2E5SA

Solution structure of the zf-ccchx2 domain of muscleblind-like 2, isoform 1 [homo sapiens]
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
98
structure length
98
Chain Sequence
GSSGSSGSTATQKLLRTDKLEVCREFQRGNCARGETDCRFAHPADSTMIDTSDNTVTVCMDYIKGRCMREKCKYFHPPAHLQAKIKAAQHQANQAAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the RNA binding domain in the human muscleblind-like protein 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords OTTHUMP00000018578
total genus 8
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2006-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar)
A PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.840 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2e5sA00
2E5SA 3D2QA 3D2NA 3D2SA
chains in the Genus database with same CATH superfamily
2VJ4A 5KFJA 4I28A 4DL2A 2EQYA 1QSYA 5KT2A 5B66U 1N5WA 4R63A 5CJ7A 4FFDA 1S5LU 5ALLA 4UB1A 4QZCA 1CUKA 4UAVA 4KLTA 2I1QA 2HOFA 1Z1VA 2ZUCA 5KG4A 5DLGA 3SV4A 2P66A 2GLEA 1TAUA 5J2CA 3Q8LA 1B4FA 4JV1A 2V9WA 3IM1A 1X6JA 1DGSA 5ALWA 2HHQA 4DL6A 5KFQA 1UPHA 2KICA 4M9GA 3PSIA 5JTIA 2OYYA 3HILA 2IOHA 3F2DA 2YB4A 2HHTA 5KG6A 3OHAA 1NKCA 2HBJA 1X42A 2CRXA 3QX7A 4UB6U 3JPTA 1UT5A 4IR1A 2K8AA 3ZDAA 1EXNA 1XO0A 5ALSA 4YVZA 1XS9D 5J2IA 4NM2A 2G09A 8ICHA 3QNMA 1CI4A 3KTQA 4DSLA 3PZPA 4RQMA 3V7KA 4RQ3A 2VA3A 8ICUA 2LHTA 2BQ3A 3LWLA 1FFUA 3D2QA 4F92B 1X9SA 2KV2A 4DOAA 5ALOA 8ICGA 5KFIA 3MDAA 4UB8U 4RPYA 1UHUA 4TUPA 1NK9A 2QARB 1KLNA 4BJQA 1C20A 4ICAA 3MGVA 2BDUA 5C5JA 5L1MA 3SZ2A 1RDFA 1T4GA 3Q8MA 3GZFA 3HKZC 2LM4A 3NS1A 5L1LA 4Y2JA 4KLSA 1XSPA 4IQTA 3I28A 2ZXIA 4O5EA 1JALA 3IRUA 2BPFA 2KNJA 4ECRA 1ED1A 5ALJA 2W9CA 4GC7A 9ICUA 2E3TA 2FMSA 1PUZA 5KFEA 2AGPA 3WKBA 5AM2A 4ED7A 4RQNA 1RQNA 2A1JB 5ALMA 2DKXA 3MDCA 5J2KA 1L3TA 4QWAA 1NJYA 7ICIA 2XY7A 4PHPA 5T14A 2F3NA 2F2AB 2O6KA 3IHQB 7ICTA 3PX6A 3OJSA 9ICRA 1YZ7A 1Q46A 3SQIA 1JX4A 4NLBA 1RYRA 2I6XA 2YMPA 1ZJNA 3C2MA 1SIJA 2KKPA 2FLNA 2R8KA 3PX0A 2H3IA 1U45A 3WK4A 4B6JA 1D8BA 4NWIA 4P4OA 8ICBA 2FPLA 4ECYA 1A77A 2BQUA 2PI5A 2RQ5A 5J2BA 3KKAC 1ZQVA 5IIKA 1ZETA 3KHHA 4UASA 2MUTB 2YQEA 1QLNA 3EZ5A 2WB1F 4CF3A 2HBMA 3MR2A 7ICUA 2ZIUA 2WF7A 5EOZA 2XICA 1IV8A 2BCVA 1ZQLA 2ZJAA 2MRLA 7ICFA 8ICKA 3MFHA 2B21A 4G3IA 4NXZA 3FC4A 3KBBA 7ICOA 3C5GA 4RNMA 2HMXA 5J2FA 5HMMA 5AI6A 2WAQC 4DLGA 2W9CB 1L3VA 3PX4A 3KHGA 5ALKA 2FLLA 3BS7A 5AIBA 1SB3C 5L1KA 2NRZA 2NYVA 4JWMA 2MAXA 3CP8A 1DXSA 3G6XA 4QZDA 3C2LA 4I2BA 3BQTA 5KFMA 2G08A 3J81j 2XCPA 3QUCA 5ALNA 3KOOA 5D46A 1SWWA 3WK5A 5J29A 4EBDA 3N7PD 2RLTA 1Z19A 4YR3A 3ONNA 4P4MA 5GTIU 1TFRA 4UQGA 4KLQA 3IG5A 1J2MA 5JU5A 4RUAA 4EX7A 3T79A 4F50A 5KT5A 2WF6A 2C22A 4Q8FA 1HUZA 4KLHA 3T5HA 4J9NA 2F1IA 5HP4A 4YMMA 5DGAA 1TAMA 5KG5A 4XA5A 3H40A 3DEEA 1ZD4A 3D2NA 2CXYA 4JWNA 1GO3F 3EPGA 4IQWA 3RR7A 4QZEA 5J0PA 5DB7A 4RQ4A 2YX8A 4J9KA 3B0XA 2DQNB 2RHFA 3UXOA 1ZQAA 1KFTA 2PI4A 4RT2A 5BOMA 4F4WA 4LZGA 4O9MA 3SAHA 1X2IA 5KFXA 2HHXA 4QIWF 5JUMA 3GV7B 4EYIB 3PO4A 1L7OA 2KZ3A 4ECTA 3QUBA 1YT3A 4USAA 2DWQA 4O5CA 5KFOA 7ICPA 3WK6A 4RQ6A 3AM9A 2NO5A 4R8UB 4ED0A 1ZQPA 3C29A 4PL1A 1SXEA 4RQ0A 1XSLA 2G5HB 2H3VA 2HSZA 4QWEA 9ICGA 3MGHA 9ICMA 3C2KA 4EZ9A 5D4BA 3UXPA 2BCQA 2PMZF 2H3FA 8ICJA 2ZG6A 4QIWC 3JPPA 2D3DA 3M8RA 3H0MB 9ICHA 2KSOB 4QZGA 4FBUA 4K4HA 2NO4A 3OTQA 4F5NA 2H3ZA 1JN3A 2VJ5A 3RRHA 1IIPA 4X5VA 4QNLA 3L3FX 4I2EA 1OW5A 1RZTA 4DSKA 1UCVA 3AN1A 2EAMA 1KBUA 2IMWP 4YG2A 4UAWA 5AKYA 9ICEA 4PZOA 4NY8A 2AHOB 3UM9A 3M6KA 4UBBA 3IG8A 2F76X 3RBDA 2OEHA 3FAHA 5HR6A 2W8KA 3TKAA 2H3QA 5EWFA 1X9XA 2WFAA 3UMCA 5AI5A 2EZYA 2FPMA 3ZDDA 4Y2YA 2NRXA 2HHUA 4IRDA 4JK1A 3MBYA 4QWDA 2AJQA 5EE0A 1AROP 5ALZA 2IBKA 2F8LA 3C28A 4WJ3B 4R8UA 8ICFA 8ICLA 1JUDA 9ICSA 2JMGA 1N61A 1RXVA 3BS5A 4B9MA 4GXJA 3OSPA 2MU2A 1S0MA 4YQWA 4CF5A 4BWJA 3D2SA 1L7NA 3ICXA 3OPXA 1ZQFA 3RRGA 4U7CA 3GIJA 2OH2A 4M9NA 2K89A 4M47A 1NNLA 2IHNA 4NL9A 5KFBA 1BNOA 4NLKA 1BGXT 2JXJA 4P0QB 2XVTA 4B9TA 4F5QA 3F5AA 3RR8A 3ZDCA 4OD0A 1HJPA 1ZQ1C 2ZIXB 3EPIA 1SKWA 1QQ5A 4HAIA 4KLFA 2KK0A 4YN4A 4FZMA 1JXEA 1A76A 3F5EA 2HCFA 5KG0A 2V4RA 2V4QA 4O3PA 1SWVA 5DQHA 1MC8A 5AM5A 1K1QA 1Q3VA 3RB4A 5DB8A 2R8JA 2WHEA 3ISDA 1ZQUA 1A6SA 3Q8RB 2P35A 1NJZA 4YXJA 5ALFA 2ALZA 2W9BB 4OO1J 