL A;  3I2Z A;  4QL5 A;  1GM5 A;  3E9H A;  1IBK Q;  3PF5 A;  4JI0 Q;  5C4X G;  1VQ4 A;  3M3Y H;  4YWM A;  1Q82 C;  1T9H A;  3PSI A;  1YIJ A;  3EBE A;  4HJ5 A;  2D0O A;  1WI5 A;  3CCM A;  3S1R H;  2C35 B;  2RHS B;  1U0L A;  1I50 H;  4YCU A;  4X66 L;  2BH2 A;  3S14 H;  3PO2 G;  1NE3 A;  1VQE A;  4A3L G;  2MO1 A;  1SRO A;  1UEB A;  1VQP A;  1B7Y B;  5H1S E;  3TRE A;  3I4M H;  1N36 Q;  1MKH A;  4JYA L;  1DGS A;  4HJA A;  3S1Q H;  1PH7 A;  4GLX A;  3A5Z B;  2PMZ E;  1P8L A;  2R7F A;  1TWC H;  1V43 A;  4GN4 B;  5IT9 c;  5JJI A;  4P71 A;  2IT1 A;  2UXB L;  1QUQ B;  4KLK A;  4DUY L;  2ZTD A;  4BBR H;  1IBK L;  4JI0 L;  1Y1W G;  2MO0 A;  3KF6 A;  4PG3 A;  4DR3 Q;  3J80 c;  4K0K L;  3A74 A;  2NZO A;  4C3H H;  3U58 A;  2QA4 A;  4JBM A;  3HOU G;  1YZ6 A;  4DPG A;  3ULL A;  4OON A;  4LNQ A;  3IRB A;  2GVB A;  4R4I A;  4NXN L;  3PUV A;  1FGU A;  2JE6 I;  2K52 A;  4MNO A;  4KHZ A;  2R6G A;  4O0A A;  4X64 L;  3KOJ A;  4UP9 A;  3PUZ A;  3F2B A;  2Q2T A;  1I94 L;  4JG2 A;  4A3F H;  1QZG A;  1IBL L;  3HOW G;  2UXC Q;  3K81 C;  4GS3 A;  4JI5 Q;  4OX9 L;  4OWW B;  2H5X A;  3PGZ A;  2VY3 A;  4DV6 Q;  3RNU A;  1E1O A;  3KF6 B;  2YTX A;  1HNX L;  1VQO A;  4LFC L;  2Y0S E;  2VQE Q;  1HR0 L;  4BY1 G;  1CUK A;  1NMF A;  2N3S A;  1VQH A;  3I55 A;  3RN5 A;  4A3C H;  2F52 A;  2LSS A;  1EYG A;  5FJ8 G;  3CQZ H;  4JI7 Q;  3H15 A;  5E7N A;  2CWP A;  3M4Q A;  1KD1 C;  5LMN W;  1WJJ A;  3M4P A;  2RHQ B;  3U4V A;  2Y0S G;  4JV5 L;  1PYB A;  1SR3 A;  2JA9 A;  4KI0 A;  4DK6 C;  3SGI A;  2JA5 H;  3S2H H;  4GKJ Q;  2NVY H;  4TQU S;  5M3M G;  1HH2 P;  3F2C A;  4JI5 L;  1TXY A;  2BA1 A;  5EAY A;  1OTC A;  4IFD J;  2Q2U A;  1SMX A;  4C3I H;  3K8A A;  3VDY A;  1C7Y A;  3UDI A;  4B3S Q;  1VQ9 A;  1NBW A;  4RG1 A;  2JA5 G;  1AH9 A;  2F4V Q;  1RL2 A;  3W1B A;  2RF4 A;  3OTO Q;  3F2D A;  3GTQ H;  3I4O A;  4B3R Q;  4DV2 L;  1OXT A;  3PUX A;  4JBK A;  3HOV G;  2R93 H;  4R4T A;  1V1Q A;  2IX0 A;  5IY0 A;  4MTN A;  2KBN A;  2GVA A;  3RN2 A;  4IPH A;  4L5R C;  2K5H A;  3MEF A;  4JI8 Q;  3KJO A;  1L1O A;  1N34 L;  3G71 A;  2UXD L;  3GTK H;  4X65 Q;  1PH3 A;  1E22 A;  5FLM H;  3JAM c;  4JI3 L;  1PH4 A;  1JJG A;  4A3K G;  3CCU A;  4P74 A;  3ICE A;  2JA6 H;  4A3E H;  4YCV A;  1Z9F A;  4EQ5 A;  3J81 j;  1YVC A;  5M3F G;  4BY7 H;  4HJ8 A;  2HHH Q;  1A8V A;  3RZO H;  4B3S L;  1B70 B;  3PV0 A;  4IJH A;  3I4N G;  2OWO A;  3DLL A;  2HT1 A;  1V9P A;  3A0J A;  5C3E H;  1QZH A;  4BY7 G;  1X9N A;  1KQS A;  4P72 A;  4DR1 L;  3H3V I;  4R4Q A;  5IE8 A;  5IWA Q;  4IPG A;  1XNQ Q;  5M5Y H;  1HR0 W;  2BA0 A;  3H0G G;  2ID0 A;  3HOX H;  1OXV A;  1VQG A;  3CPW A;  3HOZ G;  4DV1 Q;  4JI4 L;  2DUD A;  3KDF A;  4PZ8 A;  4QGU A;  1NTG A;  4JOI A;  5ELN A;  4X6A H;  1VQA A;  4X65 L;  1QVC A;  2CWA A;  1Q81 C;  1K9M C;  3A5U A;  3HOX G;  1VQ7 A;  1JJC B;  2JEB I;  2R92 H;  4LUZ A;  2B29 A;  4JI6 L;  1KRS A;  3GTM H;  3ULJ A;  4LF9 L;  2I5L X;  4KHP Q;  2VNU D;  5IP9 G;  3RLF A;  4BA2 I;  4IFD G;  2ZTE A;  1WOC A;  2JQO A;  1CKM A;  4GNX C;  1YJ9 A;  4AQY L;  2K5N A;  3CCL A;  1I5F A;  1M90 C;  4LFB Q;  1K8A C;  3M9B A;  3FKI G;  3KDF B;  5IYD G;  5C0X I;  1VQC A;  1P16 A;  4OWX B;  2ZJP A;  2VUM G;  4DV7 Q;  2UUA Q;  2ZTC A;  4LF6 L;  4H02 A;  4AH6 A;  1X56 A;  3M4O H;  5LMN Q;  4NXM Q;  2N8N A;  2HIX A;  2NN6 G;  1CSP A;  2JA8 G;  1XPO A;  1S40 A;  1JJ2 A;  1XMQ Q;  2VQF Q;  1PFS A;  1SRU A;  2EXD A;  3JC6 6;  3L0O A;  4JC0 A;  1S72 A;  5LMU Q;  1XNR L;  3KLW A;  3AFP A;  4POG A;  3S15 H;  3CC4 A;  2DGY A;  3PIO A;  4GNX A;  3GTL H;  2NZH A;  1VQ5 A;  3B6Y A;  4A4I A;  1I3Q H;  3ULP A;  4BXX H;  1YJN A;  4HID A;  4DV0 Q;  4UY8 C;  2UUC L;  5HGQ A;  3GO5 A;  1IBM Q;  3L2P A;  4DR4 Q;  1Q1E A;  1AE2 A;  1Z47 A;  1LYL A;  2B63 H;  1M1K C;  3I4M G;  2N49 A;  2NVQ H;  4X62 Q;  5GAH C;  1KC8 C;  3BU2 A;  4B3M Q;  5IYB H;  4L5S A;  4NXM L;  2EQS A;  3GTO H;  3S1N H;  5HY6 A;  1KRT A;  3M85 A;  3AYH B;  4HJ7 A;  2OQK A;  2B63 G;  2AWO A;  1VQI A;  1X6O A;  1X55 A;  2PI2 A;  3AQQ A;  2V1C C;  3L7Z C;  4BBR G;  5LMU L;  5BR8 Q;  4Y7N H;  4DR7 Q;  1IL2 A;  1VQF A;  1UE6 A;  1TWG H;  3CPF A;  4IPC A;  4J15 A;  1PA6 A;  4B3T Q;  1HNZ Q;  4DV5 Q;  3RLN A;  3H3V H;  1TWH H;  4LF8 Q;  1WCM H;  1N36 L;  4A3J H;  3JAM i;  2QGQ A;  1J5E Q;  2FXQ A;  3UE0 A;  4DV0 L;  3W5O A;  5GAE C;  4GKK Q;  1W3S A;  1GVP A;  4LFA Q;  2Q2I A;  4A3F G;  4JI2 Q;  4R4O A;  1PYS B;  2GN5 A;  4BBS H;  2IHE A;  3PCO B;  2Z6K C;  4DR3 L;  4LF5 Q;  4TVA B;  1EIF A;  1UE5 A;  1PH5 A;  3CCV A;  2CCZ A;  3CF5 A;  3KFU A;  2JK8 A;  3TRZ A;  1K0R A;  2ALY B;  1YNX A;  4L5T A;  1L1O C;  1D8L A;  3J81 c;  3NEM A;  4ALP A;  4LF7 Q;  4A3C G;  4HIO A;  3DM3 A;  4B3T L;  2KHJ A;  1HNZ L;  3WWV A;  5DLQ E;  3S17 H;  1HNW Q;  1EIY B;  3J7A 5;  2UXC L;  4GN3 B;  3TEH B;  4GN5 A;  2XGT A;  5GAD C;  3K7U C;  4A3B H;  4DV6 L;  1VQK A;  3HFZ B;  4YHH Q;  2A1A A;  4LFA L;  3PUW A;  1NMG A;  4AYB E;  3CW2 C;  5IP7 H;  2VQE L;  2MNA A;  4IOA A;  2WB1 G;  2Z6K A;  2PQA A;  5AJ3 Q;  2K5V A;  5IYC H;  2BH8 A;  4A3B G;  1N32 Q;  4JI7 L;  3ZJY C;  1XMO Q;  1Y1V H;  2LXJ A;  2AMC B;  2OQ0 A;  4GLV B;  2IY5 B;  1KXL A;  1LM0 A;  3FP9 A;  4NPS A;  2K14 A;  3CXC A;  1PH6 A;  3GTP H;  3HOY H;  1O7I A;  4O2D A;  5C44 H;  2UU9 Q;  4JBJ A;  2R93 G;  4WJ3 M;  2LXK A;  1Q1B A;  3FHW A;  4LF7 L;  5IYC G;  4WJ4 A;  