2E5LQ

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 15
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2e5lQ00
2IT1A 3CP0A 3M9BA 4WJ4A 2OQKA 4GOPC 2YV5A 4C3HH 2EQSA 1EIFA 4KI0A 2WFWA 2KCTA 3CCVA 4BBSG 1OXUA 3D31A 2KHIA 5FLMH 2UXBL 2ATWA 4DR2L 3BZKA 4A93G 4HJ9A 3RZOH 4A3BG 2AMCB 4H02A 3I4MG 4JI0Q 1I50H 3FP9A 4JG2A 4APVA 4LF8Q 3GTJH 2K50A 2N49A 3GDEA 1Y14B 4P71A 1BKBA 4OWXB 1VQ8A 1E1TA 3HOVG 4OO1I 3S1MH 4B3TL 1XTDA 2PI2A 4OONA 1B8AA 1Q12A 1XNQL 4ALPA 3A5UA 3ERSX 1EUJA 1VQFA 4HIDA 4A3MH 3S17H 5IE8A 1WFQA 2I5HA 4JI4L 5LMNL 3PF5A 1PVOA 4NPSA 2Q2HA 4A3IH 2R92G 1PHJA 3AFQA 1YBYA 1DGSA 1QVCA 4R4OA 1NJIC 4JI7Q 3GTLH 4P74A 4DR3L 4JC0A 3NBHB 2ZJPA 1JJ2A 4P73A 3VDYA 1SN8A 3KFUA 4KHPQ 3U58A 1YNXA 3PGZA 1O7IA 1X55A 1A8VA 5IYDH 4YHHQ 2K14A 4HJAA 4IPHA 1SE8A 1PH4A 1PFSA 1XPRA 4HJ5A 2NZOA 4X65L 3HKZG 2IHFA 2XGTA 1C7YA 3KDFA 3PO2H 4OO1G 1XMOQ 4LFAQ 3J7A5 2R6GA 1W2BA 1WOCA 4A3FH 1EWIA 2LXJA 3S1NH 3AFPA 4DV0L 1Q46A 1GVPA 1JB7A 4IFDI 2DGYA 1AE3A 4A3KG 3KJOA 1N9WA 2UUBQ 4L5SA 4X66L 5IT9c 4JYAQ 1I94L 4IPDA 4K0KQ 1JE5A 1VQIA 2RF4A 4DR7L 2Z0SA 5IP9G 1TWGH 4JOIC 4POFA 5JJIA 3HOUG 4P72A 1VQJA 4BBRG 5C4JH 5AJ3L 3LGJA 1X6OA 3G4SA 5DLQE 2VQEL 1QZGA 3S1QH 4GNXA 3PSIA 1Q8KA 2WAQE 4LWCA 5BR8L 4HJ7A 4ME3A 1KRSA 5IWAQ 4MZ9A 4AYBG 4WJ3M 4YCUA 1VQCA 3HOZG 4DV1L 2AKWB 1HNXL 3CD6A 2CKZB 3DM3A 3K7UC 4RMFA 4R4IA 1OTCA 4JI8L 4IJHA 3OTOL 3T1HL 1PA6A 3UE0A 2KBNA 4GLXA 4PMWA 3H15A 2I5LX 4GLAC 4LUZA 2WB1G 4C2MH 4DPGA 1GM5A 3W1GA 4YY3L 4JI1Q 2F4VQ 4A3CH 2PMZE 5EAYA 5C4XG 3W5OA 2AWOA 3CF5A 4GN4B 3M4QA 5JEAJ 1NMFA 4RG1A 1RIPA 1VQ9A 3HOXG 4QY7A 1LTLA 3KF6B 1Y1WH 1N33L 2NVTH 4GLVB 1IZ6A 1NE3A 4DR1L 1CKNA 1LM0A 1YHAA 2OQ0A 4L5TA 4LUOA 4UPAA 3HOYG 4LF9Q 4LFBL 1WJJA 1PH6A 1IBML 4DUZQ 3L7ZC 3H3VH 1VQDA 2IX0A 4BXXH 1UE1A 4AQYL 3M4OH 2K52A 3CQZH 1WYDA 4LF5Q 4A3JG 3M3YH 4R4CA 4MTNA 3J80c 4DNIA 1NY4A 4DR5Q 1X9NA 3PF4A 2UUAQ 1FL0A 1Q1EA 4X64Q 4YCVA 1KRTA 1YHBA 1B7YB 4DV4L 3RNUA 2JA6G 3PUXA 1Y1VH 2C35B 1X54A 2MFIA 4IPCA 1XMQQ 4Y52H 2Q2IA 3TEHB 5M3MG 3CMAA 3KYHC 3UDXA 4A75A 1PH5A 1XNRL 2ALYB 2YTXA 3A5ZB 3E9IA 2K5NA 1R9TH 4JBMA 2E2JH 3U4ZA 4LF6Q 1FGUA 2JK8A 4GS3A 1M1KC 4B3ML 3TREA 2VQFL 3JAMi 1PH3A 3CC4A 1W3SA 3K80C 3CCLA 1UE7A 2CWAA 2R7DA 1YVCA 4O0AA 1UEBA 4DV7Q 1I6HH 5JJLA 2RHQB 2A1AA 2UXCQ 1GO3E 5C3EH 1VS0A 1AH9A 4LFCL 4LF4L 4C3IH 1L2FA 1LUZA 1PH1A 1VQHA 2Q2TA 2MO0A 4A3GH 5IWAL 1UWVA 4KHZA 1N8RC 4Y7NH 1VQ6A 4GKJQ 2B3GA 2IY5B 1JJGA 1OXXK 4IPGA 3KLWA 3J81i 1HZ9A 2JEBI 4A3EH 1HNXQ 1ASYA 2D62A 4NXNQ 4DV2Q 2R93G 3NEMA 1PV4A 1IBLQ 4A93H 4LW1A 1XNQQ 2NVYH 1YI2A 4JCVE 2XTIA 3OTOQ 3T1HQ 1VQ7A 1TWCH 3S2HH 1Q82C 4X6AH 3GTPH 1J5EL 3Q8DA 1MJEA 2NVXH 1G6PA 4JI1L 4HIMA 5HY6A 3RN5A 1RL2A 2PI2E 3PUWA 2HHHL 5GADC 1QVGA 4BA2I 3H0GG 4JOIA 3PIPA 5C4XH 3CPFA 2Q2UA 1PH2A 4JI5Q 1FJGQ 3HOUH 3HOWG 4JV5Q 2K5HA 4QJFA 2ZM6Q 4YWMA 4LF7L 3HOXH 4A3GG 1KAWA 1E22A 1CSPA 4DV5L 1EFWA 2UXDL 2EXDA 2JQOA 3A74A 4O2DA 4HIKA 1EYGA 2E5LL 4LF9L 4POGA 3CCJA 2VUMG 3HOVH 3EIVA 4OWTB 4A3FG 4IOAA 3OYYA 4AQYQ 1B70B 1E3PA 4IO9A 1HR0W 4L5RC 5LMUL 4EQ5A 2PQAB 4DK6C 1X3GA 4HJ8A 3T1YL 2JJQA 4DR5L 1TWFH 4QIWE 2PQAA 2ZTDA 3G6EA 3G71A 4X64L 4BBSH 2F3IA 1IL2A 5J3BA 4JBKA 4BXXG 5IYDG 3S2DH 1XMQL 3CAMA 1PH9A 4LF8L 3H0GH 5FLXc 1A62A 5C0XG 3ER0A 1SRUA 3F2DA 1K8AC 1XNRQ 5IYBH 3CC2A 3WWVA 1N34Q 3U4VA 1YJNA 4B3TQ 1Q81C 3I7FA 2N8NA 4X62Q 1X65A 1XPOA 2KHJA 2UUCL 4PZ6A 2KCMA 2PNHA 4YWLA 2D0PA 3L0OA 2CQOA 3RLOA 1VQMA 4XIGS 4MNOA 1QUQA 1D8LA 1G291 5M3FH 1SROA 1WI5A 2GN5A 1VQEA 2LSSA 3K7AH 3RZDH 3UDIA 2H5XA 1K8GA 2UXCL 4A3JH 1N36L 4BY1H 4DR3Q 3J7ZC 5GAHC 4LF4Q 4LFCQ 2VY3A 4JI6Q 3CW2C 3TRZA 1GKHA 4BY7H 4GKKL 2HT1A 2OWOA 1KHIA 4B3RQ 4JBWA 1VQ5A 1YZ6A 1YJ9A 3NELA 4DUYQ 3MXNB 4IOCA 4OX9Q 3I4MH 3MEFA 4YHHL 1K83H 5C3EG 4AH6A 1YJWA 1V1QA 4GKJL 1X3FA 1C9OA 1IYJB 1P8LA 2UU9Q 2E2IH 3CCUA 3HOYH 2OTJA 3S1RH 3W1BA 1JJCB 2JE6I 1XMOL 3B6YA 2OCEA 4TQUS 3PIOA 2WB1E 5IYCH 1A0IA 4AIMA 1Z9FA 3CPWA 2YTVA 1I3QH 2BH8A 3J80i 2ZJRA 2N3SA 4JYAL 1EQRA 4A3IG 2Y0SE 1J5EQ 5IP7G 4NXMQ 3I2ZA 3K8AA 1OXVA 2QEXA 4DAYB 4A3CG 4K0KL 2EIFA 4PG3A 4BY1G 2ASBA 1H95A 3PUZA 2NZHA 4DR2Q 1Y1VG 2N78A 4A3KH 1VQPA 1S40A 4JI5L 1NMGA 1FJGL 1VCIA 1N32L 2ZJQA 4LNQA 2B63H 2JA6H 2VQEQ 1E24A 3S15H 1AE2A 1YITA 2B29A 4JI0L 3M7NA 3JC66 1HNWQ 5C44H 3I4OA 2MO1A 4DV5Q 2ZTCA 1L1OB 4QGUA 1S72A 2E5LQ 4JI3Q 3S16H 1Z47A 3KF6A 4UP7A 4DV3L 3PUYA 3BZCA 5M5WH 4C3JH 5GAEC 4BA1I 1E7ZA 1K0RA 3PUVA 2D0OA 1YIJA 3ULPA 5IYCG 1IBKL 2K5VA 3G48A 5LMUQ 3T1YQ 3I4NH 3E0EA 2BH2A 4JI8Q 3U50C 4JI4Q 1YHQA 3CCQA 2HQLA 1XPUA 4QQBX 5LMNQ 2R92H 2ID0A 4B3SL 4YWKA 4YY3Q 2F4VL 4DR6L 3CCEA 3UE1A 5M3MH 1BBUA 3F8TA 2VW9A 1HZAA 2AWNA 2B63G 3F1ZA 2JA7G 4J15A 2KENA 1N34L 1VQLA 3ICEA 1TWHH 4KHPL 1XJVA 3GO5A 1CSQA 2YYZA 4L5QA 4UY8C 2UUCQ 2F52A 1C0AA 3E9HA 5IYBG 2Z6KA 4X65Q 2FXQA 5ELNA 5FJ8G 4LUVA 1IBMQ 4DUZL 3ULJA 2IX1A 4UP9A 3CCSA 1TXYA 1PYSB 3FHWA 3DLLA 3GD7A 1N36Q 5GQOA 4OXPA 1A63A 3KJPA 3HKZE 1YEZA 3K81C 2UUBL 4JI6L 5E7NA 2I0QA 2R7ZH 3M85A 4X66Q 5K36G 2R7ZG 3JAMc 4BBRH 4DV4Q 4OX9L 2IHEA 3J81j 1V43A 2Y0SG 2K4KA 4DV6L 2NVQH 2JA8G 2UU9L 4BY7G 4DR4L 3PV0A 3CCMA 4DKAC 2VUMH 4A3EG 4A3LH 1PH7A 1Q86C 3GTMH 1MIUA 2JA9A 3OW2A 5ELOA 4TVAB 3K0XA 3F2BA 3AEVA 4LF6L 5BR8Q 3BU2A 1L1OC 3D0FA 3EBEA 4B3MQ 4A3DG 3HOZH 2QA4A 4A3DH 2NN6G 4P75A 5GAGC 4DV1Q 4DV7L 2ES2A 1VQGA 4NXML 4JI2Q 3I55A 1K9MC 3TQYA 1HZBA 3M4PA 1VQBA 4YCWA 1K3RA 1EOVA 1U0LA 5FLMG 2CFMA 3S14H 3CMEA 4R1JA 1KIXA 2K75A 1HNZL 1HR0L 4R4TA 1OXTA 1N32Q 1NTGA 4GNXB 5JEAG 1T9HA 2VS1A 4EX5A 3RN2A 1HNWL 1KC8C 5IP9H 5IY0A 1EIYB 2YU9H 4JI3L 2VL6A 4DV3Q 2MNAA 5H1SE 1QZHA 3GTKH 3GTQH 1N33Q 4NXNL 4A76A 4DV2L 1IBKQ 1SR3A 1VQKA 2CCZA 4NB3A 2RHSB 4PZ8A 3CCRA 2A8VA 3GTOH 2R93H 4DR1Q 4A3MG 1GD7A 2R7FA 3PO2G 4LFBQ 5M3FG 2NN6I 3AYHB 5HGQA 5IP7H 4B3SQ 4JBJA 4DR6Q 2UXBQ 2JA8H 4LF5L 1WCMH 4UP8A 3AQQA 3HFZB 2HIVA 2LXKA 2RCNA 3STBC 4JV5L 3HOWH 2VZAA 5M5YH 2UUAL 2ZM6L 2QGQA 4GN3B 1CKMA 2ZTEA 3RLFA 2BA1A 4QL5A 1SFOH 1E1OA 1CKNB 2WP8J 3GTGH 1UE6A 2CWPA 2JA5G 2UXDQ 1HZCA 1BBWA 2JA5H 2HIXA 4OWWB 2BA0A 3RR5A 3PCOB 1MJCA 4HIOA 1EQQA 2A19A 2GVBA 1ASZA 1PH8A 1G51A 4IFDG 2WAQG 1P16A 3STBD 3KOJA 3UDGA 3KDFB 1QUQB 2VQFQ 4AYBE 1KQSA 5FJ8H 1KXLA 1SLJA 2DUDA 1I5FA 3PO3G 3J81c 3PO3H 3F2CA 4PZ7A 5GROA 1CKOA 4A3LG 4FDBA 1X3EA 2YTYA 4DV6Q 3CXCA 2OTLA 4JI7L 1S3OA 4DAMA 4DR4Q 2JA7H 1JMCA 2E8GA 2V1CC 2L15A 1KL9A 3TS0A 1Q7YC 4A3BH 1JT8A 5JJKA 5M5XH 1Q1BA 3RLNA 4X62L 3KF8B 4GNXC 1UE5A 1Y1WG 1VQ4A 1V9PA 2Z6KC 1L0WA 1HH2P 3CC7A 4LFAL 3SGIA 2JEAI 4GN5A 2MQHA 3FKIG 4A4IA 4GOPB 3EN2A 4JI2L 1VQNA 2GVAA 4KLKA 1K73C 1WCMG 4GOPA 1M90C 2I5MX 4DV0Q 3L2PA 1IBLL 1PYBA 1FVIA 1X56A 2VNUD 1HNZQ 1HR0Q 4GKKQ 4B3RL 4DK3C 1CUKA 1NBWA 4IJLA 1I94Q 3TS2A 1LYLA 1SMXA 5C0XI 3I56A 1VQAA 1U5KA 5C44G 3UDFA 5LMNW 1HJPA 1IXRA 1VQOA 2E2HH 2HHHQ 4DR7Q 4R4QA 3H3VI 2AHOB 4IFDJ 3S24A 1TWAH 5AJ3Q 4LF7Q 3IRBA 1OXSC 1J6QA 3A0JA 1D7QA 1QVFA 1L1OA 3FKIH 1MKHA 1BVSA 4DUYL 3I4NG 3NENA 5C0XJ 3ULLA 4XTCS 1KD1C 3ZJYC 3BJUA 3HKSA
chains in the Genus database with same CATH superfamily
2A6HC 2KA7A 4GOPC 1WTHA 5FLMH 2LFNA 1IKMA 1WTPA 2EJMA 2SDFA 1DZ1A 2WB1B 4JG2A 4APVA 4C56C 4DAVA 4ULLA 5J39A 2N49A 4L8JA 1AEXA 3I72A 1FGBD 1VQ8A 1BKBA 4R8IA 5IT9E 1Y8OB 3S1MH 3R2TA 4B3TL 2PI2A 4OONA 4IQZA 3NE5B 2DNCA 4RA8A 3TZUA 1VMPA 5LMNL 3PF5A 2A69C 4NPSA 1PVOA 1PFNA 4C2MB 4CJ2C 1DGSA 2RDGA 2FHTA 3IFTA 3IAYA 4KHPQ 1SN8A 3PGZA 3CRLC 1A8VA 4YHHQ 4HJAA 1PFSA 1SXTA 3VYSA 3V96A 1XPRA 4HJ5A 4X65L 2Q8IB 2XGTA 3RZOB 4ZKCB 5FO9B 2Q8RE 4OO1G 3T53B 4G7HC 1XMOQ 3J7A5 1C48A 1W2BA 1PMRA 1CI3M 1EWIA 4DV0L 1I6VC 4A3KG 2HQEA 5FLXL 4JYAQ 4QIWB 1I94L 4KKTA 1D5ZC 4RGTA 2NVXB 1TWAB 4TKOB 1TWGH 5DM73 1GHJA 3G4SA 2L0CA 4K8JA 3HRZC 5DLQE 3MFYA 2B2WA 2WAQE 5BR8L 4ZKBB 5IWAQ 1F2YA 1VQCA 3HEJA 1PDQA 1HNXL 5JAVA 3CD6A 2CKZB 4RMFA 3A8JE 1QB5D 1B44D 1L0YB 2JXMB 3HOWB 2Z4IA 1JC7A 4IJHA 1PA6A 3UE0A 1Z7TA 4DK1A 1GM5A 4YY3L 3I4MB 4A3CH 2PMZE 3SK8A 1SNMA 4KN7C 4OIJA 3W5OA 4DN4M 4K5XA 4C1NI 2WKDA 1NMFA 5D3IB 3KF6B 4L63B 2J4XA 5M5XB 4GLVB 1NE3A 2PW5A 2X6GA 2ZT9C 3ND8A 4DR1L 1LM0A 1U9RA 3I3CA 2FMCA 4K6DA 4UPAA 4LF9Q 1WJJA 4G7OC 4DUZQ 3L7ZC 3H3VH 1U4PA 2AQ1B 4OL7A 4ZLTF 4DNIA 1X9NA 4OGQC 3KBGA 1EIGA 1CK1A 1CT1D 5CORA 5C44B 1Y1VH 3MZ5A 4Y52H 1B3AA 1LTAD 2XIWA 2F0EA 2QCPX 4QMGA 2R61A 3R93A 4G4KA 3UDXA 1Y8PB 2EXZA 4EQPA 3E9IA 4CGYB 2E2JH 4C3JG 3IKJA 2JK8A 4J6HA 1I50B 3MXUA 3JAMi 3K80C 1UE7A 2IL8A 1I6HH 2R93B 4DV7Q 5JJLA 3D3RA 2A1AA 4F7XA 4BBSB 1GO3E 4RAUC 1VS0A 3EJIA 5E3FA 1SFOB 1BCPD 2B63B 1EYDA 1TVXA 5KYLA 1EYAA 3FMCA 3KLSX 2MO0A 1JJGA 5CV4A 1K8MA 1M8AA 1AN8A 2K32A 1TQOA 3KBXA 3H94A 1PV4A 2IPKD 1IBLQ 3I91A 1W6KA 3OMCA 2O2LD 4JCVE 1YI2A 3KLSA 3GTPH 4ZK9B 1MJEA 4KHVA 4JI1L 3NP8A 1QVGA 2Q2UA 1F2LA 3HOWG 1FJGQ 3C2PA 5FKAC 1K0SA 1JOOA 2K5HA 4QJFA 5FOBB 2ZM6Q 1BNZA 3S1NB 1B2TA 4LF7L 2EY2A 1CSPA 4DV5L 2UXDL 4A3LG 1PLFA 3A74A 1EYGA 4A3FG 3OYYA 4IO9A 1EY0A 4HJ8A 1X3GA 2O5JC 2JJQA 2EJFC 4DR5L 1TWFH 4QIWE 4X64L 4FXDA 3E0JA 4BBSH 4BXXG 3HOZB 5C3EB 1QJOA 2K7VA 1PH9A 4LF8L 5C0XG 3QOJA 1G2TA 3DWPA 1SRUA 1XNRQ 5T1GA 3CC2A 1YJNA 3HS0C 4P2CB 2N8NA 1W6JA 4X62Q 2UUCL 4FVMA 2RVLA 3W3AA 2PNHA 2B2YC 1ILQA 2D0PA 2F0MA 4FF4A 5M3FH 2GN5A 1JOKA 2K04A 4JK1C 2QDBA 3BDLA 3RZDH 3UDIA 2UXCL 1N36L 3J80E 5GAHC 4LF4Q 1ZEQX 1RDPD 2OWOA 1KNEA 2M9VA 3MXNB 4IOCA 3I4MH 5CGKA 