5L1IA 2G06A 4ECSA 2KTQA 1N60A 3OGUA 4KMUA 4CGZA 9ICPA 2YN4A 3H8JA 4OJ6A 2OXOA 5DBBA 4EEKA 2OCEA 1L5UA 4CCHA 3PSPA 1S10A 4RQ8A 2EANA 4I2HA 1UT8A 1BPEA 4I2IA 1C7YA 4IQVA 9ICTA 4UB5A 2DBYA 5C0YA 4LJXA 2W11A 4CF4A 4RT3A 4CNQA 1SKSA 4KTQA 4F4KA 8ICEA 1XSNA 3GIKA 3SEIA 3WKAA 4NJ8A 4Q45A 2KHQA 4RQ7A 4C8OA 2RDIA 3AL0B 5F3XB 5KL1B 4DEZA 1QTMA 3AEVA 1F5SA 1L7PA 1VJ5A 4C7YA 4QZHA 3OJUA 4MFCA 1ZQKA 5KG1A 2WB1C 2K60A 3EYZA 2XY5A 2A3VA 1LKYB 4P4PA 7ICHA 3OHBA 1ZXIA 3HT3A 3I76A 5IIOA 2JZBA 2K8BB 3I1YA 3SD7A 1L3SA 4DF8A 4RQ1A 1T8EA 4DOBA 4DFPA 1MQ3A 3BQ1A 2E8NA 2MA1A 3C23A 5J2HA 1JXLA 5KFYA 4QZFA 5DG9A 4ELVA 4R66A 1RG6A 3PY8A 2Z7JA 2PFQA 4QW8A 2IOFK 4EEYA 5DQGA 5IIMA 2JRZA 1K5OA 2JEGA 1N2XA 2NRTA 4F91B 3HRDD 4EZ6A 1JMSA 2E1EA 2FI1A 4UATA 1FEZA 3HX0A 7ICNA 2P6RA 3RBEA 1B0XA 3ZD9A 4B9NA 2LPEA 5HHIA 4M0AA 3D6JA 3K1RB 4GFJA 2A1JA 4I2JA 3NVWA 4FE3A 2AQ0A 3JPQA 2JH7A 2XCAA 4ACOA 3H0LB 2DUYA 5IINA 2FMPA 1S9FA 4JB3A 2ASDA 4OJOA 2LMRA 2C2EA 9ICBA 3BS5B 4Y2XA 5AM1A 1PVQA 2W3SA 3QU4A 1ZQTA 2UVRA 3GV5B 2K8CB 2RDJA 3UMBA 2M9NA 7ICSA 8ICAA 1ZQWA 1ZQBA 8ICOA 3RFAA 5AKJA 2WF9A 2K4IA 5IILA 1X9WA 1T3NA 3TACB 2EZZA 4RZRA 3S6JA 4LVSA 1ZQYA 3UQ2A 5KL8B 4P0PB 3UXNA 1ZQNA 5KFWA 9ICQA 1JI7A 4Y2QA 4XRHA 4RQ5A 1OUQA 4UAYA 4DWIA 1ZQEA 1CRXA 3KHRA 4K4IA 5AKXA 1CEZA 3E0FA 3QU7A 3LDAA 1SV4A 2WF5A 1X9MA 1BNPA 5HNKA 4UAZA 2KSOA 5ALDA 3QEAZ 5J0RA 5CRXA 2HVHA 2XIDA 3G6VA 3E58A 3E2EA 2YMLA 2DPIA 5KFTA 4ED6A 5KFDA 2JEIA 2A19A 3M9OB 2F44A 4OCZA 1PK3A 2BCRA 3L4PA 5KAIU 3QYPA 3RH4A 1COOA 4TUQA 5AKLA 2LYHA 2D8CA 4QW9A 1V38A 4ZOHC 3JPRA 3M9MB 5DDYA 2PFOA 4Y2VA 5AKGA 9ICKA 1DRGA 4OJ5A 5H2FU 3CNHA 1D8YA 3PMLA 4GC6A 4F2RA 3PW5A 2PKEA 1NK0A 2KJ5A 5DLFA 1TK8A 2FLPA 4DQIA 1N5XA 3NVVA 4DSEA 1TE2A 3KKAA 4NL9C 4F2SA 3VCBA 2W55A 1S77D 4ELUA 4J9MA 5KFGA 3MFIA 4ED1A 1LV5A 2KE7A 8ICYA 5ALVA 5ALHA 4O3OA 2H5XA 2KD1A 3AU6A 1SXDA 1BVSA 1N63A 1V85A 4KLOA 2KN7A 3TARA 2Y1JA 2KFZA 1ZQJA 3M7DA 4PZNA 5F9LA 3H4DA 2XGQA 4F3OA 4C8KA 2OHFA 4Q8EA 2XO7A 5AK6A 1T94A 2W9MA 3NTUA 3M6ZA 2JEFA 5ALUA 1TVAA 4UARA 1KDHA 5HHHA 2GH1A 2W03A 5AM4A 2E8OA 1IM4A 2WAQF 4IS7A 1NZPA 5L1JA 3AU2A 7ICKA 1P7DA 4QZAA 3QZ7A 5AI9A 1KQQA 2W04A 5AKKA 1QQ7A 4UB3A 1ZRNA 3M9NB 5D49A 3G6YA 8ICTA 3BQ2A 2EDUA 1TV9A 1SL2A 5CEHA 4YFKA 1MN8A 4DSJA 2JZBB 2NRWA 2P6UA 5J0OA 1BPXA 2BPGA 1HUOA 1NKEA 3NRZA 3ETRA 5J2EA 1QH9A 2KZZA 4MF8A 1WWUA 2DF4B 2F1JA 2GOLA 2D6FC 1KRPA 3FM9A 4DO9A 4IRCA 1ZYQA 4DLEA 4RU9A 4ELTA 3QUQA 2AH5A 4R64A 1NI3A 2FMQA 3KFUF 5HR7A 3ISBA 2ZJ8A 3RB6A 3N97B 4O3NA 2K4PA 4FO6A 3ED5A 4CE6A 2ASLA 2JV3A 4QZIA 4IQUA 2W43A 9ICJA 4O0IA 8ICXA 5K4LA 2LYAA 2BHNA 1YZ6A 3F2CA 4UAUA 2JGAA 2ESEA 2C2DA 3T5KA 3V6JA 1KW4A 1ZD5A 4Y2UA 4EYHB 4RQ2A 3BZCA 9ICVA 3RJKA 4FS1A 2ISPA 4QZ9A 4FS2A 4OJPA 1KKXA 8ICZA 2R8GA 3TFRA 2ES6A 8ICNA 2VA8A 3B9JA 2HHSA 4F4ZA 5J0YA 4JMUA 2C2RA 2Y1IA 4GXIA 3RH5A 2M0NA 3PW0A 2HDOA 5GTHU 4Z6DA 2PMZC 1U49A 1XNSA 3BDPA 4TURA 3L5KA 4KLUA 1Y88A 2DKZA 4MHVA 3GFKB 2ZIUB 3SYZA 4YD1A 2AXTU 5ALPA 5KTQA 1RQLA 3T5JA 3GQCA 5AI0A 3AQFA 3V72A 3M1YA 3SMVA 2CN1A 4AP9A 1ZD3A 1X66A 2MUTA 3QU5A 3PVXA 5J0TA 3EWAA 3SENA 4DF4A 1D9FA 3BQ7A 2F8KA 4M9LA 1KFDA 2ZIWA 4LZDA 5KFKA 2IHMA 3SAFA 2Y9UA 3SR6A 2PXIA 3V6KA 3JPOA 2K4EA 2YY6A 3NVYA 3QUTA 5A0LA 1Z3EB 2HBLA 2W9AA 1SV0C 4UB4A 2W7OA 2LM1A 3SAGA 5AHXA 9ICCA 4PHEA 5DKWA 1RPLA 3AUOA 3PR4A 5AIAA 5KT3A 4UW9A 1L8LA 5G5GA 4QWBA 1A0PA 4DFDA 2KKVA 4GIBA 4M9JA 2QB1A 4KLGA 1KFSA 3UPQA 3V7LA 4YP3A 1XC9A 2Q4TA 5TISU 2R18A 3ZDBA 5AI8A 2BCSA 2XI9A 4RUCA 2LI6A 3C21A 3JPSA 3EUB2 3IV6A 4BDPA 9ICFA 4ECWA 2Q0ZX 4EELA 1TAQA 3HP6A 2JH1A 3PW4A 1D8LA 4DL5A 3N4MB 5DGBA 2G5IB 5AKHA 2WF8A 4M2YA 2UVVA 4MF2A 9ICIA 3JPNA 3GILA 2KVSA 2EAOA 4PGQA 4M6WB 3CW2C 4EBCA 4OJLA 5DB6A 3MC1A 2QARA 1UQVA 3Q8KA 3DV9A 1J97A 4NLCA 1S0NA 3GDXA 3IN5A 3TQ1A 2ASJA 2ISOA 3KHLA 1PZNA 2UVUA 3T5LA 5BPCA 4EBEA 1TK5A 4NLGA 2Y9TA 2B0CA 7ICJA 5EE1A 1BPDA 1BPBA 3Q8PB 4K4GA 3V7JA 1WG8A 3PO5A 1MSWD 4XQ8A 4DL4A 3WK7A 1LB2B 4EX6A 1ECWA 2GWSA 5AK3A 4IRKA 5J2GA 3HJEA 3OSNA 5IIJA 4A8EA 2BR0A 4PH5A 1NOMA 8ICQA 2AGQA 5AK4A 3WKEA 3ZD8A 5J2JA 4QJFB 5AKIA 2ZIVB 3LK9A 1NK8A 2E8MA 5KT4A 2W54A 1KEJA 4Y2SA 2C28A 3UMGA 5AK5A 4U6PA 9ICLA 2AGOA 4F71A 2K4HA 5EWEA 4P0PA 5J0WA 3THVA 4JV2A 1ZQQA 