2E5SA

Solution structure of the zf-ccchx2 domain of muscleblind-like 2, isoform 1 [homo sapiens]
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
98
structure length
98
Chain Sequence
GSSGSSGSTATQKLLRTDKLEVCREFQRGNCARGETDCRFAHPADSTMIDTSDNTVTVCMDYIKGRCMREKCKYFHPPAHLQAKIKAAQHQANQAAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the RNA binding domain in the human muscleblind-like protein 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords OTTHUMP00000018578
total genus 8
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2006-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar)
A PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.840 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2e5sA00
2E5SA 3D2SA 3D2QA 3D2NA
chains in the Genus database with same CATH superfamily
3RF9A 3A0HU 8ICFA 4HAIA 4ED7A 1QSSA 2ZIUB 1SZPA 4FZNA 2DQNB 1X42A 4PHAA 3O0FA 2KZ3A 2OWOA 1A0PA 3HJEA 4YXMA 3T5JA 2V4RA 1UA0A 5AK3A 8ICZA 4KMUA 5KFSA 5KFXA 5DGBA 4QWBA 3MDAA 1COOA 2FLLA 2HBJA 3QU9A 4IRKA 3LWLA 2CRXA 1QCKA 4YXJA 3THVA 4C0ZA 2KNJA 9ICCA 1KW4A 1NK4A 2GWSA 2K8BB 5CRXA 2KFNA 2EQYA 4UAUA 4OJPA 3KKAC 4FZLA 2AGQA 5GTHU 5GTIU 2E5SA 4M9HA 4PPXA 1D9DA 4ICAA 4UB4A 3PY8A 3AL0B 2DL0A 4NXZA 2VA2A 3CP8A 2WTFA 1N5WA 1XWLA 2LKYA 5IIKA 3PW4A 2KD1A 4XRHA 1ZRMA 3PX0A 3PW0A 1A77A 2F1JA 9ICOA 3QUCA 3C21A 2H3VA 2XI9A 3VC8A 2KKVA 1KQQA 4MF2A 3OTQA 4LVSA 1NK8A 2OEHA 3C5GA 1HUZA 1URJA 2H3FA 2A1JA 4C80A 4O5EA 3KZIU 5CA7A 2FMSA 3OJUA 5EWEA 4B9TA 3QUTA 1MSWD 5JTIA 4F93B 2G06A 3ETRA 3MR2A 2W3RA 1X6JA 2A1AA 1B43A 4UASA 5J0OA 3AM9A 3HT3A 4IRCA 3Q8LA 4Y2PA 2FPKA 4JV0A 4QIWF 4DL6A 3PMLA 1SXDA 3RB0A 4UARA 1N56A 4F8RA 3M9MB 3SEIA 5J0SA 2HCFA 5AKGA 4DSFA 3KHHA 2YB1A 1DK3A 3BS7A 3C1ZA 4MFAA 1B22A 3MBYA 3SQIA 4YMMA 3PX6A 2W54A 4R66A 4Q8EA 2IOFA 4HYKA 2E8NA 4PGYA 5EE9A 5ALZA 4QZDA 1O08A 1CEZA 2AHOB 3NRZA 1TFRA 3B9JA 1L3VA 8ICBA 3EZ5A 4BGDA 1ZQDA 4QIWC 1LV5A 5J2CA 4NLZA 2AXTU 2OCEA 3N97B 3H8JA 5AI5A 5KFAA 4CF5A 4IQTA 2XVTA 3DV9A 2NRXA 1L7PA 3F2DA 1Z19A 2HHQA 3RB4A 3WK9A 5EWGA 4ECSA 3M7DA 3BDPA 1ECWA 4ECWA 5JUMA 3T5KA 2LHTA 3CW2C 4I2AA 2MRLA 5ALQA 3UMGA 3UMBA 1KSPA 2F2AB 9ICWA 2FE9A 2DKXA 2JV3A 1F44A 2QB1A 2BCRA 4CF4A 1S0VA 4M47A 5CB1A 3D2NA 3RR7A 9ICTA 3NGDA 2A1JB 4FO6A 4DL7A 5KAIU 4LZGA 4O3MA 3NVZA 2WF5A 2KN7A 1CUKA 5L1KA 1X9SA 2J6SA 1ZD2P 1IV8A 4F91B 4O9MA 3FYHA 4ED3A 2VKQA 1NKCA 2YMLA 1SL0A 1XSLA 4JB3A 1ZQCA 4RT2A 4GLXA 3FM9A 5ALMA 2UVRA 3C2MA 9ICKA 7ICQA 1U48A 3UXPA 3GIMA 3GIIA 2W43A 4QWAA 3SYZA 2H3IA 4O3RA 1L6NA 1QQ6A 4RZRA 4FS1A 4B9NA 3MGVA 4MF8A 1ZETA 4J9SA 2BDPA 8ICMA 4RQ1A 3Q8SB 5J8YA 2HVHA 5ALYA 3GDXA 8ICPA 3NS1A 4DF8A 2DKZA 4RT3A 3ED5A 1IM4A 4BWJA 4CCHA 3TFSA 2ALZA 9ICUA 5FP0A 2XCPA 2EDUA 3GV5B 2W11A 5IINA 2LYBA 1ZQLA 3NASA 7ICPA 1T4GA 7ICEA 4B9SA 3H0MB 2C2EA 4PZNA 1D8BA 1S76D 5ALJA 5IIMA 1PK1B 2HBLA 1D8LA 1SWVA 4G9BA 5HNKA 4ZH4A 1K1SA 4OCZA 4EBEA 4F2RA 3A0BU 4Z6FA 4DQPA 3BJYA 9ICLA 1ZQOA 4IQVA 2BCSA 2YQEA 2GLEA 2QARB 3Q8RB 1X2IA 4NLNA 1T3QA 2E8MA 2KJ8A 9ICAA 8ICEA 1N63A 4A8EA 5KTQA 4DQIA 5ALXA 2BDUA 2R8HA 5ALTA 3G6VA 5KG5A 4C7ZA 4DFJA 3Q8QB 4EX7A 1L7MA 1SKWA 3E2EA 2C2DA 5AIBA 3MDCA 5KFBA 1OXJA 1SV0A 2ZIVA 4TQRA 1PZNA 2UVUA 4CF3A 3C28A 1HUOA 1YZ6A 3LK9A 5F9NA 4UBCA 3TAQA 1JROA 2BPCA 4F2SA 5K4LA 2MU2A 4MFFA 3ZDAA 1X40A 2W9CA 3RH5A 8ICVA 4DOBA 4BXOB 5DQIA 4UB6U 5AI0A 2XGQA 5KFYA 4EEKA 5AM2A 3BZKA 5KFKA 3OHAA 2JR5A 4KTQA 1KN5A 1JIHA 5J0PA 3L5KA 4M6WA 5AM1A 5D4BA 1S10A 1ZQMA 2JHDA 1NOMA 3V6KA 5DG9A 4M9NA 1ZQRA 4DSKA 1QLNA 3CYMA 3PSPA 2KFZA 4JWNA 2KVSA 3SAHA 2MA1A 5CEHA 2AGPA 1SKSA 3TADA 1ZQZA 3HKZC 1ZXIA 1QSLA 2L5YA 3AEVA 5J2GA 3GFKB 1SXEA 2W8LA 4LZDA 3RB6A 5KFMA 4O5CA 3AU6A 3QEAZ 1Q3UA 3GQCA 9ICMA 4RQ0A 2ESEA 2DPJA 4BUGA 3UXNA 4DQSA 5HR7A 3WKDA 2KG5A 1FEZA 4YN4A 3JPNA 3NTUA 4ED8A 2IOHA 8ICQA 1UT5A 2WFAA 4M0AA 2EZXA 4IRDA 2QKQA 2PXIA 4U6PA 5KT6A 1BGXT 5HHIA 3KKAA 2UVVA 4UAZA 4TURA 4QJFB 5CWRA 2ZIWA 5AI4A 3MR3A 2RHFA 2K4EA 5AKEA 2XY7A 4TUSA 2R8IA 4Y2JA 4YG2A 2NRTA 2W9BB 3ISCA 1NK5A 4R65A 5KG0A 1PVQA 5DBAA 2ZIXA 3RR8A 4P2HA 3C1YA 1V38A 2RLTA 1DRGA 3E0FA 4GIBA 4C4RA 4PH5A 4DO9A 4OO1J 8ICYA 4ELUA 1AROP 3QXGA 2NRVA 3JPRA 2JH7A 1Z00A 4DL2A 2R18A 1K1QA 5KFVA 3WKAA 5J0QA 5EOZA 