4GKJL 5C3EG 1X3FA 5M5YB 1C9OA 1IYJB 1P8LA 1FYCA 3CCUA 3HOYH 1JJCB 2JE6I 3M4YA 2WB1E 5IYCH 1PZID 5C3XA 3BDCA 3OWFA 2ZJRA 1RTNA 5JOBA 4M8AA 1K3BC 3I2ZA 4A3CG 1H95A 1VQPA 5HGTA 2JA7B 1VCIA 1S5ED 2ZJQA 2JA6H 3BVMA 1EY6A 1PRTF 5C44H 3TDQA 1B9MA 2A68D 2I46A 1EFID 1CM9A 1TY2A 4UP7A 3VR6A 3PUYA 1GUTA 3D4DA 1E7ZA 1XNQQ 3PUVA 5IGCA 5C5LA 1D1IA 3T1YQ 3I4NH 2OF1A 4F8MA 3NPPA 3U50C 1WTOA 2ID0A 1UAPA 4DR6L 4YWKA 3CCEA 3UE1A 4R9WA 3F8TA 2JA7G 2B63G 2XRQD 2KENA 3ICEA 3MFGA 4CHTB 4RHSA 1C0AA 3E5SA 2EZVA 4HMJA 1H9RA 2FXQA 3DMUA 2IX1A 1HFNA 4UP9A 3CCSA 4WJWA 5C4XB 1HCZA 2KCNA 4OXPA 3U9OA 4K2KA 3KJPA 1YEZA 3M85A 4X66Q 4DV4Q 1I4HA 3J81j 3V05A 2RSNA 4DV6L 2K4KA 2JA8G 1EQTA 4BY7G 4DR4L 2BE5C 2E75C 3K5OA 4RHRA 3OW2A 3F2BA 2CW0C 1B9NA 4A3DG 4I7AA 2QA4A 1BBXC 4P75A 5EGTA 5IGBA 3TQYA 4OHJA 1UUPA 4MN3A 2CFMA 3VR4A 4R1JA 1HNZL 1HR0L 4R4TA 5JEAG 3D8GA 1A3UA 3KK7A 5KNCA 5IY0A 2YU9H 1QILA 5DNFA 4DV3Q 5F2DA 2MNAA 1QZHA 1IW7D 3GTQH 4DV2L 1SR3A 2A74C 4RGMA 4A3MG 2AQ2B 5I6YA 2DY8A 5FO8B 1YNND 3DEOA 3P20A 4JV5L 2RCNA 4HEDA 3HOWH 3RLFA 1CKMA 3A7LA 4EQOA 4QL5A 1CKNB 1OO9B 4DFAA 3GTGH 3D4RA 1KDCA 2E76C 1BO0A 3DWQA 1EIHA 3PCOB 1EQQA 2HCCA 4HIOA 1PH8A 1TY0A 3KOJA 3KDFB 3EQLC 1CZWA 2NTTA 4H13C 2NTSA 2DUDA 3PO3G 3F2CA 2A73B 4JI7L 3CXCA 2J7ZA 1S3OA 2DN8A 2JA7H 2V1CC 3GTLB 3TS0A 2TSSA 5JJKA 3J81E 1Y1WG 1GUOA 4IUUA 4N8X1 3KF8A 1L0WA 5M9OA 1YNJC 2N88A 4LFAL 2EY6A 2JEAI 4JI2L 2MQHA 4GOPB 1WCMG 4GOPA 2R3ZA 2I5MX 4DV0Q 3DWAA 1FVIA 4RH6A 2B2UC 1I94Q 1X32A 3TS2A 5C44G 4FF1A 1IXRA 2HHHQ 1CHPD 2F0PA 2AHOB 3C1FA 3ONAB 4CKBA 2PZTA 2K5WA 4H44C 1L1OA 1BVSA 3I4NG 3A55A 5FLXE 1V1OA 3ZJYC 3BJUA 5DAUA 2IT1A 4PMCA 3K5LA 3C1EA 4C3HH 1EIFA 3CCVA 3NSWA 1HPCA 3BZKA 4HJ9A 1HFGA 4A3BG 1Z6HA 4H02A 3I4MG 2CVRA 1G2SA 2EOTA 1AW7A 3GDEA 1Y14B 1JQYD 1EZ6A 1LTRD 4KTAA 3SDZA 1UEAB 4ALPA 4V190 4N9TA 1WVLA 1IL8A 2AQ3B 4F87A 1WTQA 1DOLA 2N55A 3SEBA 2SOBA 4A3IH 1QVCA 4P74A 1LTSD 3MEHA 3NBHB 3GTJB 2F03A 1O7IA 2F0GA 5EKKA 3X3MA 2F0VA 3KDFA 1EY9A 3JAML 3S9WA 5CV8A 1ET6A 3S1NH 3CU7A 4IFDI 1Q46A 4KY6A 3LNNA 1N9WA 4IUNA 3KJOA 2UUBQ 2E2JB 4L5SA 5IT9c 4K0KQ 2RF4A 4DR7L 2Z0SA 3VA7A 4MHEA 3I4NB 5JJIA 4BBRG 5I6WA 3UI2A 1NCVA 4MZ9A 4XYQA 4YCUA 2CHBD 1BCPC 4DV1L 2LS01 1Q8IA 1T5XD 4XDXA 2OEOA 1NR4A 1SE2A 4GLXA 1NAPA 4PMWA 5EKIA 2WB1G 3Q24A 3W1GA 2F4VQ 4JI1Q 3A54A 5EAYA 1QCBD 4NMZA 4OO1H 3M4QA 4RG1A 1VQ9A 4U673 3HOXG 3MXGA 2DNEA 3R8BA 1ILPA 1YHAA 4B9WA 3HOYG 4L5TA 1TWGB 3K59A 4DXFA 2NN6H 1PH6A 1IBML 1U4RA 2IX0A 1UE1A 1UNSA 3FEWX 2K52A 3CQZH 1DOMA 3EROA 1NY4A 1PTOF 2UUAQ 1Q1EA 4X64Q 1STEA 4YCVA 3PIO3 5CV6A 1PTOD 2C35B 2MFIA 4OELB 5M3MG 4FF3A 3KYHC 1PH5A 5EBCA 3TBIB 3S1RB 1ONLA 1RJTA 4DGZA 1S5DD 1FNUA 3K57A 2F0JA 2F0LA 1FGUA 4B3ML 4XYOA 3TREA 3CCLA 2A6ED 1WD0A 4O0AA 1YVCA 5C5MA 3DEPA 2BDOA 1AH9A 4LF4L 4CJ0B 1L2FA 1PH1A 4KD3A 1VQ6A 2PNRC 3QWNA 4Y7NH 4DA2A 2NVYB 1HZ9A 4A3EH 3QJYA 2D62A 4QCLA 4ZAIA 5JPNC 3NEMA 4LW1A 1SE4A 1TS3A 5IGFA 1VQ7A 1TWCH 1STNA 3P75A 3WOFA 3M4OB 1J5EL 3Q8DA 1RL2A 1SMYC 2PI2E 3PUWA 1SNPA 3H0GG 3PIPA 1PH2A 3HOUH 1CQVA 4YWMA 4JPBW 1LTGD 4RKBA 4A3GG 5ELEA 3HG9A 4XQJA 1E22A 1EFWA 4CDFC 4HIKA 3FDTA 3N6RA 3CCJA 2EYOA 2JN4A 4ZUJA 4AQYQ 1S5CD 5LMUL 1Y69U 1LLRD 2PQEA 3HOYB 4Q0FA 3G6EA 1G8ZD 2JSOA 5J3BA 1D1KA 3S2DH 1IKLA 3OOCA 1XMQL 3CAMA 5FLXc 1A15A 3E3XA 3W2DA 3G7LA 3ZYYX 5IYBH 3WWVA 3NWTA 3U4VA 2KVMA 4ZRZA 4B3TQ 4HN7A 1SYEA 4IURA 3C46A 1KTKA 1XPOA 2EYFA 4A3GB 2HDMA 1EYCA 4YWLA 5COYA 5A2QE 4MIUA 4MNOA 1KLUD 1G291 1WI5A 4MTKA 3GQBA 1VQEA 2LSSA 4A3JH 4X3TA 4BY1H 4NKLA 3J7ZC 4DK0A 4LFCQ 1C4QA 2VY3A 4GKKL 3H91A 2MJ8A 3MXNA 4JBWA 1YZ6A 2A6HD 2O4XA 1FNVA 4YHHL 4AH6A 2UU9Q 3NWSA 2E2IH 1CTMA 3B6YA 3MVVA 5ISRA 2B2YA 2OCEA 3PIOA 2AUKA 2K33A 3J80L 1I4QA 3NTIA 2EE1A 3J80i 2BH8A 2MP1A 4A3IG 5IP7G 3K8AA 4I65A 1OXVA 4DAYB 2WINB 2HD3A 2NZHA 4A3KH 1DD2A 4IUVA 1ESFA 1N32L 1HUNA 1I4GA 4LNQA 1WTXA 1E24A 3Q6SA 1EWCA 2VB3X 3M7NA 1CZGA 1SAPA 3I4OA 2MO1A 1B50A 2ZTCA 1L1OB 5IOCA 2E5LQ 3ERQA 4RGOS 3S16H 3NQTA 1Z47A 4C3JH 2D0OA 2QW7A 3ULPA 2K5VA 2Z1CA 4JI8Q 1EEID 4XT1B 1YHQA 3CCQA 5EPLA 3N52A 1RF2D 4B3SL 4YY3Q 2IJ0A 1J8IA 2PW7A 5KNBA 2JYOA 4HSPA 5M3MH 1HQRD 4JW0A 2AWNA 1DOKA 1Q3LA 4J15A 1N34L 1TWHH 2K05A 5EBDA 3VR3A 2NVQB 1CSQA 5CC4A 1ICWA 4DAPA 3FVQA 2CQAA 3E9HA 4X65Q 3RZDB 5JJZA 1NR2A 5CV9A 3T51B 4LAAA 2IWHA 1MBYA 3GD7A 5GQOA 1A63A 4C3IB 1GUGA 3HKZE 4K6LA 3CKIB 4C3HG 3JAMc 1TWCB 3NBHA 4OX9L 2EDGA 2IHEA 3URYA 4WRDA 1V43A 1IYVA 1Y1WB 3PV0A 3HOUB 4DKAC 2VUMH 4A3EG 3VYTA 1PH7A 1E2WA 1TS5A 2A68C 5ELOA 1TWFB 2AUJD 3VA5A 3HOZH 4A3DH 2NN6G 1QNUA 4X3UA 5GAGC 2EYPA 2HCIA 4JI2Q 3M4PA 4YCWA 4Z9CB 1K3RA 1U0LA 5FLMG 1GUWA 4QUFA 3HP3A 4HTHA 1GHKA 3BVZA 4ZYSA 5JEAH 2VS1A 1H9MA 5D14A 4RWSC 1HNWL 5M3FB 4DF7A 5IP9H 4JI3L 3GV6A 4ODGA 3T13A 3K5NA 4NXNL 2RDHA 4A3DB 5CR3A 4DAYA 3GTOH 4DR1Q 4IUPA 1GD7A 1B1ZA 5M3FG 2RA4A 3AYHB 1PFBA 4KKSA 5IP7H 2ZXRA 4HCSA 4ZQ3A 4A3JB 2JA8H 4NW2A 4LF5L 4UP8A 3AQQA 3STBC 1SYCA 5M5YH 2WV6D 2ZM6L 2QGQA 4HSVA 1E1OA 2WP8J 1UE6A 3BVGA 1LTTD 1O78A 2XWJB 3NTKA 3HGBA 4QUCA 4DU9A 4OWWB 3RR5A 1ZXTA 5ELDA 1MJCA 5I4DA 4IN3A 1FNWA 3SK4A 4XQNA 1G51A 2WKCA 3UDGA 3STBD 1KQSA 4AYBE 1E2ZA 5FJ8H 1BCPF 3PO3H 3O13A 1CKOA 4XXEA 3RD4A 2B2UA 3S15B 4FDBA 2PCFB 3TP7A 3VR5A 4KK7A 1WD1A 4KJOA 4C3IG 1JMCA 1KL9A 1Q7YC 5M5XH 3TN2A 3KF8B 4GNXC 2NUCA 2HUGA 5BN5A 3SR1A 1PYWD 2RDFA 3FKIG 1IBLL 2VNUD 5CMDA 3BDOA 3QO2A 5C0XI 1II3A 4DUYL 4N9PA 1VQOA 2Z6BA 3DHQA 4DNRB 4A3IB 2BCOA 1SYGA 4LF7Q 3A0JA 4PMBA 4C3HB 2RCFA 5C0XJ 3ULLA 2Z4HA 1KD1C 3HKSA 3I70A 1BXTA 3NK9A 3M9BA 1GUSA 4WJ4A 1EOTA 2YV5A 2EQSA 2WFWA 2KHIA 2UXBL 4RGNA 4DR2L 2XVSA 3QOLA 3LWEA 4JI0Q 4LK1C 3IL8A 4LF8Q 5JVH3 1D5MC 4P71A 1B3QA 1QOHA 4OO1I 2OT2A 1R4PB 1XTDA 4C1NK 1XX8A 1XNQL 3GTMB 4X3KA 3A5UA 1VQFA 4FP5D 5IE8A 1WFQA 2I5HA 1LT6D 4JI4L 1QWYA 1O7ZA 3J7AV 1KABA 3AFQA 3MTSA 3ND9A 4A93B 3FPUB 1NUCA 1NJIC 3GTLH 1CA5A 1IHZA 4DR3L 1SJED 1QE6A 4NDXA 3KFUA 4ME5A 3PO2B 3U58A 2B2VC 1CQFA 1X55A 5IYDH 2K14A 4IPHA 5EPJA 3HKZG 1F2ZA 2G5DA 2R6GA 1WOCA 3AFPA 1JB7A 3GTOB 1GVPA 1AE3A 3EVQA 5JVG3 4IPDA 1SNQA 3SK6A 1JE5A 1AFPA 5IP9G 1Y1VB 1ML0D 4JOIC 4POFA 2JP1A 1F9QA 4P72A 2LY7A 2VQEL 5AJ3L 1QZGA 3LGJA 3S1QH 2PYKA 3PSIA 1JOQA 4HJ7A 1KRSA 2R7ZB 4WJ3M 3FRPB 2F3WA 3HOZG 1S4ZA 2AKWB 2KOLA 3QIAA 5KYIA 4G57A 3D4WA 2D2CC 3H15A 4EGVA 2I5LX 3T4AC 4C2MH 4DPGA 2F0UA 5C4XG 4ZCKA 2AWOA 5LL6X 3CF5A 5J22A 3I90A 5JEAJ 4I7ZC 4QY7A 1LTLA 1Y1WH 1N33L 1RTOA 1TKWB 4LUOA 3MC0B 4LFBL 5C4HA 3OHXC 1F77A 3DUZA 4BXXH 2E2IB 4AQYL 1H9SB 2YU9B 3A7AB 1WYDA 1LV9A 4MTNA 4K5VA 4DR5Q 1HA5A 2F0IA 3TP8A 3PF4A 1FL0A 1EU3A 1KRTA 1B7YB 3PUXA 4TSSA 4IPCA 4BS9A 1M4VA 3TEHB 4K5WA 4YIJA 4A75A 1F9RA 1XNRL 4HMIA 2YTXA 4A3KB 4BWGB 1R9TH 2K5NA 2FMMA 3TZDA 3U4ZA 4LF6Q 2B2TA 5BN3A 4GS3A 3HZXA 5KIXA 2VQFL 3CC4A 1PH3A 4CKCA 2R7DA 4R8NA 4FXGC 2UXCQ 5C4JB 5C3EH 1DCZA 4C3JB 4LFCL 4C3IH 2VB2X 1VQHA 1MSGA 1V1PA 2EYMA 4M1UB 4KHZA 4GKJQ 1OXXK 4IPGA 3KLWA 4CDEC 3J81i 1HXYD 2KHSA 3K7AB 2XNAC 3MWYW 1HQMC 1B4OA 2NVYH 1BQQT 2XTIA 3OTOQ 3T1HQ 2JA5B 3EFXD 4DNTB 4X6AH 3SHLA 2NVXH 1PXUA 4HIMA 5HY6A 3RN5A 1PTOB 2HHHL 1SNCA 3CPFA 3PMFA 3QR8A 2KUMA 2Z9HA 3HOXH 4S3SA 4ABNA 1EY4A 1KAWA 4DXGA 4BY1B 3Q23A 2JQOA 4O2DA 2E5LL 4POGA 4LF9L 2VUMG 1ZYRC 4OWTB 4IUQA 2KJXA 4IOAA 1ET9A 3T56B 4L5RC 4IFDH 1B70B 3OPOA 1HR0W 4EQ5A 2PQAB 2P5ZX 4DK6C 3T1YL 2PQAA 1SNOA 5KNDA 1SJHD 2JA6B 1STGA 4JBKA 2D5DA 2F0KA 5IYDG 2G9HD 1A62A 3V2TA 3F2DA 1K8AC 1GJXA 2FINB 1U4LA 1BDOA 4PV1C 2F1MA 4ID6A 1X65A 3J7AF 4PZ6A 2MPMA 2KCMA 1H9SA 3X3NA 1CFMA 3KLRA 2CQOA 3L0OA 1AZPA 4XIGS 5E4XA 1SROA 1U4MA 1JWSD 3K7AH 2K01A 5TSSA 3BG3A 4OEMB 3S16B 2RSOA 3TRZA 1LABA 3CW2C 4BY7H 4B3RQ 1KHIA 1YJ9A 3NELA 4OX9Q 3MEFA 1K83H 3TP5A 2F0WA 2OTJA 4UDUC 4PNYA 1ENCA 3W1BA 1XMOL 4XQQA 4FF2A 4TQUS 4KD4A 4RCNA 2EYHA 5I9OA 1A0IA 4AIMA 1Z9FA 3CPWA 1I3QH 1DXMA 3JAME 5DEHA 4JYAL 2Y0SE 2PO4A 2QEXA 2M00A 1D2BA 2Z8LA 3PUZA 2DJFC 1JE4A 2NB0A 4KV6A 2N78A 4JI5L 1V1PB 1NMGA 1VF5C 4RKLA 2B63H 3CRKC 2MUYA 5IT9L 3S15H 1AE2A 1YITA 1EY5A 2B29A 3JC66 1HNWQ 4DV5Q 1S72A 3PIP3 4DV3L 3OSOA 3CQZB 3BYYB 5GAEC 1A2UA 4BA1I 1K0RA 3J81L 1YIJA 5IYCG 1AZQA 3E0EA 2BH2A 1SBBB 2WACA 4KKUA 4GZYC 4QQBX 4NP5A 1I6HB 5LMNQ 2R92H 2F4VL 4K8IA 4J1MA 3ITPA 1BBUA 1HZAA 2F3VA 3R3OA 4KHPL 5I2YA 3NUCA 2YYZA 2LKVA 1FR3A 4L5QA 3RUZA 5K5PA 2SNSA 2UUCQ 4UY8C 1K83B 2F52A 1GOZA 5ELNA 1LO5D 1IBMQ 4DUZL 2F0TA 2WIIB 1TXYA 3FHWA 2J0TD 1N36Q 1YNNC 1A3VA 2DJGC 3K81C 4JI6L 5E7NA 2R7ZH 5K36G 1NSNS 1DJRD 1C8CA 1MD2D 2BOSA 2Y0SG 1PRTB 5ELCA 1Q86C 1MIUA 2JA9A 4CDCC 3K0XA 5BR8Q 3BU2A 3D0FA 2NWGA 3EBEA 1LACA 4B3MQ 2F0HA 2EYJA 4K2LA 4DV1Q 4DV7L 4NXML 5A2QL 3I55A 1HZBA 1JICA 2K5DA 2C9OA 1F9PA 4TRDA 3CMEA 3S14H 2KQ3A 2K75A 1NTGA 1T9HA 1SEBD 5IGDA 1EZ8A 5CV5A 1YNJD 5J1ZA 1E2VA 1IBKQ 1RD9D 4PZ8A 2A8VA 3A56A 1STAA 5HGQA 1XTCD 1GXDC 4JBJA 4DR6Q 5FO7B 4F88A 2UXBQ 4L6TB 3NTHA 1A2TA 1KDAA 2HIVA 1JCKB 2BA1A 3D6WA 1SFOH 1TS2A 2CWPA 2JA5G 2UXDQ 1HZCA 3M7GA 1D5XC 3S2HB 2BA0A 1BOSA 4N8FA 2KCCA 1EY8A 2CH4W 1ASZA 4IFDG 1LT3D 1P16A 1KXLA 1L0XB 1I5FA 1I3QB 4RFBA 3HKZB 2SNMA 1HA6A 3GV3A 4DR4Q 2VXWA 4DAMA 1Y8NB 2L15A 3A8KE 3A8IE 1JT8A 2NVTB 1Q1BA 3QG1A 3RLNA 4X62L 5I2XA 2B2WC 2Y0SB 2Z6KC 4WORA 1HH2P 2L9HA 1R4QB 3S17B 4UHVA 4GN5A 3EN2A 2XN9C 1R9TB 3L2PA 4J8QA 3C3LA 1PYBA 1HR0Q 3VYUA 4GKKQ 2LMCB 4DK3C 1NBWA 1J9OA 1LYLA 3I56A 5LMNW 1VQAA 