4IL6U 3RH6A 5KFPA 1J2NA 2JHDA 4C8MA 2KJ9A 5AKEA 5ALXA 5J0SA 3RJGA 5KFZA 5DQIA 2ZUDA 4DL7A 1WUDA 5J2AA 2G07A 2HOIA 1ZQXA 3O0FA 3VC8A 5DB9A 3PMNA 5KFUA 1ZJMA 1X40A 2I9GA 3HPOA 1KL9A 4AYBC 3RTVA 5CB1A 5ALYA 2PFPA 4FZLA 2ATLA 1DK2A 5DG8A 3HW8A 2KG5A 1XO1A 1NK7A 1F0MA 1B22A 3K1ZA 2QB0A 4KLIA 4KX5A 2DL0A 8ICCA 2KHVA 1QCKA 2XY6A 4M9HA 1Z00B 4F72A 2YMQA 4MEYA 4Q44A 4US8A 1RXWA 4F93B 4ED8A 4F5PA 5F9NA 4EENA 1UA0A 4YCXA 1URJA 4ZH4A 3QU9A 3Q8SB 4PHAA 3B0YA 4C4TA 1NJWA 1BPYA 1PK1B 4J9PA 2I5HA 2XC9A 3LVVA 2KOBA 2IOFA 2HW3A 3PNCA 4B9UA 1ZOLA 3TADC 4PPXA 5DBCA 1JRPA 2FDRA 5CA7A 4PHDA 5AI4A 3NASA 3H8SA 3K75D 3KZIU 5KFHA 4C4SA 5B5EU 4RNNA 2JEJA 3RJHA 1Z1BA 3TAPA 2NV3A 5KFFA 1WYGA 3RJEA 2HVIA 1ZD2P 1FFVA 1VLBA 1NK5A 7ICGA 1KSPA 2FJ6A 4UB2A 3TADA 1XWLA 1QSLA 4J9OA 4MFFA 1B43A 1SZPA 5TZVA 4FZNA 2ZTCA 4PGXA 4US9A 8ICSA 2L5YA 2W9BA 4KN4A 2EAPA 2E5SA 7ICRA 5KFRA 4DCCA 1MA7A 3LWMA 4DSFA 3KZXA 5ALTA 5E79U 3UQ0A 2W3RA 4TQRA 4NLZA 2UVWA 3TI0A 1DOQA 2HHVA 1PK1A 4JV0A 4J9LA 3T3FA 1UA1A 1AQ6A 5J0XA 1U9LA 5J8YA 3ISCA 4KLMA 1JROA 3PSFA 5DDMA 3PR5B 1ZQRA 5EE9A 1F44A 2NRVA 3RJJA 4DOCA 2BKEA 2ZIXA 3SV3A 4O3RA 3GU3A 4ECVA 4MEXA 4DS5A 4F4YA 3A0HU 4HYKA 2F1HA 9ICXA 4R65A 4QZ8A 4I27A 3WKCA 4P0QA 3Q8QB 1L6NA 4J9RA 3C1YA 5KAFU 4GXKA 2QB0B 2KZMA 4F8RA 2Y0SC 1SV0A 2VIXA 1Q3UA 1V9PA 4KLEA 3ZDEA 5ALEA 1U47A 2WTFA 4ECZA 4PGYA 1O03A 2N1RA 4DL3A 1ZQMA 2YTUA 3PV8A 3PW2A 5CP2A 1L3UA 5EWGA 4DQRA 1RYUA 4YD2A 3RF9A 1Z4OA 8ICMA 1DK3A 3NGDA 1KN5A 1IG6A 4JUZA 4F4XA 3RAQA 2Y0SF 3SI8A 1TKDA 7ICEA 3QEBZ 1Q8KA 4CRXA 2ZIVA 3GV8B 2F77X 3MR5A 4YMNA 4DQQA 1K1SA 4NV0A 4MFAA 4C0ZA 4C8LA 4F5RA 3WKDA 3H7IA 3ETLA 3V6HA 1QSSA 2LYBA 8ICWA 4O3SA 5KFLA 3H8MA 4RNOA 3M8SA 3AQEA 1Z4NA 4BX9C 2YMMA 2VA2A 3RJFA 1RYSA 2KIVA 4ECQA 4F5OA 4G9BA 7ICMA 1ZQDA 9ICOA 5ALGA 1ZQZA 5ALRA 4I2CA 4TQSA 4DFMA 4C7ZA 3EW9A 2OWOA 2E1FA 3DDHA 1FO4A 3ALRA 8ICVA 4QZBA 5KFNA 2ODGA 2BGWA 1S8OA 3U26A 4Z6EA 2J6UA 4E0DA 3RB3A 1JIHA 4M6WA 8ICRA 5AICA 4C4RA 2ZXHA 1T7PA 3HWTA 5ALQA 2RP5A 4DFKA 4J9QA 2AQ4A 3TANA 2DPJA 3NUQA 4FBTA 5KT6A 4DFJA 9ICAA 1V97A 1S76D 3BJYA 3QXGA 1QQ6A 4KX3A 2CPRA 4YR2A 1NZBA 4B9SA 4QWCA 3ORYA 4I2FA 4BWMA 1MQ2A 2LKYA 3F2BA 7ICVA 2HI0A 3GIMA 3QE9Y 1S0OA 7ICLA 4BUGA 4KN7A 1ZQSA 1IXRA 4ECXA 7ICQA 5KG3A 2MSNA 4DQPA 3PW7A 3R9KA 4J03A 4PJ0U 4DS4A 3N7RC 1ZQGA 1ZQCA 4I2AA 4BXOA 2VANA 4Y2PA 5ALIA 4ED3A 2HOQA 2YB1A 1X6IA 4O5KA 5KG2A 3CYMA 5KFSA 1ZQOA 1HIWA 4XUSA 4IC9A 9ICWA 1COKA 4PL2A 1PVRA 1L7MA 2ZTDA 4IR9A 2R8HA 5CWRA 2J6TA 2W7PA 3NRWA 2ZIWB 1LKYA 2IA6A 3N28A 2HHWA 1ZRMA 4C80A 2KVCA 3LVWA 2E8PA 1N48A 1L8OA 2G0AA 4KITB 1NK6A 4NLNA 4Y2RA 2AU0A 1OXJA 1HEKA 1H38A 2W8LA 5KFVA 5EE3A 4ED2A 3WU2U 4B9LA 8ICIA 3IDWA 1BPZA 3BQ0A 4I29A 3C1ZA 2LBOA 2RRDA 2VKQA 4CDGA 1S97A 2KEYA 2GO7A 5HMLA 2ZUBA 4Z6FA 3PSTA 5KG7A 2B6GA 3H0RB 2R8IA 5JRTA 3F53A 5G5HA 5J0QA 2QKQA 3FDSA 1SGGA 5FP0A 1N56A 4TUSA 5IIIA 3ZI4A 1ZQIA 1NJXA 3QZ8A 3TAQA 1PVPA 2KIWA 4O3QA 5J2DA 1DGJA 1S0VA 5KNIA 4Z6CA 2BPCA 3BZKA 4YMOA 1SKRA 2EZXA 3A0BU 4I2DA 3MGIA 9ICNA 3MABA 5J8YC 4RPZA 2BCUA 4Y2TA 3HKZF 4RPXA 5L9XA 2BDPA 2A1AA 1LVHA 3N7SC 1FIQA 3CRXA 3WK8A 3MR3A 1WCNA 1D9DA 4O3MA 3MR6A 1KTQA 2ZTEA 1ZQHA 3RB0A 1SZHA 5DBAA 2ZJ5A 1N62A 1WWVA 4DQSA 1SL1A 1Z00A 2KJ8A 1M6YA 1U4BA 2PFNA 2OM6A 5DG7A 1RM6C 1SL0A 4Q43A 1TK0A 5CHGA 2KMDA 1T3QA 1WCLA 2HBKA 5AKZA 4BGDA 4KLDA 4B9VA 8ICPA 3NVZA 1U48A 3C5FA 1VDVA 3H4BA 3RJIA 2EH9A 2QLTA 4AYBF 2J6SA 4NM1A 2FE9A 5BOLA 4I2GA 3AMZA 2FPKA 3QU2A 4J9SA 4KLLA 2DFLA 1NKBA 2BQRA 1NK4A 4YR0A 5AM0A 2XGPA 2JR5A 4P2HA 4KMOB 5CR0A 2DGZA 1O08A 4M04A 3FYHA 5J0UA 4UBCA 3GIIA 3RAXA 2KP7A 3IP4B 2KFNA 4YXMA 5KT7A 5AM3A 4BXOB 3KD3A 3TFSA 4ECUA 4KLJA 4C8NA 2BZFA 5KFAA 3LYSA 3H8WA 1XU4A 3WK9A 4GLXA 4DSIA 3K4GA 5KFCA
chains in the Genus database with same CATH topology