4JOI C;  4AYB G;  4A75 A;  4A3M H;  3TS2 A;  1WFQ A;  1E3P A;  3CP0 A;  4P73 A;  1VCI A;  1SFO H;  1E7Z A;  4GKJ L;  1J6Q A;  1GO3 E;  1HZB A;  1HNW L;  3HOY G;  1Q8K A;  5C44 G;  4OO1 I;  3T1H Q;  2R7D A;  1VQJ A;  4L5Q A;  3PUY A;  1N9W A;  2KEN A;  5FLM G;  1YJW A;  2JA7 H;  1PHJ A;  1HJP A;  4DR6 Q;  2Q2H A;  4YHH L;  5FLX c;  2KHI A;  3KJP A;  2F4V L;  4DAM A;  4DR2 Q;  3T1Y Q;  5J3B A;  4YWK A;  3OTO L;  4A3E G;  2JA6 G;  1N8R C;  1VS0 A;  4B3R L;  5AJ3 L;  3CAM A;  3U4Z A;  2B3G A;  3GTG H;  3TQY A;  1L1O B;  3K80 C;  1XMO L;  3CD6 A;  5JEA J;  2ZJR A;  1MIU A;  4PZ7 A;  1AE3 A;  1OXX K;  1X3F A;  2Z0S A;  4JI8 L;  5C3E G;  3NEL A;  3GDE A;  1IZ6 A;  1SLJ A;  3RZD H;  1XTD A;  4HIM A;  2UUB Q;  3GD7 A;  4OWT B;  1E1T A;  2OTL A;  3AFQ A;  4AIM A;  3CCE A;  3J80 i;  1K3R A;  1W2B A;  3HKZ E;  3T1H L;  1EFW A;  4DUZ Q;  4OXP A;  1PVO A;  2HHH L;  2E8G A;  2WFW A;  4EX5 A;  2VW9 A;  2R92 G;  1A0I A;  4LUO A;  1XPU A;  1C9O A;  1HZC A;  1FJG Q;  1VQ6 A;  1MJC A;  1Q46 A;  1QVF A;  4A3I H;  4LUV A;  1FVI A;  2AWN A;  5IWA L;  1YIT A;  1XJV A;  3HKZ G;  1XNQ L;  1A62 A;  1CKN A;  1N33 Q;  3PO3 H;  1YI2 A;  1Q7Y C;  1GKH A;  1E24 A;  4UPA A;  3UDF A;  4DV1 L;  4A3D H;  1FL0 A;  4NB3 A;  2I5M X;  2HIV A;  2ZJQ A;  2YYZ A;  4UP7 A;  3G4S A;  1RIP A;  1S3O A;  4C3J H;  4X66 Q;  1NJI C;  1VQL A;  1LUZ A;  1VQN A;  2R7Z H;  3Q8D A;  4KHP L;  1JT8 A;  2AHO B;  4HIK A;  4R4C A;  4JYA Q;  1FJG L;  5C4X H;  3EIV A;  4PZ6 A;  1EQR A;  3U50 C;  3EN2 A;  3S1M H;  4LFB L;  2EIF A;  2L15 A;  3BZK A;  4ME3 A;  5C0X J;  4YWL A;  1Q12 A;  2I0Q A;  3F8T A;  1KHI A;  4DV7 L;  1X3G A;  1I6H H;  4DUY Q;  1MJE A;  2UUA L;  4QIW E;  3OYY A;  4BXX G;  1L0W A;  4DR5 Q;  2NVX H;  2ES2 A;  5JEA G;  4K0K Q;  3PO2 H;  3D31 A;  5LMN L;  4A3L H;  1QUQ A;  2KCT A;  3LGJ A;  1SN8 A;  3W1G A;  1G6P A;  1X65 A;  2WAQ G;  1XMQ L;  4MZ9 A;  2VQF L;  4GNX B;  1YBY A;  4NXN Q;  5IYB G;  2MQH A;  4X64 Q;  3STB D;  4OO1 G;  1NY4 A;  3BZC A;  1XPR A;  1IXR A;  1ASY A;  5JJL A;  1I94 Q;  1IBL Q;  1B8A A;  3RLO A;  4UP8 A;  4OX9 Q;  1Y1W H;  4A93 H;  2JJQ A;  1UE1 A;  1IBM L;  1K73 C;  1UWV A;  2PNH A;  1G29 1;  3E9I A;  1HNX Q;  3HOU H;  4DR4 L;  4LFC Q;  1D7Q A;  2IHF A;  1HR0 Q;  1WCM G;  1HZ9 A;  1EWI A;  4A3J G;  4X62 L;  2JEA I;  4DR5 L;  4A93 G;  5M5X H;  2D0P A;  4B3M L;  3HKS A;  3OW2 A;  3G6E A;  3K0X A;  4DNI A;  4GOP C;  3HOW H;  1R9T H;  1VQD A;  2YTV A;  5BR8 L;  1EQQ A;  4BBS G;  4DR7 L;  4JI1 Q;  1UE7 A;  4DAY B;  4JV5 Q;  1YHA A;  4JCV E;  2ZM6 Q;  1BKB A;  4IOC A;  4DV5 L;  1PH1 A;  1CSQ A;  2WB1 E;  1HZA A;  4IPD A;  4A76 A;  4BY1 H;  4LF8 L;  1H95 A;  4IFD I;  1Y14 B;  4HJ9 A;  1X54 A;  1J5E L;  5K36 G;  1TWF H;  2F3I A;  2OTJ A;  4C2M H;  4YY3 Q;  1JMC A;  4GKK L;  3UDX A;  5FJ8 H;  1BVS A;  4RMF A;  3K7A H;  1QVG A;  2YTY A;  3E0E A;  3NEN A;  5C0X G;  4LF4 Q;  2ATW A;  4DV2 Q;  4JI2 L;  1ASZ A;  4LF5 L;  4GOP A;  1EOV A;  2N78 A;  5M3M H;  1N34 Q;  3KYH C;  5IP7 G;  2UXD Q;  2QEX A;  3CME A;  2NN6 I;  3CC7 A;  3CCS A;  1TWA H;  4JI1 L;  2HQL A;  2E5L Q;  1KAW A;  4JI3 Q;  2ZM6 L;  4XTC S;  5GRO A;  2WP8 J;  1Y1V G;  1OXU A;  2K50 A;  2A19 A;  4BA1 I;  2VS1 A;  3BJU A;  3I56 A;  3CCR A;  4PMW A;  4DV4 Q;  3HOV H;  3S2D H;  4YY3 L;  4APV A;  3F1Z A;  4A3M G;  4QY7 A;  3RR5 A;  1K8G A;  4P75 A;  5C4J H;  2PQA B;  1JE5 A;  4QJF A;  4LF4 L;  2E2J H;  4GOP B;  2OCE A;  4DV3 Q;  4DR1 Q;  2E2I H;  2IX1 A;  4QQB X;  1OXS C;  4YCW A;  2JA7 G;  2CQO A;  3ERS X;  1N32 L;  5GQO A;  3PIP A;  4FDB A;  4A3K H;  1LTL A;  2RCN A;  3NBH B;  4JI4 Q;  1VQB A;  1X3E A;  4JBW A;  2AKW B;  1C0A A;  5M3F H;  2UU9 L;  1G51 A;  3S24 A;  1U5K A;  1WYD A;  1CKO A;  3ER0 A;  4POF A;  2E5L L;  1BBU A;  3I4N H;  1YHQ A;  5ELO A;  1YEZ A;  2CKZ B;  2I5H A;  4JI6 Q;  4DV4 L;  2VL6 A;  4LF9 Q;  3TS0 A;  4GLA C; 
#chains in the Genus database with same CATH topology
 4LWC A;  3I7F A;  4NW2 A;  5FLX L;  4QB4 A;  3HOZ H;  4H0L C;  3AEV A;  5C5L A;  3D4R A;  1A15 A;  1PV4 A;  3MXN A;  4DK1 A;  3K7A B;  2YV5 A;  5LL6 X;  3BVG A;  4H13 C;  4OGQ C;  1VQM A;  2D62 A;  1EY0 A;  4IAL A;  5M9O A;  4KJO A;  2E2H H;  3MAQ A;  1BCP D;  2EJG C;  4IFD H;  1Q3L A;  2RVL A;  3EA6 A;  4HN7 A;  1ESF A;  5M3M B;  3S16 H;  3GTJ H;  3D0F A;  3OMG A;  4FO2 A;  4FXG C;  4BS9 A;  2X69 A;  4O42 A;  5DEH A;  1VQ8 A;  3J7Z C;  1KLU D;  1TKW B;  3Q22 A;  1HRJ A;  2CFM A;  1ET9 A;  2LS0 1;  3I91 A;  3MXN B;  3J81 i;  1PH2 A;  1F2M A;  4KV6 A;  2UUC Q;  1L2F A;  4K8I A;  4LW1 A;  3J81 E;  3CCJ A;  3HG9 A;  2UXB Q;  5CGK A;  2F03 A;  5I9P A;  4HSP A;  1CTM A;  4KY5 A;  1T9H A;  1Q82 C;  4HJ5 A;  4ZAI A;  1WI5 A;  3S1R H;  2PZU A;  2RHS B;  4DAP A;  4YCU A;  3I4N B;  3PO2 G;  1NE3 A;  1VQE A;  4PMC A;  5H1S E;  2WKC A;  4HJA A;  1DM0 B;  4RH6 A;  4X3K A;  3ERO A;  3OW7 A;  1A3T A;  3HOZ B;  1CI3 M;  1M4V A;  1TWC H;  1V43 A;  1QJO A;  2L4N A;  4CJ1 B;  5JJI A;  1IYV A;  4DUY L;  1IBK L;  3HOX B;  3A74 A;  3OHX C;  3T53 B;  1I4Q A;  3U58 A;  3HOU G;  2F3W A;  3HS0 C;  4N9T A;  1LLR D;  4R4I A;  1FGU A;  1MD2 D;  1YNN C;  2K52 A;  2BDO A;  3S16 B;  1CT1 D;  1DON A;  1I94 L;  3HOW G;  4K5V A;  3K81 C;  4OX9 L;  3NQT A;  1Y8O B;  1VF7 A;  2F0W A;  4DV6 Q;  1E1O A;  1TY0 A;  4JVZ A;  4FYD A;  5KYL A;  2QEJ C;  3CQZ H;  4IN3 A;  3V2T A;  5E7N A;  1W6K A;  