1XWEA 2E2HH 4DR7Q 3CHBD 1STBA 1A6XA 1ENAA 3H3VI 4IALA 4IFDJ 1PFMA 1PRTC 3S24A 1TWAH 5AJ3Q 3IRBA 1SNDA 1D7QA 1KDBA 1QVFA 3FKIH 3NHHA 3P7JA 4XTCS 4FO2A 3CP0A 2OQKA 1H9JA 4KI0A 2IX3A 5KEEA 2KCTA 4BBSG 1OXUA 1BCPB 3D31A 2ATWA 5AFWA 4A93G 3RZOH 2H1EA 4EVOA 3R2IA 2QDLA 1EU4A 2AMCB 2L11A 3LX0A 2K03A 1I50H 3FP9A 1KLGD 3GTJH 4RCOA 2K50A 2B2VA 1PTOH 4OWXB 5LHY1 3HOVG 5E1FA 1E1TA 1B8AA 1Q12A 3MA2B 2L4NA 2PZUA 5DM63 3ERSX 1EUJA 4HIDA 4A3MH 3S17H 3SXHA 2ENBA 2Q2HA 3TMEA 2R92G 1PHJA 1YBYA 4CJ1B 4R4OA 4JI7Q 1HRJA 4JC0A 4KY7A 5ELBA 5KGUA 2ZJPA 1JJ2A 1KNAA 4P73A 3VDYA 1YNXA 1EWHA 3GTKB 1PH4A 1SE8A 2PPBC 4WFN3 1PZJD 3HOVB 1EEFD 2NZOA 2IHFA 1C7YA 2XWBB 3PO2H 1ICFB 4LFAQ 1K28A 3AU7A 3OW7A 3NBIA 4A3FH 4H7BA 2L1BA 2LXJA 3OIQA 2DGYA 1WTWA 1NNXA 5IGEA 3M3YB 4X66L 2IW3A 2PZWA 4FNFA 2K28A 5K36H 1VQIA 3K6OA 2K5QA 5C3WA 3PQIA 5C0XH 1TU2B 3MXPA 4IZ8A 1CHQD 3BYTB 3HOUG 1VQJA 1S5FD 5C4JH 1Q90A 1X6OA 1HTLD 4GNXA 1Q8KA 4LWCA 5D3DA 4ME3A 1BR9A 4AYBG 3WOEA 1EY7A 2BDNA 1JORA 1DYQA 3K7UC 3DM3A 5D65A 1OTCA 4R4IA 4JI8L 5IODA 3OTOL 3T1HL 1ESRA 2KBNA 1ENFA 4QB4A 2QKIC 4GLAC 4LUZA 4A3BB 1D6EC 1BF4A 1DM0B 5IGGA 4GN4B 1RIPA 3K5MA 4V0BA 2G9DA 2NVTH 1IZ6A 1CKNA 2OQ0A 2X6LA 1G91A 5LL6S 1VQDA 1JB3A 4A3FB 2KEEA 4G7ZC 3M4OH 1JWUD 4Q5VA 4LF5Q 4A3JG 3M3YH 4R4CA 3J80c 3AMUA 2BE5D 5E4WC 1YHBA 4DV4L 3RNUA 2JA6G 2E2HB 5EPKA 1XMQQ 1X54A 1ZYRD 4KN4C 2Q2IA 2B8FA 1O7YA 3CMAA 1RODA 2ALYB 1E0BA 2QEJC 3GTPB 3A5ZB 3BS1A 4JBMA 1HUMA 3I4LA 2D9UA 4CKEA 2FFKB 1M1KC 2B39A 1W3SA 5FK9C 2CWAA 1S5BD 4K14A 1UEBA 2RHQB 1LTBD 1VDZA 1H9KA 5L37A 3H0GB 2QF7A 1QNKA 1SDFA 1LUZA 1PTOC 4KJNA 2Q2TA 5CYUA 4A3GH 5IWAL 1UWVA 1N8RC 2R92B 3U9SA 2IY5B 2B3GA 4O42A 2JEBI 1HNXQ 2B2TC 1STHA 1ASYA 4XT3B 2KECA 4NXNQ 4FXKC 4DV2Q 5M5WB 2R93G 2JA8B 3BZDB 2EY1A 4CBVA 4A3MB 4A93H 1DONA 1BUVT 2EPBA 1LTID 3S2HH 1Q82C 1VF7A 3NXWA 3AB9A 1G6PA 1EQVA 5GADC 4BA2I 4JOIA 4JI5Q 5C4XH 4JV5Q 1G6ZA 3SE0A 3H3VC 1VMCA 3DXJC 4A3EB 1V8QA 3IFDA 2EYLA 2EXDA 5BN4A 3HOVH 2ICEC 3EIVA 5G3LF 1TIID 1HTPA 1E3PA 5G3LD 4EQNA 3D6CA 1I4RA 2ZTDA 3G71A 1I4XA 2F3IA 1FD7D 1X3PA 1WTRA 1IL2A 1K8OA 3S1QB 2DY7A 3H0GH 4QF4A 3ER0A 2K1BA 1STYA 1A3TA 3LWUA 2F0SA 3GP7A 1N34Q 1WTVA 2VUMB 1Q81C 3I7FA 4Y7NB 5CBEE 2KHJA 3T16A 1VQMA 3RLOA 3GTQB 1QUQA 1D8LA 4ZUIA 1WCMB 2H5XA 1K8GA 3EA6A 4DR3Q 3H09A 4JI6Q 1GKHA 2HT1A 3OIPA 1VQ5A 4DUYQ 3KUPA 2F0OA 2GA4B 4E6IA 5CBAE 5KRUA 1YJWA 2OXPA 1V1QA 1JR0D 1IW7C 3S1RH 5HURA 2ZXOA 3MAQA 1MSHA 2RBMA 1PRTD 4HAEA 3K0YA 5A35A 2YTVA 3PO3B 2N3SA 1JWMD 1EQRA 1J5EQ 4NXMQ 4LMQD 2NYZD 4K0KL 2EIFA 4PG3A 4BY1G 2ASBA 3RMHA 4DR2Q 1Y1VG 1S40A 1FJGL 2A6EC 5M3MB 2VQEQ 4JI0L 1ZKOA 1SMYD 2V4DA 4QGUA 4ILWA 4JI3Q 2QILA 3KF6A 4AYBB 3F2UA 3BZCA 5I9PA 2KEDA 5C4ZA 5M5WH 3E6ZX 3DM1A 1IBKL 2PMZB 1LT5D 3WDNA 3G48A 5LMUQ 2EVBA 4JI4Q 2HQLA 1XPUA 4CDDC 1AP0A 3TP6A 4X3SA 1F9SA 2L55A 2VW9A 1RKNA 3F1ZA 5T1IA 1VQLA 3P1HA 1XJVA 3GO5A 1TR5A 1PZKD 2F0FA 3SK5A 1MHWC 2WAQB 1QG7A 1SYFA 3S14B 2K6AA 3TSSA 5IYBG 2Z6KA 2MGSA 2NBFA 4LUVA 5FJ8G 3ULJA 2ZXPA 1PYSB 3DLLA 3Q0AA 2UUBL 2EY5A 2I0QA 1O80A 4U68A 2R7ZG 4BBRH 2L5TA 2I07B 1TWHB 3G6JB 5ELFA 2NVQH 1XXGA 2UU9L 2MHVA 3CCMA 1O7LA 5EJWA 4A3LH 3OMGA 2F0QA 3GTMH 3VYRA 4TVAB 3AEVA 4LF6L 1L1OC 4KY5A 3MHBA 1VQGA 2ES2A 1K9MC 3L9AX 1VQBA 1EOVA 2L12A 1KIXA 1N32Q 1OXTA 1RHPA 2F4IA 3OWEB 4GNXB 3HOXB 3NQIA 2A5HA 4EX5A 4B08A 2RKSA 3RN2A 1SSOA 1KC8C 4O1NA 2XSCA 1EIYB 4HR7B 2VL6A 4OIKA 5H1SE 2E74C 3GTKH 1N33Q 4A76A 1VQKA 2CCZA 4NB3A 2RHSB 2NZ1D 3CCRA 2R93H 3FPPA 2R7FA 3PO2G 2C5CA 4LFBQ 2NN6I 1I4PA 4B3SQ 3Q22A 1TT2A 2E2DC 5CV7A 2A69D 2CH4A 1WCMH 1B53A 3GTGB 3HFZB 3K58A 2LXKA 2XRSD 3I8ZA 4BBRB 2VZAA 2UUAL 4GN3B 2ZTEA 4FYDA 1F2MA 3VR2A 2F0DA 1SYBA 1T5EA 1BBWA 2JA5H 2HIXA 4B9XA 1XYIA 3I73A 4H0LC 2F0NA 2A19A 2GVBA 1GUNA 3QB3A 2WAQG 4BY7B 1QUQB 2VQFQ 2CW0D 5C6AA 4IUTA 2TMPA 1SLJA 1X3QA 3J81c 4PZ7A 5GROA 1IYUA 1SYDA 2RQXA 2Q8TA 4DV6Q 1X3EA 2YTYA 2M2LA 3SVMA 3H6MA 2OTLA 1LT4D 4UAIA 2E8GA 2FJ2A 4A3BH 1KAAA 1EL0A 1UE5A 1VQ4A 2O5IC 1V9PA 4HCEA 1SE3A 3CC7A 2HDLA 5NUCA 1TS4A 3SGIA 4A4IA 1VQNA 2GVAA 4KLKA 1K73C 1M90C 1X56A 1HNZQ 4B3RL 3J7YW 2SEBD 1CUKA 1MI2A 4IJLA 1MGSA 1SMXA 3L3OC 2H4OA 1U5KA 1CA6A 3UDFA 1HJPA 4JVZA 4LJZC 4KMUC 4R4QA 3FKIB 1RCVD 3S2DB 5EKLA 2X69A 4PQXA 1HHVA 2B8GA 1OXSC 1J6QA 5JPMC 5EQ0A 2EJGC 1MKHA 3S1MB 3NENA 5IIFA 2ICIA
chains in the Genus database with same CATH topology
2IT1A 3CP0A 3M9BA 4WJ4A 2OQKA 4GOPC 2YV5A 4C3HH 2EQSA 1EIFA 4KI0A 2WFWA 2KCTA 3CCVA 4BBSG 1OXUA 3D31A 2KHIA 5FLMH 2UXBL 2ATWA 4DR2L 3BZKA 4A93G 4HJ9A 3RZOH 4A3BG 2AMCB 4H02A 3I4MG 4JI0Q 1I50H 3FP9A 4JG2A 4APVA 4LF8Q 3GTJH 2K50A 2N49A 3GDEA 1Y14B 4P71A 1BKBA 4OWXB 1VQ8A 1E1TA 3HOVG 4OO1I 3S1MH 4B3TL 1XTDA 2PI2A 4OONA 1B8AA 1Q12A 1XNQL 4ALPA 3A5UA 3ERSX 1EUJA 1VQFA 4HIDA 4A3MH 3S17H 5IE8A 1WFQA 2I5HA 4JI4L 5LMNL 3PF5A 1PVOA 4NPSA 2Q2HA 4A3IH 2R92G 1PHJA 3AFQA 1YBYA 1DGSA 1QVCA 4R4OA 1NJIC 4JI7Q 3GTLH 4P74A 4DR3L 4JC0A 3NBHB 2ZJPA 1JJ2A 4P73A 3VDYA 1SN8A 3KFUA 4KHPQ 3U58A 1YNXA 3PGZA 1O7IA 1X55A 1A8VA 5IYDH 4YHHQ 2K14A 4HJAA 4IPHA 1SE8A 1PH4A 1PFSA 1XPRA 4HJ5A 2NZOA 4X65L 3HKZG 2IHFA 2XGTA 1C7YA 3KDFA 3PO2H 4OO1G 1XMOQ 4LFAQ 3J7A5 2R6GA 1W2BA 1WOCA 4A3FH 1EWIA 2LXJA 3S1NH 3AFPA 4DV0L 1Q46A 1GVPA 1JB7A 4IFDI 2DGYA 1AE3A 4A3KG 3KJOA 1N9WA 2UUBQ 4L5SA 4X66L 5IT9c 4JYAQ 1I94L 4IPDA 4K0KQ 1JE5A 1VQIA 2RF4A 4DR7L 2Z0SA 5IP9G 1TWGH 4JOIC 4POFA 5JJIA 3HOUG 4P72A 1VQJA 4BBRG 5C4JH 5AJ3L 3LGJA 1X6OA 3G4SA 5DLQE 2VQEL 1QZGA 3S1QH 4GNXA 3PSIA 1Q8KA 2WAQE 4LWCA 5BR8L 4HJ7A 4ME3A 1KRSA 5IWAQ 4MZ9A 4AYBG 4WJ3M 4YCUA 1VQCA 3HOZG 4DV1L 2AKWB 1HNXL 3CD6A 2CKZB 3DM3A 3K7UC 4RMFA 4R4IA 1OTCA 4JI8L 4IJHA 3OTOL 3T1HL 1PA6A 3UE0A 2KBNA 4GLXA 4PMWA 3H15A 2I5LX 4GLAC 4LUZA 2WB1G 4C2MH 4DPGA 1GM5A 3W1GA 4YY3L 4JI1Q 2F4VQ 4A3CH 2PMZE 5EAYA 5C4XG 3W5OA 2AWOA 3CF5A 4GN4B 3M4QA 5JEAJ 1NMFA 4RG1A 1RIPA 1VQ9A 3HOXG 4QY7A 1LTLA 3KF6B 1Y1WH 1N33L 2NVTH 4GLVB 1IZ6A 1NE3A 4DR1L 1CKNA 1LM0A 1YHAA 2OQ0A 4L5TA 4LUOA 4UPAA 3HOYG 4LF9Q 4LFBL 1WJJA 1PH6A 1IBML 4DUZQ 3L7ZC 3H3VH 1VQDA 2IX0A 4BXXH 1UE1A 4AQYL 3M4OH 2K52A 3CQZH 1WYDA 4LF5Q 4A3JG 3M3YH 4R4CA 4MTNA 3J80c 4DNIA 1NY4A 4DR5Q 1X9NA 3PF4A 2UUAQ 1FL0A 1Q1EA 4X64Q 4YCVA 1KRTA 1YHBA 1B7YB 4DV4L 3RNUA 2JA6G 3PUXA 1Y1VH 2C35B 1X54A 2MFIA 4IPCA 1XMQQ 4Y52H 2Q2IA 3TEHB 5M3MG 3CMAA 3KYHC 3UDXA 4A75A 1PH5A 1XNRL 2ALYB 2YTXA 3A5ZB 3E9IA 2K5NA 1R9TH 4JBMA 2E2JH 3U4ZA 4LF6Q 1FGUA 2JK8A 4GS3A 1M1KC 4B3ML 3TREA 2VQFL 3JAMi 1PH3A 3CC4A 1W3SA 3K80C 3CCLA 1UE7A 2CWAA 2R7DA 1YVCA 4O0AA 1UEBA 4DV7Q 1I6HH 5JJLA 2RHQB 2A1AA 2UXCQ 1GO3E 5C3EH 1VS0A 1AH9A 4LFCL 4LF4L 4C3IH 1L2FA 1LUZA 1PH1A 1VQHA 2Q2TA 2MO0A 4A3GH 5IWAL 1UWVA 4KHZA 1N8RC 4Y7NH 1VQ6A 4GKJQ 2B3GA 2IY5B 1JJGA 1OXXK 4IPGA 3KLWA 3J81i 1HZ9A 2JEBI 4A3EH 1HNXQ 1ASYA 2D62A 4NXNQ 4DV2Q 2R93G 3NEMA 1PV4A 1IBLQ 4A93H 4LW1A 1XNQQ 2NVYH 1YI2A 4JCVE 2XTIA 3OTOQ 3T1HQ 1VQ7A 1TWCH 3S2HH 1Q82C 4X6AH 3GTPH 1J5EL 3Q8DA 1MJEA 2NVXH 1G6PA 4JI1L 4HIMA 5HY6A 3RN5A 1RL2A 2PI2E 3PUWA 2HHHL 5GADC 1QVGA 4BA2I 3H0GG 4JOIA 3PIPA 5C4XH 3CPFA 2Q2UA 1PH2A 4JI5Q 1FJGQ 3HOUH 3HOWG 4JV5Q 2K5HA 4QJFA 2ZM6Q 4YWMA 4LF7L 3HOXH 4A3GG 1KAWA 1E22A 1CSPA 4DV5L 1EFWA 2UXDL 2EXDA 2JQOA 3A74A 4O2DA 4HIKA 1EYGA 2E5LL 4LF9L 4POGA 3CCJA 2VUMG 3HOVH 3EIVA 4OWTB 4A3FG 4IOAA 3OYYA 4AQYQ 1B70B 1E3PA 4IO9A 1HR0W 4L5RC 5LMUL 4EQ5A 2PQAB 4DK6C 1X3GA 4HJ8A 3T1YL 2JJQA 4DR5L 1TWFH 4QIWE 2PQAA 2ZTDA 3G6EA 3G71A 4X64L 4BBSH 2F3IA 1IL2A 5J3BA 4JBKA 4BXXG 5IYDG 3S2DH 1XMQL 3CAMA 1PH9A 4LF8L 3H0GH 5FLXc 1A62A 5C0XG 3ER0A 1SRUA 3F2DA 1K8AC 1XNRQ 5IYBH 3CC2A 3WWVA 1N34Q 3U4VA 1YJNA 4B3TQ 1Q81C 3I7FA 2N8NA 4X62Q 1X65A 1XPOA 2KHJA 2UUCL 4PZ6A 2KCMA 2PNHA 4YWLA 2D0PA 3L0OA 2CQOA 3RLOA 1VQMA 4XIGS 4MNOA 1QUQA 1D8LA 1G291 5M3FH 1SROA 1WI5A 2GN5A 1VQEA 2LSSA 3K7AH 3RZDH 3UDIA 2H5XA 1K8GA 2UXCL 4A3JH 1N36L 4BY1H 4DR3Q 3J7ZC 5GAHC 4LF4Q 4LFCQ 2VY3A 4JI6Q 3CW2C 3TRZA 1GKHA 4BY7H 4GKKL 2HT1A 2OWOA 1KHIA 4B3RQ 4JBWA 1VQ5A 1YZ6A 1YJ9A 3NELA 4DUYQ 3MXNB 4IOCA 4OX9Q 3I4MH 3MEFA 4YHHL 1K83H 5C3EG 4AH6A 1YJWA 1V1QA 4GKJL 1X3FA 1C9OA 1IYJB 1P8LA 2UU9Q 2E2IH 3CCUA 3HOYH 2OTJA 3S1RH 3W1BA 1JJCB 2JE6I 1XMOL 3B6YA 2OCEA 4TQUS 3PIOA 2WB1E 5IYCH 1A0IA 4AIMA 1Z9FA 3CPWA 2YTVA 1I3QH 2BH8A 3J80i 2ZJRA 2N3SA 4JYAL 1EQRA 4A3IG 2Y0SE 1J5EQ 5IP7G 4NXMQ 3I2ZA 3K8AA 1OXVA 2QEXA 4DAYB 4A3CG 4K0KL 2EIFA 4PG3A 4BY1G 2ASBA 1H95A 3PUZA 2NZHA 4DR2Q 1Y1VG 2N78A 4A3KH 1VQPA 1S40A 4JI5L 1NMGA 1FJGL 1VCIA 1N32L 2ZJQA 4LNQA 2B63H 2JA6H 2VQEQ 1E24A 3S15H 1AE2A 1YITA 2B29A 4JI0L 3M7NA 3JC66 1HNWQ 5C44H 3I4OA 2MO1A 4DV5Q 2ZTCA 1L1OB 4QGUA 1S72A 2E5LQ 4JI3Q 3S16H 1Z47A 3KF6A 4UP7A 4DV3L 3PUYA 3BZCA 5M5WH 4C3JH 5GAEC 4BA1I 1E7ZA 1K0RA 3PUVA 2D0OA 1YIJA 3ULPA 5IYCG 1IBKL 2K5VA 3G48A 5LMUQ 3T1YQ 3I4NH 3E0EA 2BH2A 4JI8Q 3U50C 4JI4Q 1YHQA 3CCQA 2HQLA 1XPUA 4QQBX 5LMNQ 2R92H 2ID0A 4B3SL 4YWKA 4YY3Q 2F4VL 4DR6L 3CCEA 3UE1A 5M3MH 1BBUA 3F8TA 2VW9A 1HZAA 2AWNA 2B63G 3F1ZA 2JA7G 4J15A 2KENA 1N34L 1VQLA 3ICEA 1TWHH 4KHPL 1XJVA 3GO5A 1CSQA 2YYZA 4L5QA 4UY8C 2UUCQ 2F52A 1C0AA 3E9HA 5IYBG 2Z6KA 4X65Q 2FXQA 5ELNA 5FJ8G 4LUVA 1IBMQ 4DUZL 3ULJA 2IX1A 4UP9A 3CCSA 1TXYA 1PYSB 3FHWA 3DLLA 3GD7A 1N36Q 5GQOA 4OXPA 1A63A 3KJPA 3HKZE 1YEZA 3K81C 2UUBL 4JI6L 5E7NA 2I0QA 2R7ZH 3M85A 4X66Q 5K36G 2R7ZG 3JAMc 4BBRH 4DV4Q 4OX9L 2IHEA 3J81j 1V43A 2Y0SG 