2VJ4A 5CRXA 2XIDA 4CGZA 3DEEA 4AYBC 2LYBA 3D2NA 2HOQA 2YB1A 1XNSA 4OJ6A 2OXOA 4FZLA 1GO3F 3PSPA 4GFJA 2YX8A 2ZIUB 3HKZF 4BJQA 3CYMA 2E1EA 2WB1F 2DQNB 2RHFA 2HBMA 4OJLA 3PSFA 4ICAA 2BDUA 1HIWA 3MGVA 3AQEA 2ZIUA 3N7SC 2F8LA 4FE3A 4BX9C 2HOFA 3CRXA 2XICA 3K1ZA 4IC9A 3AQFA 3C28A 4WJ3B 3GZFA 3HKZC 4O3MA 5C0YA 2JH7A 2MRLA 4NLCA 3SMVA 2CN1A 4KX5A 1F44A 4ACOA 4PL2A 3IN5A 2KHVA 1PVRA 2JMGA 2ZIXA 2ZXIA 3SAHA 3GU3A 1SZHA 2DF4B 4QIWF 2GOLA 3H0LB 3NRWA 2ZIWB 2W7PA 2D6FC 3D2SA 2KNJA 3ICXA 3OPXA 1DRGA 2KHQA 2ZIWA 4OJ5A 3AL0B 4U7CA 4P0QA 1ED1A 5KL1B 3SAFA 1L6NA 1URJA 2KJ8A 4OJOA 2KVCA 3LVWA 2E1FA 1YT3A 2HMXA 2G0AA 2KJ5A 2OM6A 2OH2A 3KFUF 2K4EA 1UPHA 3ALRA 1PVQA 2K89A 2KICA 3PSIA 1HEKA 3C29A 5HR7A 5A0LA 2K8CB 2WAQC 2Y0SC 2HBLA 2OYYA 4PL1A 2HBKA 2VIXA 1Q3UA 3VCBA 2WB1C 3LVVA 2KOBA 4P0QB 2W7OA 2XVTA 2G5HB 2H3VA 2YB4A 1ECWA 3SAGA 3F2DA 3RFAA 2A3VA 4AYBF 3F5AA 2K4IA 2KD1A 5HR6A 2ZXHA 2N1RA 4A8EA 2RP5A 2PMZF 1ZQ1C 2H3FA 2ZIXB 5T14A 2F2AB 2ZG6A 2LBOA 2HBJA 2RRDA 2VKQA 4CDGA 3CP8A 3NUQA 2KEYA 2LYAA 4QIWC 2CRXA 4QJFB 3F2CA 5KL8B 1Z1BA 4P0PB 2K8BB 2ZIVB 2JGAA 4FZMA 3RF9A 3H0MB 4KX3A 1A0PA 2NV3A 3M7DA 2CPRA 2G08A 3SQIA 2KKVA 1NZBA 2K8AA 3F5EA 4NLBA 1XO0A 2Y0SF 3PSTA 1T94A 4KMOB 2DGZA 3N7PD 2LKYA 2Q4TA 3M6ZA 2H3ZA 3ONNA 2R18A 4U6PA 3F2BA 2VJ5A 1Z19A 1Q3VA 1IIPA 3H0RB 2K4HA 2G09A 2XI9A 2MA1A 3IG5A 3F53A 4P0PA 2GH1A 2KKPA 2W03A 4OJPA 4QNLA 1OUQA 3IP4B 3L3FX 3PZPA 4CRXA 2ZIVA 4BUGA 1CRXA 1KBUA 1A6SA 2WAQF 2H3IA 2JHDA 4FZNA 2F77X 3T79A 2Z7JA 2LHTA 3E0FA 2KJ9A 1D8BA 4JMUA 4NWIA 1WUDA 3LYSA 1P7DA 3D2QA 2G07A 3M6KA 2E5SA 2JH1A 3IG8A 1PVPA 3N7RC 4NV0A 2F76X 1MA7A 2KV2A 2HOIA 2M0NA 2KIWA 4C0ZA 4OO1J 2G06A 2W04A 3O0FA 1TAMA 3VC8A 3KZXA 2G5IB 2PMZC 2H3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5S A;  3D2Q A;  3D2N A;  3D2S A; 
#chains in the Genus database with same CATH topology
 2VJ4 A;  5KFJ A;  4I28 A;  4DL2 A;  2EQY A;  1QSY A;  5KT2 A;  5B66 U;  1N5W A;  4R63 A;  5CJ7 A;  4FFD A;  1S5L U;  5ALL A;  4UB1 A;  4QZC A;  1CUK A;  4UAV A;  4KLT A;  2I1Q A;  2HOF A;  1Z1V A;  2ZUC A;  5KG4 A;  5DLG A;  3SV4 A;  2P66 A;  2GLE A;  1TAU A;  5J2C A;  3Q8L A;  1B4F A;  4JV1 A;  2V9W A;  3IM1 A;  1X6J A;  1DGS A;  5ALW A;  2HHQ A;  4DL6 A;  5KFQ A;  1UPH A;  2KIC A;  4M9G A;  3PSI A;  5JTI A;  2OYY A;  3HIL A;  2IOH A;  3F2D A;  2YB4 A;  2HHT A;  5KG6 A;  3OHA A;  1NKC A;  2HBJ A;  1X42 A;  2CRX A;  3QX7 A;  4UB6 U;  3JPT A;  1UT5 A;  4IR1 A;  2K8A A;  3ZDA A;  1EXN A;  1XO0 A;  5ALS A;  4YVZ A;  1XS9 D;  5J2I A;  4NM2 A;  2G09 A;  8ICH A;  3QNM A;  1CI4 A;  3KTQ A;  4DSL A;  3PZP A;  4RQM A;  3V7K A;  4RQ3 A;  2VA3 A;  8ICU A;  2LHT A;  2BQ3 A;  3LWL A;  1FFU A;  3D2Q A;  4F92 B;  1X9S A;  2KV2 A;  4DOA A;  5ALO A;  8ICG A;  5KFI A;  3MDA A;  4UB8 U;  4RPY A;  1UHU A;  4TUP A;  1NK9 A;  2QAR B;  1KLN A;  4BJQ A;  1C20 A;  4ICA A;  3MGV A;  2BDU A;  5C5J A;  5L1M A;  3SZ2 A;  1RDF A;  1T4G A;  3Q8M A;  3GZF A;  3HKZ C;  2LM4 A;  3NS1 A;  5L1L A;  4Y2J A;  4KLS A;  1XSP A;  4IQT A;  3I28 A;  2ZXI A;  4O5E A;  1JAL A;  3IRU A;  2BPF A;  2KNJ A;  4ECR A;  1ED1 A;  5ALJ A;  2W9C A;  4GC7 A;  9ICU A;  2E3T A;  2FMS A;  1PUZ A;  5KFE A;  2AGP A;  3WKB A;  5AM2 A;  4ED7 A;  4RQN A;  1RQN A;  2A1J B;  5ALM A;  2DKX A;  3MDC A;  5J2K A;  1L3T A;  4QWA A;  1NJY A;  7ICI A;  2XY7 A;  4PHP A;  5T14 A;  2F3N A;  2F2A B;  2O6K A;  3IHQ B;  7ICT A;  3PX6 A;  3OJS A;  9ICR A;  1YZ7 A;  1Q46 A;  3SQI A;  1JX4 A;  4NLB A;  1RYR A;  2I6X A;  2YMP A;  1ZJN A;  3C2M A;  1SIJ A;  2KKP A;  2FLN A;  2R8K A;  3PX0 A;  2H3I A;  1U45 A;  3WK4 A;  4B6J A;  1D8B A;  4NWI A;  4P4O A;  8ICB A;  2FPL A;  4ECY A;  1A77 A;  2BQU A;  2PI5 A;  2RQ5 A;  5J2B A;  3KKA C;  1ZQV A;  5IIK A;  1ZET A;  3KHH A;  4UAS A;  2MUT B;  2YQE A;  1QLN A;  3EZ5 A;  2WB1 F;  4CF3 A;  2HBM A;  3MR2 A;  7ICU A;  2ZIU A;  2WF7 A;  5EOZ A;  2XIC A;  1IV8 A;  2BCV A;  1ZQL A;  2ZJA A;  2MRL A;  7ICF A;  8ICK A;  3MFH A;  2B21 A;  4G3I A;  4NXZ A;  3FC4 A;  3KBB A;  7ICO A;  3C5G A;  4RNM A;  2HMX A;  5J2F A;  5HMM A;  5AI6 A;  2WAQ C;  4DLG A;  2W9C B;  1L3V A;  3PX4 A;  3KHG A;  5ALK A;  2FLL A;  3BS7 A;  5AIB A;  1SB3 C;  5L1K A;  2NRZ A;  2NYV A;  4JWM A;  2MAX A;  3CP8 A;  1DXS A;  3G6X A;  4QZD A;  3C2L A;  4I2B A;  3BQT A;  5KFM A;  2G08 A;  3J81 j;  2XCP A;  3QUC A;  5ALN A;  3KOO A;  5D46 A;  1SWW A;  3WK5 A;  5J29 A;  4EBD A;  3N7P D;  2RLT A;  1Z19 A;  4YR3 A;  3ONN A;  4P4M A;  5GTI U;  1TFR A;  4UQG A;  4KLQ A;  3IG5 A;  1J2M A;  5JU5 A;  4RUA A;  4EX7 A;  3T79 A;  4F50 A;  5KT5 A;  2WF6 A;  2C22 A;  4Q8F A;  1HUZ A;  4KLH A;  3T5H A;  