3IHQB 5KFDA 2VA3A 4I2HA 1L3TA 2JEGA 4C7YA 2E1EA 5KFHA 2W9MA 4TUQA 3N7SC 5C5JA 2FPMA 2NRZA 2FMQA 3IV6A 1N61A 5B66U 1MQ3A 3ZDCA 3LVWA 2AQ0A 2QB0B 4P0QA 2KJ5A 5DDYA 4KN4A 1NJWA 2RDIA 2ES6A 1DGJA 3BQ1A 3M1YA 4O3PA 1KTQA 1U9LA 1QSYA 1XNSA 8ICXA 3QX7A 5EWFA 3OPXA 2F44A 3SENA 1V9PA 2KP7A 2N1RA 5DG7A 5EE0A 2P35A 2VJ5A 2ZIXB 3PW2A 3QU5A 1WYGA 5AKJA 1RYRA 3FAHA 3ISDA 3MGIA 1XS9D 4QZGA 1J2MA 2KOBA 3H40A 3L3FX 2KMDA 2R8JA 5J29A 3WK4A 1FFUA 1XO0A 3OJSA 5AK6A 2ZIWB 1Z3EB 2BQUA 2KIVA 4G3IA 1LVHA 8ICJA 2HOFA 3ZDEA 2FLNA 2O6KA 1RDFA 2HBKA 2KHVA 4BDPA 4WJ3B 3ZDBA 4C8KA 4KLTA 4DF4A 2OH2A 1PK1A 2KKPA 5HR6A 1KRPA 3V6JA 3H8WA 2LMRA 1SWWA 4YR2A 4NL9A 4QW8A 4Q8FA 3HRDD 1H38A 8ICOA 3N7PD 3F53A 3KTQA 3TI0A 8ICHA 1YZ7A 2YX8A 1RYSA 2RP5A 2CPRA 3M9OB 3RH4A 2XC9A 4RQNA 2MSNA 1Q8KA 5BOMA 5ALFA 3C29A 4C8MA 4AP9A 3ICXA 5DB9A 3BQ7A 1TE2A 2NO5A 1U45A 4R8UA 1KBUA 5DB6A 1L5UA 2HHSA 4JV2A 3HP6A 1T8EA 4K4IA 1J97A 3HILA 2IHNA 2BCQA 3OSPA 2Y0SC 1JUDA 4YP3A 5KFOA 3KZXA 3NVYA 2BGWA 5CJ7A 2HOIA 4XA5A 3F5EA 4GXIA 4DWIA 5ALRA 2ZUBA 2B6GA 2E1FA 4F5OA 4EBDA 2LM1A 4BXOA 1L7NA 1O03A 4J9KA 1F5SA 1RM6C 3SI8A 3HWTA 1SGGA 4ECYA 1HIWA 4IR1A 1ZQTA 2K8AA 1ZQKA 4IS7A 3R9KA 4NLKA 2W9BA 1LKYA 2DPIA 4NLCA 1JXLA 2DUYA 4GFJA 4M9GA 2BQ3A 8ICLA 2ATLA 2EAMA 5IIJA 2HMXA 1A6SA 5EE1A 4GC6A 2FLPA 4BJQA 2IMWP 4JWMA 3G6YA 2ISPA 1ZQJA 2VA8A 1PUZA 2F1IA 3SV4A 3PNCA 4PHDA 4QZEA 8ICRA 2KZZA 3K1RB 5J0XA 2BPGA 1DXSA 1EXNA 4EELA 1BPYA 1KKXA 5AKZA 4DEZA 5A0LA 3ETLA 3IP4B 4F4KA 1IXRA 4I2FA 4OJ5A 8ICAA 1B4FA 4PL2A 4O0IA 3K1ZA 4NV0A 1XC9A 4KLDA 5HP4A 4DOAA 2HHTA 1ZD4A 2PI5A 5DLGA 2F77X 4KX3A 1XU4A 8ICTA 1L8OA 1SL2A 2HI0A 4JMUA 2V4QA 9ICRA 3HW8A 2WHEA 3UM9A 4RPZA 2M0NA 4B6JA 2HHVA 1YT3A 1Z1BA 3M8RA 1TAUA 1RQNA 4TUPA 4UB2A 2JEFA 8ICIA 4RNMA 3F5AA 4FBUA 2XY6A 1ZQHA 4ED0A 4I2EA 1KFSA 3IG5A 1NJZA 1PK3A 5AK5A 1ZQVA 4QZAA 8ICSA 9ICJA 1DGSA 5G5GA 2ZTCA 3S6JA 2JZBA 4F5PA 1TKDA 3UQ2A 4YVZA 3N4MB 5J2EA 2ISOA 4J03A 1FO4A 2J6TA 4CGZA 2E3TA 5ALPA 3B0XA 7ICVA 5HHHA 4RQ8A 4Y2VA 3AQFA 3TFRA 1F0MA 5BPCA 4JUZA 3RAQA 3ALRA 1NJYA 5AKHA 4IQUA 4KITB 2H3ZA 4RU9A 5KFPA 5KAFU 3JPOA 3PR5B 5AKKA 3PR4A 2AJQA 3SD7A 4JV1A 8ICGA 4IC9A 4C4SA 3QUQA 1SZHA 2CXYA 2J6UA 1COKA 2HSZA 5AK4A 1L7OA 1TK5A 1S77D 4RQ4A 1BNPA 1C20A 5KFJA 2W8KA 1OUQA 3EYZA 3T5LA 2ZG6A 3KFUF 4XUSA 4KLJA 4GXKA 2YMQA 2ASJA 5KNIA 4DL3A 5ALUA 2GO7A 1WUDA 4RQ6A 3M6KA 1L8LA 5CP2A 3EWAA 3C2LA 4F50A 4C8NA 3GU3A 5ALWA 4F5NA 5J8YC 3UQ0A 2IBKA 5DB7A 4IQWA 2NO4A 1RXWA 4EX6A 1HJPA 2DWQA 1ZD3A 3HPOA 1QTMA 4FS2A 5KFIA 3V6HA 5AI9A 3V7KA 2BQRA 5L1IA 3WKEA 2JH1A 4UB3A 9ICHA 4K4GA 5ALIA 9ICFA 5AI8A 5JU5A 3KBBA 2P6RA 1PVRA 1K5OA 4NJ8A 4F4WA 3QU4A 2EH9A 3ZI4A 3RJKA 1BVSA 5D46A 9ICIA 3N28A 4YD2A 5KT2A 2KEYA 5DGAA 4PZOA 4O3SA 5KFLA 3CRXA 3QZ7A 2ZTEA 5AKXA 2K89A 4ED2A 1N5XA 4UB5A 2PMZC 2H5XA 2MUTA 2ZJAA 3H4DA 3U26A 3LYSA 2G09A 4DSJA 9ICSA 4J9RA 4ECUA 4RNNA 4NLBA 5DKWA 3UPQA 2XY5A 2BCVA 4DSLA 4RQ2A 1ZQSA 4YMOA 2W9CB 3NUQA 4NWIA 2RQ5A 1ZJMA 1BPZA 1S97A 2IOFK 4DFPA 4XQ8A 2AQ4A 4YCXA 4B9MA 3RRHA 2YN4A 2PKEA 1ZQIA 2DGZA 3Q8MA 9ICNA 1X9XA 4KLMA 1T3NA 4X5VA 1Q3VA 1SV0C 3RBDA 5DBCA 5KFTA 1ZJNA 4KN7A 1VJ5A 4CE6A 2RRDA 3LVVA 5AKLA 1MQ2A 2KICA 4PL1A 5IILA 2GH1A 2BHNA 4J9NA 2DBYA 3HX0A 3L4PA 2F1HA 4PHPA 3Q8PB 5AM0A 4K4HA 4USAA 1ZQBA 2D6FC 5AKIA 2FPLA 1JALA 4M9LA 3AQEA 4DFKA 2KZMA 3T5HA 1UA1A 1MA7A 3ZD9A 7ICJA 2D8CA 1SV4A 5ALKA 3N7RC 1X6IA 1DOQA 2IHMA 2C28A 1AQ6A 2EZYA 4DL4A 4YR0A 1NJXA 2WB1C 1ZOLA 4ECXA 2HDOA 2BKEA 2Y9TA 1XSPA 4F3OA 2YTUA 1FFVA 5J2HA 2W7OA 3EPGA 4Z6DA 3LWMA 3M6ZA 1NZPA 1N62A 1S8OA 1KLNA 8ICKA 2OHFA 3QE9Y 1JI7A 1X9MA 4ELTA 3TARA 3FDSA 2E8OA 2K8CB 4ZOHC 2F76X 4MFCA 2WF8A 4O3QA 5L1JA 2VANA 4UAWA 1RG6A 2FDRA 2W9AA 3BS5A 1T7PA 7ICHA 4P4PA 4B9VA 4NL9C 8ICWA 2LI6A 4QZBA 4I27A 3LDAA 4DS4A 3BZCA 3WK5A 2ZJ5A 3SZ2A 5ALNA 1JXEA 3I76A 4KLSA 2Z7JA 5J2BA 4UW9A 3RAXA 2MUTB 2KJ9A 4J9QA 1HEKA 1RQLA 3SAGA 3AUOA 5L1MA 3IRUA 2UVWA 2MAXA 1C7YA 4PGXA 4MEYA 4Q45A 3KOOA 2W04A 2ZXIA 4P4MA 3M9NB 4M9JA 5KG2A 3RJEA 7ICKA 1A76A 3AMZA 2NRWA 1NZBA 2Q4TA 4KLLA 1L3UA 4IR9A 1Q46A 3EW9A 4R64A 3RJHA 3KHGA 2OYYA 3PW5A 4O3NA 3UMCA 4I29A 4RQ5A 3SR6A 5KG3A 2XO7A 5L9XA 2I6XA 3D6JA 4DSEA 3QU7A 1KEJA 3DDHA 5KT4A 4ELVA 3QNMA 3MGHA 4DQQA 2WAQF 4B9LA 