2K4KA 4DV6L 2NVQH 2JA8G 2UU9L 4BY7G 4DR4L 3PV0A 3CCMA 4DKAC 2VUMH 4A3EG 4A3LH 1PH7A 1Q86C 3GTMH 1MIUA 2JA9A 3OW2A 5ELOA 4TVAB 3K0XA 3F2BA 3AEVA 4LF6L 5BR8Q 3BU2A 1L1OC 3D0FA 3EBEA 4B3MQ 4A3DG 3HOZH 2QA4A 4A3DH 2NN6G 4P75A 5GAGC 4DV1Q 4DV7L 2ES2A 1VQGA 4NXML 4JI2Q 3I55A 1K9MC 3TQYA 1HZBA 3M4PA 1VQBA 4YCWA 1K3RA 1EOVA 1U0LA 5FLMG 2CFMA 3S14H 3CMEA 4R1JA 1KIXA 2K75A 1HNZL 1HR0L 4R4TA 1OXTA 1N32Q 1NTGA 4GNXB 5JEAG 1T9HA 2VS1A 4EX5A 3RN2A 1HNWL 1KC8C 5IP9H 5IY0A 1EIYB 2YU9H 4JI3L 2VL6A 4DV3Q 2MNAA 5H1SE 1QZHA 3GTKH 3GTQH 1N33Q 4NXNL 4A76A 4DV2L 1IBKQ 1SR3A 1VQKA 2CCZA 4NB3A 2RHSB 4PZ8A 3CCRA 2A8VA 3GTOH 2R93H 4DR1Q 4A3MG 1GD7A 2R7FA 3PO2G 4LFBQ 5M3FG 2NN6I 3AYHB 5HGQA 5IP7H 4B3SQ 4JBJA 4DR6Q 2UXBQ 2JA8H 4LF5L 1WCMH 4UP8A 3AQQA 3HFZB 2HIVA 2LXKA 2RCNA 3STBC 4JV5L 3HOWH 2VZAA 5M5YH 2UUAL 2ZM6L 2QGQA 4GN3B 1CKMA 2ZTEA 3RLFA 2BA1A 4QL5A 1SFOH 1E1OA 1CKNB 2WP8J 3GTGH 1UE6A 2CWPA 2JA5G 2UXDQ 1HZCA 1BBWA 2JA5H 2HIXA 4OWWB 2BA0A 3RR5A 3PCOB 1MJCA 4HIOA 1EQQA 2A19A 2GVBA 1ASZA 1PH8A 1G51A 4IFDG 2WAQG 1P16A 3STBD 3KOJA 3UDGA 3KDFB 1QUQB 2VQFQ 4AYBE 1KQSA 5FJ8H 1KXLA 1SLJA 2DUDA 1I5FA 3PO3G 3J81c 3PO3H 3F2CA 4PZ7A 5GROA 1CKOA 4A3LG 4FDBA 1X3EA 2YTYA 4DV6Q 3CXCA 2OTLA 4JI7L 1S3OA 4DAMA 4DR4Q 2JA7H 1JMCA 2E8GA 2V1CC 2L15A 1KL9A 3TS0A 1Q7YC 4A3BH 1JT8A 5JJKA 5M5XH 1Q1BA 3RLNA 4X62L 3KF8B 4GNXC 1UE5A 1Y1WG 1VQ4A 1V9PA 2Z6KC 1L0WA 1HH2P 3CC7A 4LFAL 3SGIA 2JEAI 4GN5A 2MQHA 3FKIG 4A4IA 4GOPB 3EN2A 4JI2L 1VQNA 2GVAA 4KLKA 1K73C 1WCMG 4GOPA 1M90C 2I5MX 4DV0Q 3L2PA 1IBLL 1PYBA 1FVIA 1X56A 2VNUD 1HNZQ 1HR0Q 4GKKQ 4B3RL 4DK3C 1CUKA 1NBWA 4IJLA 1I94Q 3TS2A 1LYLA 1SMXA 5C0XI 3I56A 1VQAA 1U5KA 5C44G 3UDFA 5LMNW 1HJPA 1IXRA 1VQOA 2E2HH 2HHHQ 4DR7Q 4R4QA 3H3VI 2AHOB 4IFDJ 3S24A 1TWAH 5AJ3Q 4LF7Q 3IRBA 1OXSC 1J6QA 3A0JA 1D7QA 1QVFA 1L1OA 3FKIH 1MKHA 1BVSA 4DUYL 3I4NG 3NENA 5C0XJ 3ULLA 4XTCS 1KD1C 3ZJYC 3BJUA 3HKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IT1 A;  3CP0 A;  3M9B A;  4WJ4 A;  2OQK A;  4GOP C;  2YV5 A;  4C3H H;  2EQS A;  1EIF A;  4KI0 A;  2WFW A;  2KCT A;  3CCV A;  4BBS G;  1OXU A;  3D31 A;  2KHI A;  5FLM H;  2UXB L;  2ATW A;  4DR2 L;  3BZK A;  4A93 G;  4HJ9 A;  3RZO H;  4A3B G;  2AMC B;  4H02 A;  3I4M G;  4JI0 Q;  1I50 H;  3FP9 A;  4JG2 A;  4APV A;  4LF8 Q;  3GTJ H;  2K50 A;  2N49 A;  3GDE A;  1Y14 B;  4P71 A;  1BKB A;  4OWX B;  1VQ8 A;  1E1T A;  3HOV G;  4OO1 I;  3S1M H;  4B3T L;  1XTD A;  2PI2 A;  4OON A;  1B8A A;  1Q12 A;  1XNQ L;  4ALP A;  3A5U A;  3ERS X;  1EUJ A;  1VQF A;  4HID A;  4A3M H;  3S17 H;  5IE8 A;  1WFQ A;  2I5H A;  4JI4 L;  5LMN L;  3PF5 A;  1PVO A;  4NPS A;  2Q2H A;  4A3I H;  2R92 G;  1PHJ A;  3AFQ A;  1YBY A;  1DGS A;  1QVC A;  4R4O A;  1NJI C;  4JI7 Q;  3GTL H;  4P74 A;  4DR3 L;  4JC0 A;  3NBH B;  2ZJP A;  1JJ2 A;  4P73 A;  3VDY A;  1SN8 A;  3KFU A;  4KHP Q;  3U58 A;  1YNX A;  3PGZ A;  1O7I A;  1X55 A;  1A8V A;  5IYD H;  4YHH Q;  2K14 A;  4HJA A;  4IPH A;  1SE8 A;  1PH4 A;  1PFS A;  1XPR A;  4HJ5 A;  2NZO A;  4X65 L;  3HKZ G;  2IHF A;  2XGT A;  1C7Y A;  3KDF A;  3PO2 H;  4OO1 G;  1XMO Q;  4LFA Q;  3J7A 5;  2R6G A;  1W2B A;  1WOC A;  4A3F H;  1EWI A;  2LXJ A;  3S1N H;  3AFP A;  4DV0 L;  1Q46 A;  1GVP A;  1JB7 A;  4IFD I;  2DGY A;  1AE3 A;  4A3K G;  3KJO A;  1N9W A;  2UUB Q;  4L5S A;  4X66 L;  5IT9 c;  4JYA Q;  1I94 L;  4IPD A;  4K0K Q;  1JE5 A;  1VQI A;  2RF4 A;  4DR7 L;  2Z0S A;  5IP9 G;  1TWG H;  4JOI C;  4POF A;  5JJI A;  3HOU G;  4P72 A;  1VQJ A;  4BBR G;  5C4J H;  5AJ3 L;  3LGJ A;  1X6O A;  3G4S A;  5DLQ E;  2VQE L;  1QZG A;  3S1Q H;  4GNX A;  3PSI A;  1Q8K A;  2WAQ E;  4LWC A;  5BR8 L;  4HJ7 A;  4ME3 A;  1KRS A;  5IWA Q;  4MZ9 A;  4AYB G;  4WJ3 M;  4YCU A;  1VQC A;  3HOZ G;  4DV1 L;  2AKW B;  1HNX L;  3CD6 A;  2CKZ B;  3DM3 A;  3K7U C;  4RMF A;  4R4I A;  1OTC A;  4JI8 L;  4IJH A;  3OTO L;  3T1H L;  1PA6 A;  3UE0 A;  2KBN A;  4GLX A;  4PMW A;  3H15 A;  2I5L X;  4GLA C;  4LUZ A;  2WB1 G;  4C2M H;  4DPG A;  1GM5 A;  3W1G A;  4YY3 L;  4JI1 Q;  2F4V Q;  4A3C H;  2PMZ E;  5EAY A;  5C4X G;  3W5O A;  2AWO A;  3CF5 A;  4GN4 B;  3M4Q A;  5JEA J;  1NMF A;  4RG1 A;  1RIP A;  1VQ9 A;  3HOX G;  4QY7 A;  1LTL A;  3KF6 B;  1Y1W H;  1N33 L;  2NVT H;  4GLV B;  1IZ6 A;  1NE3 A;  4DR1 L;  1CKN A;  1LM0 A;  1YHA A;  2OQ0 A;  4L5T A;  4LUO A;  4UPA A;  3HOY G;  4LF9 Q;  4LFB L;  1WJJ A;  1PH6 A;  1IBM L;  4DUZ Q;  3L7Z C;  3H3V H;  1VQD A;  2IX0 A;  4BXX H;  1UE1 A;  4AQY L;  3M4O H;  2K52 A;  3CQZ H;  1WYD A;  4LF5 Q;  4A3J G;  3M3Y H;  4R4C A;  4MTN A;  3J80 c;  4DNI A;  1NY4 A;  4DR5 Q;  1X9N A;  3PF4 A;  2UUA Q;  1FL0 A;  1Q1E A;  4X64 Q;  4YCV A;  1KRT A;  1YHB A;  1B7Y B;  4DV4 L;  3RNU A;  2JA6 G;  3PUX A;  1Y1V H;  2C35 B;  1X54 A;  2MFI A;  4IPC A;  1XMQ Q;  4Y52 H;  2Q2I A;  3TEH B;  5M3M G;  3CMA A;  3KYH C;  3UDX A;  4A75 A;  1PH5 A;  1XNR L;  2ALY B;  2YTX A;  3A5Z B;  3E9I A;  2K5N A;  1R9T H;  4JBM A;  2E2J H;  3U4Z A;  4LF6 Q;  1FGU A;  2JK8 A;  4GS3 A;  1M1K C;  4B3M L;  3TRE A;  2VQF L;  3JAM i;  1PH3 A;  3CC4 A;  1W3S A;  3K80 C;  3CCL A;  1UE7 A;  2CWA A;  2R7D A;  1YVC A;  4O0A A;  1UEB A;  4DV7 Q;  1I6H H;  5JJL A;  2RHQ B;  2A1A A;  2UXC Q;  1GO3 E;  5C3E H;  1VS0 A;  1AH9 A;  4LFC L;  4LF4 L;  4C3I H;  1L2F A;  1LUZ A;  1PH1 A;  1VQH A;  2Q2T A;  2MO0 A;  4A3G H;  5IWA L;  1UWV A;  4KHZ A;  1N8R C;  4Y7N H;  1VQ6 A;  4GKJ Q;  2B3G A;  2IY5 B;  1JJG A;  1OXX K;  4IPG A;  3KLW A;  3J81 i;  1HZ9 A;  2JEB I;  4A3E H;  1HNX Q;  1ASY A;  2D62 A;  4NXN Q;  4DV2 Q;  2R93 G;  3NEM A;  1PV4 A;  1IBL Q;  4A93 H;  4LW1 A;  1XNQ Q;  2NVY H;  1YI2 A;  4JCV E;  2XTI A;  3OTO Q;  3T1H Q;  1VQ7 A;  1TWC H;  3S2H H;  1Q82 C;  4X6A H;  3GTP H;  1J5E L;  3Q8D A;  1MJE A;  2NVX H;  1G6P A;  4JI1 L;  4HIM A;  5HY6 A;  3RN5 A;  1RL2 A;  2PI2 E;  3PUW A;  2HHH L;  5GAD C;  1QVG A;  4BA2 I;  3H0G G;  4JOI A;  3PIP A;  5C4X H;  3CPF A;  2Q2U A;  1PH2 A;  4JI5 Q;  1FJG Q;  3HOU H;  3HOW G;  4JV5 Q;  2K5H A;  4QJF A;  2ZM6 Q;  4YWM A;  4LF7 L;  3HOX H;  4A3G G;  1KAW A;  1E22 A;  1CSP A;  4DV5 L;  1EFW A;  2UXD L;  2EXD A;  2JQO A;  3A74 A;  4O2D A;  4HIK A;  1EYG A;  2E5L L;  4LF9 L;  4POG A;  3CCJ A;  2VUM G;  3HOV H;  3EIV A;  4OWT B;  4A3F G;  4IOA A;  3OYY A;  4AQY Q;  1B70 B;  1E3P A;  4IO9 A;  1HR0 W;  4L5R C;  5LMU L;  4EQ5 A;  2PQA B;  4DK6 C;  1X3G A;  4HJ8 A;  3T1Y L;  2JJQ A;  4DR5 L;  1TWF H;  4QIW E;  2PQA A;  2ZTD A;  3G6E A;  3G71 A;  4X64 L;  4BBS H;  2F3I A;  1IL2 A;  5J3B A;  4JBK A;  4BXX G;  5IYD G;  3S2D H;  1XMQ L;  3CAM A;  1PH9 A;  4LF8 L;  3H0G H;  5FLX c;  1A62 A;  5C0X G;  3ER0 A;  1SRU A;  3F2D A;  1K8A C;  1XNR Q;  5IYB H;  3CC2 A;  3WWV A;  1N34 Q;  3U4V A;  1YJN A;  4B3T Q;  1Q81 C;  3I7F A;  2N8N A;  4X62 Q;  1X65 A;  1XPO A;  2KHJ A;  2UUC L;  4PZ6 A;  2KCM A;  2PNH A;  4YWL A;  2D0P A;  3L0O A;  2CQO A;  3RLO A;  1VQM A;  4XIG S;  4MNO A;  1QUQ A;  1D8L A;  1G29 1;  5M3F H;  1SRO A;  1WI5 A;  2GN5 A;  1VQE A;  2LSS A;  3K7A H;  3RZD H;  3UDI A;  2H5X A;  1K8G A;  2UXC L;  4A3J H;  1N36 L;  4BY1 H;  4DR3 Q;  3J7Z C;  5GAH C;  4LF4 Q;  4LFC Q;  2VY3 A;  4JI6 Q;  3CW2 C;  3TRZ A;  1GKH A;  4BY7 H;  4GKK L;  2HT1 A;  2OWO A;  1KHI A;  4B3R Q;  4JBW A;  1VQ5 A;  1YZ6 A;  1YJ9 A;  3NEL A;  4DUY Q;  3MXN B;  4IOC A;  4OX9 Q;  3I4M H;  3MEF A;  4YHH L;  1K83 H;  5C3E G;  4AH6 A;  1YJW A;  1V1Q A;  4GKJ L;  1X3F A;  1C9O A;  1IYJ B;  1P8L A;  2UU9 Q;  2E2I H;  3CCU A;  3HOY H;  2OTJ A;  3S1R H;  3W1B A;  1JJC B;  2JE6 I;  1XMO L;  3B6Y A;  2OCE A;  4TQU S;  3PIO A;  2WB1 E;  5IYC H;  1A0I A;  4AIM A;  1Z9F A;  3CPW A;  2YTV A;  1I3Q H;  2BH8 A;  3J80 i;  2ZJR A;  2N3S A;  4JYA L;  1EQR A;  4A3I G;  2Y0S E;  1J5E Q;  5IP7 G;  4NXM Q;  3I2Z A;  3K8A A;  1OXV A;  2QEX A;  4DAY B;  4A3C G;  4K0K L;  2EIF A;  4PG3 A;  4BY1 G;  2ASB A;  1H95 A;  3PUZ A;  2NZH A;  4DR2 Q;  1Y1V G;  2N78 A;  4A3K H;  1VQP A;  1S40 A;  4JI5 L;  1NMG A;  1FJG L;  1VCI A;  1N32 L;  2ZJQ A;  4LNQ A;  2B63 H;  2JA6 H;  2VQE Q;  1E24 A;  3S15 H;  1AE2 A;  1YIT A;  2B29 A;  4JI0 L;  3M7N A;  3JC6 6;  1HNW Q;  5C44 H;  3I4O A;  2MO1 A;  4DV5 Q;  2ZTC A;  1L1O B;  4QGU A;  1S72 A;  2E5L Q;  4JI3 Q;  3S16 H;  1Z47 A;  3KF6 A;  4UP7 A;  4DV3 L;  3PUY A;  3BZC A;  5M5W H;  4C3J H;  5GAE C;  4BA1 I;  1E7Z A;  1K0R A;  3PUV A;  2D0O A;  1YIJ A;  3ULP A;  5IYC G;  1IBK L;  2K5V A;  3G48 A;  5LMU Q;  3T1Y Q;  3I4N H;  3E0E A;  2BH2 A;  4JI8 Q;  3U50 C;  4JI4 Q;  1YHQ A;  3CCQ A;  2HQL A;  1XPU A;  4QQB X;  5LMN Q;  2R92 H;  2ID0 A;  4B3S L;  4YWK A;  4YY3 Q;  2F4V L;  4DR6 L;  3CCE A;  3UE1 A;  5M3M H;  1BBU A;  3F8T A;  2VW9 A;  1HZA A;  2AWN A;  2B63 G;  3F1Z A;  2JA7 G;  4J15 A;  2KEN A;  1N34 L;  1VQL A;  3ICE A;  1TWH H;  4KHP L;  1XJV A;  3GO5 A;  1CSQ A;  2YYZ A;  4L5Q A;  4UY8 C;  2UUC Q;  2F52 A;  1C0A A;  3E9H A;  5IYB G;  2Z6K A;  4X65 Q;  2FXQ A;  5ELN A;  5FJ8 G;  4LUV A;  1IBM Q;  4DUZ L;  3ULJ A;  2IX1 A;  4UP9 A;  3CCS A;  1TXY A;  1PYS B;  3FHW A;  3DLL A;  3GD7 A;  1N36 Q;  5GQO A;  4OXP A;  1A63 A;  3KJP A;  3HKZ E;  1YEZ A;  3K81 C;  2UUB L;  4JI6 L;  5E7N A;  2I0Q A;  2R7Z H;  3M85 A;  4X66 Q;  5K36 G;  2R7Z G;  3JAM c;  4BBR