4K2K A;  3DWP A;  3U4V A;  1PYB A;  1SR3 A;  2NVY H;  4TQU S;  5M3M G;  1HH2 P;  1GHK A;  1RTO A;  4J1M A;  1B3A A;  3P75 A;  4ZRZ A;  1VQ9 A;  2F4V Q;  4K5X A;  2MJ8 A;  4PNY A;  5K5P A;  2RF4 A;  3F2D A;  3SEB A;  4OEM B;  4HSV A;  3T51 B;  2B2Y A;  3M7G A;  3HOV G;  2B63 B;  3MEH A;  1V1Q A;  2GVA A;  4IPH A;  3BS1 A;  2K5H A;  4JI8 Q;  1BCP C;  2K32 A;  1JJG A;  4A3K G;  4ZUI A;  4A3E H;  4EQ5 A;  1Z9F A;  1YVC A;  4BY7 H;  2EY1 A;  4B3S L;  3MFG A;  3I4N G;  1V9P A;  1HTL D;  4K5W A;  4DK0 A;  5C3E H;  2SNM A;  2VXW A;  2Z1C A;  1X9N A;  5ELD A;  3GQB A;  2J0T D;  4R4Q A;  3VR4 A;  3H3V I;  1HR0 W;  3PQI A;  2B2W A;  4IZ8 A;  2K01 A;  1VQG A;  5JPM C;  3OOC A;  3CPW A;  3HOZ G;  4PZ8 A;  2VB2 X;  2RKS A;  4X6A H;  1VQA A;  1JE4 A;  3HOX G;  1VQ7 A;  2R92 H;  1JJC B;  2LMC B;  4FNF A;  5D3I B;  3D6C A;  3ULJ A;  4CJ0 B;  4LF9 L;  2I5L X;  4IFD G;  5C4Z A;  1EYA A;  2NVY B;  2EPB A;  2F0K A;  4AQY L;  4C56 C;  2WB1 B;  2PW5 A;  1A3V A;  3TP8 A;  1TT2 A;  4DV7 Q;  1LTB D;  4K6D A;  1Y8N B;  2UUA Q;  1GUS A;  4LF6 L;  1DD2 A;  3MWY W;  2N8N A;  4NKL A;  5F2D A;  4RHS A;  1EFI D;  1S40 A;  2KQ3 A;  2CVR A;  4DXF A;  1XMQ Q;  4BA2 I;  2EDG A;  4TRD A;  4A3E B;  3B6Y A;  1YJN A;  4DV0 Q;  5JEA H;  5HGQ A;  2VB3 X;  1CQF A;  1MGS A;  3L2P A;  5C3E B;  3H09 A;  1STH A;  2NVQ H;  3BU2 A;  4L5S A;  1O7Z A;  1K8M A;  4ZCK A;  2JXM B;  3GTO H;  2B63 G;  2R61 A;  2OQK A;  2AWO A;  1VQI A;  3CRK C;  4FP5 D;  1TWG H;  3LNN A;  4J15 A;  1PA6 A;  1F9P A;  4DV5 Q;  4LF8 Q;  1WCM H;  2EJF C;  1SNC A;  1C48 A;  1W3S A;  1STA A;  5T1G A;  3CHB D;  1RHP A;  5IT9 L;  2A68 D;  3AMU A;  2EY2 A;  4R4O A;  5A2Q L;  5C3X A;  3QG1 A;  4LF5 Q;  1EIF A;  1PH5 A;  3CCV A;  5BN5 A;  5K36 H;  2AQ3 B;  2ALY B;  3NEM A;  5DLQ E;  3S17 H;  2A6H D;  1I4H A;  5C0X H;  3C46 A;  1EIY B;  3J7A 5;  1E2V A;  1I4R A;  2WV6 D;  1LT5 D;  3K7U C;  1MSH A;  2EYO A;  2PYK A;  3V05 A;  3K59 A;  1I4X A;  3HFZ B;  1VQK A;  4LFA L;  1GJX A;  2IJ0 A;  2VQE L;  3I90 A;  2MNA A;  3S1M B;  2WB1 G;  2EYF A;  3NE5 B;  2K5V A;  1M8A A;  1EWC A;  2BH8 A;  5IYC H;  4JI7 L;  2WAQ B;  1XMO Q;  2NVQ B;  1LM0 A;  3FP9 A;  5DM6 3;  1PH6 A;  3GTP H;  1O7I A;  5C44 H;  3GTO B;  3QWN A;  4WJ4 A;  4LF7 L;  1PTO B;  5DM7 3;  3CP0 A;  3ND8 A;  3G7L A;  1SSO A;  1HNW L;  2K5Q A;  4OO1 I;  2EVB A;  1TWG B;  1YJW A;  5IGC A;  2EYJ A;  1HJP A;  2Q2H A;  4YHH L;  2SDF A;  4DR2 Q;  3OTO L;  4YWK A;  4A3E G;  1JWS D;  5AJ3 L;  1L1O B;  2DNC A;  3CD6 A;  3VYR A;  1OXX K;  2Z0S A;  5C3E G;  3GP7 A;  2F0U A;  1IZ6 A;  3BG3 A;  3JAM L;  1H9S B;  1W2B A;  1K3R A;  4XQN A;  3T1H L;  5IT9 E;  1EFW A;  2ZXR A;  1MHW C;  3SXH A;  4C1N K;  4CDD C;  2PZW A;  1CA6 A;  1LAC A;  1A0I A;  2R92 G;  1XPU A;  1HZC A;  2L1B A;  1VQ6 A;  1Q46 A;  1WTO A;  3ZYY X;  1XJV A;  1XNQ L;  1CKN A;  4ZKC B;  1DOK A;  1YI2 A;  1Q7Y C;  1GKH A;  1E2W A;  3UDF A;  3RUZ A;  4DV1 L;  4A3D H;  5IGB A;  4NB3 A;  2I5M X;  4UHV A;  4UP7 A;  1HA6 A;  1HCZ A;  2WAC A;  1X3Q A;  3GTP B;  1VQL A;  1FR3 A;  2QCP X;  2K1B A;  2R7Z H;  2X6L A;  4V0B A;  4RA8 A;  4JYA Q;  5C4X H;  3AU7 A;  4X3U A;  3EIV A;  1S5B D;  3U50 C;  4LFB L;  4KJN A;  4IUU A;  1KDC A;  1X3G A;  1QNK A;  1WTH A;  3K6O A;  4KN7 C;  1L0W A;  4DR5 Q;  3A7L A;  2ES2 A;  5JEA G;  5ELC A;  4A3L H;  3D31 A;  1B3Q A;  2N88 A;  3LGJ A;  1SN8 A;  1G6P A;  1X65 A;  4CDF C;  2F0N A;  2WAQ G;  2V4D A;  2KCC A;  2L5T A;  1PRT F;  1U4R A;  2IL8 A;  1PFM A;  1Y1W H;  2A6E D;  5I9O A;  1IBM L;  2TSS A;  2PNH A;  1G29 1;  2Z8L A;  4LFC Q;  1HR0 Q;  2EJM A;  1WCM G;  5EBC A;  1WTR A;  1EWI A;  2PQE A;  4X62 L;  5M5X H;  3HKS A;  3NTI A;  3J80 L;  1I6V C;  1TS5 A;  2E74 C;  4OEL B;  4A3D B;  1IKM A;  4EQN A;  5KEE A;  1DZ1 A;  4GOP C;  3MFY A;  4DU9 A;  2XNA C;  3T13 A;  5BR8 L;  2NVT B;  5EQ0 A;  4JCV E;  3BDL A;  1BKB A;  4RKL A;  4A76 A;  4BY1 H;  5K36 G;  1TWF H;  2R7Z B;  2OTJ A;  4A3G B;  3SK4 A;  1BVS A;  1PYW D;  1Z6H A;  5C4X B;  2YTY A;  5C0X G;  2JA8 B;  1LV9 A;  1KTK A;  3Q6S A;  1XX8 A;  4I7Z C;  1TWA H;  4JI1 L;  1SMY D;  2OF1 A;  3KBG A;  1B53 A;  5GRO A;  1EZ8 A;  2A74 C;  1I50 B;  2A19 A;  2VS1 A;  3BJU A;  3FDT A;  4DV4 Q;  3S2D H;  3A56 A;  4P75 A;  5C4J H;  3U9O A;  1JE5 A;  1RCV D;  1SYG A;  3HZX A;  1Y1W B;  4LF4 L;  4ID6 A;  4DR1 Q;  2IX1 A;  4G7O C;  3QB3 A;  4YCW A;  2KUM A;  5TSS A;  3ERS X;  1N32 L;  4FDB A;  2RCN A;  3NBH B;  5JJZ A;  4JI4 Q;  4H44 C;  3C1E A;  1G2T A;  5M3F H;  1XYI A;  3F2U A;  1U5K A;  4C1N I;  1YHQ A;  2K03 A;  2XWJ B;  2I5H A;  4JI6 Q;  1LTG D;  4DFA A;  2GA4 B;  5DNF A;  1SDF A;  2EOT A;  2BDN A;  4DR6 L;  1PH9 A;  4BY1 B;  1SAP A;  4R1J A;  4ULL A;  2XTI A;  3T1Y L;  1B44 D;  1NR4 A;  2Z4I A;  3WOF A;  4DV3 L;  2NB0 A;  2HCC A;  4IO9 A;  2YU9 H;  2F3V A;  3NPP A;  2MUY A;  1G6Z A;  1SNM A;  1IYJ B;  3CCQ A;  2Y0S B;  4XIG S;  1TVX A;  5IP9 H;  2UUB L;  4RGM A;  2SEB D;  4A3D G;  4FF3 A;  1EUJ A;  3DXJ C;  3FKI H;  2JA5 B;  2K05 A;  1BBW A;  3SDZ A;  1JB7 A;  2A6E C;  1F2Z A;  2JYO A;  5GAG C;  2A8V A;  1DYQ A;  1CQV A;  2PO4 A;  2XWB B;  5C4J B;  2R7Z G;  2NN6 H;  4A3G G;  2R93 B;  5IGF A;  4IJL A;  3I2Z A;  5C4X G;  4JI0 Q;  1SE2 A;  3M3Y H;  3GV3 A;  3I72 A;  3PSI A;  1NSN S;  3CCM A;  1ML0 D;  4X66 L;  3DEP A;  4IQZ A;  4A3L G;  1SRO A;  1Z7T A;  3DM1 A;  1SBB B;  1KDA A;  