3GV8B 5C0YA 2WB1F 5J0UA 1M6YA 5AM5A 1DK2A 5IIIA 5KG6A 3F2CA 1BNOA 5J2KA 4M04A 2AH5A 2LYAA 2K4PA 5J2AA 4M2YA 2M9NA 3C23A 2K4IA 3H0LB 3KHLA 1JRPA 4DFMA 3QEBZ 5T14A 4KLEA 3GIJA 4QZ9A 5AHXA 1UHUA 4Y2TA 4Y2UA 5DDMA 2KSOB 4ECVA 2Y0SF 2WF9A 4F4XA 2NV3A 5J2FA 2HHWA 4QWDA 4Y2SA 5AI6A 4DLGA 8ICNA 3OGUA 3RFAA 4FE3A 1NI3A 3WK6A 2W3SA 3TKAA 4AYBC 3MFHA 1ZD5A 2WF7A 4NM1A 4DOCA 1BPBA 9ICVA 5KL1B 3C2KA 4EBCA 3PV8A 3H7IA 2ZTDA 4DQRA 5CHGA 5KT3A 4DCCA 4GC7A 1ZQGA 1D9FA 4RUCA 2KV2A 1GO3F 1SIJA 4OD0A 5CR0A 2HVIA 1ZQUA 5ALGA 4J9PA 2WF6A 4ECTA 5L1LA 5DB8A 1WWUA 4Q44A 4KLHA 4RUAA 2ZUDA 2YMPA 4BWMA 1U4BA 3D2SA 4ECZA 3IM1A 1N48A 4AYBF 3C5FA 5DBBA 1NKBA 4I2CA 1IIPA 7ICOA 4QZHA 1U47A 4OJ6A 3SMVA 4YD1A 5KFCA 3J81j 2Y9UA 5JRTA 1NK0A 5J2DA 2KE7A 4BX9C 5BOLA 5KFEA 5DG8A 1KL9A 2B21A 2LPEA 3WK7A 1TV9A 4RNOA 4DSIA 9ICPA 2C2RA 3V7LA 3IG8A 4E0DA 4LJXA 1TAMA 3GZFA 4IL6U 3D2QA 3VCBA 4PHEA 4J9OA 1LKYB 7ICGA 1JX4A 3MR5A 4FBTA 4UB8U 2WAQC 3PX4A 3GV7B 4O5KA 5ALVA 2ZUCA 2FJ6A 2LYHA 1ZQFA 1J2NA 2XIDA 5KFNA 1QQ5A 5ALSA 3V7JA 4QZCA 3TANA 4I28A 5J0WA 4US8A 3PW7A 9ICQA 5KFZA 3T79A 2OXOA 4EYHB 4C4TA 4P0PB 3MFIA 5ALOA 5ALEA 2BCUA 2BPFA 3HKZF 3GIKA 4RQ7A 1ED1A 4KLGA 2EAOA 3G6XA 3RBEA 3M8SA 1T94A 2P6UA 4C8OA 3RTVA 3NRWA 1TK0A 2JZBB 4FFDA 4CNQA 3MR6A 3NVWA 5KFGA 5EE3A 1Z00B 4EZ6A 4Z6EA 1U49A 1RXVA 2JRZA 5F3XB 3AU2A 5KFRA 1UQVA 1JMSA 2ZIUA 2Y1JA 2A19A 4C8LA 4DLEA 1V97A 3H4BA 1N2XA 1WWVA 5AICA 2DF4B 2I1QA 2ZJ8A 1B0XA 4QZIA 4TQSA 1BPXA 1S0OA 4Y2YA 1NK7A 2ODGA 3PO5A 5KFFA 2HBMA 1MN8A 1UCVA 1BPEA 4P4OA 2NYVA 3QZ8A 4KLOA 3KHRA 4RQMA 1KFDA 1NK6A 1ZYQA 1FIQA 4YR3A 5KFWA 2PFOA 1PVPA 4YMNA 4I2GA 5AIAA 3BQTA 4DS5A 1LB2B 2KK0A 4QNLA 7ICFA 7ICNA 2PMZF 3IN5A 3E58A 7ICTA 3GILA 4DL5A 5HMLA 1KFTA 3QUBA 4PJ0U 3EPIA 5DLFA 2G5HB 4KX5A 4UQGA 4J9LA 1N60A 4PGQA 2BR0A 2G08A 3PVXA 4ECQA 3V72A 2FMPA 4UAVA 5G5HA 2ASDA 1UT8A 2XICA 4ED1A 1NNLA 4F4ZA 3JPSA 2PFPA 3RJJA 2K60A 2QLTA 3K75D 4ACOA 3I28A 5AM3A 5KG7A 2F3NA 3Q8KA 2XGPA 2G5IB 4M6WB 3WK8A 3ORYA 4FZMA 4O3OA 2EANA 4UBBA 3BQ0A 5KT7A 1XSNA 3RJGA 2LBOA 4QWEA 1OW5A 4OJOA 3RJFA 3OHBA 2A3VA 2PI4A 4EZ9A 1X66A 5TZVA 1MC8A 3UXOA 5F9LA 4EEYA 4P0QB 2AGOA 3ISBA 2XCAA 3WKBA 4JK1A 2P66A 4I2DA 3F2BA 8ICUA 5E79U 2I9GA 3H0RB 2K4HA 2JGAA 4R8UB 2I5HA 4R63A 4QZ8A 4CDGA 4F5RA 4EENA 2D3DA 4DFDA 2HOQA 5J0TA 1BPDA 5B5EU 1ZQEA 5J0YA 1ZQPA 1S0NA 2VIXA 3QU2A 1SB3C 4EYIB 1Z1VA 5KFQA 3IDWA 2QARA 2B0CA 1CRXA 3PSTA 2ZXHA 3RRGA 2E8PA 1CI4A 1V85A 3OSNA 1ZQAA 5HMMA 1ZQ1C 4F92B 1NKEA 2PFQA 3H8MA 2JMGA 4Y2QA 5AKYA 3RB3A 1Y88A 4F4YA 2HHXA 4QWCA 2F8LA 2YB4A 3CNHA 4GXJA 3EUB2 1ZRNA 4RQ3A 4YFKA 4MEXA 3WKCA 2KIWA 2W7PA 4KMOB 3B0YA 2AU0A 2JEIA 2OM6A 4KLUA 5IIOA 1NK9A 4RPXA 1TAQA 9ICBA 1RYUA 3PZPA 2C22A 3ZDDA 1Z4NA 5DQHA 2YY6A 2VJ4A 3SV3A 4Q43A 1UPHA 2H3QA 3BQ2A 2IA6A 4Z6CA 7ICLA 4KLQA 1X9WA 3BS5B 2FI1A 2F8KA 3AN1A 2HHUA 3PSIA 4U7CA 5H2FU 1VDVA 4F72A 2QB0A 2V9WA 2KHQA 9ICXA 4I2BA 2GOLA 4MHVA 1WCNA 1ZQYA 4KLFA 2YMMA 8ICCA 2ZIVB 4P0PA 4Y2XA 4YQWA 3ZD8A 5KT5A 1RPLA 4I2JA 2KTQA 5J2IA 3QYPA 4Y2RA 1S9FA 3TAPA 2JXJA 3RJIA 1WG8A 2JEJA 1P7DA 1ZQQA 2CN1A 1XO1A 1IG6A 4UB1A 7ICIA 3MABA 4F71A 2G07A 2KVCA 2PFNA 4US9A 3TACB 4UATA 4I2IA 1VLBA 3TQ1A 2KSOA 3ONNA 3WU2U 1TK8A 4NM2A 1WCLA 1SL1A 5TISU 2G0AA 1D8YA 3I1YA 5KG1A 4CRXA 7ICRA 2RDJA 4NY8A 2Y1IA 4ECRA 5J2JA 3JPPA 3PSFA 2R8KA 3T3FA 7ICMA 2EAPA 7ICUA 5J0RA 4KLIA 3H8SA 9ICEA 4QW9A 1S5LU 5DQGA 5KG4A 2LM4A 5D49A 2DFLA 2HW3A 2R8GA 3PO4A 1ZQXA 5ALLA 4UAYA 3RH6A 4OJLA 4B9UA 5ALHA 2EZZA 1TVAA 1L3SA 4ED6A 4QZFA 1QQ7A 3MC1A 4NLGA 1ZQWA 4J9MA 1KDHA 3NVVA 3K4GA 1Z4OA 1SKRA 5ALDA 3FC4A 9ICGA 4RPYA 3PMNA 5KFUA 3JPTA 1RZTA 2W03A 5KL8B 3KD3A 5AM4A 1S0MA 1QH9A 2BZFA 1ZQNA 3DEEA 3TADC 2W55A 7ICSA 1JN3A 3SAFA 4F5QA 2Q0ZX 3JPQA 2ASLA
chains in the Genus database with same CATH topology