H;  4DV4 Q;  4OX9 L;  2IHE A;  3J81 j;  1V43 A;  2Y0S G;  2K4K A;  4DV6 L;  2NVQ H;  2JA8 G;  2UU9 L;  4BY7 G;  4DR4 L;  3PV0 A;  3CCM A;  4DKA C;  2VUM H;  4A3E G;  4A3L H;  1PH7 A;  1Q86 C;  3GTM H;  1MIU A;  2JA9 A;  3OW2 A;  5ELO A;  4TVA B;  3K0X A;  3F2B A;  3AEV A;  4LF6 L;  5BR8 Q;  3BU2 A;  1L1O C;  3D0F A;  3EBE A;  4B3M Q;  4A3D G;  3HOZ H;  2QA4 A;  4A3D H;  2NN6 G;  4P75 A;  5GAG C;  4DV1 Q;  4DV7 L;  2ES2 A;  1VQG A;  4NXM L;  4JI2 Q;  3I55 A;  1K9M C;  3TQY A;  1HZB A;  3M4P A;  1VQB A;  4YCW A;  1K3R A;  1EOV A;  1U0L A;  5FLM G;  2CFM A;  3S14 H;  3CME A;  4R1J A;  1KIX A;  2K75 A;  1HNZ L;  1HR0 L;  4R4T A;  1OXT A;  1N32 Q;  1NTG A;  4GNX B;  5JEA G;  1T9H A;  2VS1 A;  4EX5 A;  3RN2 A;  1HNW L;  1KC8 C;  5IP9 H;  5IY0 A;  1EIY B;  2YU9 H;  4JI3 L;  2VL6 A;  4DV3 Q;  2MNA A;  5H1S E;  1QZH A;  3GTK H;  3GTQ H;  1N33 Q;  4NXN L;  4A76 A;  4DV2 L;  1IBK Q;  1SR3 A;  1VQK A;  2CCZ A;  4NB3 A;  2RHS B;  4PZ8 A;  3CCR A;  2A8V A;  3GTO H;  2R93 H;  4DR1 Q;  4A3M G;  1GD7 A;  2R7F A;  3PO2 G;  4LFB Q;  5M3F G;  2NN6 I;  3AYH B;  5HGQ A;  5IP7 H;  4B3S Q;  4JBJ A;  4DR6 Q;  2UXB Q;  2JA8 H;  4LF5 L;  1WCM H;  4UP8 A;  3AQQ A;  3HFZ B;  2HIV A;  2LXK A;  2RCN A;  3STB C;  4JV5 L;  3HOW H;  2VZA A;  5M5Y H;  2UUA L;  2ZM6 L;  2QGQ A;  4GN3 B;  1CKM A;  2ZTE A;  3RLF A;  2BA1 A;  4QL5 A;  1SFO H;  1E1O A;  1CKN B;  2WP8 J;  3GTG H;  1UE6 A;  2CWP A;  2JA5 G;  2UXD Q;  1HZC A;  1BBW A;  2JA5 H;  2HIX A;  4OWW B;  2BA0 A;  3RR5 A;  3PCO B;  1MJC A;  4HIO A;  1EQQ A;  2A19 A;  2GVB A;  1ASZ A;  1PH8 A;  1G51 A;  4IFD G;  2WAQ G;  1P16 A;  3STB D;  3KOJ A;  3UDG A;  3KDF B;  1QUQ B;  2VQF Q;  4AYB E;  1KQS A;  5FJ8 H;  1KXL A;  1SLJ A;  2DUD A;  1I5F A;  3PO3 G;  3J81 c;  3PO3 H;  3F2C A;  4PZ7 A;  5GRO A;  1CKO A;  4A3L G;  4FDB A;  1X3E A;  2YTY A;  4DV6 Q;  3CXC A;  2OTL A;  4JI7 L;  1S3O A;  4DAM A;  4DR4 Q;  2JA7 H;  1JMC A;  2E8G A;  2V1C C;  2L15 A;  1KL9 A;  3TS0 A;  1Q7Y C;  4A3B H;  1JT8 A;  5JJK A;  5M5X H;  1Q1B A;  3RLN A;  4X62 L;  3KF8 B;  4GNX C;  1UE5 A;  1Y1W G;  1VQ4 A;  1V9P A;  2Z6K C;  1L0W A;  1HH2 P;  3CC7 A;  4LFA L;  3SGI A;  2JEA I;  4GN5 A;  2MQH A;  3FKI G;  4A4I A;  4GOP B;  3EN2 A;  4JI2 L;  1VQN A;  2GVA A;  4KLK A;  1K73 C;  1WCM G;  4GOP A;  1M90 C;  2I5M X;  4DV0 Q;  3L2P A;  1IBL L;  1PYB A;  1FVI A;  1X56 A;  2VNU D;  1HNZ Q;  1HR0 Q;  4GKK Q;  4B3R L;  4DK3 C;  1CUK A;  1NBW A;  4IJL A;  1I94 Q;  3TS2 A;  1LYL A;  1SMX A;  5C0X I;  3I56 A;  1VQA A;  1U5K A;  5C44 G;  3UDF A;  5LMN W;  1HJP A;  1IXR A;  1VQO A;  2E2H H;  2HHH Q;  4DR7 Q;  4R4Q A;  3H3V I;  2AHO B;  4IFD J;  3S24 A;  1TWA H;  5AJ3 Q;  4LF7 Q;  3IRB A;  1OXS C;  1J6Q A;  3A0J A;  1D7Q A;  1QVF A;  1L1O A;  3FKI H;  1MKH A;  1BVS A;  4DUY L;  3I4N G;  3NEN A;  5C0X J;  3ULL A;  4XTC S;  1KD1 C;  3ZJY C;  3BJU A;  3HKS A; 
#chains in the Genus database with same CATH topology
 2A6H C;  2KA7 A;  4GOP C;  1WTH A;  5FLM H;  2LFN A;  1IKM A;  1WTP A;  2EJM A;  2SDF A;  1DZ1 A;  2WB1 B;  4JG2 A;  4APV A;  4C56 C;  4DAV A;  4ULL A;  5J39 A;  2N49 A;  4L8J A;  1AEX A;  3I72 A;  1FGB D;  1VQ8 A;  1BKB A;  4R8I A;  5IT9 E;  1Y8O B;  3S1M H;  3R2T A;  4B3T L;  2PI2 A;  4OON A;  4IQZ A;  3NE5 B;  2DNC A;  4RA8 A;  3TZU A;  1VMP A;  5LMN L;  3PF5 A;  2A69 C;  4NPS A;  1PVO A;  1PFN A;  4C2M B;  4CJ2 C;  1DGS A;  2RDG A;  2FHT A;  3IFT A;  3IAY A;  4KHP Q;  1SN8 A;  3PGZ A;  3CRL C;  1A8V A;  4YHH Q;  4HJA A;  1PFS A;  1SXT A;  3VYS A;  3V96 A;  1XPR A;  4HJ5 A;  4X65 L;  2Q8I B;  2XGT A;  3RZO B;  4ZKC B;  5FO9 B;  2Q8R E;  4OO1 G;  3T53 B;  4G7H C;  1XMO Q;  3J7A 5;  1C48 A;  1W2B A;  1PMR A;  1CI3 M;  1EWI A;  4DV0 L;  1I6V C;  4A3K G;  2HQE A;  5FLX L;  4JYA Q;  4QIW B;  1I94 L;  4KKT A;  1D5Z C;  4RGT A;  2NVX B;  1TWA B;  4TKO B;  1TWG H;  5DM7 3;  1GHJ A;  3G4S A;  2L0C A;  4K8J A;  3HRZ C;  5DLQ E;  3MFY A;  2B2W A;  2WAQ E;  5BR8 L;  4ZKB B;  5IWA Q;  1F2Y A;  1VQC A;  3HEJ A;  1PDQ A;  1HNX L;  5JAV A;  3CD6 A;  2CKZ B;  4RMF A;  3A8J E;  1QB5 D;  1B44 D;  1L0Y B;  2JXM B;  3HOW B;  2Z4I A;  1JC7 A;  4IJH A;  1PA6 A;  3UE0 A;  1Z7T A;  4DK1 A;  1GM5 A;  4YY3 L;  3I4M B;  4A3C H;  2PMZ E;  3SK8 A;  1SNM A;  4KN7 C;  4OIJ A;  3W5O A;  4DN4 M;  4K5X A;  4C1N I;  2WKD A;  1NMF A;  5D3I B;  3KF6 B;  4L63 B;  2J4X A;  5M5X B;  4GLV B;  1NE3 A;  2PW5 A;  2X6G A;  2ZT9 C;  3ND8 A;  4DR1 L;  1LM0 A;  1U9R A;  3I3C A;  2FMC A;  4K6D A;  4UPA A;  4LF9 Q;  1WJJ A;  4G7O C;  4DUZ Q;  3L7Z C;  3H3V H;  1U4P A;  2AQ1 B;  4OL7 A;  4ZLT F;  4DNI A;  1X9N A;  4OGQ C;  3KBG A;  1EIG A;  1CK1 A;  1CT1 D;  5COR A;  5C44 B;  1Y1V H;  3MZ5 A;  4Y52 H;  1B3A A;  1LTA D;  2XIW A;  2F0E A;  2QCP X;  4QMG A;  2R61 A;  3R93 A;  4G4K A;  3UDX A;  1Y8P B;  2EXZ A;  4EQP A;  3E9I A;  4CGY B;  2E2J H;  4C3J G;  3IKJ A;  2JK8 A;  4J6H A;  1I50 B;  3MXU A;  3JAM i;  3K80 C;  1UE7 A;  2IL8 A;  1I6H H;  2R93 B;  4DV7 Q;  5JJL A;  3D3R A;  2A1A A;  4F7X A;  4BBS B;  1GO3 E;  4RAU C;  1VS0 A;  3EJI A;  5E3F A;  1SFO B;  1BCP D;  2B63 B;  1EYD A;  1TVX A;  5KYL A;  1EYA A;  3FMC A;  3KLS X;  2MO0 A;  1JJG A;  5CV4 A;  1K8M A;  1M8A A;  1AN8 A;  2K32 A;  1TQO A;  3KBX A;  3H94 A;  1PV4 A;  2IPK D;  1IBL Q;  3I91 A;  1W6K A;  3OMC A;  2O2L D;  4JCV E;  1YI2 A;  3KLS A;  3GTP H;  4ZK9 B;  1MJE A;  4KHV A;  4JI1 L;  3NP8 A;  1QVG A;  2Q2U A;  1F2L A;  3HOW G;  1FJG Q;  3C2P A;  5FKA C;  1K0S A;  1JOO A;  2K5H A;  4QJF A;  5FOB B;  2ZM6 Q;  1BNZ A;  3S1N B;  1B2T A;  4LF7 L;  2EY2 A;  1CSP A;  4DV5 L;  2UXD L;  4A3L G;  1PLF A;  3A74 A;  1EYG A;  4A3F G;  3OYY A;  4IO9 A;  1EY0 A;  4HJ8 A;  1X3G A;  2O5J C;  2JJQ A;  2EJF C;  4DR5 L;  1TWF H;  4QIW E;  4X64 L;  4FXD A;  3E0J A;  4BBS H;  4BXX G;  3HOZ B;  5C3E B;  1QJO A;  2K7V A;  1PH9 A;  4LF8 L;  5C0X G;  3QOJ A;  1G2T A;  3DWP A;  1SRU A;  1XNR Q;  5T1G A;  3CC2 A;  1YJN A;  3HS0 C;  4P2C B;  2N8N A;  1W6J A;  4X62 Q;  2UUC L;  4FVM A;  2RVL A;  3W3A A;  2PNH A;  2B2Y C;  1ILQ A;  2D0P A;  2F0M A;  4FF4 A;  5M3F H;  2GN5 A;  1JOK A;  2K04 A;  4JK1 C;  2QDB A;  3BDL A;  3RZD H;  3UDI A;  2UXC L;  1N36 L;  3J80 E;  5GAH C;  4LF4 Q;  1ZEQ X;  1RDP D;  2OWO A;  1KNE A;  2M9V A;  3MXN B;  4IOC A;  3I4M H;  5CGK A;  4GKJ L;  5C3E G;  1X3F A;  5M5Y B;  1C9O A;  1IYJ B;  1P8L A;  1FYC A;  3CCU A;  3HOY H;  1JJC B;  2JE6 I;  3M4Y A;  2WB1 E;  5IYC H;  1PZI D;  5C3X A;  3BDC A;  3OWF A;  2ZJR A;  1RTN A;  5JOB A;  4M8A A;  1K3B C;  3I2Z A;  4A3C G;  1H95 A;  1VQP A;  5HGT A;  2JA7 B;  1VCI A;  1S5E D;  2ZJQ A;  2JA6 H;  3BVM A;  1EY6 A;  1PRT F;  5C44 H;  3TDQ A;  1B9M A;  2A68 D;  2I46 A;  1EFI D;  1CM9 A;  1TY2 A;  4UP7 A;  3VR6 A;  3PUY A;  1GUT A;  3D4D A;  1E7Z A;  1XNQ Q;  3PUV A;  5IGC A;  5C5L A;  1D1I A;  3T1Y Q;  3I4N H;  2OF1 A;  4F8M A;  3NPP A;  3U50 C;  1WTO A;  2ID0 A;  1UAP A;  4DR6 L;  4YWK A;  3CCE A;  3UE1 A;  4R9W A;  3F8T A;  2JA7 G;  2B63 G;  2XRQ D;  2KEN A;  3ICE A;  3MFG A;  4CHT B;  4RHS A;  1C0A A;  3E5S A;  2EZV A;  4HMJ A;  1H9R A;  2FXQ A;  3DMU A;  2IX1 A;  1HFN A;  4UP9 A;  3CCS A;  4WJW A;  5C4X B;  1HCZ A;  2KCN A;  4OXP A;  3U9O A;  4K2K A;  3KJP A;  1YEZ A;  3M85 A;  4X66 Q;  4DV4 Q;  1I4H A;  3J81 j;  3V05 A;  2RSN A;  4DV6 L;  2K4K A;  2JA8 G;  1EQT A;  4BY7 G;  4DR4 L;  2BE5 C;  2E75 C;  3K5O A;  4RHR A;  3OW2 A;  3F2B A;  2CW0 C;  1B9N A;  4A3D G;  4I7A A;  2QA4 A;  1BBX C;  4P75 A;  5EGT A;  5IGB A;  3TQY A;  4OHJ A;  1UUP A;  4MN3 A;  2CFM A;  3VR4 A;  4R1J A;  1HNZ L;  1HR0 L;  4R4T A;  5JEA G;  3D8G A;  1A3U A;  3KK7 A;  5KNC A;  5IY0 A;  2YU9 H;  1QIL A;  5DNF A;  4DV3 Q;  5F2D A;  2MNA A;  1QZH A;  1IW7 D;  3GTQ H;  4DV2 L;  1SR3 A;  2A74 C;  4RGM A;  4A3M G;  2AQ2 B;  5I6Y A;  2DY8 A;  5FO8 B;  1YNN D;  3DEO A;  3P20 A;  4JV5 L;  2RCN A;  4HED A;  3HOW H;  3RLF A;  1CKM A;  3A7L A;  4EQO A;  4QL5 A;  1CKN B;  1OO9 B;  4DFA A;  3GTG H;  3D4R A;  1KDC A;  2E76 C;  1BO0 A;  3DWQ A;  1EIH A;  3PCO B;  1EQQ A;  2HCC A;  4HIO A;  1PH8 A;  1TY0 A;  3KOJ A;  3KDF B;  3EQL C;  1CZW A;  2NTT A;  4H13 C;  2NTS A;  2DUD A;  3PO3 G;  3F2C A;  2A73 B;  4JI7 L;  3CXC A;  2J7Z A;  1S3O A;  2DN8 A;  2JA7 H;  2V1C C;  3GTL B;  3TS0 A;  2TSS A;  5JJK A;  3J81 E;  1Y1W G;  1GUO A;  4IUU A;  4N8X 1;  3KF8 A;  1L0W A;  5M9O A;  1YNJ C;  2N88 A;  4LFA L;  2EY6 A;  2JEA I;  4JI2 L;  2MQH A;  4GOP B;  1WCM G;  4GOP A;  2R3Z A;  2I5M X;  4DV0 Q;  3DWA A;  1FVI A;  4RH6 A;  2B2U C;  1I94 Q;  1X32 A;  3TS2 A;  5C44 G;  4FF1 A;  1IXR A;  2HHH Q;  1CHP D;  2F0P A;  2AHO B;  3C1F A;  3ONA B;  4CKB A;  2PZT A;  2K5W A;  4H44 C;  1L1O A;  1BVS A;  3I4N G;  3A55 A;  5FLX E;  1V1O A;  3ZJY C;  3BJU A;  5DAU A;  2IT1 A;  4PMC A;  3K5L A;  3C1E A;  4C3H H;  1EIF A;  3CCV A;  3NSW A;  1HPC A;  3BZK A;  4HJ9 A;  1HFG A;  4A3B G;  1Z6H A;  4H02 A;  3I4M G;  2CVR A;  1G2S A;  2EOT A;  1AW7 A;  3GDE A;  1Y14 B;  1JQY D;  1EZ6 A;  1LTR D;  4KTA A;  3SDZ A;  1UEA B;  4ALP A;  4V19 0;  4N9T A;  1WVL A;  1IL8 A;  2AQ3 B;  4F87 A;  1WTQ A;  1DOL A;  2N55 A;  3SEB A;  2SOB A;  4A3I H;  1QVC A;  4P74 A;  1LTS D;  3MEH