4J9N A;  2F1I A;  5HP4 A;  4YMM A;  5DGA A;  1TAM A;  5KG5 A;  4XA5 A;  3H40 A;  3DEE A;  1ZD4 A;  3D2N A;  2CXY A;  4JWN A;  1GO3 F;  3EPG A;  4IQW A;  3RR7 A;  4QZE A;  5J0P A;  5DB7 A;  4RQ4 A;  2YX8 A;  4J9K A;  3B0X A;  2DQN B;  2RHF A;  3UXO A;  1ZQA A;  1KFT A;  2PI4 A;  4RT2 A;  5BOM A;  4F4W A;  4LZG A;  4O9M A;  3SAH A;  1X2I A;  5KFX A;  2HHX A;  4QIW F;  5JUM A;  3GV7 B;  4EYI B;  3PO4 A;  1L7O A;  2KZ3 A;  4ECT A;  3QUB A;  1YT3 A;  4USA A;  2DWQ A;  4O5C A;  5KFO A;  7ICP A;  3WK6 A;  4RQ6 A;  3AM9 A;  2NO5 A;  4R8U B;  4ED0 A;  1ZQP A;  3C29 A;  4PL1 A;  1SXE A;  4RQ0 A;  1XSL A;  2G5H B;  2H3V A;  2HSZ A;  4QWE A;  9ICG A;  3MGH A;  9ICM A;  3C2K A;  4EZ9 A;  5D4B A;  3UXP A;  2BCQ A;  2PMZ F;  2H3F A;  8ICJ A;  2ZG6 A;  4QIW C;  3JPP A;  2D3D A;  3M8R A;  3H0M B;  9ICH A;  2KSO B;  4QZG A;  4FBU A;  4K4H A;  2NO4 A;  3OTQ A;  4F5N A;  2H3Z A;  1JN3 A;  2VJ5 A;  3RRH A;  1IIP A;  4X5V A;  4QNL A;  3L3F X;  4I2E A;  1OW5 A;  1RZT A;  4DSK A;  1UCV A;  3AN1 A;  2EAM A;  1KBU A;  2IMW P;  4YG2 A;  4UAW A;  5AKY A;  9ICE A;  4PZO A;  4NY8 A;  2AHO B;  3UM9 A;  3M6K A;  4UBB A;  3IG8 A;  2F76 X;  3RBD A;  2OEH A;  3FAH A;  5HR6 A;  2W8K A;  3TKA A;  2H3Q A;  5EWF A;  1X9X A;  2WFA A;  3UMC A;  5AI5 A;  2EZY A;  2FPM A;  3ZDD A;  4Y2Y A;  2NRX A;  2HHU A;  4IRD A;  4JK1 A;  3MBY A;  4QWD A;  2AJQ A;  5EE0 A;  1ARO P;  5ALZ A;  2IBK A;  2F8L A;  3C28 A;  4WJ3 B;  4R8U A;  8ICF A;  8ICL A;  1JUD A;  9ICS A;  2JMG A;  1N61 A;  1RXV A;  3BS5 A;  4B9M A;  4GXJ A;  3OSP A;  2MU2 A;  1S0M A;  4YQW A;  4CF5 A;  4BWJ A;  3D2S A;  1L7N A;  3ICX A;  3OPX A;  1ZQF A;  3RRG A;  4U7C A;  3GIJ A;  2OH2 A;  4M9N A;  2K89 A;  4M47 A;  1NNL A;  2IHN A;  4NL9 A;  5KFB A;  1BNO A;  4NLK A;  1BGX T;  2JXJ A;  4P0Q B;  2XVT A;  4B9T A;  4F5Q A;  3F5A A;  3RR8 A;  3ZDC A;  4OD0 A;  1HJP A;  1ZQ1 C;  2ZIX B;  3EPI A;  1SKW A;  1QQ5 A;  4HAI A;  4KLF A;  2KK0 A;  4YN4 A;  4FZM A;  1JXE A;  1A76 A;  3F5E A;  2HCF A;  5KG0 A;  2V4R A;  2V4Q A;  4O3P A;  1SWV A;  5DQH A;  1MC8 A;  5AM5 A;  1K1Q A;  1Q3V A;  3RB4 A;  5DB8 A;  2R8J A;  2WHE A;  3ISD A;  1ZQU A;  1A6S A;  3Q8R B;  2P35 A;  1NJZ A;  4YXJ A;  5ALF A;  2ALZ A;  2W9B B;  4OO1 J;  5L1I A;  2G06 A;  4ECS A;  2KTQ A;  1N60 A;  3OGU A;  4KMU A;  4CGZ A;  9ICP A;  2YN4 A;  3H8J A;  4OJ6 A;  2OXO A;  5DBB A;  4EEK A;  2OCE A;  1L5U A;  4CCH A;  3PSP A;  1S10 A;  4RQ8 A;  2EAN A;  4I2H A;  1UT8 A;  1BPE A;  4I2I A;  1C7Y A;  4IQV A;  9ICT A;  4UB5 A;  2DBY A;  5C0Y A;  4LJX A;  2W11 A;  4CF4 A;  4RT3 A;  4CNQ A;  1SKS A;  4KTQ A;  4F4K A;  8ICE A;  1XSN A;  3GIK A;  3SEI A;  3WKA A;  4NJ8 A;  4Q45 A;  2KHQ A;  4RQ7 A;  4C8O A;  2RDI A;  3AL0 B;  5F3X B;  5KL1 B;  4DEZ A;  1QTM A;  3AEV A;  1F5S A;  1L7P A;  1VJ5 A;  4C7Y A;  4QZH A;  3OJU A;  4MFC A;  1ZQK A;  5KG1 A;  2WB1 C;  2K60 A;  3EYZ A;  2XY5 A;  2A3V A;  1LKY B;  4P4P A;  7ICH A;  3OHB A;  1ZXI A;  3HT3 A;  3I76 A;  5IIO A;  2JZB A;  2K8B B;  3I1Y A;  3SD7 A;  1L3S A;  4DF8 A;  4RQ1 A;  1T8E A;  4DOB A;  4DFP A;  1MQ3 A;  3BQ1 A;  2E8N A;  2MA1 A;  3C23 A;  5J2H A;  1JXL A;  5KFY A;  4QZF A;  5DG9 A;  4ELV A;  4R66 A;  1RG6 A;  3PY8 A;  2Z7J A;  2PFQ A;  4QW8 A;  2IOF K;  4EEY A;  5DQG A;  5IIM A;  2JRZ A;  1K5O A;  2JEG A;  1N2X A;  2NRT A;  4F91 B;  3HRD D;  4EZ6 A;  1JMS A;  2E1E A;  2FI1 A;  4UAT A;  1FEZ A;  3HX0 A;  7ICN A;  2P6R A;  3RBE A;  1B0X A;  3ZD9 A;  4B9N A;  2LPE A;  5HHI A;  4M0A A;  3D6J A;  3K1R B;  4GFJ A;  2A1J A;  4I2J A;  3NVW A;  4FE3 A;  2AQ0 A;  3JPQ A;  2JH7 A;  2XCA A;  4ACO A;  3H0L B;  2DUY A;  5IIN A;  2FMP A;  1S9F A;  4JB3 A;  2ASD A;  4OJO A;  2LMR A;  2C2E A;  9ICB A;  3BS5 B;  4Y2X A;  5AM1 A;  1PVQ A;  2W3S A;  3QU4 A;  1ZQT A;  2UVR A;  3GV5 B;  2K8C B;  2RDJ A;  3UMB A;  2M9N A;  7ICS A;  8ICA A;  1ZQW A;  1ZQB A;  8ICO A;  3RFA A;  5AKJ A;  2WF9 A;  2K4I A;  5IIL A;  1X9W A;  1T3N A;  3TAC B;  2EZZ A;  4RZR A;  3S6J A;  4LVS A;  1ZQY A;  3UQ2 A;  5KL8 B;  4P0P B;  3UXN A;  1ZQN A;  5KFW A;  9ICQ A;  1JI7 A;  4Y2Q A;  4XRH A;  4RQ5 A;  1OUQ A;  4UAY A;  4DWI A;  1ZQE A;  1CRX A;  3KHR A;  4K4I A;  5AKX A;  1CEZ A;  3E0F A;  3QU7 A;  3LDA A;  1SV4 A;  2WF5 A;  1X9M A;  1BNP A;  5HNK A;  4UAZ A;  2KSO A;  5ALD A;  3QEA Z;  5J0R A;  5CRX A;  2HVH A;  2XID A;  3G6V A;  3E58 A;  3E2E A;  2YML A;  2DPI A;  5KFT A;  4ED6 A;  5KFD A;  2JEI A;  2A19 A;  3M9O B;  2F44 A;  4OCZ A;  1PK3 A;  2BCR A;  3L4P A;  5KAI U;  3QYP A;  3RH4 A;  1COO A;  4TUQ A;  5AKL A;  2LYH A;  2D8C A;  4QW9 A;  1V38 A;  4ZOH C;  3JPR A;  3M9M B;  5DDY A;  2PFO A;  4Y2V A;  5AKG A;  9ICK A;  1DRG A;  4OJ5 A;  5H2F U;  3CNH A;  1D8Y A;  3PML A;  4GC6 A;  4F2R A;  3PW5 A;  2PKE A;  1NK0 A;  2KJ5 A;  5DLF A;  1TK8 A;  2FLP A;  4DQI A;  1N5X A;  3NVV A;  4DSE A;  1TE2 A;  3KKA A;  4NL9 C;  4F2S A;  3VCB A;  2W55 A;  1S77 D;  4ELU A;  4J9M A;  5KFG A;  3MFI A;  4ED1 A;  1LV5 A;  2KE7 A;  8ICY A;  5ALV A;  5ALH A;  4O3O A;  2H5X A;  2KD1 A;  3AU6 A;  1SXD A;  1BVS A;  1N63 A;  1V85 A;  4KLO A;  2KN7 A;  3TAR A;  2Y1J A;  2KFZ A;  1ZQJ A;  3M7D A;  4PZN A;  5F9L A;  3H4D A;  2XGQ A;  4F3O A;  4C8K A;  2OHF A;  4Q8E A;  2XO7 A;  5AK6 A;  1T94 A;  2W9M A;  3NTU A;  3M6Z A;  2JEF A;  5ALU A;  1TVA A;  4UAR A;  1KDH A;  5HHH A;  2GH1 A;  2W03 A;  5AM4 A;  2E8O A;  1IM4 A;  2WAQ F;  4IS7 A;  1NZP A;  5L1J A;  3AU2 A;  7ICK A;  1P7D A;  4QZA A;  3QZ7 A;  5AI9 A;  1KQQ A;  2W04 A;  5AKK A;  1QQ7 A;  4UB3 A;  1ZRN A;  3M9N B;  5D49 A;  3G6Y A;  8ICT A;  3BQ2 A;  2EDU A;  1TV9 A;  1SL2 A;  5CEH A;  4YFK A;  1MN8 A;  4DSJ A;  2JZB B;  2NRW A;  2P6U A;  5J0O A;  1BPX A;  2BPG A;  1HUO A;  1NKE A;  3NRZ A;  3ETR A;  5J2E A;  1QH9 A;  2KZZ A;  4MF8 A;  1WWU A;  2DF4 B;  2F1J A;  2GOL A;  2D6F C;  1KRP A;  3FM9 A;  4DO9 A;  4IRC A;  1ZYQ A;  4DLE A;  4RU9 A;  4ELT A;  3QUQ A;  2AH5 A;  4R64 A;  1NI3 A;  2FMQ A;  3KFU F;  5HR7 A;  3ISB A;  2ZJ8 A;  3RB6 A;  3N97 B;  4O3N A;  2K4P A;  4FO6 A;  3ED5 A;  4CE6 A;  2ASL A;  2JV3 A;  4QZI A;  4IQU A;  2W43 A;  9ICJ A;  4O0I A;  8ICX A;  5K4L A;  2LYA A;  2BHN A;  1YZ6 A;  3F2C A;  4UAU A;  2JGA A;  2ESE A;  2C2D A;  3T5K A;  3V6J A;  1KW4 A;  1ZD5 A;  4Y2U A;  4EYH B;  4RQ2 A;  3BZC A;  9ICV A;  3RJK A;  4FS1 A;  2ISP A;  4QZ9 A;  4FS2 A;  4OJP A;  1KKX A;  8ICZ A;  2R8G A;  3TFR A;  2ES6 A;  8ICN A;  2VA8 A;  3B9J A;  2HHS A;  4F4Z A;  5J0Y A;  4JMU A;  2C2R A;  2Y1I A;  4GXI A;  3RH5 A;  2M0N A;  3PW0 A;  2HDO A;  5GTH U;  4Z6D A;  2PMZ C;  1U49 A;  1XNS A;  3BDP A;  4TUR A;  3L5K A;  4KLU A;  1Y88 A;  2DKZ A;  4MHV A;  3GFK B;  2ZIU B;  3SYZ A;  4YD1 A;  2AXT U;  5ALP A;  5KTQ A;  1RQL A;  3T5J A;  3GQC A;  5AI0 A;  3AQF A;  3V72 A;  3M1Y A;  3SMV A;  2CN1 A;  4AP9 A;  1ZD3 A;  1X66 A;  2MUT A;  3QU5 A;  3PVX A;  5J0T A;  3EWA A;  3SEN A;  4DF4 A;  1D9F A;  3BQ7 A;  2F8K A;  4M9L A;  1KFD A;  2ZIW A;  4LZD A;  5KFK A;  2IHM A;  3SAF A;  2Y9U A;  3SR6 A;  2PXI A;  3V6K A;  3JPO A;  2K4E A;  2YY6 A;  3NVY A;  3QUT A;  5A0L A;  1Z3E B;  2HBL A;  2W9A A;  1SV0 C;  4UB4 A;  2W7O A;  2LM1 A;  3SAG A;  5AHX A;  9ICC A;  4PHE A;  5DKW A;  1RPL A;  3AUO A;  3PR4 A;  5AIA A;  5KT3 A;  4UW9 A;  1L8L A;  5G5G A;  4QWB A;  1A0P A;  4DFD A;  2KKV A;  4GIB A;  4M9J A;  2QB1 A;  4KLG A;  1KFS A;  3UPQ A;  3V7L A;  4YP3 A;  1XC9 A;  2Q4T A;  5TIS U;  2R18 A;  3ZDB A;  5AI8 A;  2BCS A;  2XI9 A;  4RUC A;  2LI6 A;  3C21 A;  3JPS A;  3EUB 2;  3IV6 A;  4BDP A;  9ICF A;  4ECW A;  2Q0Z X;  4EEL A;  1TAQ A;  3HP6 A;  2JH1 A;  3PW4 A;  1D8L A;  4DL5 A;  3N4M B;  5DGB A;  2G5I B;  5AKH A;  2WF8 A;  4M2Y A;  2UVV A;  4MF2 A;  9ICI A;  3JPN A;  3GIL A;  2KVS A;  2EAO A;  4PGQ A;  4M6W B;  3CW2 C;  4EBC A;  4OJL A;  5DB6 A;  3MC1 A;  2QAR A;  1UQV A;  3Q8K A;  3DV9 A;  1J97 A;  4NLC A;  1S0N A;  3GDX A;  3IN5 A;  3TQ1 A;  2ASJ A;  2ISO A;  3KHL A;  1PZN A;  2UVU A;  3T5L A;  5BPC A;  4EBE A;  1TK5 A;  4NLG A;  2Y9T A;  2B0C A;  7ICJ A;  5EE1 A;  1BPD A;  1BPB A;  3Q8P B;  4K4G A;  3V7J A;  1WG8 A;  3PO5 A;  1MSW D;  4XQ8 A;  4DL4 A;  3WK7 A;  1LB2 B;  4EX6 A;  1ECW A;  2GWS A;  5AK3 A;  4IRK A;  5J2G A;  3HJE A;  3OSN A;  5IIJ A;  4A8E A;  2BR0 A;  4PH5 A;  1NOM A;  8ICQ A;  2AGQ A;  5AK4 A;  3WKE A;  3ZD8 A;  5J2J A;  4QJF B;  5AKI A;  2ZIV B;  3LK9 A;  1NK8 A;  2E8M A;  5KT4 A;  2W54 A;  