3NUQA 3RF9A 4NWIA 3SAHA 1OUQA 2WAQC 2ZG6A 2VIXA 2MA1A 3KFUF 1KBUA 1P7DA 3RFAA 2Z7JA 4FE3A 2ZIUB 2F77X 3HKZC 2CN1A 2DGZA 4FZNA 5T14A 2DQNB 4KX3A 4AYBC 1PVPA 2KJ9A 4O3MA 3O0FA 1HEKA 3LVWA 2G07A 1WUDA 4JMUA 3SAGA 4P0QA 2KJ5A 2KVCA 1A0PA 2XIDA 3N7SC 3M6KA 2Y0SC 1CRXA 2M0NA 3PSTA 4QIWF 5KL1B 3KZXA 1Q3VA 2ZXHA 1YT3A 3GU3A 1Q3UA 1Z1BA 2HOIA 4QNLA 2VKQA 2PMZF 3ONNA 3IN5A 3T79A 2OXOA 1ZQ1C 2RRDA 3F5EA 3LVVA 1XNSA 4P0PB 2W04A 3OPXA 2G0AA 2KICA 2HBJA 2G5HB 2KJ8A 2ZXIA 3F5AA 4KX5A 4CRXA 4PL1A 2E1FA 2KV2A 2YB1A 3HKZF 4A8EA 3IG5A 1GO3F 4BUGA 2JMGA 2GH1A 2N1RA 2CRXA 1ED1A 5HR7A 2G08A 2BDUA 4C0ZA 3SQIA 2KNJA 2VJ5A 2ZIXB 1NZBA 2F8LA 2K8BB 2Q4TA 5CRXA 2YB4A 2XICA 3PSFA 1HIWA 4OJPA 3D2SA 2JH1A 2H3IA 2OYYA 2K8AA 4FZLA 2D6FC 1L6NA 2E5SA 1T94A 2KOBA 3NRWA 3L3FX 2KIWA 3AQEA 4ACOA 4KMOB 4AYBF 2W7PA 4CGZA 2OM6A 1XO0A 1MA7A 4NLCA 3MGVA 4ICAA 2ZIWB 2ZIVA 2G5IB 1IIPA 4GFJA 4U6PA 3AL0B 3N7RC 4FZMA 3PSPA 4OJLA 2WAQF 3CP8A 2HMXA 4QIWC 1PVRA 2HOFA 4OJ6A 3AQFA 3SMVA 3PZPA 1A6SA 2LKYA 4QJFB 2KD1A 3C28A 5C0YA 2ZIWA 2WB1F 2ZIUA 2WB1C 4BJQA 2HBKA 2KHVA 2RHFA 4WJ3B 2VJ4A 4BX9C 2K4EA 2LBOA 1UPHA 2H3QA 2XVTA 3F2CA 2OH2A 4OJOA 3ALRA 2W7OA 2KEYA 2A3VA 3M6ZA 2KKPA 2H3ZA 2H3VA 3F2DA 1Z19A 3CRXA 2DF4B 2XI9A 2KKVA 3VC8A 5HR6A 2LYAA 1PVQA 4P0QB 2K89A 2ZIXA 2PMZC 3PSIA 4U7CA 3M7DA 1DRGA 4OO1J 3E0FA 2K8CB 2K4IA 1ECWA 2F76X 3H0LB 3IG8A 3N7PD 3F53A 4IC9A 5A0LA 3IP4B 2LHTA 2KHQA 3F2BA 2W03A 2YX8A 2JH7A 5KL8B 2RP5A 2CPRA 1URJA 2H3FA 2MRLA 2GOLA 2LYBA 4OJ5A 3LYSA 2G09A 1TAMA 4PL2A 1SZHA 3H0RB 3H0MB 2JHDA 2K4HA 2JGAA 4NLBA 2HBMA 2R18A 3GZFA 2F2AB 3K1ZA 1D8BA 4NV0A 3DEEA 4CDGA 2ZIVB 3D2QA 3C29A 2Y0SF 3VCBA 4P0PA 2HBLA 3SAFA 3ICXA 1F44A 2E1EA 2G06A 2HOQA 3CYMA 2NV3A 3D2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5S A;  3D2S A;  3D2Q A;  3D2N A; 
#chains in the Genus database with same CATH topology
 3RF9 A;  3A0H U;  8ICF A;  4HAI A;  4ED7 A;  1QSS A;  2ZIU B;  1SZP A;  4FZN A;  2DQN B;  1X42 A;  4PHA A;  3O0F A;  2KZ3 A;  2OWO A;  1A0P A;  3HJE A;  4YXM A;  3T5J A;  2V4R A;  1UA0 A;  5AK3 A;  8ICZ A;  4KMU A;  5KFS A;  5KFX A;  5DGB A;  4QWB A;  3MDA A;  1COO A;  2FLL A;  2HBJ A;  3QU9 A;  4IRK A;  3LWL A;  2CRX A;  1QCK A;  4YXJ A;  3THV A;  4C0Z A;  2KNJ A;  9ICC A;  1KW4 A;  1NK4 A;  2GWS A;  2K8B B;  5CRX A;  2KFN A;  2EQY A;  4UAU A;  4OJP A;  3KKA C;  4FZL A;  2AGQ A;  5GTH U;  5GTI U;  2E5S A;  4M9H A;  4PPX A;  1D9D A;  4ICA A;  4UB4 A;  3PY8 A;  3AL0 B;  2DL0 A;  4NXZ A;  2VA2 A;  3CP8 A;  2WTF A;  1N5W A;  1XWL A;  2LKY A;  5IIK A;  3PW4 A;  2KD1 A;  4XRH A;  1ZRM A;  3PX0 A;  3PW0 A;  1A77 A;  2F1J A;  9ICO A;  3QUC A;  3C21 A;  2H3V A;  2XI9 A;  3VC8 A;  2KKV A;  1KQQ A;  4MF2 A;  3OTQ A;  4LVS A;  1NK8 A;  2OEH A;  3C5G A;  1HUZ A;  1URJ A;  2H3F A;  2A1J A;  4C80 A;  4O5E A;  3KZI U;  5CA7 A;  2FMS A;  3OJU A;  5EWE A;  4B9T A;  3QUT A;  1MSW D;  5JTI A;  4F93 B;  2G06 A;  3ETR A;  3MR2 A;  2W3R A;  1X6J A;  2A1A A;  1B43 A;  4UAS A;  5J0O A;  3AM9 A;  3HT3 A;  4IRC A;  3Q8L A;  4Y2P A;  2FPK A;  4JV0 A;  4QIW F;  4DL6 A;  3PML A;  1SXD A;  3RB0 A;  4UAR A;  1N56 A;  4F8R A;  3M9M B;  3SEI A;  5J0S A;  2HCF A;  5AKG A;  4DSF A;  3KHH A;  2YB1 A;  1DK3 A;  3BS7 A;  3C1Z A;  4MFA A;  1B22 A;  3MBY A;  3SQI A;  4YMM A;  3PX6 A;  2W54 A;  4R66 A;  4Q8E A;  2IOF A;  4HYK A;  2E8N A;  4PGY A;  5EE9 A;  5ALZ A;  4QZD A;  1O08 A;  1CEZ A;  2AHO B;  3NRZ A;  1TFR A;  3B9J A;  1L3V A;  8ICB A;  3EZ5 A;  4BGD A;  1ZQD A;  4QIW C;  1LV5 A;  5J2C A;  4NLZ A;  2AXT U;  2OCE A;  3N97 B;  3H8J A;  5AI5 A;  5KFA A;  4CF5 A;  4IQT A;  2XVT A;  3DV9 A;  2NRX A;  1L7P A;  3F2D A;  1Z19 A;  2HHQ A;  3RB4 A;  3WK9 A;  5EWG A;  4ECS A;  3M7D A;  3BDP A;  1ECW A;  4ECW A;  5JUM A;  3T5K A;  2LHT A;  3CW2 C;  4I2A A;  2MRL A;  5ALQ A;  3UMG A;  3UMB A;  1KSP A;  2F2A B;  9ICW A;  2FE9 A;  2DKX A;  2JV3 A;  1F44 A;  2QB1 A;  2BCR A;  4CF4 A;  1S0V A;  4M47 A;  5CB1 A;  3D2N A;  3RR7 A;  9ICT A;  3NGD A;  2A1J B;  4FO6 A;  4DL7 A;  5KAI U;  4LZG A;  4O3M A;  3NVZ A;  2WF5 A;  2KN7 A;  1CUK A;  5L1K A;  1X9S A;  2J6S A;  1ZD2 P;  1IV8 A;  4F91 B;  4O9M A;  3FYH A;  4ED3 A;  2VKQ A;  1NKC A;  2YML A;  1SL0 A;  1XSL A;  4JB3 A;  1ZQC A;  4RT2 A;  4GLX A;  3FM9 A;  5ALM A;  2UVR A;  3C2M A;  9ICK A;  7ICQ A;  1U48 A;  3UXP A;  3GIM A;  3GII A;  2W43 A;  4QWA A;  3SYZ A;  2H3I A;  4O3R A;  1L6N A;  1QQ6 A;  4RZR A;  4FS1 A;  4B9N A;  3MGV A;  4MF8 A;  1ZET A;  4J9S A;  2BDP A;  8ICM A;  4RQ1 A;  3Q8S B;  5J8Y A;  2HVH A;  5ALY A;  3GDX A;  8ICP A;  3NS1 A;  4DF8 A;  2DKZ A;  4RT3 A;  3ED5 A;  1IM4 A;  4BWJ A;  4CCH A;  