A;  3NBH B;  3GTJ B;  2F03 A;  1O7I A;  2F0G A;  5EKK A;  3X3M A;  2F0V A;  3KDF A;  1EY9 A;  3JAM L;  3S9W A;  5CV8 A;  1ET6 A;  3S1N H;  3CU7 A;  4IFD I;  1Q46 A;  4KY6 A;  3LNN A;  1N9W A;  4IUN A;  3KJO A;  2UUB Q;  2E2J B;  4L5S A;  5IT9 c;  4K0K Q;  2RF4 A;  4DR7 L;  2Z0S A;  3VA7 A;  4MHE A;  3I4N B;  5JJI A;  4BBR G;  5I6W A;  3UI2 A;  1NCV A;  4MZ9 A;  4XYQ A;  4YCU A;  2CHB D;  1BCP C;  4DV1 L;  2LS0 1;  1Q8I A;  1T5X D;  4XDX A;  2OEO A;  1NR4 A;  1SE2 A;  4GLX A;  1NAP A;  4PMW A;  5EKI A;  2WB1 G;  3Q24 A;  3W1G A;  2F4V Q;  4JI1 Q;  3A54 A;  5EAY A;  1QCB D;  4NMZ A;  4OO1 H;  3M4Q A;  4RG1 A;  1VQ9 A;  4U67 3;  3HOX G;  3MXG A;  2DNE A;  3R8B A;  1ILP A;  1YHA A;  4B9W A;  3HOY G;  4L5T A;  1TWG B;  3K59 A;  4DXF A;  2NN6 H;  1PH6 A;  1IBM L;  1U4R A;  2IX0 A;  1UE1 A;  1UNS A;  3FEW X;  2K52 A;  3CQZ H;  1DOM A;  3ERO A;  1NY4 A;  1PTO F;  2UUA Q;  1Q1E A;  4X64 Q;  1STE A;  4YCV A;  3PIO 3;  5CV6 A;  1PTO D;  2C35 B;  2MFI A;  4OEL B;  5M3M G;  4FF3 A;  3KYH C;  1PH5 A;  5EBC A;  3TBI B;  3S1R B;  1ONL A;  1RJT A;  4DGZ A;  1S5D D;  1FNU A;  3K57 A;  2F0J A;  2F0L A;  1FGU A;  4B3M L;  4XYO A;  3TRE A;  3CCL A;  2A6E D;  1WD0 A;  4O0A A;  1YVC A;  5C5M A;  3DEP A;  2BDO A;  1AH9 A;  4LF4 L;  4CJ0 B;  1L2F A;  1PH1 A;  4KD3 A;  1VQ6 A;  2PNR C;  3QWN A;  4Y7N H;  4DA2 A;  2NVY B;  1HZ9 A;  4A3E H;  3QJY A;  2D62 A;  4QCL A;  4ZAI A;  5JPN C;  3NEM A;  4LW1 A;  1SE4 A;  1TS3 A;  5IGF A;  1VQ7 A;  1TWC H;  1STN A;  3P75 A;  3WOF A;  3M4O B;  1J5E L;  3Q8D A;  1RL2 A;  1SMY C;  2PI2 E;  3PUW A;  1SNP A;  3H0G G;  3PIP A;  1PH2 A;  3HOU H;  1CQV A;  4YWM A;  4JPB W;  1LTG D;  4RKB A;  4A3G G;  5ELE A;  3HG9 A;  4XQJ A;  1E22 A;  1EFW A;  4CDF C;  4HIK A;  3FDT A;  3N6R A;  3CCJ A;  2EYO A;  2JN4 A;  4ZUJ A;  4AQY Q;  1S5C D;  5LMU L;  1Y69 U;  1LLR D;  2PQE A;  3HOY B;  4Q0F A;  3G6E A;  1G8Z D;  2JSO A;  5J3B A;  1D1K A;  3S2D H;  1IKL A;  3OOC A;  1XMQ L;  3CAM A;  5FLX c;  1A15 A;  3E3X A;  3W2D A;  3G7L A;  3ZYY X;  5IYB H;  3WWV A;  3NWT A;  3U4V A;  2KVM A;  4ZRZ A;  4B3T Q;  4HN7 A;  1SYE A;  4IUR A;  3C46 A;  1KTK A;  1XPO A;  2EYF A;  4A3G B;  2HDM A;  1EYC A;  4YWL A;  5COY A;  5A2Q E;  4MIU A;  4MNO A;  1KLU D;  1G29 1;  1WI5 A;  4MTK A;  3GQB A;  1VQE A;  2LSS A;  4A3J H;  4X3T A;  4BY1 H;  4NKL A;  3J7Z C;  4DK0 A;  4LFC Q;  1C4Q A;  2VY3 A;  4GKK L;  3H91 A;  2MJ8 A;  3MXN A;  4JBW A;  1YZ6 A;  2A6H D;  2O4X A;  1FNV A;  4YHH L;  4AH6 A;  2UU9 Q;  3NWS A;  2E2I H;  1CTM A;  3B6Y A;  3MVV A;  5ISR A;  2B2Y A;  2OCE A;  3PIO A;  2AUK A;  2K33 A;  3J80 L;  1I4Q A;  3NTI A;  2EE1 A;  3J80 i;  2BH8 A;  2MP1 A;  4A3I G;  5IP7 G;  3K8A A;  4I65 A;  1OXV A;  4DAY B;  2WIN B;  2HD3 A;  2NZH A;  4A3K H;  1DD2 A;  4IUV A;  1ESF A;  1N32 L;  1HUN A;  1I4G A;  4LNQ A;  1WTX A;  1E24 A;  3Q6S A;  1EWC A;  2VB3 X;  3M7N A;  1CZG A;  1SAP A;  3I4O A;  2MO1 A;  1B50 A;  2ZTC A;  1L1O B;  5IOC A;  2E5L Q;  3ERQ A;  4RGO S;  3S16 H;  3NQT A;  1Z47 A;  4C3J H;  2D0O A;  2QW7 A;  3ULP A;  2K5V A;  2Z1C A;  4JI8 Q;  1EEI D;  4XT1 B;  1YHQ A;  3CCQ A;  5EPL A;  3N52 A;  1RF2 D;  4B3S L;  4YY3 Q;  2IJ0 A;  1J8I A;  2PW7 A;  5KNB A;  2JYO A;  4HSP A;  5M3M H;  1HQR D;  4JW0 A;  2AWN A;  1DOK A;  1Q3L A;  4J15 A;  1N34 L;  1TWH H;  2K05 A;  5EBD A;  3VR3 A;  2NVQ B;  1CSQ A;  5CC4 A;  1ICW A;  4DAP A;  3FVQ A;  2CQA A;  3E9H A;  4X65 Q;  3RZD B;  5JJZ A;  1NR2 A;  5CV9 A;  3T51 B;  4LAA A;  2IWH A;  1MBY A;  3GD7 A;  5GQO A;  1A63 A;  4C3I B;  1GUG A;  3HKZ E;  4K6L A;  3CKI B;  4C3H G;  3JAM c;  1TWC B;  3NBH A;  4OX9 L;  2EDG A;  2IHE A;  3URY A;  4WRD A;  1V43 A;  1IYV A;  1Y1W B;  3PV0 A;  3HOU B;  4DKA C;  2VUM H;  4A3E G;  3VYT A;  1PH7 A;  1E2W A;  1TS5 A;  2A68 C;  5ELO A;  1TWF B;  2AUJ D;  3VA5 A;  3HOZ H;  4A3D H;  2NN6 G;  1QNU A;  4X3U A;  5GAG C;  2EYP A;  2HCI A;  4JI2 Q;  3M4P A;  4YCW A;  4Z9C B;  1K3R A;  1U0L A;  5FLM G;  1GUW A;  4QUF A;  3HP3 A;  4HTH A;  1GHK A;  3BVZ A;  4ZYS A;  5JEA H;  2VS1 A;  1H9M A;  5D14 A;  4RWS C;  1HNW L;  5M3F B;  4DF7 A;  5IP9 H;  4JI3 L;  3GV6 A;  4ODG A;  3T13 A;  3K5N A;  4NXN L;  2RDH A;  4A3D B;  5CR3 A;  4DAY A;  3GTO H;  4DR1 Q;  4IUP A;  1GD7 A;  1B1Z A;  5M3F G;  2RA4 A;  3AYH B;  1PFB A;  4KKS A;  5IP7 H;  2ZXR A;  4HCS A;  4ZQ3 A;  4A3J B;  2JA8 H;  4NW2 A;  4LF5 L;  4UP8 A;  3AQQ A;  3STB C;  1SYC A;  5M5Y H;  2WV6 D;  2ZM6 L;  2QGQ A;  4HSV A;  1E1O A;  2WP8 J;  1UE6 A;  3BVG A;  1LTT D;  1O78 A;  2XWJ B;  3NTK A;  3HGB A;  4QUC A;  4DU9 A;  4OWW B;  3RR5 A;  1ZXT A;  5ELD A;  1MJC A;  5I4D A;  4IN3 A;  1FNW A;  3SK4 A;  4XQN A;  1G51 A;  2WKC A;  3UDG A;  3STB D;  1KQS A;  4AYB E;  1E2Z A;  5FJ8 H;  1BCP F;  3PO3 H;  3O13 A;  1CKO A;  4XXE A;  3RD4 A;  2B2U A;  3S15 B;  4FDB A;  2PCF B;  3TP7 A;  3VR5 A;  4KK7 A;  1WD1 A;  4KJO A;  4C3I G;  1JMC A;  1KL9 A;  1Q7Y C;  5M5X H;  3TN2 A;  3KF8 B;  4GNX C;  2NUC A;  2HUG A;  5BN5 A;  3SR1 A;  1PYW D;  2RDF A;  3FKI G;  1IBL L;  2VNU D;  5CMD A;  3BDO A;  3QO2 A;  5C0X I;  1II3 A;  4DUY L;  4N9P A;  1VQO A;  2Z6B A;  3DHQ A;  4DNR B;  4A3I B;  2BCO A;  1SYG A;  4LF7 Q;  3A0J A;  4PMB A;  4C3H B;  2RCF A;  5C0X J;  3ULL A;  2Z4H A;  1KD1 C;  3HKS A;  3I70 A;  1BXT A;  3NK9 A;  3M9B A;  1GUS A;  4WJ4 A;  1EOT A;  2YV5 A;  2EQS A;  2WFW A;  2KHI A;  2UXB L;  4RGN A;  4DR2 L;  2XVS A;  3QOL A;  3LWE A;  4JI0 Q;  4LK1 C;  3IL8 A;  4LF8 Q;  5JVH 3;  1D5M C;  4P71 A;  1B3Q A;  1QOH A;  4OO1 I;  2OT2 A;  1R4P B;  1XTD A;  4C1N K;  1XX8 A;  1XNQ L;  3GTM B;  4X3K A;  3A5U A;  1VQF A;  4FP5 D;  5IE8 A;  1WFQ A;  2I5H A;  1LT6 D;  4JI4 L;  1QWY A;  1O7Z A;  3J7A V;  1KAB A;  3AFQ A;  3MTS A;  3ND9 A;  4A93 B;  3FPU B;  1NUC A;  1NJI C;  3GTL H;  1CA5 A;  1IHZ A;  4DR3 L;  1SJE D;  1QE6 A;  4NDX A;  3KFU A;  4ME5 A;  3PO2 B;  3U58 A;  2B2V C;  1CQF A;  1X55 A;  5IYD H;  2K14 A;  4IPH A;  5EPJ A;  3HKZ G;  1F2Z A;  2G5D A;  2R6G A;  1WOC A;  3AFP A;  1JB7 A;  3GTO B;  1GVP A;  1AE3 A;  3EVQ A;  5JVG 3;  4IPD A;  1SNQ A;  3SK6 A;  1JE5 A;  1AFP A;  5IP9 G;  1Y1V B;  1ML0 D;  4JOI C;  4POF A;  2JP1 A;  1F9Q A;  4P72 A;  2LY7 A;  2VQE L;  5AJ3 L;  1QZG A;  3LGJ A;  3S1Q H;  2PYK A;  3PSI A;  1JOQ A;  4HJ7 A;  1KRS A;  2R7Z B;  4WJ3 M;  3FRP B;  2F3W A;  3HOZ G;  1S4Z A;  2AKW B;  2KOL A;  3QIA A;  5KYI A;  4G57 A;  3D4W A;  2D2C C;  3H15 A;  4EGV A;  2I5L X;  3T4A C;  4C2M H;  4DPG A;  2F0U A;  5C4X G;  4ZCK A;  2AWO A;  5LL6 X;  3CF5 A;  5J22 A;  3I90 A;  5JEA J;  4I7Z C;  4QY7 A;  1LTL A;  1Y1W H;  1N33 L;  1RTO A;  1TKW B;  4LUO A;  3MC0 B;  4LFB L;  5C4H A;  3OHX C;  1F77 A;  3DUZ A;  4BXX H;  2E2I B;  4AQY L;  1H9S B;  2YU9 B;  3A7A B;  1WYD A;  1LV9 A;  4MTN A;  4K5V A;  4DR5 Q;  1HA5 A;  2F0I A;  3TP8 A;  3PF4 A;  1FL0 A;  1EU3 A;  1KRT A;  1B7Y B;  3PUX A;  4TSS A;  4IPC A;  4BS9 A;  1M4V A;  3TEH B;  4K5W A;  4YIJ A;  4A75 A;  1F9R A;  1XNR L;  4HMI A;  2YTX A;  4A3K B;  4BWG B;  1R9T H;  2K5N A;  2FMM A;  3TZD A;  3U4Z A;  4LF6 Q;  2B2T A;  5BN3 A;  4GS3 A;  3HZX A;  5KIX A;  2VQF L;  3CC4 A;  1PH3 A;  4CKC A;  2R7D A;  4R8N A;  4FXG C;  2UXC Q;  5C4J B;  5C3E H;  1DCZ A;  4C3J B;  4LFC L;  4C3I H;  2VB2 X;  1VQH A;  1MSG A;  1V1P A;  2EYM A;  4M1U B;  4KHZ A;  4GKJ Q;  1OXX K;  4IPG A;  3KLW A;  4CDE C;  3J81 i;  1HXY D;  2KHS A;  3K7A B;  2XNA C;  3MWY W;  1HQM C;  1B4O A;  2NVY H;  1BQQ T;  2XTI A;  3OTO Q;  3T1H Q;  2JA5 B;  3EFX D;  4DNT B;  4X6A H;  3SHL A;  2NVX H;  1PXU A;  4HIM A;  5HY6 A;  3RN5 A;  1PTO B;  2HHH L;  1SNC A;  3CPF A;  3PMF A;  3QR8 A;  2KUM A;  2Z9H A;  3HOX H;  4S3S A;  4ABN A;  1EY4 A;  1KAW A;  4DXG A;  4BY1 B;  3Q23 A;  2JQO A;  4O2D A;  2E5L L;  4POG A;  4LF9 L;  2VUM G;  1ZYR C;  4OWT B;  4IUQ A;  2KJX A;  4IOA A;  1ET9 A;  3T56 B;  4L5R C;  4IFD H;  1B70 B;  3OPO A;  1HR0 W;  4EQ5 A;  2PQA B;  2P5Z X;  4DK6 C;  3T1Y L;  2PQA A;  1SNO A;  5KND A;  1SJH D;  2JA6 B;  1STG A;  4JBK A;  2D5D A;  2F0K A;  5IYD G;  2G9H D;  1A62 A;  3V2T A;  3F2D A;  1K8A C;  1GJX A;  2FIN B;  1U4L A;  1BDO A;  4PV1 C;  2F1M A;  4ID6 A;  1X65 A;  3J7A F;  4PZ6 A;  2MPM A;  2KCM A;  1H9S A;  3X3N A;  1CFM A;  3KLR A;  2CQO A;  3L0O A;  1AZP A;  4XIG S;  5E4X A;  1SRO A;  1U4M A;  1JWS D;  3K7A H;  2K01 A;  5TSS A;  3BG3 A;  4OEM B;  3S16 B;  2RSO A;  3TRZ A;  1LAB A;  3CW2 C;  4BY7 H;  4B3R Q;  1KHI A;  1YJ9 A;  3NEL A;  4OX9 Q;  3MEF A;  1K83 H;  3TP5 A;  2F0W A;  2OTJ A;  4UDU C;  4PNY A;  1ENC A;  3W1B A;  1XMO L;  4XQQ A;  4FF2 A;  4TQU S;  4KD4 A;  4RCN A;  2EYH A;  5I9O A;  1A0I A;  4AIM A;  1Z9F A;  3CPW A;  1I3Q H;  1DXM A;  3JAM E;  5DEH A;  4JYA L;  2Y0S E;  2PO4 A;  2QEX A;  2M00 A;  1D2B A;  2Z8L A;  3PUZ A;  2DJF C;  1JE4 A;  2NB0 A;  4KV6 A;  2N78 A;  4JI5 L;  1V1P B;  1NMG A;  1VF5 C;  4RKL A;  2B63 H;  3CRK C;  2MUY A;  5IT9 L;  3S15 H;  1AE2 A;  1YIT A;  1EY5 A;  2B29 A;  3JC6 6;  1HNW Q;  4DV5 Q;  1S72 A;  3PIP 3;  4DV3 L;  3OSO A;  3CQZ B;  3BYY B;  5GAE C;  1A2U A;  4BA1 I;  1K0R A;  3J81 L;  1YIJ A;  5IYC G;  1AZQ A;  3E0E A;  2BH2 A;  1SBB B;  2WAC A;  4KKU A;  4GZY C;  4QQB X;  4NP5 A;  