3RZO B;  1MKH A;  4CBV A;  1DGS A;  3BDO A;  3A8I E;  4GLX A;  1EQT A;  3K5L A;  4P2C B;  4P71 A;  2UXB L;  2H4O A;  2RDF A;  1QUQ B;  4KLK A;  4QUF A;  4RKB A;  1Y1W G;  2YU9 B;  4DGZ A;  1WVL A;  4K0K L;  3J80 c;  1LT3 D;  3E0J A;  2L55 A;  4JBM A;  1YZ6 A;  4DPG A;  1SMY C;  4LNQ A;  1PZK D;  4RCO A;  3IRB A;  4NXN L;  4OL7 A;  4X64 L;  2JE6 I;  2R6G A;  3BVZ A;  4A3F H;  1QZG A;  2UXC Q;  1EIG A;  1EY6 A;  3QOL A;  2K28 A;  3HKZ B;  2EXZ A;  2H5X A;  1GHJ A;  2K33 A;  1HNX L;  2BE5 D;  4BY1 G;  1VQH A;  1L0X B;  1LTS D;  1ROD A;  3SK8 A;  2F52 A;  5E4X A;  3M4O B;  2CWP A;  3M4Q A;  5JVG 3;  1KD1 C;  2Z6B A;  3M3Y B;  3J81 L;  3M4P A;  2RHQ B;  2Y0S G;  2EY5 A;  1D2B A;  2JA9 A;  4KI0 A;  4DK6 C;  3S2H H;  3RD4 A;  4GKJ Q;  1AZQ A;  4CDE C;  4IFD J;  2F0V A;  5EAY A;  1FNU A;  3VDY A;  2Q2U A;  3K8A A;  1GUW A;  3UDI A;  4ZKB B;  4RG1 A;  2JA5 G;  5IGG A;  3W1B A;  4EVO A;  1UNS A;  3I4O A;  1OXT A;  1WTX A;  4R4T A;  2KBN A;  2H1E A;  3MZ5 A;  3RN2 A;  3KBX A;  1N34 L;  3G71 A;  4QIW B;  2UXD L;  3J7Y W;  4ZUJ A;  4X65 Q;  5ELB A;  4I65 A;  4JI3 L;  1PH4 A;  2CH4 A;  4FF1 A;  5M3F G;  4HJ8 A;  2HHH Q;  1A8V A;  3DUZ A;  3FVQ A;  4EQP A;  1B70 B;  3E6Z X;  3DLL A;  2HT1 A;  4A3F B;  3LWE A;  4DNR B;  1QZH A;  2NZ1 D;  4P72 A;  5M5Y H;  1ILP A;  2BA0 A;  3HOX H;  1H9M A;  4RGT A;  1OXV A;  3CU7 A;  1BCP F;  5ELN A;  3FPP A;  4JK1 C;  4KKS A;  3TZU A;  3IFD A;  3TSS A;  3NUC A;  1WTQ A;  1ICW A;  3S2H B;  5IP9 G;  1YJ9 A;  1GXD C;  1D1K A;  2WII B;  4A3B B;  1I5F A;  3FKI G;  3OMC A;  4Q5V A;  1P16 A;  4OWX B;  3OWE B;  2ZTC A;  2OEO A;  4H02 A;  4AH6 A;  4AYB B;  5LMN Q;  5CV6 A;  4NXM Q;  4FF2 A;  2NN6 G;  1CSP A;  2B2V C;  1XPO A;  3HOY B;  2VQF Q;  2EXD A;  3L0O A;  5FO7 B;  3JC6 6;  5C6A A;  1GUT A;  4A3M B;  5LMU Q;  1S72 A;  5KRU A;  1XNR L;  1PZI D;  3AFP A;  3S15 H;  3CC4 A;  2DY8 A;  4GNX A;  3MXP A;  2NZH A;  3VA7 A;  3GTL H;  3ULP A;  1U9R A;  4BXX H;  4HID A;  2F0J A;  1FNV A;  1DOL A;  1SYD A;  2BE5 C;  3W3A A;  4ODG A;  4EGV A;  3GO5 A;  4U67 3;  4DR4 Q;  1HUN A;  1Z47 A;  2B63 H;  5D14 A;  3TP7 A;  1M1K C;  5E1F A;  4B3M Q;  3GTG B;  4XT1 B;  4OO1 H;  5M5Y B;  4KY6 A;  2NUC A;  5HY6 A;  3S1N H;  1SYB A;  1KRT A;  4HJ7 A;  3IFT A;  1GUO A;  1X6O A;  3AQQ A;  3L7Z C;  2V1C C;  5I4D A;  5AFW A;  4DR7 Q;  1ET6 A;  4BWG B;  3CPF A;  4B3T Q;  1Q8I A;  3K58 A;  4DAY A;  1N36 L;  2Q8R E;  3H91 A;  2FXQ A;  4DV0 L;  4B9X A;  4KD3 A;  2A69 D;  3Q24 A;  2BOS A;  2NTT A;  4A3F G;  4DR3 L;  4XXE A;  5J22 A;  1ZYR C;  3DHQ A;  3KLR A;  2CCZ A;  1H9K A;  2ZXP A;  4L5T A;  3J81 c;  1D8L A;  4ALP A;  2KHJ A;  3WWV A;  4KTA A;  5EKK A;  5CV7 A;  1KAB A;  5G3L D;  3S15 B;  5NUC A;  3OWF A;  3H94 A;  3GTL B;  1ENF A;  4O1N A;  1NMG A;  2L12 A;  2Z6K A;  2PQA A;  2K7V A;  4X3S A;  4A3B G;  3PMF A;  1ZEQ X;  2AMC B;  1V1P A;  2EY6 A;  2QW7 A;  3CXC A;  5JVH 3;  1DOM A;  2UU9 Q;  4WJ3 M;  3S1N B;  5KNB A;  1FD7 D;  4AYB G;  4A75 A;  4P73 A;  1VCI A;  1JOR A;  1E7Z A;  3J7A V;  2F0E A;  4X3T A;  3HOY G;  2R7D A;  1VQJ A;  2DJG C;  3PUY A;  1PHJ A;  5FLX c;  1GOZ A;  5J3B A;  2PZT A;  1STG A;  5T1I A;  1N8R C;  4B3R L;  3U4Z A;  2B3G A;  1D5X C;  1H9J A;  1NUC A;  1XMO L;  5JEA J;  1EYC A;  1B50 A;  3NEL A;  3URY A;  5ISR A;  4HCS A;  1SLJ A;  4N8X 1;  2CQA A;  4JPB W;  4HMJ A;  2RDG A;  2MHV A;  3KLS X;  4M8A A;  1KAA A;  4OXP A;  5JOB A;  2E8G A;  2I46 A;  2ICI A;  1C9O A;  4CJ2 C;  3NBI A;  1QVF A;  3LX0 A;  4A3I H;  4LUV A;  2AWN A;  5IWA L;  4IUQ A;  1PFB A;  1FNW A;  1CK1 A;  5CYU A;  3I3C A;  3SK5 A;  3KF8 A;  3G4S A;  2DY7 A;  2F0D A;  3HRZ C;  1SNP A;  4RCN A;  1NJI C;  4LJZ C;  3Q8D A;  4KHP L;  5FOB B;  3Q23 A;  2AHO B;  2FJ2 A;  2NTS A;  2A69 C;  4PZ6 A;  5EBD A;  3S1M H;  1RTN A;  4G7H C;  3BZK A;  2L15 A;  5C0X J;  1Q12 A;  5EGT A;  2L11 A;  3SK6 A;  1S5D D;  1I6H H;  4DUY Q;  1BO0 A;  3GV6 A;  4BXX G;  3ITP A;  4ZQ3 A;  1IW7 D;  1S4Z A;  1TQO A;  1VDZ A;  2RQX A;  3A7A B;  2KCT A;  1YNJ D;  3W1G A;  3VR6 A;  1PTO H;  5IOC A;  4MZ9 A;  1B9M A;  4F88 A;  2MQH A;  1CHP D;  4OO1 G;  1ASY A;  1I94 Q;  4OX9 Q;  2XSC A;  4DF7 A;  1K73 C;  1T5X D;  2NWG A;  4IUR A;  1HUM A;  4DNT B;  2JEA I;  4UDU C;  4DR5 L;  4A3I B;  1VF5 C;  1PRT B;  2LY7 A;  1NCV A;  2G9D A;  3K0X A;  4DNI A;  1EYD A;  1EU3 A;  2YTV A;  3PIO 3;  3HGB A;  4XDX A;  2PPB C;  4L63 B;  1YHA A;  5M5W B;  1HZA A;  2F0M A;  2RSN A;  3C1F A;  1H95 A;  4IFD I;  1Y14 B;  2HQE A;  1X54 A;  1J5E L;  2F3I A;  1RD9 D;  4YY3 Q;  4GKK L;  2VUM B;  1J8I A;  5FJ8 H;  4CHT B;  2AUK A;  3NEN A;  1DXM A;  4JI2 L;  3IL8 A;  1I6H B;  1EOV A;  5EJW A;  5I6W A;  4CDC C;  1GUG A;  1KNE A;  4MTK A;  3CC7 A;  2HQL A;  1SE3 A;  1KAW A;  1OXU A;  3S14 B;  1JB3 A;  1EQV A;  3TDQ A;  1F77 A;  4APV A;  2NYZ D;  3F1Z A;  2B2U A;  3I4L A;  5CC4 A;  2E2J H;  1L0Y B;  3D4D A;  1HA5 A;  3A54 A;  3R8B A;  2OCE A;  1Y8P B;  2E2I H;  2F0S A;  1LTR D;  1QOH A;  2CQO A;  5GQO A;  4JBW A;  2AKW B;  4C3H B;  1G51 A;  4LAA A;  1CKO A;  4OIJ A;  3L9A X;  1YEZ A;  1B2T A;  3EQL C;  3W2D A;  4DV4 L;  2VL6 A;  4LF9 Q;  4K2L A;  1FYC A;  2SNS A;  4GLA C;  2K5D A;  1SEB D;  3CC2 A;  2MFI A;  4AQY Q;  2B2T C;  2VZA A;  2ASB A;  1GUN A;  2PI2 E;  1GD7 A;  5HGT A;  4LK1 C;  2DJF C;  2JP1 A;  1PH8 A;  1PDQ A;  1IW7 C;  4DAV A;  4LF6 Q;  4R8N A;  1YHB A;  1SYE A;  4CKE A;  4WFN 3;  4HMI A;  1YNJ C;  3NK9 A;  4A3I G;  1O7Y A;  3UDG A;  2NVT H;  3TP6 A;  4DKA C;  1SE8 A;  4DUZ L;  1Q86 C;  2KOL A;  5IYD H;  4A3G H;  4C3I B;  1IKL A;  1CKN B;  4DK3 C;  5JJK A;  3A55 A;  3VYS A;  1K28 A;  5CBA E;  2RBM A;  1TR5 A;  3EFX D;  2JA8 H;  1N33 L;  4MHE A;  1JCK B;  3S9W A;  2E2J B;  2E2I B;  3E9H A;  3PF5 A;  1ESR A;  2Q8T A;  1VQ4 A;  4YWM A;  5C5M A;  1A2U A;  4J8Q A;  2D0O A;  2ZXO A;  1SNO A;  2C35 B;  1I50 H;  1A3U A;  1UEB A;  3G6J B;  1VQP A;  3TRE A;  1Q90 A;  2FMC A;  3S1Q H;  1PH7 A;  1C8C A;  3A5Z B;  5I2Y A;  2PMZ E;  2KHS A;  1P8L A;  2R7F A;  3QR8 A;  4GN4 B;  4L8J A;  5IT9 c;  2WKD A;  4HTH A;  2ZTD A;  2IWH A;  4JI0 L;  3VR2 A;  2EYL A;  4PG3 A;  2B2V A;  1SE4 A;  1EY9 A;  3K5O A;  2QA4 A;  3ULL A;  1HXY D;  1BNZ A;  4OON A;  1SJE D;  2PCF B;  2GVB A;  4KHZ A;  1S5F D;  4O0A A;  3TME A;  3F2B A;  3PUZ A;  1IBL L;  4JG2 A;  2EYM A;  1QCB D;  4JI5 Q;  3PGZ A;  3IKJ A;  2RDH A;  1LTT D;  2YTX A;  5FK9 C;  1VQO A;  2Y0S E;  2VQE Q;  1UAP A;  3WDN A;  3U9S A;  3RN5 A;  2B2Y C;  2LSS A;  4JI7 Q;  5FJ8 G;  3H15 A;  2F0T A;  3A8K E;  5EPL A;  5LMN W;  1WJJ A;  1G8Z D;  4JV5 L;  4PMB A;  3SGI A;  2QDB A;  2JA5 H;  1JWM D;  4PQX A;  3KLS A;  1TXY A;  2BA1 A;  1LO5 D;  3NTK A;  3OIP A;  1QE6 A;  1NBW A;  1PTO D;  1AH9 A;  1RL2 A;  3TZD A;  2A73 B;  3OTO Q;  3GTQ H;  3S1Q B;  1RJT A;  4DV2 L;  2R93 H;  2IX0 A;  1CHQ D;  3VR5 A;  3X3N A;  2B2W C;  3TBI B;  1PH3 A;  5FLM H;  3JAM c;  5C3W A;  1EEI D;  3T56 B;  4YCV A;  3J81 j;  2BCO A;  3V96 A;  5BN3 A;  3RZO H;  3BYT B;  1TWH B;  4IJH A;  3FRP B;  3ONA B;  3A0J A;  4ABN A;  1R4Q B;  1KQS A;  1EOT A;  4IPG A;  1XNQ Q;  3WOE A;  1EY4 A;  1QB5 D;  3VR3 A;  3K5N A;  4DV1 Q;  2DUD A;  1BXT A;  2AQ1 B;  4X65 L;  2CWA A;  1Q81 C;  2RSO A;  5LL6 S;  2JEB I;  2B29 A;  1KRS A;  2XRS D;  3GTM H;  2IX3 A;  1JOQ A;  3RLF A;  1E2Z A;  5EKL A;  1F9Q A;  2ZTE A;  2JQO A;  1CKM A;  2KCN A;  1BCP B;  1M90 C;  4LFB Q;  2E2D C;  3M9B A;  1K8A C;  5IYD G;  3VYT A;  1VQC A;  5C0X I;  2ZJP A;  3GTQ B;  4DN4 M;  2RA4 A;  1V1O A;  3M4O H;  1D5M C;  2WIN B;  1Y1V B;  2HIX A;  4EQO A;  2JA8 G;  2J4X A;  1JJ2 A;  4RHR A;  4KHV A;  4DA2 A;  3H6M A;  3PIO A;  2J7Z A;  3T4A C;  1I3Q H;  3CRL C;  2E76 C;  2M00 A;  3P7J A;  2UUC L;  1IBM Q;  5LHY 1;  1LYL A;  4NP5 A;  4X62 Q;  5GAH C;  4NXM L;  1JC7 A;  3AYH B;  1QG7 A;  5E3F A;  5LMU L;  3OSO A;  5BR8 Q;  4Y7N H;  1WTW A;  2MP1 A;  1SYC A;  3EVQ A;  3Q0A A;  3K5M A;  1HNZ Q;  1II3 A;  3H3V H;  2HUG A;  3GTM B;  1PTO C;  1EIH A;  4N8F A;  5JPN C;  1PYS B;  1HFN A;  3MVV A;  1NAP A;  1UE5 A;  2CW0 C;  2FHT A;  5CV8 A;  1ILQ A;  2D5D A;  1K0R A;  1A6X A;  1YNX A;  1L1O C;  3NWS A;  4HIO A;  3DM3 A;  2I07 B;  4B3T L;  2KVM A;  2HDM A;  2KA7 A;  4CGY B;  1S5C D;  3TEH B;  1LAB A;  5GAD C;  4XQQ A;  4A3B H;  4DV6 L;  1I3Q B;  2A1A A;  4AYB E;  3CW2 C;  4IUV A;  4IOA A;  1VMP A;  3DEO A;  1MBY A;  4MN3 A;  1N32 Q;  3ZJY C;  2D2C C;  1JR0 D;  2LXJ A;  2IY5 B;  2OQ0 A;  4GLV B;  1KXL A;  3PO2 B;  3HOY H;  1EU4 A;  2R93 G;  1Q1B A;  3KK7 A;  4JOI C;  1ZYR D;  4A3M H;  3TS2 A;  2LFN A;  1WFQ A;  1E3P A;  1SFO H;  3QO2 A;  1J6Q A;  4TKO B;  1HZB A;  4Y7N B;  2F4I A;  1AEX A;  1KLG D;  1KNA A;  3D6W A;  5FLM G;  4DR6 Q;  1SNQ A;  3KJP A;  4A93 B;  2F4V L;  3T1Y Q;  3ND9 A;  3CAM A;  2K6A A;  3A8J E;  3MTS A;  3GTG H;  3K80 C;  1MI2 A;  1RF2 D;  3LWU A;  1MIU A;  2B8F A;  2SOB A;  4JI8 L;  4KD4 A;  3GDE A;  4G57 A;  3RZD H;  2UUB Q;  2KEE A;  3GD7 A;  4OWT B;  1E1T A;  5EKI A;  2OTL A;  4AIM A;  3KUP A;  5I2X A;  1PVO A;  2IPK D;  4PV1 C;  4C2M B;  1FJG Q;  4TSS A;  1MJC A;  3AB9 A;  3RMH A;  2FMM A;  3P20 A;  3HKZ G;  1A62 A;  2HCI A;  1CFM A;  3NP8 A;  3PO3 H;  2OT2 A;  4UPA A;  1HPC A;  1FL0 A;  3MHB A;  4QCL A;  2HIV A;  4JW0 A;  5CR3 A;  4C3J H;  4X66 Q;  2FFK B;  2K04 A;  1LUZ A;  1XTC D;  1SFO B;  5CV9 A;  2B2T A;  3FMC A;  3VA5 A;  5KYI A;  3HEJ A;  3HOV B;  1TU2 B;  2N55 A;  1FGB D;  4ME3 A;  4YWL A;  3F8T A;  2F0I A;  1KHI A;  4DV7 L;  2K5W A;  1MJE A;  2UUA L;  3OYY A;  5KNC A;  4K0K Q;  4A3K B;  3VYU A;  1W6J A;  1XMQ L;  1C4Q A;  2D9U A;  1YBY A;  4GNX B;  3RZD B;  4X64 Q;  4NXN Q;  3STB D;  3BZC A;  5FO9 B;  1IXR A;  1K0S A;  4IUN A;  1HQM C;  2JJQ A;  1IL8 A;  3P1H A;  1UWV A;  1HNX Q;  1DJR D;  3E9I A;  2IHF A;  1HZ9 A;  4A93 G;  4RGN A;  5ELF A;  3OW2 A;  1CZG A;  1STY A;  3BYY B;  1EZ6 A;  3PO3 B;  4FF4 A;  2E2H B;  1D1I A;  5FLX E;  4GZY C;  1VQD A;  1EQQ A;  1UE7 A;  4DAY B;  4CKB A;  3GTJ B;  5D3D A;  1XXG A;  3FPU B;  5G3L F;  4C3J B;  2ZM6 Q;  4DV5 L;  4IOC A;  2WB1 E;  4IPD A;  4LF8 L;  2QKI C;  3MXU A;  2QIL A;  1UEA B;  4RMF A;  1G91 A;  3E0E A;  2RCF A;  5FO8 B;  4LF5 L;  4GOP A;  2N78 A;  1N34 Q;  3KYH C;  3J7A F;  2QEX A;  3CME A;  2ICE C;  2NN6 I;  2UXD Q;  1EY8 A;  3S1R B;  2E5L Q;  4JI3 Q;  4XTC S;  2WP8 J;  4XQJ A;  4BA1 I;  2TMP A;  4PMW A;  2O5I C;  2F0Q A;  4YY3 L;  3MA2 B;  4A3M G;  3RR5 A;  1Y69 U;  1K8G A;  2PQA B;  4QJF A;  4KKT A;  4GOP B;  1BOS A;  1TWC B;  1V1P B;  1I4P A;  1X3E A;  1C0A A;  5FKA C;  3S24 A;  5I6Y A;  3ER0 A;  4POF A;  1LTI D;  4HAE A;  3BVM A;  4LMQ D;  3TS0 A;  1D7Q A;  3OPO A;  1NNX A;  4Q0F A;  1KL9 A;  1KIX A;  3H0G H;  2G9H D;  2KCM A;  2Z4H A;  2F0H A;  4DR2 L;  1JOK A;  2F0L A;  1EL0 A;  