3TFS A;  2ALZ A;  9ICU A;  5FP0 A;  2XCP A;  2EDU A;  3GV5 B;  2W11 A;  5IIN A;  2LYB A;  1ZQL A;  3NAS A;  7ICP A;  1T4G A;  7ICE A;  4B9S A;  3H0M B;  2C2E A;  4PZN A;  1D8B A;  1S76 D;  5ALJ A;  5IIM A;  1PK1 B;  2HBL A;  1D8L A;  1SWV A;  4G9B A;  5HNK A;  4ZH4 A;  1K1S A;  4OCZ A;  4EBE A;  4F2R A;  3A0B U;  4Z6F A;  4DQP A;  3BJY A;  9ICL A;  1ZQO A;  4IQV A;  2BCS A;  2YQE A;  2GLE A;  2QAR B;  3Q8R B;  1X2I A;  4NLN A;  1T3Q A;  2E8M A;  2KJ8 A;  9ICA A;  8ICE A;  1N63 A;  4A8E A;  5KTQ A;  4DQI A;  5ALX A;  2BDU A;  2R8H A;  5ALT A;  3G6V A;  5KG5 A;  4C7Z A;  4DFJ A;  3Q8Q B;  4EX7 A;  1L7M A;  1SKW A;  3E2E A;  2C2D A;  5AIB A;  3MDC A;  5KFB A;  1OXJ A;  1SV0 A;  2ZIV A;  4TQR A;  1PZN A;  2UVU A;  4CF3 A;  3C28 A;  1HUO A;  1YZ6 A;  3LK9 A;  5F9N A;  4UBC A;  3TAQ A;  1JRO A;  2BPC A;  4F2S A;  5K4L A;  2MU2 A;  4MFF A;  3ZDA A;  1X40 A;  2W9C A;  3RH5 A;  8ICV A;  4DOB A;  4BXO B;  5DQI A;  4UB6 U;  5AI0 A;  2XGQ A;  5KFY A;  4EEK A;  5AM2 A;  3BZK A;  5KFK A;  3OHA A;  2JR5 A;  4KTQ A;  1KN5 A;  1JIH A;  5J0P A;  3L5K A;  4M6W A;  5AM1 A;  5D4B A;  1S10 A;  1ZQM A;  2JHD A;  1NOM A;  3V6K A;  5DG9 A;  4M9N A;  1ZQR A;  4DSK A;  1QLN A;  3CYM A;  3PSP A;  2KFZ A;  4JWN A;  2KVS A;  3SAH A;  2MA1 A;  5CEH A;  2AGP A;  1SKS A;  3TAD A;  1ZQZ A;  3HKZ C;  1ZXI A;  1QSL A;  2L5Y A;  3AEV A;  5J2G A;  3GFK B;  1SXE A;  2W8L A;  4LZD A;  3RB6 A;  5KFM A;  4O5C A;  3AU6 A;  3QEA Z;  1Q3U A;  3GQC A;  9ICM A;  4RQ0 A;  2ESE A;  2DPJ A;  4BUG A;  3UXN A;  4DQS A;  5HR7 A;  3WKD A;  2KG5 A;  1FEZ A;  4YN4 A;  3JPN A;  3NTU A;  4ED8 A;  2IOH A;  8ICQ A;  1UT5 A;  2WFA A;  4M0A A;  2EZX A;  4IRD A;  2QKQ A;  2PXI A;  4U6P A;  5KT6 A;  1BGX T;  5HHI A;  3KKA A;  2UVV A;  4UAZ A;  4TUR A;  4QJF B;  5CWR A;  2ZIW A;  5AI4 A;  3MR3 A;  2RHF A;  2K4E A;  5AKE A;  2XY7 A;  4TUS A;  2R8I A;  4Y2J A;  4YG2 A;  2NRT A;  2W9B B;  3ISC A;  1NK5 A;  4R65 A;  5KG0 A;  1PVQ A;  5DBA A;  2ZIX A;  3RR8 A;  4P2H A;  3C1Y A;  1V38 A;  2RLT A;  1DRG A;  3E0F A;  4GIB A;  4C4R A;  4PH5 A;  4DO9 A;  4OO1 J;  8ICY A;  4ELU A;  1ARO P;  3QXG A;  2NRV A;  3JPR A;  2JH7 A;  1Z00 A;  4DL2 A;  2R18 A;  1K1Q A;  5KFV A;  3WKA A;  5J0Q A;  5EOZ A;  3IHQ B;  5KFD A;  2VA3 A;  4I2H A;  1L3T A;  2JEG A;  4C7Y A;  2E1E A;  5KFH A;  2W9M A;  4TUQ A;  3N7S C;  5C5J A;  2FPM A;  2NRZ A;  2FMQ A;  3IV6 A;  1N61 A;  5B66 U;  1MQ3 A;  3ZDC A;  3LVW A;  2AQ0 A;  2QB0 B;  4P0Q A;  2KJ5 A;  5DDY A;  4KN4 A;  1NJW A;  2RDI A;  2ES6 A;  1DGJ A;  3BQ1 A;  3M1Y A;  4O3P A;  1KTQ A;  1U9L A;  1QSY A;  1XNS A;  8ICX A;  3QX7 A;  5EWF A;  3OPX A;  2F44 A;  3SEN A;  1V9P A;  2KP7 A;  2N1R A;  5DG7 A;  5EE0 A;  2P35 A;  2VJ5 A;  2ZIX B;  3PW2 A;  3QU5 A;  1WYG A;  5AKJ A;  1RYR A;  3FAH A;  3ISD A;  3MGI A;  1XS9 D;  4QZG A;  1J2M A;  2KOB A;  3H40 A;  3L3F X;  2KMD A;  2R8J A;  5J29 A;  3WK4 A;  1FFU A;  1XO0 A;  3OJS A;  5AK6 A;  2ZIW B;  1Z3E B;  2BQU A;  2KIV A;  4G3I A;  1LVH A;  8ICJ A;  2HOF A;  3ZDE A;  2FLN A;  2O6K A;  1RDF A;  2HBK A;  2KHV A;  4BDP A;  4WJ3 B;  3ZDB A;  4C8K A;  4KLT A;  4DF4 A;  2OH2 A;  1PK1 A;  2KKP A;  5HR6 A;  1KRP A;  3V6J A;  3H8W A;  2LMR A;  1SWW A;  4YR2 A;  4NL9 A;  4QW8 A;  4Q8F A;  3HRD D;  1H38 A;  8ICO A;  3N7P D;  3F53 A;  3KTQ A;  3TI0 A;  8ICH A;  1YZ7 A;  2YX8 A;  1RYS A;  2RP5 A;  2CPR A;  3M9O B;  3RH4 A;  2XC9 A;  4RQN A;  2MSN A;  1Q8K A;  5BOM A;  5ALF A;  3C29 A;  4C8M A;  4AP9 A;  3ICX A;  5DB9 A;  3BQ7 A;  1TE2 A;  2NO5 A;  1U45 A;  4R8U A;  1KBU A;  5DB6 A;  1L5U A;  2HHS A;  4JV2 A;  3HP6 A;  1T8E A;  4K4I A;  1J97 A;  3HIL A;  2IHN A;  2BCQ A;  3OSP A;  2Y0S C;  1JUD A;  4YP3 A;  5KFO A;  3KZX A;  3NVY A;  2BGW A;  5CJ7 A;  2HOI A;  4XA5 A;  3F5E A;  4GXI A;  4DWI A;  5ALR A;  2ZUB A;  2B6G A;  2E1F A;  4F5O A;  4EBD A;  2LM1 A;  4BXO A;  1L7N A;  1O03 A;  4J9K A;  1F5S A;  1RM6 C;  3SI8 A;  3HWT A;  1SGG A;  4ECY A;  1HIW A;  4IR1 A;  1ZQT A;  2K8A A;  1ZQK A;  4IS7 A;  3R9K A;  4NLK A;  2W9B A;  1LKY A;  2DPI A;  4NLC A;  1JXL A;  2DUY A;  4GFJ A;  4M9G A;  2BQ3 A;  8ICL A;  2ATL A;  2EAM A;  5IIJ A;  2HMX A;  1A6S A;  5EE1 A;  4GC6 