1I6H B;  5LMN Q;  2R92 H;  2F4V L;  4K8I A;  4J1M A;  3ITP A;  1BBU A;  1HZA A;  2F3V A;  3R3O A;  4KHP L;  5I2Y A;  3NUC A;  2YYZ A;  2LKV A;  1FR3 A;  4L5Q A;  3RUZ A;  5K5P A;  2SNS A;  2UUC Q;  4UY8 C;  1K83 B;  2F52 A;  1GOZ A;  5ELN A;  1LO5 D;  1IBM Q;  4DUZ L;  2F0T A;  2WII B;  1TXY A;  3FHW A;  2J0T D;  1N36 Q;  1YNN C;  1A3V A;  2DJG C;  3K81 C;  4JI6 L;  5E7N A;  2R7Z H;  5K36 G;  1NSN S;  1DJR D;  1C8C A;  1MD2 D;  2BOS A;  2Y0S G;  1PRT B;  5ELC A;  1Q86 C;  1MIU A;  2JA9 A;  4CDC C;  3K0X A;  5BR8 Q;  3BU2 A;  3D0F A;  2NWG A;  3EBE A;  1LAC A;  4B3M Q;  2F0H A;  2EYJ A;  4K2L A;  4DV1 Q;  4DV7 L;  4NXM L;  5A2Q L;  3I55 A;  1HZB A;  1JIC A;  2K5D A;  2C9O A;  1F9P A;  4TRD A;  3CME A;  3S14 H;  2KQ3 A;  2K75 A;  1NTG A;  1T9H A;  1SEB D;  5IGD A;  1EZ8 A;  5CV5 A;  1YNJ D;  5J1Z A;  1E2V A;  1IBK Q;  1RD9 D;  4PZ8 A;  2A8V A;  3A56 A;  1STA A;  5HGQ A;  1XTC D;  1GXD C;  4JBJ A;  4DR6 Q;  5FO7 B;  4F88 A;  2UXB Q;  4L6T B;  3NTH A;  1A2T A;  1KDA A;  2HIV A;  1JCK B;  2BA1 A;  3D6W A;  1SFO H;  1TS2 A;  2CWP A;  2JA5 G;  2UXD Q;  1HZC A;  3M7G A;  1D5X C;  3S2H B;  2BA0 A;  1BOS A;  4N8F A;  2KCC A;  1EY8 A;  2CH4 W;  1ASZ A;  4IFD G;  1LT3 D;  1P16 A;  1KXL A;  1L0X B;  1I5F A;  1I3Q B;  4RFB A;  3HKZ B;  2SNM A;  1HA6 A;  3GV3 A;  4DR4 Q;  2VXW A;  4DAM A;  1Y8N B;  2L15 A;  3A8K E;  3A8I E;  1JT8 A;  2NVT B;  1Q1B A;  3QG1 A;  3RLN A;  4X62 L;  5I2X A;  2B2W C;  2Y0S B;  2Z6K C;  4WOR A;  1HH2 P;  2L9H A;  1R4Q B;  3S17 B;  4UHV A;  4GN5 A;  3EN2 A;  2XN9 C;  1R9T B;  3L2P A;  4J8Q A;  3C3L A;  1PYB A;  1HR0 Q;  3VYU A;  4GKK Q;  2LMC B;  4DK3 C;  1NBW A;  1J9O A;  1LYL A;  3I56 A;  5LMN W;  1VQA A;  1XWE A;  2E2H H;  4DR7 Q;  3CHB D;  1STB A;  1A6X A;  1ENA A;  3H3V I;  4IAL A;  4IFD J;  1PFM A;  1PRT C;  3S24 A;  1TWA H;  5AJ3 Q;  3IRB A;  1SND A;  1D7Q A;  1KDB A;  1QVF A;  3FKI H;  3NHH A;  3P7J A;  4XTC S;  4FO2 A;  3CP0 A;  2OQK A;  1H9J A;  4KI0 A;  2IX3 A;  5KEE A;  2KCT A;  4BBS G;  1OXU A;  1BCP B;  3D31 A;  2ATW A;  5AFW A;  4A93 G;  3RZO H;  2H1E A;  4EVO A;  3R2I A;  2QDL A;  1EU4 A;  2AMC B;  2L11 A;  3LX0 A;  2K03 A;  1I50 H;  3FP9 A;  1KLG D;  3GTJ H;  4RCO A;  2K50 A;  2B2V A;  1PTO H;  4OWX B;  5LHY 1;  3HOV G;  5E1F A;  1E1T A;  1B8A A;  1Q12 A;  3MA2 B;  2L4N A;  2PZU A;  5DM6 3;  3ERS X;  1EUJ A;  4HID A;  4A3M H;  3S17 H;  3SXH A;  2ENB A;  2Q2H A;  3TME A;  2R92 G;  1PHJ A;  1YBY A;  4CJ1 B;  4R4O A;  4JI7 Q;  1HRJ A;  4JC0 A;  4KY7 A;  5ELB A;  5KGU A;  2ZJP A;  1JJ2 A;  1KNA A;  4P73 A;  3VDY A;  1YNX A;  1EWH A;  3GTK B;  1PH4 A;  1SE8 A;  2PPB C;  4WFN 3;  1PZJ D;  3HOV B;  1EEF D;  2NZO A;  2IHF A;  1C7Y A;  2XWB B;  3PO2 H;  1ICF B;  4LFA Q;  1K28 A;  3AU7 A;  3OW7 A;  3NBI A;  4A3F H;  4H7B A;  2L1B A;  2LXJ A;  3OIQ A;  2DGY A;  1WTW A;  1NNX A;  5IGE A;  3M3Y B;  4X66 L;  2IW3 A;  2PZW A;  4FNF A;  2K28 A;  5K36 H;  1VQI A;  3K6O A;  2K5Q A;  5C3W A;  3PQI A;  5C0X H;  1TU2 B;  3MXP A;  4IZ8 A;  1CHQ D;  3BYT B;  3HOU G;  1VQJ A;  1S5F D;  5C4J H;  1Q90 A;  1X6O A;  1HTL D;  4GNX A;  1Q8K A;  4LWC A;  5D3D A;  4ME3 A;  1BR9 A;  4AYB G;  3WOE A;  1EY7 A;  2BDN A;  1JOR A;  1DYQ A;  3K7U C;  3DM3 A;  5D65 A;  1OTC A;  4R4I A;  4JI8 L;  5IOD A;  3OTO L;  3T1H L;  1ESR A;  2KBN A;  1ENF A;  4QB4 A;  2QKI C;  4GLA C;  4LUZ A;  4A3B B;  1D6E C;  1BF4 A;  1DM0 B;  5IGG A;  4GN4 B;  1RIP A;  3K5M A;  4V0B A;  2G9D A;  2NVT H;  1IZ6 A;  1CKN A;  2OQ0 A;  2X6L A;  1G91 A;  5LL6 S;  1VQD A;  1JB3 A;  4A3F B;  2KEE A;  4G7Z C;  3M4O H;  1JWU D;  4Q5V A;  4LF5 Q;  4A3J G;  3M3Y H;  4R4C A;  3J80 c;  3AMU A;  2BE5 D;  5E4W C;  1YHB A;  4DV4 L;  3RNU A;  2JA6 G;  2E2H B;  5EPK A;  1XMQ Q;  1X54 A;  1ZYR D;  4KN4 C;  2Q2I A;  2B8F A;  1O7Y A;  3CMA A;  1ROD A;  2ALY B;  1E0B A;  2QEJ C;  3GTP B;  3A5Z B;  3BS1 A;  4JBM A;  1HUM A;  3I4L A;  2D9U A;  4CKE A;  2FFK B;  1M1K C;  2B39 A;  1W3S A;  5FK9 C;  2CWA A;  1S5B D;  4K14 A;  1UEB A;  2RHQ B;  1LTB D;  1VDZ A;  1H9K A;  5L37 A;  3H0G B;  2QF7 A;  1QNK A;  1SDF A;  1LUZ A;  1PTO C;  4KJN A;  2Q2T A;  5CYU A;  4A3G H;  5IWA L;  1UWV A;  1N8R C;  2R92 B;  3U9S A;  2IY5 B;  2B3G A;  4O42 A;  2JEB I;  1HNX Q;  2B2T C;  1STH A;  1ASY A;  4XT3 B;  2KEC A;  4NXN Q;  4FXK C;  4DV2 Q;  5M5W B;  2R93 G;  2JA8 B;  3BZD B;  2EY1 A;  4CBV A;  4A3M B;  4A93 H;  1DON A;  1BUV T;  2EPB A;  1LTI D;  3S2H H;  1Q82 C;  1VF7 A;  3NXW A;  3AB9 A;  1G6P A;  1EQV A;  5GAD C;  4BA2 I;  4JOI A;  4JI5 Q;  5C4X H;  4JV5 Q;  1G6Z A;  3SE0 A;  3H3V C;  1VMC A;  3DXJ C;  4A3E B;  1V8Q A;  3IFD A;  2EYL A;  2EXD A;  5BN4 A;  3HOV H;  2ICE C;  3EIV A;  5G3L F;  1TII D;  1HTP A;  1E3P A;  5G3L D;  4EQN A;  3D6C A;  1I4R A;  2ZTD A;  3G71 A;  1I4X A;  2F3I A;  1FD7 D;  1X3P A;  1WTR A;  1IL2 A;  1K8O A;  3S1Q B;  2DY7 A;  3H0G H;  4QF4 A;  3ER0 A;  2K1B A;  1STY A;  1A3T A;  3LWU A;  2F0S A;  3GP7 A;  1N34 Q;  1WTV A;  2VUM B;  1Q81 C;  3I7F A;  4Y7N B;  5CBE E;  2KHJ A;  3T16 A;  1VQM A;  3RLO A;  3GTQ B;  1QUQ A;  1D8L A;  4ZUI A;  1WCM B;  2H5X A;  1K8G A;  3EA6 A;  4DR3 Q;  3H09 A;  4JI6 Q;  1GKH A;  2HT1 A;  3OIP A;  1VQ5 A;  4DUY Q;  3KUP A;  2F0O A;  2GA4 B;  4E6I A;  5CBA E;  5KRU A;  1YJW A;  2OXP A;  1V1Q A;  1JR0 D;  1IW7 C;  3S1R H;  5HUR A;  2ZXO A;  3MAQ A;  1MSH A;  2RBM A;  1PRT D;  4HAE A;  3K0Y A;  5A35 A;  2YTV A;  3PO3 B;  2N3S A;  1JWM D;  1EQR A;  1J5E Q;  4NXM Q;  4LMQ D;  2NYZ D;  4K0K L;  2EIF A;  4PG3 A;  4BY1 G;  2ASB A;  3RMH A;  4DR2 Q;  1Y1V G;  1S40 A;  1FJG L;  2A6E C;  5M3M B;  2VQE Q;  4JI0 L;  1ZKO A;  1SMY D;  2V4D A;  4QGU A;  4ILW A;  4JI3 Q;  2QIL A;  3KF6 A;  4AYB B;  3F2U A;  3BZC A;  5I9P A;  2KED A;  5C4Z A;  5M5W H;  3E6Z X;  3DM1 A;  1IBK L;  2PMZ B;  1LT5 D;  3WDN A;  3G48 A;  5LMU Q;  2EVB A;  4JI4 Q;  2HQL A;  1XPU A;  4CDD C;  1AP0 A;  3TP6 A;  4X3S A;  1F9S A;  2L55 A;  2VW9 A;  1RKN A;  3F1Z A;  5T1I A;  1VQL A;  3P1H A;  1XJV A;  3GO5 A;  1TR5 A;  1PZK D;  2F0F A;  3SK5 A;  1MHW C;  2WAQ B;  1QG7 A;  1SYF A;  3S14 B;  2K6A A;  3TSS A;  5IYB G;  2Z6K A;  2MGS A;  2NBF A;  4LUV A;  5FJ8 G;  3ULJ A;  2ZXP A;  1PYS B;  3DLL A;  3Q0A A;  2UUB L;  2EY5 A;  2I0Q A;  1O80 A;  4U68 A;  2R7Z G;  4BBR H;  2L5T A;  2I07 B;  1TWH B;  3G6J B;  5ELF A;  2NVQ H;  1XXG A;  2UU9 L;  2MHV A;  3CCM A;  1O7L A;  5EJW A;  4A3L H;  3OMG A;  2F0Q A;  3GTM H;  3VYR A;  4TVA B;  3AEV A;  4LF6 L;  1L1O C;  4KY5 A;  3MHB A;  1VQG A;  2ES2 A;  1K9M C;  3L9A X;  1VQB A;  1EOV A;  2L12 A;  1KIX A;  1N32 Q;  1OXT A;  1RHP A;  2F4I A;  3OWE B;  4GNX B;  3HOX B;  3NQI A;  2A5H A;  4EX5 A;  4B08 A;  2RKS A;  3RN2 A;  1SSO A;  1KC8 C;  4O1N A;  2XSC A;  1EIY B;  4HR7 B;  2VL6 A;  4OIK A;  5H1S E;  2E74 C;  3GTK H;  1N33 Q;  4A76 A;  1VQK A;  2CCZ A;  4NB3 A;  2RHS B;  2NZ1 D;  3CCR A;  2R93 H;  3FPP A;  2R7F A;  3PO2 G;  2C5C A;  4LFB Q;  2NN6 I;  1I4P A;  4B3S Q;  3Q22 A;  1TT2 A;  2E2D C;  5CV7 A;  2A69 D;  2CH4 A;  1WCM H;  1B53 A;  3GTG B;  3HFZ B;  3K58 A;  2LXK A;  2XRS D;  3I8Z A;  4BBR B;  2VZA A;  2UUA L;  4GN3 B;  2ZTE A;  4FYD A;  1F2M A;  3VR2 A;  2F0D A;  1SYB A;  1T5E A;  1BBW A;  2JA5 H;  2HIX A;  4B9X A;  1XYI A;  3I73 A;  4H0L C;  2F0N A;  2A19 A;  2GVB A;  1GUN A;  3QB3 A;  2WAQ G;  4BY7 B;  1QUQ B;  2VQF Q;  2CW0 D;  5C6A A;  4IUT A;  2TMP A;  1SLJ A;  1X3Q A;  3J81 c;  4PZ7 A;  5GRO A;  1IYU A;  1SYD A;  2RQX A;  2Q8T A;  4DV6 Q;  1X3E A;  2YTY A;  2M2L A;  3SVM A;  3H6M A;  2OTL A;  1LT4 D;  4UAI A;  2E8G A;  2FJ2 A;  4A3B H;  1KAA A;  1EL0 A;  1UE5 A;  1VQ4 A;  2O5I C;  1V9P A;  4HCE A;  1SE3 A;  3CC7 A;  2HDL A;  5NUC A;  1TS4 A;  3SGI A;  4A4I A;  1VQN A;  2GVA A;  4KLK A;  1K73 C;  1M90 C;  1X56 A;  1HNZ Q;  4B3R L;  3J7Y W;  2SEB D;  1CUK A;  1MI2 A;  4IJL A;  1MGS A;  1SMX A;  3L3O C;  2H4O A;  1U5K A;  1CA6 A;  3UDF A;  1HJP A;  4JVZ A;  4LJZ C;  4KMU C;  4R4Q A;  3FKI B;  1RCV D;  3S2D B;  5EKL A;  2X69 A;  4PQX A;  1HHV A;  2B8G A;  1OXS C;  1J6Q A;  5JPM C;  5EQ0 A;  2EJG C;  1MKH A;  3S1M B;  3NEN A;  5IIF A;  2ICI A; 
#chains in the Genus database with same CATH homology