4DXG A;  3G48 A;  1AFP A;  4HCE A;  1AN8 A;  3CQZ B;  3CMA A;  2HD3 A;  4N9P A;  5ELE A;  2K75 A;  4XT3 B;  2XIW A;  3PF4 A;  2B8G A;  1A63 A;  3STB C;  3PO3 G;  1XNR Q;  4H7B A;  5M5W H;  3MXG A;  4Y52 H;  5CMD A;  2VUM H;  3I8Z A;  3UE1 A;  4C3J G;  3M7N A;  2C5C A;  1E0B A;  1DCZ A;  2K4K A;  1SND A;  4RAU C;  2WAQ E;  1JWU D;  1K83 H;  2QDL A;  3NHH A;  1EY5 A;  3KF8 B;  4QL5 A;  1GM5 A;  2HDL A;  1IBK Q;  1YIJ A;  3EBE A;  1ONL A;  4WJW A;  3TP5 A;  3D3R A;  1PMR A;  5EPK A;  1U0L A;  2BH2 A;  3S14 H;  1QNU A;  1K8O A;  2MO1 A;  4MIU A;  3MC0 B;  3I4M H;  1B7Y B;  5CV5 A;  4K8J A;  1N36 Q;  4BY7 B;  4JYA L;  2ENB A;  4WOR A;  3H0G B;  3HP3 A;  1IYU A;  2IT1 A;  2M2L A;  4BBR H;  1WD1 A;  5IGD A;  2MO0 A;  3KF6 A;  4DR3 Q;  4C3H H;  2NZO A;  1EWH A;  4QF4 A;  2KJX A;  4FXK C;  1TS3 A;  1SXT A;  2G5D A;  1BUV T;  1B1Z A;  3PUV A;  2R92 B;  4MNO A;  1V8Q A;  3E5S A;  3KOJ A;  4UP9 A;  2Q2T A;  1X3P A;  3M4Y A;  1RDP D;  4GS3 A;  4U68 A;  4OWW B;  1HQR D;  2VY3 A;  3RNU A;  2DN8 A;  3KF6 B;  4LFC L;  1HR0 L;  1CUK A;  1NMF A;  2N3S A;  4R9W A;  3I55 A;  3H3V C;  4F87 A;  1S5E D;  4A3C H;  1K83 B;  1EYG A;  1JIC A;  1X32 A;  3R3O A;  1PZJ D;  2P5Z X;  2F0P A;  3K57 A;  5COR A;  2XVS A;  4K14 A;  5EPJ A;  3NTH A;  5HUR A;  1LT4 D;  1OTC A;  4JI5 L;  1SMX A;  4C3I H;  1AZP A;  1B9N A;  1G2S A;  4OHJ A;  1C7Y A;  4B3S Q;  3I4M B;  4B3R Q;  3PUX A;  4JBK A;  5IY0 A;  1QIL A;  1BQQ T;  4MTN A;  5E4W C;  4F7X A;  4KY7 A;  4L5R C;  2X6G A;  3NXW A;  4BBR B;  3MEF A;  3KJO A;  3IAY A;  1L1O A;  2F1M A;  4XYQ A;  3GTK H;  4I7A A;  1E22 A;  3CCU A;  4ZYS A;  4P74 A;  3ICE A;  2JA6 H;  1H9S A;  3PV0 A;  1WCM B;  2OWO A;  5KIX A;  2EZV A;  3D4W A;  3N52 A;  2ZT9 C;  1U4L A;  4BY7 G;  4DR1 L;  5IWA Q;  4IUT A;  5IE8 A;  3R2T A;  3C3L A;  3H0G G;  4S3S A;  2ID0 A;  1I4G A;  2EE1 A;  4QMG A;  4JI4 L;  4QGU A;  3KDF A;  1NTG A;  4JOI A;  1QVC A;  1BBX C;  1K9M C;  3A5U A;  1ENA A;  4LUZ A;  4JI6 L;  4J6H A;  5D65 A;  3S17 B;  4KHP Q;  2VNU D;  1R4P B;  2O5J C;  1HTP A;  5A2Q E;  1WOC A;  4GNX C;  1BDO A;  2K5N A;  5J1Z A;  3CCL A;  4B9W A;  3PIP 3;  1CZW A;  1PFN A;  1UUP A;  3KDF B;  1SJH D;  4XYO A;  2A5H A;  2VUM G;  1VMC A;  5KGU A;  1O80 A;  1F2L A;  1X56 A;  1STE A;  3OIQ A;  1CM9 A;  1TS2 A;  3T16 A;  2B39 A;  1PLF A;  5C44 B;  5COY A;  1PFS A;  1SRU A;  5C4H A;  4JC0 A;  3GTK B;  3R2I A;  3DWQ A;  1RKN A;  3KLW A;  4POG A;  2DGY A;  2CH4 W;  1EEF D;  1QWY A;  2JA6 B;  1VQ5 A;  4A4I A;  2PW7 A;  1KDB A;  5DAU A;  2A68 C;  1A2T A;  2M9V A;  4ILW A;  4UY8 C;  3ERQ A;  1Q1E A;  1AE2 A;  3I4M G;  2N49 A;  1KC8 C;  5IYB H;  2AUJ D;  2EQS A;  4E6I A;  3M85 A;  1X55 A;  2PI2 A;  3O13 A;  4BBR G;  2A6H C;  4NDX A;  3NWT A;  1VQF A;  1UE6 A;  2KEC A;  1IL2 A;  5CV4 A;  4C3H G;  4IPC A;  3I73 A;  1STB A;  3RLN A;  1TWH H;  1PRT D;  1BF4 A;  4A3J H;  3JAM i;  2QGQ A;  1J5E Q;  3UE0 A;  3W5O A;  5GAE C;  4GKK Q;  1LTA D;  1GVP A;  4LFA Q;  3E3X A;  3JAM E;  2Q2I A;  3NQI A;  4JI2 Q;  2GN5 A;  4BBS H;  2IHE A;  3PCO B;  2Z6K C;  4TVA B;  2MPM A;  4ZK9 B;  3CF5 A;  3KFU A;  2JK8 A;  5IGE A;  3TRZ A;  4LF7 Q;  4A3C G;  4KK7 A;  1HNZ L;  3NSW A;  4KMU C;  1HNW Q;  1WTP A;  2UXC L;  4GN3 B;  1PTO F;  1AW7 A;  4GN5 A;  2XGT A;  3I70 A;  4YHH Q;  2PNR C;  3PUW A;  5IOD A;  5IP7 H;  4NMZ A;  5AJ3 Q;  4C3I G;  1HFG A;  5BN4 A;  1Y1V H;  4RFB A;  2R3Z A;  4NPS A;  2JSO A;  2K14 A;  3K0Y A;  4O2D A;  1EY7 A;  4JBJ A;  3NBH A;  2LXK A;  3FHW A;  2CW0 D;  4F8M A;  2DNE A;  5IYC G;  2JN4 A;  3QIA A;  3DMU A;  4GKJ L;  1GO3 E;  1HHV A;  1Q8K A;  5C44 G;  4IUP A;  1JOO A;  3T1H Q;  2CHB D;  4L5Q A;  2JA7 H;  1N9W A;  2KEN A;  2KHI A;  4A3J B;  1WD0 A;  4DAM A;  2JA6 G;  1VS0 A;  1BR9 A;  4FVM A;  3TQY A;  1MSG A;  2PMZ B;  4OIK A;  2ZJR A;  4PZ7 A;  5M5X B;  3L3O C;  1AE3 A;  1X3F A;  4BBS B;  2L0C A;  5J39 A;  1XTD A;  4HIM A;  2FIN B;  2O4X A;  3AFQ A;  3N6R A;  3CCE A;  3J80 i;  3HKZ E;  1D5Z C;  4DUZ Q;  5L37 A;  2HHH L;  1AP0 A;  2WFW A;  4L6T B;  1OO9 B;  1T5E A;  4EX5 A;  2VW9 A;  4ME5 A;  4LUO A;  3BDC A;  3J80 E;  1TWF B;  1ICF B;  2L9H A;  4K6L A;  1FVI A;  2EYP A;  4YIJ A;  1YIT A;  2AQ2 B;  1ZXT A;  2IW3 A;  1JQY D;  1N33 Q;  3DWA A;  1E24 A;  4R8I A;  1J9O A;  5A35 A;  2ZJQ A;  2YYZ A;  2KED A;  1S3O A;  1CA5 A;  2XRQ D;  2F0F A;  2QF7 A;  1TWA B;  2EYH A;  1PRT C;  5CBE E;  4FXD A;  4ZLT F;  1VQN A;  3QJY A;  1JT8 A;  4HIK A;  3UI2 A;  4R4C A;  3S2D B;  1LT6 D;  2F0G A;  1FJG L;  2JA7 B;  1EQR A;  1U4M A;  3EN2 A;  1U4P A;  2EIF A;  2I0Q A;  3EJI A;  4RWS C;  1F2Y A;  4QIW E;  4WRD A;  1WTV A;  2NVX H;  3PO2 H;  1TY2 A;  5LMN L;  1QUQ A;  4G7Z C;  2Z9H A;  4V19 0;  5JAV A;  1B4O A;  5M3F B;  3R93 A;  2VQF L;  1TS4 A;  5IYB G;  2XN9 C;  1NY4 A;  1TII D;  1XPR A;  1O78 A;  5JJL A;  1IBL Q;  2LKV A;  1B8A A;  4UAI A;  3RLO A;  4UP8 A;  4A93 H;  2OXP A;  1ZKO A;  1UE1 A;  3CKI B;  1ENC A;  4DR4 L;  3HOU H;  4HR7 B;  4A3J G;  1SYF A;  2D0P A;  4B08 A;  4B3M L;  4HED A;  3SE0 A;  3G6E A;  3TN2 A;  3HOW H;  2E75 C;  1R9T H;  1K3B C;  1XWE A;  4DR7 L;  4BBS G;  4JI1 Q;  4JV5 Q;  3SVM A;  1PH1 A;  1CSQ A;  3FKI B;  4HJ9 A;  4KKU A;  2C9O A;  2NBF A;  4C2M H;  1JMC A;  3C2P A;  3UDX A;  3K7A H;  2B2U C;  1QVG A;  1F9R A;  4LF4 Q;  2ATW A;  3D8G A;  1H9R A;  1PXU A;  3SHL A;  3X3M A;  4DV2 Q;  1ASZ A;  2O2L D;  4G4K A;  2F0O A;  1NR2 A;  3FEW X;  5M3M H;  2MGS A;  2NVX B;  5IP7 G;  4M1U B;  3CCS A;  2ZM6 L;  1Y1V G;  2K50 A;  1YNN D;  3I56 A;  3CCR A;  3HOV H;  3BZD B;  4Z9C B;  1O7L A;  4QY7 A;  2Q8I B;  3QOJ A;  4DV3 Q;  4QQB X;  1OXS C;  3HOU B;  2JA7 G;  1STN A;  1IHZ A;  4CKC A;  3PIP A;  4A3K H;  1LTL A;  1VQB A;  2UU9 L;  1WYD A;  2E5L L;  5KND A;  1BBU A;  3I4N H;  5ELO A;  2CKZ B;  3HOW B;  1D6E C;  1R9T B;  3SR1 A;  4RGO S;  4KN4 C;  1RIP A;  4QUC A;  1F9S A;  5IIF A;  3F2C A; 