1KEJ A;  4Y2S A;  2C28 A;  3UMG A;  5AK5 A;  4U6P A;  9ICL A;  2AGO A;  4F71 A;  2K4H A;  5EWE A;  4P0P A;  5J0W A;  3THV A;  4JV2 A;  1ZQQ A;  4IL6 U;  3RH6 A;  5KFP A;  1J2N A;  2JHD A;  4C8M A;  2KJ9 A;  5AKE A;  5ALX A;  5J0S A;  3RJG A;  5KFZ A;  5DQI A;  2ZUD A;  4DL7 A;  1WUD A;  5J2A A;  2G07 A;  2HOI A;  1ZQX A;  3O0F A;  3VC8 A;  5DB9 A;  3PMN A;  5KFU A;  1ZJM A;  1X40 A;  2I9G A;  3HPO A;  1KL9 A;  4AYB C;  3RTV A;  5CB1 A;  5ALY A;  2PFP A;  4FZL A;  2ATL A;  1DK2 A;  5DG8 A;  3HW8 A;  2KG5 A;  1XO1 A;  1NK7 A;  1F0M A;  1B22 A;  3K1Z A;  2QB0 A;  4KLI A;  4KX5 A;  2DL0 A;  8ICC A;  2KHV A;  1QCK A;  2XY6 A;  4M9H A;  1Z00 B;  4F72 A;  2YMQ A;  4MEY A;  4Q44 A;  4US8 A;  1RXW A;  4F93 B;  4ED8 A;  4F5P A;  5F9N A;  4EEN A;  1UA0 A;  4YCX A;  1URJ A;  4ZH4 A;  3QU9 A;  3Q8S B;  4PHA A;  3B0Y A;  4C4T A;  1NJW A;  1BPY A;  1PK1 B;  4J9P A;  2I5H A;  2XC9 A;  3LVV A;  2KOB A;  2IOF A;  2HW3 A;  3PNC A;  4B9U A;  1ZOL A;  3TAD C;  4PPX A;  5DBC A;  1JRP A;  2FDR A;  5CA7 A;  4PHD A;  5AI4 A;  3NAS A;  3H8S A;  3K75 D;  3KZI U;  5KFH A;  4C4S A;  5B5E U;  4RNN A;  2JEJ A;  3RJH A;  1Z1B A;  3TAP A;  2NV3 A;  5KFF A;  1WYG A;  3RJE A;  2HVI A;  1ZD2 P;  1FFV A;  1VLB A;  1NK5 A;  7ICG A;  1KSP A;  2FJ6 A;  4UB2 A;  3TAD A;  1XWL A;  1QSL A;  4J9O A;  4MFF A;  1B43 A;  1SZP A;  5TZV A;  4FZN A;  2ZTC A;  4PGX A;  4US9 A;  8ICS A;  2L5Y A;  2W9B A;  4KN4 A;  2EAP A;  2E5S A;  7ICR A;  5KFR A;  4DCC A;  1MA7 A;  3LWM A;  4DSF A;  3KZX A;  5ALT A;  5E79 U;  3UQ0 A;  2W3R A;  4TQR A;  4NLZ A;  2UVW A;  3TI0 A;  1DOQ A;  2HHV A;  1PK1 A;  4JV0 A;  4J9L A;  3T3F A;  1UA1 A;  1AQ6 A;  5J0X A;  1U9L A;  5J8Y A;  3ISC A;  4KLM A;  1JRO A;  3PSF A;  5DDM A;  3PR5 B;  1ZQR A;  5EE9 A;  1F44 A;  2NRV A;  3RJJ A;  4DOC A;  2BKE A;  2ZIX A;  3SV3 A;  4O3R A;  3GU3 A;  4ECV A;  4MEX A;  4DS5 A;  4F4Y A;  3A0H U;  4HYK A;  2F1H A;  9ICX A;  4R65 A;  4QZ8 A;  4I27 A;  3WKC A;  4P0Q A;  3Q8Q B;  1L6N A;  4J9R A;  3C1Y A;  5KAF U;  4GXK A;  2QB0 B;  2KZM A;  4F8R A;  2Y0S C;  1SV0 A;  2VIX A;  1Q3U A;  1V9P A;  4KLE A;  3ZDE A;  5ALE A;  1U47 A;  2WTF A;  4ECZ A;  4PGY A;  1O03 A;  2N1R A;  4DL3 A;  1ZQM A;  2YTU A;  3PV8 A;  3PW2 A;  5CP2 A;  1L3U A;  5EWG A;  4DQR A;  1RYU A;  4YD2 A;  3RF9 A;  1Z4O A;  8ICM A;  1DK3 A;  3NGD A;  1KN5 A;  1IG6 A;  4JUZ A;  4F4X A;  3RAQ A;  2Y0S F;  3SI8 A;  1TKD A;  7ICE A;  3QEB Z;  1Q8K A;  4CRX A;  2ZIV A;  3GV8 B;  2F77 X;  3MR5 A;  4YMN A;  4DQQ A;  1K1S A;  4NV0 A;  4MFA A;  4C0Z A;  4C8L A;  4F5R A;  3WKD A;  3H7I A;  3ETL A;  3V6H A;  1QSS A;  2LYB A;  8ICW A;  4O3S A;  5KFL A;  3H8M A;  4RNO A;  3M8S A;  3AQE A;  1Z4N A;  4BX9 C;  2YMM A;  2VA2 A;  3RJF A;  1RYS A;  2KIV A;  4ECQ A;  4F5O A;  4G9B A;  7ICM A;  1ZQD A;  9ICO A;  5ALG A;  1ZQZ A;  5ALR A;  4I2C A;  4TQS A;  4DFM A;  4C7Z A;  3EW9 A;  2OWO A;  2E1F A;  3DDH A;  1FO4 A;  3ALR A;  8ICV A;  4QZB A;  5KFN A;  2ODG A;  2BGW A;  1S8O A;  3U26 A;  4Z6E A;  2J6U A;  4E0D A;  3RB3 A;  1JIH A;  4M6W A;  8ICR A;  5AIC A;  4C4R A;  2ZXH A;  1T7P A;  3HWT A;  5ALQ A;  2RP5 A;  4DFK A;  4J9Q A;  2AQ4 A;  3TAN A;  2DPJ A;  3NUQ A;  4FBT A;  5KT6 A;  4DFJ A;  9ICA A;  1V97 A;  1S76 D;  3BJY A;  3QXG A;  1QQ6 A;  4KX3 A;  2CPR A;  4YR2 A;  1NZB A;  4B9S A;  4QWC A;  3ORY A;  4I2F A;  4BWM A;  1MQ2 A;  2LKY A;  3F2B A;  7ICV A;  2HI0 A;  3GIM A;  3QE9 Y;  1S0O A;  7ICL A;  4BUG A;  4KN7 A;  1ZQS A;  1IXR A;  4ECX A;  7ICQ A;  5KG3 A;  2MSN A;  4DQP A;  3PW7 A;  3R9K A;  4J03 A;  4PJ0 U;  4DS4 A;  3N7R C;  1ZQG A;  1ZQC A;  4I2A A;  4BXO A;  2VAN A;  4Y2P A;  5ALI A;  4ED3 A;  2HOQ A;  2YB1 A;  1X6I A;  4O5K A;  5KG2 A;  3CYM A;  5KFS A;  1ZQO A;  1HIW A;  4XUS A;  4IC9 A;  9ICW A;  1COK A;  4PL2 A;  1PVR A;  1L7M A;  2ZTD A;  4IR9 A;  2R8H A;  5CWR A;  2J6T A;  2W7P A;  3NRW A;  2ZIW B;  1LKY A;  2IA6 A;  3N28 A;  2HHW A;  1ZRM A;  4C80 A;  2KVC A;  3LVW A;  2E8P A;  1N48 A;  1L8O A;  2G0A A;  4KIT B;  1NK6 A;  4NLN A;  4Y2R A;  2AU0 A;  1OXJ A;  1HEK A;  1H38 A;  2W8L A;  5KFV A;  5EE3 A;  4ED2 A;  3WU2 U;  4B9L A;  8ICI A;  3IDW A;  1BPZ A;  3BQ0 A;  4I29 A;  