A;  2FLP A;  4BJQ A;  2IMW P;  4JWM A;  3G6Y A;  2ISP A;  1ZQJ A;  2VA8 A;  1PUZ A;  2F1I A;  3SV4 A;  3PNC A;  4PHD A;  4QZE A;  8ICR A;  2KZZ A;  3K1R B;  5J0X A;  2BPG A;  1DXS A;  1EXN A;  4EEL A;  1BPY A;  1KKX A;  5AKZ A;  4DEZ A;  5A0L A;  3ETL A;  3IP4 B;  4F4K A;  1IXR A;  4I2F A;  4OJ5 A;  8ICA A;  1B4F A;  4PL2 A;  4O0I A;  3K1Z A;  4NV0 A;  1XC9 A;  4KLD A;  5HP4 A;  4DOA A;  2HHT A;  1ZD4 A;  2PI5 A;  5DLG A;  2F77 X;  4KX3 A;  1XU4 A;  8ICT A;  1L8O A;  1SL2 A;  2HI0 A;  4JMU A;  2V4Q A;  9ICR A;  3HW8 A;  2WHE A;  3UM9 A;  4RPZ A;  2M0N A;  4B6J A;  2HHV A;  1YT3 A;  1Z1B A;  3M8R A;  1TAU A;  1RQN A;  4TUP A;  4UB2 A;  2JEF A;  8ICI A;  4RNM A;  3F5A A;  4FBU A;  2XY6 A;  1ZQH A;  4ED0 A;  4I2E A;  1KFS A;  3IG5 A;  1NJZ A;  1PK3 A;  5AK5 A;  1ZQV A;  4QZA A;  8ICS A;  9ICJ A;  1DGS A;  5G5G A;  2ZTC A;  3S6J A;  2JZB A;  4F5P A;  1TKD A;  3UQ2 A;  4YVZ A;  3N4M B;  5J2E A;  2ISO A;  4J03 A;  1FO4 A;  2J6T A;  4CGZ A;  2E3T A;  5ALP A;  3B0X A;  7ICV A;  5HHH A;  4RQ8 A;  4Y2V A;  3AQF A;  3TFR A;  1F0M A;  5BPC A;  4JUZ A;  3RAQ A;  3ALR A;  1NJY A;  5AKH A;  4IQU A;  4KIT B;  2H3Z A;  4RU9 A;  5KFP A;  5KAF U;  3JPO A;  3PR5 B;  5AKK A;  3PR4 A;  2AJQ A;  3SD7 A;  4JV1 A;  8ICG A;  4IC9 A;  4C4S A;  3QUQ A;  1SZH A;  2CXY A;  2J6U A;  1COK A;  2HSZ A;  5AK4 A;  1L7O A;  1TK5 A;  1S77 D;  4RQ4 A;  1BNP A;  1C20 A;  5KFJ A;  2W8K A;  1OUQ A;  3EYZ A;  3T5L A;  2ZG6 A;  3KFU F;  4XUS A;  4KLJ A;  4GXK A;  2YMQ A;  2ASJ A;  5KNI A;  4DL3 A;  5ALU A;  2GO7 A;  1WUD A;  4RQ6 A;  3M6K A;  1L8L A;  5CP2 A;  3EWA A;  3C2L A;  4F50 A;  4C8N A;  3GU3 A;  5ALW A;  4F5N A;  5J8Y C;  3UQ0 A;  2IBK A;  5DB7 A;  4IQW A;  2NO4 A;  1RXW A;  4EX6 A;  1HJP A;  2DWQ A;  1ZD3 A;  3HPO A;  1QTM A;  4FS2 A;  5KFI A;  3V6H A;  5AI9 A;  3V7K A;  2BQR A;  5L1I A;  3WKE A;  2JH1 A;  4UB3 A;  9ICH A;  4K4G A;  5ALI A;  9ICF A;  5AI8 A;  5JU5 A;  3KBB A;  2P6R A;  1PVR A;  1K5O A;  4NJ8 A;  4F4W A;  3QU4 A;  2EH9 A;  3ZI4 A;  3RJK A;  1BVS A;  5D46 A;  9ICI A;  3N28 A;  4YD2 A;  5KT2 A;  2KEY A;  5DGA A;  4PZO A;  4O3S A;  5KFL A;  3CRX A;  3QZ7 A;  2ZTE A;  5AKX A;  2K89 A;  4ED2 A;  1N5X A;  4UB5 A;  2PMZ C;  2H5X A;  2MUT A;  2ZJA A;  3H4D A;  3U26 A;  3LYS A;  2G09 A;  4DSJ A;  9ICS A;  4J9R A;  4ECU A;  4RNN A;  4NLB A;  5DKW A;  3UPQ A;  2XY5 A;  2BCV A;  4DSL A;  4RQ2 A;  1ZQS A;  4YMO A;  2W9C B;  3NUQ A;  4NWI A;  2RQ5 A;  1ZJM A;  1BPZ A;  1S97 A;  2IOF K;  4DFP A;  4XQ8 A;  2AQ4 A;  4YCX A;  4B9M A;  3RRH A;  2YN4 A;  2PKE A;  1ZQI A;  2DGZ A;  3Q8M A;  9ICN A;  1X9X A;  4KLM A;  1T3N A;  4X5V A;  1Q3V A;  1SV0 C;  3RBD A;  5DBC A;  5KFT A;  1ZJN A;  4KN7 A;  1VJ5 A;  4CE6 A;  2RRD A;  3LVV A;  5AKL A;  1MQ2 A;  2KIC A;  4PL1 A;  5IIL A;  2GH1 A;  2BHN A;  4J9N A;  2DBY A;  3HX0 A;  3L4P A;  2F1H A;  4PHP A;  3Q8P B;  5AM0 A;  4K4H A;  4USA A;  1ZQB A;  2D6F C;  5AKI A;  2FPL A;  1JAL A;  4M9L A;  3AQE A;  4DFK A;  2KZM A;  3T5H A;  1UA1 A;  1MA7 A;  3ZD9 A;  7ICJ A;  2D8C A;  1SV4 A;  5ALK A;  3N7R C;  1X6I A;  1DOQ A;  2IHM A;  2C28 A;  1AQ6 A;  2EZY A;  4DL4 A;  4YR0 A;  1NJX A;  2WB1 C;  1ZOL A;  4ECX A;  2HDO A;  2BKE A;  2Y9T A;  1XSP A;  4F3O A;  2YTU A;  1FFV A;  5J2H A;  2W7O A;  3EPG A;  4Z6D A;  3LWM A;  3M6Z A;  1NZP A;  1N62 A;  1S8O A;  1KLN A;  8ICK A;  2OHF A;  3QE9 Y;  1JI7 A;  1X9M A;  4ELT A;  3TAR A;  3FDS A;  2E8O A;  2K8C B;  4ZOH C;  2F76 X;  4MFC A;  2WF8 A;  4O3Q A;  5L1J A;  2VAN A;  4UAW A;  1RG6 A;  2FDR A;  2W9A A;  3BS5 A;  1T7P A;  7ICH A;  4P4P A;  4B9V A;  4NL9 C;  8ICW A;  2LI6 A;  4QZB A;  4I27 A;  3LDA A;  4DS4 A;  3BZC A;  3WK5 A;  2ZJ5 A;  3SZ2 A;  5ALN A;  1JXE A;  3I76 A;  4KLS A;  2Z7J A;  5J2B A;  4UW9 A;  3RAX A;  2MUT B;  2KJ9 A;  4J9Q A;  1HEK A;  1RQL A;  3SAG A;  3AUO A;  5L1M A;  3IRU A;  2UVW A;  2MAX A;  1C7Y A;  4PGX A;  4MEY A;  4Q45 A;  3KOO A;  2W04 A;  2ZXI A;  4P4M A;  3M9N B;  4M9J A;  5KG2 A;  3RJE A;  7ICK A;  1A76 A;  3AMZ A;  2NRW A;  1NZB A;  2Q4T A;  4KLL A;  1L3U A;  4IR9 A;  1Q46 A;  3EW9 A;  4R64 A;  3RJH A;  3KHG A;  2OYY A;  3PW5 A;  4O3N A;  3UMC A;  4I29 A;  4RQ5 A;  3SR6 A;  