#chains in the Genus database with same CATH homology
 4LWC A;  1KL9 A;  1KIX A;  3CC2 A;  3I7F A;  2MFI A;  3H0G H;  4DR6 L;  2KCM A;  3HOZ H;  1PH9 A;  4R1J A;  4AQY Q;  3AEV A;  2VZA A;  2XTI A;  4DR2 L;  2ASB A;  3T1Y L;  4DV3 L;  2PI2 E;  1GD7 A;  1PV4 A;  2YU9 H;  4IO9 A;  2YV5 A;  1PH8 A;  3G48 A;  2D62 A;  1VQM A;  1YHB A;  4LF6 Q;  3CCQ A;  1IYJ B;  4XIG S;  2E2H H;  3CMA A;  4A3I G;  5IP9 H;  3UDG A;  2UUB L;  2K75 A;  2NVT H;  1A63 A;  3PF4 A;  3S16 H;  3GTJ H;  3STB C;  3PO3 G;  4A3D G;  1XNR Q;  3D0F A;  4DKA C;  5M5W H;  1SE8 A;  1EUJ A;  4DUZ L;  1Q86 C;  4Y52 H;  3FKI H;  1BBW A;  5IYD H;  1JB7 A;  1VQ8 A;  3J7Z C;  2VUM H;  4A3G H;  2CFM A;  3MXN B;  3J81 i;  3UE1 A;  5GAG C;  1PH2 A;  2A8V A;  3M7N A;  4DK3 C;  1CKN B;  5JJK A;  2K4K A;  2UUC Q;  1L2F A;  4LW1 A;  2R7Z G;  2WAQ E;  2JA8 H;  1K83 H;  4A3G G;  1N33 L;  3CCJ A;  3KF8 B;  2UXB Q;  4IJL A;  3I2Z A;  4QL5 A;  1GM5 A;  3E9H A;  1IBK Q;  3PF5 A;  4JI0 Q;  5C4X G;  1VQ4 A;  3M3Y H;  4YWM A;  1Q82 C;  1T9H A;  3PSI A;  1YIJ A;  3EBE A;  4HJ5 A;  2D0O A;  1WI5 A;  3CCM A;  3S1R H;  2C35 B;  2RHS B;  1U0L A;  1I50 H;  4YCU A;  4X66 L;  2BH2 A;  3S14 H;  3PO2 G;  1NE3 A;  1VQE A;  4A3L G;  2MO1 A;  1SRO A;  1UEB A;  1VQP A;  1B7Y B;  5H1S E;  3TRE A;  3I4M H;  1N36 Q;  1MKH A;  4JYA L;  1DGS A;  4HJA A;  3S1Q H;  1PH7 A;  4GLX A;  3A5Z B;  2PMZ E;  1P8L A;  2R7F A;  1TWC H;  1V43 A;  4GN4 B;  5IT9 c;  5JJI A;  4P71 A;  2IT1 A;  2UXB L;  1QUQ B;  4KLK A;  4DUY L;  2ZTD A;  4BBR H;  1IBK L;  4JI0 L;  1Y1W G;  2MO0 A;  3KF6 A;  4PG3 A;  4DR3 Q;  3J80 c;  4K0K L;  3A74 A;  2NZO A;  4C3H H;  3U58 A;  2QA4 A;  4JBM A;  3HOU G;  1YZ6 A;  4DPG A;  3ULL A;  4OON A;  4LNQ A;  3IRB A;  2GVB A;  4R4I A;  4NXN L;  3PUV A;  1FGU A;  2JE6 I;  2K52 A;  4MNO A;  4KHZ A;  2R6G A;  4O0A A;  4X64 L;  3KOJ A;  4UP9 A;  3PUZ A;  3F2B A;  2Q2T A;  1I94 L;  4JG2 A;  4A3F H;  1QZG A;  1IBL L;  3HOW G;  2UXC Q;  3K81 C;  4GS3 A;  4JI5 Q;  4OX9 L;  4OWW B;  2H5X A;  3PGZ A;  2VY3 A;  4DV6 Q;  3RNU A;  1E1O A;  3KF6 B;  2YTX A;  1HNX L;  1VQO A;  4LFC L;  2Y0S E;  2VQE Q;  1HR0 L;  4BY1 G;  1CUK A;  1NMF A;  2N3S A;  1VQH A;  3I55 A;  3RN5 A;  4A3C H;  2F52 A;  2LSS A;  1EYG A;  5FJ8 G;  3CQZ H;  4JI7 Q;  3H15 A;  5E7N A;  2CWP A;  3M4Q A;  1KD1 C;  5LMN W;  1WJJ A;  3M4P A;  2RHQ B;  3U4V A;  2Y0S G;  4JV5 L;  1PYB A;  1SR3 A;  2JA9 A;  4KI0 A;  4DK6 C;  3SGI A;  2JA5 H;  3S2H H;  4GKJ Q;  2NVY H;  4TQU S;  5M3M G;  1HH2 P;  3F2C A;  4JI5 L;  1TXY A;  2BA1 A;  5EAY A;  1OTC A;  4IFD J;  2Q2U A;  1SMX A;  4C3I H;  3K8A A;  3VDY A;  1C7Y A;  3UDI A;  4B3S Q;  1VQ9 A;  1NBW A;  4RG1 A;  2JA5 G;  1AH9 A;  2F4V Q;  1RL2 A;  3W1B A;  2RF4 A;  3OTO Q;  3F2D A;  3GTQ H;  3I4O A;  4B3R Q;  4DV2 L;  1OXT A;  3PUX A;  4JBK A;  3HOV G;  2R93 H;  4R4T A;  1V1Q A;  2IX0 A;  5IY0 A;  4MTN A;  2KBN A;  2GVA A;  3RN2 A;  4IPH A;  4L5R C;  2K5H A;  3MEF A;  4JI8 Q;  3KJO A;  1L1O A;  1N34 L;  3G71 A;  2UXD L;  3GTK H;  4X65 Q;  1PH3 A;  1E22 A;  5FLM H;  3JAM c;  4JI3 L;  1PH4 A;  1JJG A;  4A3K G;  3CCU A;  4P74 A;  3ICE A;  2JA6 H;  4A3E H;  4YCV A;  1Z9F A;  4EQ5 A;  3J81 j;  1YVC A;  5M3F G;  4BY7 H;  4HJ8 A;  2HHH Q;  1A8V A;  3RZO H;  4B3S L;  1B70 B;  3PV0 A;  4IJH A;  3I4N G;  2OWO A;  3DLL A;  2HT1 A;  1V9P A;  3A0J A;  5C3E H;  1QZH A;  4BY7 G;  1X9N A;  1KQS A;  4P72 A;  4DR1 L;  3H3V I;  4R4Q A;  5IE8 A;  5IWA Q;  4IPG A;  1XNQ Q;  5M5Y H;  1HR0 W;  2BA0 A;  3H0G G;  2ID0 A;  3HOX H;  1OXV A;  1VQG A;  3CPW A;  3HOZ G;  4DV1 Q;  4JI4 L;  2DUD A;  3KDF A;  4PZ8 A;  4QGU A;  1NTG A;  4JOI A;  5ELN A;  4X6A H;  1VQA A;  4X65 L;  1QVC A;  2CWA A;  1Q81 C;  1K9M C;  3A5U A;  3HOX G;  1VQ7 A;  1JJC B;  2JEB I;  2R92 H;  4LUZ A;  2B29 A;  4JI6 L;  1KRS A;  3GTM H;  3ULJ A;  4LF9 L;  2I5L X;  4KHP Q;  2VNU D;  5IP9 G;  3RLF A;  4BA2 I;  4IFD G;  2ZTE A;  1WOC A;  2JQO A;  1CKM A;  4GNX C;  1YJ9 A;  4AQY L;  2K5N A;  3CCL A;  1I5F A;  1M90 C;  4LFB Q;  1K8A C;  3M9B A;  3FKI G;  3KDF B;  5IYD G;  5C0X I;  1VQC A;  1P16 A;  4OWX B;  2ZJP A;  2VUM G;  4DV7 Q;  2UUA Q;  2ZTC A;  4LF6 L;  4H02 A;  4AH6 A;  1X56 A;  3M4O H;  5LMN Q;  4NXM Q;  2N8N A;  2HIX A;  2NN6 G;  1CSP A;  2JA8 G;  1XPO A;  1S40 A;  1JJ2 A;  1XMQ Q;  2VQF Q;  1PFS A;  1SRU A;  2EXD A;  3JC6 6;  3L0O A;  4JC0 A;  1S72 A;  5LMU Q;  1XNR L;  3KLW A;  3AFP A;  4POG A;  3S15 H;  3CC4 A;  2DGY A;  3PIO A;  4GNX A;  3GTL H;  2NZH A;  1VQ5 A;  3B6Y A;  4A4I A;  1I3Q H;  3ULP A;  4BXX H;  1YJN A;  4HID A;  4DV0 Q;  4UY8 C;  2UUC L;  5HGQ A;  3GO5 A;  1IBM Q;  3L2P A;  4DR4 Q;  1Q1E A;  1AE2 A;  1Z47 A;  1LYL A;  2B63 H;  1M1K C;  3I4M G;  2N49 A;  2NVQ H;  4X62 Q;  5GAH C;  1KC8 C;  3BU2 A;  4B3M Q;  5IYB H;  4L5S A;  4NXM L;  2EQS A;  3GTO H;  3S1N H;  5HY6 A;  1KRT A;  3M85 