3C1Z A;  2LBO A;  2RRD A;  2VKQ A;  4CDG A;  1S97 A;  2KEY A;  2GO7 A;  5HML A;  2ZUB A;  4Z6F A;  3PST A;  5KG7 A;  2B6G A;  3H0R B;  2R8I A;  5JRT A;  3F53 A;  5G5H A;  5J0Q A;  2QKQ A;  3FDS A;  1SGG A;  5FP0 A;  1N56 A;  4TUS A;  5III A;  3ZI4 A;  1ZQI A;  1NJX A;  3QZ8 A;  3TAQ A;  1PVP A;  2KIW A;  4O3Q A;  5J2D A;  1DGJ A;  1S0V A;  5KNI A;  4Z6C A;  2BPC A;  3BZK A;  4YMO A;  1SKR A;  2EZX A;  3A0B U;  4I2D A;  3MGI A;  9ICN A;  3MAB A;  5J8Y C;  4RPZ A;  2BCU A;  4Y2T A;  3HKZ F;  4RPX A;  5L9X A;  2BDP A;  2A1A A;  1LVH A;  3N7S C;  1FIQ A;  3CRX A;  3WK8 A;  3MR3 A;  1WCN A;  1D9D A;  4O3M A;  3MR6 A;  1KTQ A;  2ZTE A;  1ZQH A;  3RB0 A;  1SZH A;  5DBA A;  2ZJ5 A;  1N62 A;  1WWV A;  4DQS A;  1SL1 A;  1Z00 A;  2KJ8 A;  1M6Y A;  1U4B A;  2PFN A;  2OM6 A;  5DG7 A;  1RM6 C;  1SL0 A;  4Q43 A;  1TK0 A;  5CHG A;  2KMD A;  1T3Q A;  1WCL A;  2HBK A;  5AKZ A;  4BGD A;  4KLD A;  4B9V A;  8ICP A;  3NVZ A;  1U48 A;  3C5F A;  1VDV A;  3H4B A;  3RJI A;  2EH9 A;  2QLT A;  4AYB F;  2J6S A;  4NM1 A;  2FE9 A;  5BOL A;  4I2G A;  3AMZ A;  2FPK A;  3QU2 A;  4J9S A;  4KLL A;  2DFL A;  1NKB A;  2BQR A;  1NK4 A;  4YR0 A;  5AM0 A;  2XGP A;  2JR5 A;  4P2H A;  4KMO B;  5CR0 A;  2DGZ A;  1O08 A;  4M04 A;  3FYH A;  5J0U A;  4UBC A;  3GII A;  3RAX A;  2KP7 A;  3IP4 B;  2KFN A;  4YXM A;  5KT7 A;  5AM3 A;  4BXO B;  3KD3 A;  3TFS A;  4ECU A;  4KLJ A;  4C8N A;  2BZF A;  5KFA A;  3LYS A;  3H8W A;  1XU4 A;  3WK9 A;  4GLX A;  4DSI A;  3K4G A;  5KFC A; 
#chains in the Genus database with same CATH homology
 2VJ4 A;  5CRX A;  2XID A;  4CGZ A;  3DEE A;  4AYB C;  2LYB A;  3D2N A;  2HOQ A;  2YB1 A;  1XNS A;  4OJ6 A;  2OXO A;  4FZL A;  1GO3 F;  3PSP A;  4GFJ A;  2YX8 A;  2ZIU B;  3HKZ F;  4BJQ A;  3CYM A;  2E1E A;  2WB1 F;  2DQN B;  2RHF A;  2HBM A;  4OJL A;  3PSF A;  4ICA A;  2BDU A;  1HIW A;  3MGV A;  3AQE A;  2ZIU A;  3N7S C;  2F8L A;  4FE3 A;  4BX9 C;  2HOF A;  3CRX A;  2XIC A;  3K1Z A;  4IC9 A;  3AQF A;  3C28 A;  4WJ3 B;  3GZF A;  3HKZ C;  4O3M A;  5C0Y A;  2JH7 A;  2MRL A;  4NLC A;  3SMV A;  2CN1 A;  4KX5 A;  1F44 A;  4ACO A;  4PL2 A;  3IN5 A;  2KHV A;  1PVR A;  2JMG A;  2ZIX A;  2ZXI A;  3SAH A;  3GU3 A;  1SZH A;  2DF4 B;  4QIW F;  2GOL A;  3H0L B;  3NRW A;  2ZIW B;  2W7P A;  2D6F C;  3D2S A;  2KNJ A;  3ICX A;  3OPX A;  1DRG A;  2KHQ A;  2ZIW A;  4OJ5 A;  3AL0 B;  4U7C A;  4P0Q A;  1ED1 A;  5KL1 B;  3SAF A;  1L6N A;  1URJ A;  2KJ8 A;  4OJO A;  2KVC A;  3LVW A;  2E1F A;  1YT3 A;  2HMX A;  2G0A A;  2KJ5 A;  2OM6 A;  2OH2 A;  3KFU F;  2K4E A;  1UPH A;  3ALR A;  1PVQ A;  2K89 A;  2KIC A;  3PSI A;  1HEK A;  3C29 A;  5HR7 A;  5A0L A;  2K8C B;  2WAQ C;  2Y0S C;  2HBL A;  2OYY A;  4PL1 A;  2HBK A;  2VIX A;  1Q3U A;  3VCB A;  2WB1 C;  3LVV A;  2KOB A;  4P0Q B;  2W7O A;  2XVT A;  2G5H B;  2H3V A;  2YB4 A;  1ECW A;  3SAG A;  3F2D A;  3RFA A;  2A3V A;  4AYB F;  3F5A A;  2K4I A;  2KD1 A;  5HR6 A;  2ZXH A;  2N1R A;  4A8E A;  2RP5 A;  2PMZ F;  1ZQ1 C;  2H3F A;  2ZIX B;  5T14 A;  2F2A B;  2ZG6 A;  2LBO A;  2HBJ A;  2RRD A;  2VKQ A;  4CDG A;  3CP8 A;  3NUQ A;  2KEY A;  2LYA A;  4QIW C;  2CRX A;  4QJF B;  3F2C A;  5KL8 B;  1Z1B A;  4P0P B;  2K8B B;  2ZIV B;  2JGA A;  4FZM A;  3RF9 A;  3H0M B;  4KX3 A;  1A0P A;  2NV3 A;  3M7D A;  2CPR A;  2G08 A;  3SQI A;  2KKV A;  1NZB A;  2K8A A;  3F5E A;  4NLB A;  1XO0 A;  2Y0S F;  3PST A;  1T94 A;  4KMO B;  2DGZ A;  3N7P D;  2LKY A;  2Q4T A;  3M6Z A;  2H3Z A;  3ONN A;  2R18 A;  4U6P A;  3F2B A;  2VJ5 A;  1Z19 A;  1Q3V A;  1IIP A;  3H0R B;  2K4H A;  2G09 A;  2XI9 A;  2MA1 A;  3IG5 A;  3F53 A;  4P0P A;  2GH1 A;  2KKP A;  2W03 A;  4OJP A;  4QNL A;  1OUQ A;  3IP4 B;  3L3F X;  3PZP A;  4CRX A;  2ZIV A;  4BUG A;  1CRX A;  1KBU A;  1A6S A;  2WAQ F;  2H3I A;  2JHD A;  4FZN A;  2F77 X;  3T79 A;  2Z7J A;  2LHT A;  3E0F A;  2KJ9 A;  1D8B A;  4JMU A;  4NWI A;  1WUD A;  3LYS A;  1P7D A;  3D2Q A;  2G07 A;  3M6K A;  2E5S A;  2JH1 A;  3IG8 A;  1PVP A;  3N7R C;  4NV0 A;  2F76 X;  1MA7 A;  2KV2 A;  2HOI A;  2M0N A;  2KIW A;  4C0Z A;  4OO1 J;  2G06 A;  2W04 A;  3O0F A;  1TAM A;  3VC8 A;  3KZX A;  2G5I B;  2PMZ C;  2H3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...