5KG3 A;  2XO7 A;  5L9X A;  2I6X A;  3D6J A;  4DSE A;  3QU7 A;  1KEJ A;  3DDH A;  5KT4 A;  4ELV A;  3QNM A;  3MGH A;  4DQQ A;  2WAQ F;  4B9L A;  3GV8 B;  5C0Y A;  2WB1 F;  5J0U A;  1M6Y A;  5AM5 A;  1DK2 A;  5III A;  5KG6 A;  3F2C A;  1BNO A;  5J2K A;  4M04 A;  2AH5 A;  2LYA A;  2K4P A;  5J2A A;  4M2Y A;  2M9N A;  3C23 A;  2K4I A;  3H0L B;  3KHL A;  1JRP A;  4DFM A;  3QEB Z;  5T14 A;  4KLE A;  3GIJ A;  4QZ9 A;  5AHX A;  1UHU A;  4Y2T A;  4Y2U A;  5DDM A;  2KSO B;  4ECV A;  2Y0S F;  2WF9 A;  4F4X A;  2NV3 A;  5J2F A;  2HHW A;  4QWD A;  4Y2S A;  5AI6 A;  4DLG A;  8ICN A;  3OGU A;  3RFA A;  4FE3 A;  1NI3 A;  3WK6 A;  2W3S A;  3TKA A;  4AYB C;  3MFH A;  1ZD5 A;  2WF7 A;  4NM1 A;  4DOC A;  1BPB A;  9ICV A;  5KL1 B;  3C2K A;  4EBC A;  3PV8 A;  3H7I A;  2ZTD A;  4DQR A;  5CHG A;  5KT3 A;  4DCC A;  4GC7 A;  1ZQG A;  1D9F A;  4RUC A;  2KV2 A;  1GO3 F;  1SIJ A;  4OD0 A;  5CR0 A;  2HVI A;  1ZQU A;  5ALG A;  4J9P A;  2WF6 A;  4ECT A;  5L1L A;  5DB8 A;  1WWU A;  4Q44 A;  4KLH A;  4RUA A;  2ZUD A;  2YMP A;  4BWM A;  1U4B A;  3D2S A;  4ECZ A;  3IM1 A;  1N48 A;  4AYB F;  3C5F A;  5DBB A;  1NKB A;  4I2C A;  1IIP A;  7ICO A;  4QZH A;  1U47 A;  4OJ6 A;  3SMV A;  4YD1 A;  5KFC A;  3J81 j;  2Y9U A;  5JRT A;  1NK0 A;  5J2D A;  2KE7 A;  4BX9 C;  5BOL A;  5KFE A;  5DG8 A;  1KL9 A;  2B21 A;  2LPE A;  3WK7 A;  1TV9 A;  4RNO A;  4DSI A;  9ICP A;  2C2R A;  3V7L A;  3IG8 A;  4E0D A;  4LJX A;  1TAM A;  3GZF A;  4IL6 U;  3D2Q A;  3VCB A;  4PHE A;  4J9O A;  1LKY B;  7ICG A;  1JX4 A;  3MR5 A;  4FBT A;  4UB8 U;  2WAQ C;  3PX4 A;  3GV7 B;  4O5K A;  5ALV A;  2ZUC A;  2FJ6 A;  2LYH A;  1ZQF A;  1J2N A;  2XID A;  5KFN A;  1QQ5 A;  5ALS A;  3V7J A;  4QZC A;  3TAN A;  4I28 A;  5J0W A;  4US8 A;  3PW7 A;  9ICQ A;  5KFZ A;  3T79 A;  2OXO A;  4EYH B;  4C4T A;  4P0P B;  3MFI A;  5ALO A;  5ALE A;  2BCU A;  2BPF A;  3HKZ F;  3GIK A;  4RQ7 A;  1ED1 A;  4KLG A;  2EAO A;  3G6X A;  3RBE A;  3M8S A;  1T94 A;  2P6U A;  4C8O A;  3RTV A;  3NRW A;  1TK0 A;  2JZB B;  4FFD A;  4CNQ A;  3MR6 A;  3NVW A;  5KFG A;  5EE3 A;  1Z00 B;  4EZ6 A;  4Z6E A;  1U49 A;  1RXV A;  2JRZ A;  5F3X B;  3AU2 A;  5KFR A;  1UQV A;  1JMS A;  2ZIU A;  2Y1J A;  2A19 A;  4C8L A;  4DLE A;  1V97 A;  3H4B A;  1N2X A;  1WWV A;  5AIC A;  2DF4 B;  2I1Q A;  2ZJ8 A;  1B0X A;  4QZI A;  4TQS A;  1BPX A;  1S0O A;  4Y2Y A;  1NK7 A;  2ODG A;  3PO5 A;  5KFF A;  2HBM A;  1MN8 A;  1UCV A;  1BPE A;  4P4O A;  2NYV A;  3QZ8 A;  4KLO A;  3KHR A;  4RQM A;  1KFD A;  1NK6 A;  1ZYQ A;  1FIQ A;  4YR3 A;  5KFW A;  2PFO A;  1PVP A;  4YMN A;  4I2G A;  5AIA A;  3BQT A;  4DS5 A;  1LB2 B;  2KK0 A;  4QNL A;  7ICF A;  7ICN A;  2PMZ F;  3IN5 A;  3E58 A;  7ICT A;  3GIL A;  4DL5 A;  5HML A;  1KFT A;  3QUB A;  4PJ0 U;  3EPI A;  5DLF A;  2G5H B;  4KX5 A;  4UQG A;  4J9L A;  1N60 A;  4PGQ A;  2BR0 A;  2G08 A;  3PVX A;  4ECQ A;  3V72 A;  2FMP A;  4UAV A;  5G5H A;  2ASD A;  1UT8 A;  2XIC A;  4ED1 A;  1NNL A;  4F4Z A;  3JPS A;  2PFP A;  3RJJ A;  2K60 A;  2QLT A;  3K75 D;  4ACO A;  3I28 A;  5AM3 A;  5KG7 A;  2F3N A;  3Q8K A;  2XGP A;  2G5I B;  4M6W B;  3WK8 A;  3ORY A;  4FZM A;  4O3O A;  2EAN A;  4UBB A;  3BQ0 A;  5KT7 A;  1XSN A;  3RJG A;  2LBO A;  4QWE A;  1OW5 A;  4OJO A;  3RJF A;  3OHB A;  2A3V A;  2PI4 A;  4EZ9 A;  1X66 A;  5TZV A;  1MC8 A;  3UXO A;  5F9L A;  4EEY A;  4P0Q B;  2AGO A;  3ISB A;  2XCA A;  3WKB A;  4JK1 A;  2P66 A;  4I2D A;  3F2B A;  8ICU A;  5E79 U;  2I9G A;  3H0R B;  2K4H A;  2JGA A;  4R8U B;  2I5H A;  4R63 A;  4QZ8 A;  4CDG A;  4F5R A;  4EEN A;  2D3D A;  4DFD A;  2HOQ A;  5J0T A;  1BPD A;  5B5E U;  1ZQE A;  5J0Y A;  1ZQP A;  1S0N A;  2VIX A;  3QU2 A;  1SB3 C;  4EYI B;  1Z1V A;  5KFQ A;  3IDW A;  2QAR A;  2B0C A;  1CRX A;  3PST A;  2ZXH A;  3RRG A;  2E8P A;  1CI4 A;  1V85 A;  3OSN A;  1ZQA A;  5HMM A;  1ZQ1 C;  4F92 B;  1NKE A;  2PFQ A;  3H8M A;  2JMG A;  4Y2Q A;  5AKY A;  3RB3 A;  1Y88 A;  4F4Y A;  2HHX A;  4QWC A;  2F8L A;  2YB4 A;  3CNH A;  4GXJ A;  3EUB 2;  1ZRN A;  4RQ3 A;  4YFK A;  4MEX A;  3WKC A;  2KIW A;  2W7P A;  4KMO B;  3B0Y A;  2AU0 A;  2JEI A;  2OM6 A;  4KLU A;  5IIO A;  1NK9 A;  4RPX A;  1TAQ A;  9ICB A;  1RYU A;  3PZP A;  2C22 A;  