 2IT1 A;  3CP0 A;  3M9B A;  4WJ4 A;  2OQK A;  4GOP C;  2YV5 A;  4C3H H;  2EQS A;  1EIF A;  4KI0 A;  2WFW A;  2KCT A;  3CCV A;  4BBS G;  1OXU A;  3D31 A;  2KHI A;  5FLM H;  2UXB L;  2ATW A;  4DR2 L;  3BZK A;  4A93 G;  4HJ9 A;  3RZO H;  4A3B G;  2AMC B;  4H02 A;  3I4M G;  4JI0 Q;  1I50 H;  3FP9 A;  4JG2 A;  4APV A;  4LF8 Q;  3GTJ H;  2K50 A;  2N49 A;  3GDE A;  1Y14 B;  4P71 A;  1BKB A;  4OWX B;  1VQ8 A;  1E1T A;  3HOV G;  4OO1 I;  3S1M H;  4B3T L;  1XTD A;  2PI2 A;  4OON A;  1B8A A;  1Q12 A;  1XNQ L;  4ALP A;  3A5U A;  3ERS X;  1EUJ A;  1VQF A;  4HID A;  4A3M H;  3S17 H;  5IE8 A;  1WFQ A;  2I5H A;  4JI4 L;  5LMN L;  3PF5 A;  1PVO A;  4NPS A;  2Q2H A;  4A3I H;  2R92 G;  1PHJ A;  3AFQ A;  1YBY A;  1DGS A;  1QVC A;  4R4O A;  1NJI C;  4JI7 Q;  3GTL H;  4P74 A;  4DR3 L;  4JC0 A;  3NBH B;  2ZJP A;  1JJ2 A;  4P73 A;  3VDY A;  1SN8 A;  3KFU A;  4KHP Q;  3U58 A;  1YNX A;  3PGZ A;  1O7I A;  1X55 A;  1A8V A;  5IYD H;  4YHH Q;  2K14 A;  4HJA A;  4IPH A;  1SE8 A;  1PH4 A;  1PFS A;  1XPR A;  4HJ5 A;  2NZO A;  4X65 L;  3HKZ G;  2IHF A;  2XGT A;  1C7Y A;  3KDF A;  3PO2 H;  4OO1 G;  1XMO Q;  4LFA Q;  3J7A 5;  2R6G A;  1W2B A;  1WOC A;  4A3F H;  1EWI A;  2LXJ A;  3S1N H;  3AFP A;  4DV0 L;  1Q46 A;  1GVP A;  1JB7 A;  4IFD I;  2DGY A;  1AE3 A;  4A3K G;  3KJO A;  1N9W A;  2UUB Q;  4L5S A;  4X66 L;  5IT9 c;  4JYA Q;  1I94 L;  4IPD A;  4K0K Q;  1JE5 A;  1VQI A;  2RF4 A;  4DR7 L;  2Z0S A;  5IP9 G;  1TWG H;  4JOI C;  4POF A;  5JJI A;  3HOU G;  4P72 A;  1VQJ A;  4BBR G;  5C4J H;  5AJ3 L;  3LGJ A;  1X6O A;  3G4S A;  5DLQ E;  2VQE L;  1QZG A;  3S1Q H;  4GNX A;  3PSI A;  1Q8K A;  2WAQ E;  4LWC A;  5BR8 L;  4HJ7 A;  4ME3 A;  1KRS A;  5IWA Q;  4MZ9 A;  4AYB G;  4WJ3 M;  4YCU A;  1VQC A;  3HOZ G;  4DV1 L;  2AKW B;  1HNX L;  3CD6 A;  2CKZ B;  3DM3 A;  3K7U C;  4RMF A;  4R4I A;  1OTC A;  4JI8 L;  4IJH A;  3OTO L;  3T1H L;  1PA6 A;  3UE0 A;  2KBN A;  4GLX A;  4PMW A;  3H15 A;  2I5L X;  4GLA C;  4LUZ A;  2WB1 G;  4C2M H;  4DPG A;  1GM5 A;  3W1G A;  4YY3 L;  4JI1 Q;  2F4V Q;  4A3C H;  2PMZ E;  5EAY A;  5C4X G;  3W5O A;  2AWO A;  3CF5 A;  4GN4 B;  3M4Q A;  5JEA J;  1NMF A;  4RG1 A;  1RIP A;  1VQ9 A;  3HOX G;  4QY7 A;  1LTL A;  3KF6 B;  1Y1W H;  1N33 L;  2NVT H;  4GLV B;  1IZ6 A;  1NE3 A;  4DR1 L;  1CKN A;  1LM0 A;  1YHA A;  2OQ0 A;  4L5T A;  4LUO A;  4UPA A;  3HOY G;  4LF9 Q;  4LFB L;  1WJJ A;  1PH6 A;  1IBM L;  4DUZ Q;  3L7Z C;  3H3V H;  1VQD A;  2IX0 A;  4BXX H;  1UE1 A;  4AQY L;  3M4O H;  2K52 A;  3CQZ H;  1WYD A;  4LF5 Q;  4A3J G;  3M3Y H;  4R4C A;  4MTN A;  3J80 c;  4DNI A;  1NY4 A;  4DR5 Q;  1X9N A;  3PF4 A;  2UUA Q;  1FL0 A;  1Q1E A;  4X64 Q;  4YCV A;  1KRT A;  1YHB A;  1B7Y B;  4DV4 L;  3RNU A;  2JA6 G;  3PUX A;  1Y1V H;  2C35 B;  1X54 A;  2MFI A;  4IPC A;  1XMQ Q;  4Y52 H;  2Q2I A;  3TEH B;  5M3M G;  3CMA A;  3KYH C;  3UDX A;  4A75 A;  1PH5 A;  1XNR L;  2ALY B;  2YTX A;  3A5Z B;  3E9I A;  2K5N A;  1R9T H;  4JBM A;  2E2J H;  3U4Z A;  4LF6 Q;  1FGU A;  2JK8 A;  4GS3 A;  1M1K C;  4B3M L;  3TRE A;  2VQF L;  3JAM i;  1PH3 A;  3CC4 A;  1W3S A;  3K80 C;  3CCL A;  1UE7 A;  2CWA A;  2R7D A;  1YVC A;  4O0A A;  1UEB A;  4DV7 Q;  1I6H H;  5JJL A;  2RHQ B;  2A1A A;  2UXC Q;  1GO3 E;  5C3E H;  1VS0 A;  1AH9 A;  4LFC L;  4LF4 L;  4C3I H;  1L2F A;  1LUZ A;  1PH1 A;  1VQH A;  2Q2T A;  2MO0 A;  4A3G H;  5IWA L;  1UWV A;  4KHZ A;  1N8R C;  4Y7N H;  1VQ6 A;  4GKJ Q;  2B3G A;  2IY5 B;  1JJG A;  1OXX K;  4IPG A;  3KLW A;  3J81 i;  1HZ9 A;  2JEB I;  4A3E H;  1HNX Q;  1ASY A;  2D62 A;  4NXN Q;  4DV2 Q;  2R93 G;  3NEM A;  1PV4 A;  1IBL Q;  4A93 H;  4LW1 A;  1XNQ Q;  2NVY H;  1YI2 A;  4JCV E;  2XTI A;  3OTO Q;  3T1H Q;  1VQ7 A;  1TWC H;  3S2H H;  1Q82 C;  4X6A H;  3GTP H;  1J5E L;  3Q8D A;  1MJE A;  2NVX H;  1G6P A;  4JI1 L;  4HIM A;  5HY6 A;  3RN5 A;  1RL2 A;  2PI2 E;  3PUW A;  2HHH L;  5GAD C;  1QVG A;  4BA2 I;  3H0G G;  4JOI A;  3PIP A;  5C4X H;  3CPF A;  2Q2U A;  1PH2 A;  4JI5 Q;  1FJG Q;  3HOU H;  3HOW G;  4JV5 Q;  2K5H A;  4QJF A;  2ZM6 Q;  4YWM A;  4LF7 L;  3HOX H;  4A3G G;  1KAW A;  1E22 A;  1CSP A;  4DV5 L;  1EFW A;  2UXD L;  2EXD A;  2JQO A;  3A74 A;  4O2D A;  4HIK A;  1EYG A;  2E5L L;  4LF9 L;  4POG A;  3CCJ A;  2VUM G;  3HOV H;  3EIV A;  4OWT B;  4A3F G;  4IOA A;  3OYY A;  4AQY Q;  1B70 B;  1E3P A;  4IO9 A;  1HR0 W;  4L5R C;  5LMU L;  4EQ5 A;  2PQA B;  4DK6 C;  1X3G A;  4HJ8 A;  3T1Y L;  2JJQ A;  4DR5 L;  1TWF H;  4QIW E;  2PQA A;  2ZTD A;  3G6E A;  3G71 A;  4X64 L;  4BBS H;  2F3I A;  1IL2 A;  5J3B A;  4JBK A;  4BXX G;  5IYD G;  3S2D H;  1XMQ L;  3CAM A;  1PH9 A;  4LF8 L;  3H0G H;  5FLX c;  1A62 A;  5C0X G;  3ER0 A;  1SRU A;  3F2D A;  1K8A C;  1XNR Q;  5IYB H;  3CC2 A;  3WWV A;  1N34 Q;  3U4V A;  1YJN A;  4B3T Q;  1Q81 C;  3I7F A;  2N8N A;  4X62 Q;  1X65 A;  1XPO A;  2KHJ A;  2UUC L;  4PZ6 A;  2KCM A;  2PNH A;  4YWL A;  2D0P A;  3L0O A;  2CQO A;  3RLO A;  1VQM A;  4XIG S;  4MNO A;  1QUQ A;  1D8L A;  1G29 1;  5M3F H;  1SRO A;  1WI5 A;  2GN5 A;  1VQE A;  2LSS A;  3K7A H;  3RZD H;  3UDI A;  2H5X A;  1K8G A;  2UXC L;  4A3J H;  1N36 L;  4BY1 H;  4DR3 Q;  3J7Z C;  5GAH C;  4LF4 Q;  4LFC Q;  2VY3 A;  4JI6 Q;  3CW2 C;  3TRZ A;  1GKH A;  4BY7 H;  4GKK L;  2HT1 A;  2OWO A;  1KHI A;  4B3R Q;  4JBW A;  1VQ5 A;  1YZ6 A;  1YJ9 A;  3NEL A;  4DUY Q;  3MXN B;  4IOC A;  4OX9 Q;  3I4M H;  3MEF A;  4YHH L;  1K83 H;  5C3E G;  4AH6 A;  1YJW A;  1V1Q A;  4GKJ L;  1X3F A;  1C9O A;  1IYJ B;  1P8L A;  2UU9 Q;  2E2I H;  3CCU A;  3HOY H;  2OTJ A;  3S1R H;  3W1B A;  1JJC B;  2JE6 I;  1XMO L;  3B6Y A;  2OCE A;  4TQU S;  3PIO A;  2WB1 E;  5IYC H;  1A0I A;  4AIM A;  1Z9F A;  3CPW A;  2YTV A;  1I3Q H;  2BH8 A;  3J80 i;  2ZJR A;  2N3S A;  4JYA L;  1EQR A;  4A3I G;  2Y0S E;  1J5E Q;  5IP7 G;  4NXM Q;  3I2Z A;  3K8A A;  1OXV A;  2QEX A;  4DAY B;  4A3C G;  4K0K L;  2EIF A;  4PG3 A;  4BY1 G;  2ASB A;  1H95 A;  3PUZ A;  2NZH A;  4DR2 Q;  1Y1V G;  2N78 A;  4A3K H;  1VQP A;  1S40 A;  4JI5 L;  1NMG A;  1FJG L;  1VCI A;  1N32 L;  2ZJQ A;  4LNQ A;  2B63 H;  2JA6 H;  2VQE Q;  1E24 A;  3S15 H;  1AE2 A;  1YIT A;  2B29 A;  4JI0 L;  3M7N A;  3JC6 6;  1HNW Q;  5C44 H;  3I4O A;  2MO1 A;  4DV5 Q;  2ZTC A;  1L1O B;  4QGU A;  1S72 A;  2E5L Q;  4JI3 Q;  3S16 H;  1Z47 A;  3KF6 A;  4UP7 A;  4DV3 L;  3PUY A;  3BZC A;  5M5W H;  4C3J H;  5GAE C;  4BA1 I;  1E7Z A;  1K0R A;  3PUV A;  2D0O A;  1YIJ A;  3ULP A;  5IYC G;  1IBK L;  2K5V A;  3G48 A;  5LMU Q;  3T1Y Q;  3I4N H;  3E0E A;  2BH2 A;  4JI8 Q;  3U50 C;  4JI4 Q;  1YHQ A;  3CCQ A;  2HQL A;  1XPU A;  4QQB X;  5LMN Q;  2R92 H;  2ID0 A;  4B3S L;  4YWK A;  4YY3 Q;  2F4V L;  4DR6 L;  3CCE A;  3UE1 A;  5M3M H;  1BBU A;  3F8T A;  2VW9 A;  1HZA A;  2AWN A;  2B63 G;  3F1Z A;  2JA7 G;  4J15 A;  2KEN A;  1N34 L;  1VQL A;  3ICE A;  1TWH H;  4KHP L;  1XJV A;  3GO5 A;  1CSQ A;  2YYZ A;  4L5Q A;  4UY8 C;  2UUC Q;  2F52 A;  1C0A A;  3E9H A;  5IYB G;  2Z6K A;  4X65 Q;  2FXQ A;  5ELN A;  5FJ8 G;  4LUV A;  1IBM Q;  4DUZ L;  3ULJ A;  2IX1 A;  4UP9 A;  3CCS A;  1TXY A;  1PYS B;  3FHW A;  3DLL A;  3GD7 A;  1N36 Q;  5GQO A;  4OXP A;  1A63 A;  3KJP A;  3HKZ E;  1YEZ A;  3K81 C;  2UUB L;  4JI6 L;  5E7N A;  2I0Q A;  2R7Z H;  3M85 A;  4X66 Q;  5K36 G;  2R7Z G;  3JAM c;  4BBR H;  4DV4 Q;  4OX9 L;  2IHE A;  3J81 j;  1V43 A;  2Y0S G;  2K4K A;  4DV6 L;  2NVQ H;  2JA8 G;  2UU9 L;  4BY7 G;  4DR4 L;  3PV0 A;  3CCM A;  4DKA C;  2VUM H;  4A3E G;  4A3L H;  1PH7 A;  1Q86 C;  3GTM H;  1MIU A;  2JA9 A;  3OW2 A;  5ELO A;  4TVA B;  3K0X A;  3F2B A;  3AEV A;  4LF6 L;  5BR8 Q;  3BU2 A;  1L1O C;  3D0F A;  3EBE A;  4B3M Q;  4A3D G;  3HOZ H;  2QA4 A;  4A3D H;  2NN6 G;  4P75 A;  5GAG C;  4DV1 Q;  4DV7 L;  2ES2 A;  1VQG A;  4NXM L;  4JI2 Q;  3I55 A;  1K9M C;  3TQY A;  1HZB A;  3M4P A;  1VQB A;  4YCW A;  1K3R A;  1EOV A;  1U0L A;  5FLM G;  2CFM A;  3S14 H;  3CME A;  4R1J A;  1KIX A;  2K75 A;  1HNZ L;  1HR0 L;  4R4T A;  1OXT A;  1N32 Q;  1NTG A;  4GNX B;  5JEA G;  1T9H A;  2VS1 A;  4EX5 A;  3RN2 A;  1HNW L;  1KC8 C;  5IP9 H;  5IY0 A;  1EIY B;  2YU9 H;  4JI3 L;  2VL6 A;  4DV3 Q;  2MNA A;  5H1S E;  1QZH A;  3GTK H;  3GTQ H;  1N33 Q;  4NXN L;  4A76 A;  4DV2 L;  1IBK Q;  1SR3 A;  1VQK A;  2CCZ A;  4NB3 A;  2RHS B;  4PZ8 A;  3CCR A;  2A8V A;  3GTO H;  2R93 H;  4DR1 Q;  4A3M G;  1GD7 A;  2R7F A;  3PO2 G;  4LFB Q;  5M3F G;  2NN6 I;  3AYH B;  5HGQ A;  5IP7 H;  4B3S Q;  4JBJ A;  4DR6 Q;  2UXB Q;  2JA8 H;  4LF5 L;  1WCM H;  4UP8 A;  3AQQ A;  3HFZ B;  2HIV A;  2LXK A;  2RCN A;  3STB C;  4JV5 L;  3HOW H;  2VZA A;  5M5Y H;  2UUA L;  2ZM6 L;  2QGQ A;  4GN3 B;  1CKM A;  2ZTE A;  3RLF A;  2BA1 A;  4QL5 A;  1SFO H;  1E1O A;  1CKN B;  2WP8 J;  3GTG H;  1UE6 A;  2CWP A;  2JA5 G;  2UXD Q;  1HZC A;  1BBW A;  2JA5 H;  2HIX A;  4OWW B;  2BA0 A;  3RR5 A;  3PCO B;  1MJC A;  4HIO A;  1EQQ A;  2A19 A;  2GVB A;  1ASZ A;  1PH8 A;  1G51 A;  4IFD G;  2WAQ G;  1P16 A;  3STB D;  3KOJ A;  3UDG A;  3KDF B;  1QUQ B;  2VQF Q;  4AYB E;  1KQS A;  5FJ8 H;  1KXL A;  1SLJ A;  2DUD A;  1I5F A;  3PO3 G;  3J81 c;  3PO3 H;  3F2C A;  4PZ7 A;  5GRO A;  1CKO A;  4A3L G;  4FDB A;  1X3E A;  2YTY A;  4DV6 Q;  3CXC A;  2OTL A;  4JI7 L;  1S3O A;  4DAM A;  4DR4 Q;  2JA7 H;  1JMC A;  2E8G A;  2V1C C;  2L15 A;  1KL9 A;  3TS0 A;  1Q7Y C;  4A3B H;  1JT8 A;  5JJK A;  5M5X H;  1Q1B A;  3RLN A;  4X62 L;  3KF8 B;  4GNX C;  1UE5 A;  1Y1W G;  1VQ4 A;  1V9P A;  2Z6K C;  1L0W A;  1HH2 P;  3CC7 A;  4LFA L;  3SGI A;  2JEA I;  4GN5 A;  2MQH A;  3FKI G;  4A4I A;  4GOP B;  3EN2 A;  4JI2 L;  1VQN A;  2GVA A;  4KLK A;  1K73 C;  1WCM G;  4GOP A;  1M90 C;  2I5M X;  4DV0 Q;  3L2P A;  1IBL L;  1PYB A;  1FVI A;  1X56 A;  2VNU D;  1HNZ Q;  1HR0 Q;  4GKK Q;  4B3R L;  4DK3 C;  1CUK A;  1NBW A;  4IJL A;  1I94 Q;  3TS2 A;  1LYL A;  1SMX A;  5C0X I;  3I56 A;  1VQA A;  1U5K A;  5C44 G;  3UDF A;  5LMN W;  1HJP A;  1IXR A;  1VQO A;  2E2H H;  2HHH Q;  4DR7 Q;  4R4Q A;  3H3V I;  2AHO B;  4IFD J;  3S24 A;  1TWA H;  5AJ3 Q;  4LF7 Q;  3IRB A;  1OXS C;  1J6Q A;  3A0J A;  1D7Q A;  1QVF A;  1L1O A;  3FKI H;  1MKH A;  1BVS A;  4DUY L;  3I4N G;  3NEN A;  5C0X J;  3ULL A;  4XTC S;  1KD1 C;  3ZJY C;  3BJU A;  3HKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...