A;  3AYH B;  4HJ7 A;  2OQK A;  2B63 G;  2AWO A;  1VQI A;  1X6O A;  1X55 A;  2PI2 A;  3AQQ A;  2V1C C;  3L7Z C;  4BBR G;  5LMU L;  5BR8 Q;  4Y7N H;  4DR7 Q;  1IL2 A;  1VQF A;  1UE6 A;  1TWG H;  3CPF A;  4IPC A;  4J15 A;  1PA6 A;  4B3T Q;  1HNZ Q;  4DV5 Q;  3RLN A;  3H3V H;  1TWH H;  4LF8 Q;  1WCM H;  1N36 L;  4A3J H;  3JAM i;  2QGQ A;  1J5E Q;  2FXQ A;  3UE0 A;  4DV0 L;  3W5O A;  5GAE C;  4GKK Q;  1W3S A;  1GVP A;  4LFA Q;  2Q2I A;  4A3F G;  4JI2 Q;  4R4O A;  1PYS B;  2GN5 A;  4BBS H;  2IHE A;  3PCO B;  2Z6K C;  4DR3 L;  4LF5 Q;  4TVA B;  1EIF A;  1UE5 A;  1PH5 A;  3CCV A;  2CCZ A;  3CF5 A;  3KFU A;  2JK8 A;  3TRZ A;  1K0R A;  2ALY B;  1YNX A;  4L5T A;  1L1O C;  1D8L A;  3J81 c;  3NEM A;  4ALP A;  4LF7 Q;  4A3C G;  4HIO A;  3DM3 A;  4B3T L;  2KHJ A;  1HNZ L;  3WWV A;  5DLQ E;  3S17 H;  1HNW Q;  1EIY B;  3J7A 5;  2UXC L;  4GN3 B;  3TEH B;  4GN5 A;  2XGT A;  5GAD C;  3K7U C;  4A3B H;  4DV6 L;  1VQK A;  3HFZ B;  4YHH Q;  2A1A A;  4LFA L;  3PUW A;  1NMG A;  4AYB E;  3CW2 C;  5IP7 H;  2VQE L;  2MNA A;  4IOA A;  2WB1 G;  2Z6K A;  2PQA A;  5AJ3 Q;  2K5V A;  5IYC H;  2BH8 A;  4A3B G;  1N32 Q;  4JI7 L;  3ZJY C;  1XMO Q;  1Y1V H;  2LXJ A;  2AMC B;  2OQ0 A;  4GLV B;  2IY5 B;  1KXL A;  1LM0 A;  3FP9 A;  4NPS A;  2K14 A;  3CXC A;  1PH6 A;  3GTP H;  3HOY H;  1O7I A;  4O2D A;  5C44 H;  2UU9 Q;  4JBJ A;  2R93 G;  4WJ3 M;  2LXK A;  1Q1B A;  3FHW A;  4LF7 L;  5IYC G;  4WJ4 A;  4JOI C;  4AYB G;  4A75 A;  4A3M H;  3TS2 A;  1WFQ A;  1E3P A;  3CP0 A;  4P73 A;  1VCI A;  1SFO H;  1E7Z A;  4GKJ L;  1J6Q A;  1GO3 E;  1HZB A;  1HNW L;  3HOY G;  1Q8K A;  5C44 G;  4OO1 I;  3T1H Q;  2R7D A;  1VQJ A;  4L5Q A;  3PUY A;  1N9W A;  2KEN A;  5FLM G;  1YJW A;  2JA7 H;  1PHJ A;  1HJP A;  4DR6 Q;  2Q2H A;  4YHH L;  5FLX c;  2KHI A;  3KJP A;  2F4V L;  4DAM A;  4DR2 Q;  3T1Y Q;  5J3B A;  4YWK A;  3OTO L;  4A3E G;  2JA6 G;  1N8R C;  1VS0 A;  4B3R L;  5AJ3 L;  3CAM A;  3U4Z A;  2B3G A;  3GTG H;  3TQY A;  1L1O B;  3K80 C;  1XMO L;  3CD6 A;  5JEA J;  2ZJR A;  1MIU A;  4PZ7 A;  1AE3 A;  1OXX K;  1X3F A;  2Z0S A;  4JI8 L;  5C3E G;  3NEL A;  3GDE A;  1IZ6 A;  1SLJ A;  3RZD H;  1XTD A;  4HIM A;  2UUB Q;  3GD7 A;  4OWT B;  1E1T A;  2OTL A;  3AFQ A;  4AIM A;  3CCE A;  3J80 i;  1K3R A;  1W2B A;  3HKZ E;  3T1H L;  1EFW A;  4DUZ Q;  4OXP A;  1PVO A;  2HHH L;  2E8G A;  2WFW A;  4EX5 A;  2VW9 A;  2R92 G;  1A0I A;  4LUO A;  1XPU A;  1C9O A;  1HZC A;  1FJG Q;  1VQ6 A;  1MJC A;  1Q46 A;  1QVF A;  4A3I H;  4LUV A;  1FVI A;  2AWN A;  5IWA L;  1YIT A;  1XJV A;  3HKZ G;  1XNQ L;  1A62 A;  1CKN A;  1N33 Q;  3PO3 H;  1YI2 A;  1Q7Y C;  1GKH A;  1E24 A;  4UPA A;  3UDF A;  4DV1 L;  4A3D H;  1FL0 A;  4NB3 A;  2I5M X;  2HIV A;  2ZJQ A;  2YYZ A;  4UP7 A;  3G4S A;  1RIP A;  1S3O A;  4C3J H;  4X66 Q;  1NJI C;  1VQL A;  1LUZ A;  1VQN A;  2R7Z H;  3Q8D A;  4KHP L;  1JT8 A;  2AHO B;  4HIK A;  4R4C A;  4JYA Q;  1FJG L;  5C4X H;  3EIV A;  4PZ6 A;  1EQR A;  3U50 C;  3EN2 A;  3S1M H;  4LFB L;  2EIF A;  2L15 A;  3BZK A;  4ME3 A;  5C0X J;  4YWL A;  1Q12 A;  2I0Q A;  3F8T A;  1KHI A;  4DV7 L;  1X3G A;  1I6H H;  4DUY Q;  1MJE A;  2UUA L;  4QIW E;  3OYY A;  4BXX G;  1L0W A;  4DR5 Q;  2NVX H;  2ES2 A;  5JEA G;  4K0K Q;  3PO2 H;  3D31 A;  5LMN L;  4A3L H;  1QUQ A;  2KCT A;  3LGJ A;  1SN8 A;  3W1G A;  1G6P A;  1X65 A;  2WAQ G;  1XMQ L;  4MZ9 A;  2VQF L;  4GNX B;  1YBY A;  4NXN Q;  5IYB G;  2MQH A;  4X64 Q;  3STB D;  4OO1 G;  1NY4 A;  3BZC A;  1XPR A;  1IXR A;  1ASY A;  5JJL A;  1I94 Q;  1IBL Q;  1B8A A;  3RLO A;  4UP8 A;  4OX9 Q;  1Y1W H;  4A93 H;  2JJQ A;  1UE1 A;  1IBM L;  1K73 C;  1UWV A;  2PNH A;  1G29 1;  3E9I A;  1HNX Q;  3HOU H;  4DR4 L;  4LFC Q;  1D7Q A;  2IHF A;  1HR0 Q;  1WCM G;  1HZ9 A;  1EWI A;  4A3J G;  4X62 L;  2JEA I;  4DR5 L;  4A93 G;  5M5X H;  2D0P A;  4B3M L;  3HKS A;  3OW2 A;  3G6E A;  3K0X A;  4DNI A;  4GOP C;  3HOW H;  1R9T H;  1VQD A;  2YTV A;  5BR8 L;  1EQQ A;  4BBS G;  4DR7 L;  4JI1 Q;  1UE7 A;  4DAY B;  4JV5 Q;  1YHA A;  4JCV E;  2ZM6 Q;  1BKB A;  4IOC A;  4DV5 L;  1PH1 A;  1CSQ A;  2WB1 E;  1HZA A;  4IPD A;  4A76 A;  4BY1 H;  4LF8 L;  1H95 A;  4IFD I;  1Y14 B;  4HJ9 A;  1X54 A;  1J5E L;  5K36 G;  1TWF H;  2F3I A;  2OTJ A;  4C2M H;  4YY3 Q;  1JMC A;  4GKK L;  3UDX A;  5FJ8 H;  1BVS A;  4RMF A;  3K7A H;  1QVG A;  2YTY A;  3E0E A;  3NEN A;  5C0X G;  4LF4 Q;  2ATW A;  4DV2 Q;  4JI2 L;  1ASZ A;  4LF5 L;  4GOP A;  1EOV A;  2N78 A;  5M3M H;  1N34 Q;  3KYH C;  5IP7 G;  2UXD Q;  2QEX A;  3CME A;  2NN6 I;  3CC7 A;  3CCS A;  1TWA H;  4JI1 L;  2HQL A;  2E5L Q;  1KAW A;  4JI3 Q;  2ZM6 L;  4XTC S;  5GRO A;  2WP8 J;  1Y1V G;  1OXU A;  2K50 A;  2A19 A;  4BA1 I;  2VS1 A;  3BJU A;  3I56 A;  3CCR A;  4PMW A;  4DV4 Q;  3HOV H;  3S2D H;  4YY3 L;  4APV A;  3F1Z A;  4A3M G;  4QY7 A;  3RR5 A;  1K8G A;  4P75 A;  5C4J H;  2PQA B;  1JE5 A;  4QJF A;  4LF4 L;  2E2J H;  4GOP B;  2OCE A;  4DV3 Q;  4DR1 Q;  2E2I H;  2IX1 A;  4QQB X;  1OXS C;  4YCW A;  2JA7 G;  2CQO A;  3ERS X;  1N32 L;  5GQO A;  3PIP A;  4FDB A;  4A3K H;  1LTL A;  2RCN A;  3NBH B;  4JI4 Q;  1VQB A;  1X3E A;  4JBW A;  2AKW B;  1C0A A;  5M3F H;  2UU9 L;  1G51 A;  3S24 A;  1U5K A;  1WYD A;  1CKO A;  3ER0 A;  4POF A;  2E5L L;  1BBU A;  3I4N H;  1YHQ A;  5ELO A;  1YEZ A;  2CKZ B;  2I5H A;  4JI6 Q;  4DV4 L;  2VL6 A;  4LF9 Q;  3TS0 A;  4GLA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...