3ZDD A;  1Z4N A;  5DQH A;  2YY6 A;  2VJ4 A;  3SV3 A;  4Q43 A;  1UPH A;  2H3Q A;  3BQ2 A;  2IA6 A;  4Z6C A;  7ICL A;  4KLQ A;  1X9W A;  3BS5 B;  2FI1 A;  2F8K A;  3AN1 A;  2HHU A;  3PSI A;  4U7C A;  5H2F U;  1VDV A;  4F72 A;  2QB0 A;  2V9W A;  2KHQ A;  9ICX A;  4I2B A;  2GOL A;  4MHV A;  1WCN A;  1ZQY A;  4KLF A;  2YMM A;  8ICC A;  2ZIV B;  4P0P A;  4Y2X A;  4YQW A;  3ZD8 A;  5KT5 A;  1RPL A;  4I2J A;  2KTQ A;  5J2I A;  3QYP A;  4Y2R A;  1S9F A;  3TAP A;  2JXJ A;  3RJI A;  1WG8 A;  2JEJ A;  1P7D A;  1ZQQ A;  2CN1 A;  1XO1 A;  1IG6 A;  4UB1 A;  7ICI A;  3MAB A;  4F71 A;  2G07 A;  2KVC A;  2PFN A;  4US9 A;  3TAC B;  4UAT A;  4I2I A;  1VLB A;  3TQ1 A;  2KSO A;  3ONN A;  3WU2 U;  1TK8 A;  4NM2 A;  1WCL A;  1SL1 A;  5TIS U;  2G0A A;  1D8Y A;  3I1Y A;  5KG1 A;  4CRX A;  7ICR A;  2RDJ A;  4NY8 A;  2Y1I A;  4ECR A;  5J2J A;  3JPP A;  3PSF A;  2R8K A;  3T3F A;  7ICM A;  2EAP A;  7ICU A;  5J0R A;  4KLI A;  3H8S A;  9ICE A;  4QW9 A;  1S5L U;  5DQG A;  5KG4 A;  2LM4 A;  5D49 A;  2DFL A;  2HW3 A;  2R8G A;  3PO4 A;  1ZQX A;  5ALL A;  4UAY A;  3RH6 A;  4OJL A;  4B9U A;  5ALH A;  2EZZ A;  1TVA A;  1L3S A;  4ED6 A;  4QZF A;  1QQ7 A;  3MC1 A;  4NLG A;  1ZQW A;  4J9M A;  1KDH A;  3NVV A;  3K4G A;  1Z4O A;  1SKR A;  5ALD A;  3FC4 A;  9ICG A;  4RPY A;  3PMN A;  5KFU A;  3JPT A;  1RZT A;  2W03 A;  5KL8 B;  3KD3 A;  5AM4 A;  1S0M A;  1QH9 A;  2BZF A;  1ZQN A;  3DEE A;  3TAD C;  2W55 A;  7ICS A;  1JN3 A;  3SAF A;  4F5Q A;  2Q0Z X;  3JPQ A;  2ASL A; 
#chains in the Genus database with same CATH homology
 3NUQ A;  3RF9 A;  4NWI A;  3SAH A;  1OUQ A;  2WAQ C;  2ZG6 A;  2VIX A;  2MA1 A;  3KFU F;  1KBU A;  1P7D A;  3RFA A;  2Z7J A;  4FE3 A;  2ZIU B;  2F77 X;  3HKZ C;  2CN1 A;  2DGZ A;  4FZN A;  5T14 A;  2DQN B;  4KX3 A;  4AYB C;  1PVP A;  2KJ9 A;  4O3M A;  3O0F A;  1HEK A;  3LVW A;  2G07 A;  1WUD A;  4JMU A;  3SAG A;  4P0Q A;  2KJ5 A;  2KVC A;  1A0P A;  2XID A;  3N7S C;  3M6K A;  2Y0S C;  1CRX A;  2M0N A;  3PST A;  4QIW F;  5KL1 B;  3KZX A;  1Q3V A;  2ZXH A;  1YT3 A;  3GU3 A;  1Q3U A;  1Z1B A;  2HOI A;  4QNL A;  2VKQ A;  2PMZ F;  3ONN A;  3IN5 A;  3T79 A;  2OXO A;  1ZQ1 C;  2RRD A;  3F5E A;  3LVV A;  1XNS A;  4P0P B;  2W04 A;  3OPX A;  2G0A A;  2KIC A;  2HBJ A;  2G5H B;  2KJ8 A;  2ZXI A;  3F5A A;  4KX5 A;  4CRX A;  4PL1 A;  2E1F A;  2KV2 A;  2YB1 A;  3HKZ F;  4A8E A;  3IG5 A;  1GO3 F;  4BUG A;  2JMG A;  2GH1 A;  2N1R A;  2CRX A;  1ED1 A;  5HR7 A;  2G08 A;  2BDU A;  4C0Z A;  3SQI A;  2KNJ A;  2VJ5 A;  2ZIX B;  1NZB A;  2F8L A;  2K8B B;  2Q4T A;  5CRX A;  2YB4 A;  2XIC A;  3PSF A;  1HIW A;  4OJP A;  3D2S A;  2JH1 A;  2H3I A;  2OYY A;  2K8A A;  4FZL A;  2D6F C;  1L6N A;  2E5S A;  1T94 A;  2KOB A;  3NRW A;  3L3F X;  2KIW A;  3AQE A;  4ACO A;  4KMO B;  4AYB F;  2W7P A;  4CGZ A;  2OM6 A;  1XO0 A;  1MA7 A;  4NLC A;  3MGV A;  4ICA A;  2ZIW B;  2ZIV A;  2G5I B;  1IIP A;  4GFJ A;  4U6P A;  3AL0 B;  3N7R C;  4FZM A;  3PSP A;  4OJL A;  2WAQ F;  3CP8 A;  2HMX A;  4QIW C;  1PVR A;  2HOF A;  4OJ6 A;  3AQF A;  3SMV A;  3PZP A;  1A6S A;  2LKY A;  4QJF B;  2KD1 A;  3C28 A;  5C0Y A;  2ZIW A;  2WB1 F;  2ZIU A;  2WB1 C;  4BJQ A;  2HBK A;  2KHV A;  2RHF A;  4WJ3 B;  2VJ4 A;  4BX9 C;  2K4E A;  2LBO A;  1UPH A;  2H3Q A;  2XVT A;  3F2C A;  2OH2 A;  4OJO A;  3ALR A;  2W7O A;  2KEY A;  2A3V A;  3M6Z A;  2KKP A;  2H3Z A;  2H3V A;  3F2D A;  1Z19 A;  3CRX A;  2DF4 B;  2XI9 A;  2KKV A;  3VC8 A;  5HR6 A;  2LYA A;  1PVQ A;  4P0Q B;  2K89 A;  2ZIX A;  2PMZ C;  3PSI A;  4U7C A;  3M7D A;  1DRG A;  4OO1 J;  3E0F A;  2K8C B;  2K4I A;  1ECW A;  2F76 X;  3H0L B;  3IG8 A;  3N7P D;  3F53 A;  4IC9 A;  5A0L A;  3IP4 B;  2LHT A;  2KHQ A;  3F2B A;  2W03 A;  2YX8 A;  2JH7 A;  5KL8 B;  2RP5 A;  2CPR A;  1URJ A;  2H3F A;  2MRL A;  2GOL A;  2LYB A;  4OJ5 A;  3LYS A;  2G09 A;  1TAM A;  4PL2 A;  1SZH A;  3H0R B;  3H0M B;  2JHD A;  2K4H A;  2JGA A;  4NLB A;  2HBM A;  2R18 A;  3GZF A;  2F2A B;  3K1Z A;  1D8B A;  4NV0 A;  3DEE A;  4CDG A;  2ZIV B;  3D2Q A;  3C29 A;  2Y0S F;  3VCB A;  4P0P A;  2HBL A;  3SAF A;  3ICX A;  1F44 A;  2E1E A;  2G06 A;  2HOQ A;  3CYM A;  2NV3 A;  3D2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...