2E5SA

Solution structure of the zf-ccchx2 domain of muscleblind-like 2, isoform 1 [homo sapiens]
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
98
structure length
98
Chain Sequence
GSSGSSGSTATQKLLRTDKLEVCREFQRGNCARGETDCRFAHPADSTMIDTSDNTVTVCMDYIKGRCMREKCKYFHPPAHLQAKIKAAQHQANQAAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OTTHUMP00000018578
publication title Solution structure of the RNA binding domain in the human muscleblind-like protein 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 8
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2006-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar)
A PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.840 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2e5sA00
3D2SA 2E5SA 3D2NA 3D2QA
chains in the Genus database with same CATH superfamily
2RP5A 4QZCA 5KFXA 4NLZA 4K4HA 1U47A 4NXZA 1KW4A 3A0BU 2OH2A 1SV0C 4ECTA 1KDHA 2JHDA 4O3OA 1D8BA 4UQGA 1PK3A 5ALUA 4U7CA 3BS7A 5ALRA 3IG5A 3SV4A 4EBDA 4PGYA 3OPXA 4ED3A 2K89A 2H3VA 4F92B 4O3PA 4AP9A 3MR6A 1U4BA 4Y2UA 5KFUA 1S0VA 7ICIA 2K4HA 2AQ4A 5KFKA 3KFUF 2HHUA 4NL9A 3IN5A 4LZGA 1ZQAA 5DLGA 1DGSA 1ZQEA 2ZJ5A 4IQUA 2DBYA 3BZCA 4I2GA 5DQHA 4FZLA 4ECYA 3QZ7A 5DGAA 2AGPA 2AU0A 4MEXA 2W8LA 2KVCA 2JV3A 3GV8B 1ZQLA 4DSKA 1Y88A 5EWGA 3BDPA 4QZBA 4M9HA 4NM2A 2E1FA 1ZQPA 5ALPA 5B5EU 2BR0A 2LYHA 1ZQKA 2JRZA 1J97A 1X6IA 3F2BA 4C4RA 4QZ9A 1X2IA 4ACOA 4EYHB 5L1JA 3OJUA 2EZZA 1BGXT 4F4XA 2OEHA 2C28A 2JEFA 1N56A 2ZTEA 2ZXHA 5KFSA 2W8KA 1ZETA 2IHNA 2Y0SC 2W9BA 4RPYA 4FE3A 5IIIA 4F93B 1ZD5A 4QZFA 5G5HA 1L6NA 3Q8QB 1SKRA 1NKBA 2CRXA 4YD2A 9ICGA 2MU2A 4I28A 3U26A 5DB9A 4F50A 8ICVA 4OJPA 3BQ2A 1ZQIA 4KLDA 2JH7A 4YD1A 2I6XA 3AMZA 1PK1B 4DL3A 2HBMA 2WF5A 5AK5A 2MUTA 4B9UA 4ECVA 4C4SA 3WKBA 3BZKA 4UB1A 7ICGA 5ALNA 1TVAA 4UBCA 2QLTA 2LPEA 4P0PA 3AU2A 4NLCA 4Y2YA 3K75D 5AM0A 3PR5B 4QZEA 3THVA 4I2JA 4EEKA 3KHGA 4KTQA 4F71A 1V9PA 3QU4A 3OGUA 1X9MA 4MF2A 4YMOA 3QZ8A 4DWIA 2IOFK 4ED6A 2H3ZA 1ZQUA 4QWBA 2Y1JA 3RJIA 3H8WA 3F53A 3H0MB 5EE0A 1ZQRA 3WK5A 4YXMA 4GXKA 3LDAA 1PVPA 2YMPA 1BPXA 1PVQA 3QYPA 1P7DA 4P0QA 2F1HA 4E0DA 4J9SA 5ALQA 4US8A 2HHXA 9ICKA 7ICUA 3C2MA 3KTQA 4I29A 1MC8A 4JV2A 3M9OB 3UMCA 5AKHA 1ZQZA 3WKAA 1F5SA 4M9JA 2WF8A 3EW9A 5AK3A 3RB6A 4UASA 2WB1C 1RQNA 4NWIA 3CW2C 5KTQA 1KL9A 2ZTDA 5J0TA 1DK3A 2JR5A 1X66A 3EZ5A 3T5LA 5J0XA 3C5GA 1L8LA 3TADC 3MBYA 1Z00A 5AK6A 2H3IA 1ECWA 2Y0SF 5DLFA 4DFJA 8ICNA 4RU9A 2C2EA 5KT7A 3PR4A 1ZXIA 3JPPA 4LVSA 1B22A 5KFGA 3H0RB 1WYGA 3GIKA 3H40A 4RQ3A 3OHBA 1RPLA 4QZIA 2GLEA 1T4GA 3S6JA 5IINA 4F4WA 1SIJA 4PHPA 5AKEA 9ICHA 2W9BB 1D8YA 8ICQA 3C29A 3Q8RB 5ALDA 1ZQQA 4O9MA 3AN1A 5AKZA 3KKAC 4QWCA 4FO6A 4KLOA 5CB1A 1WWVA 5KT5A 1S0OA 2AH5A 3H4DA 2PXIA 3H7IA 5KFZA 3QX7A 1B4FA 4C8LA 1TE2A 4P4OA 2BGWA 3PSFA 3TFSA 2OM6A 5KFQA 3F5EA 9ICAA 2W43A 3KD3A 5KL8B 4FS2A 3VCBA 3E2EA 7ICOA 5AICA 4F2SA 2MUTB 4O0IA 1KFTA 3AQEA 5AKGA 2EAMA 2K8CB 2Q0ZX 3MGIA 3T3FA 2ODGA 2FLLA 4Y2XA 2BPFA 3TANA 1ED1A 1QQ5A 4LZDA 2W03A 4DLEA 1ZQWA 3RH6A 4Y2PA 4UB3A 3QE9Y 2JH1A 1V38A 5L9XA 9ICRA 2G06A 5ALOA 3O0FA 5ALLA 3AEVA 5AIBA 2J6UA 2E1EA 4YR2A 1N5XA 1URJA 2ZIWA 4C0ZA 1RG6A 5J0OA 2HHVA 2D8CA 4EZ6A 2P6UA 1BPEA 1UHUA 7ICHA 2KP7A 1JROA 9ICFA 5J0WA 4DS5A 3KBBA 5KT4A 1H38A 3F5AA 1A6SA 4OJOA 3RJFA 4P0QB 3N7RC 5CJ7A 3SYZA 2P66A 4DSJA 5C0YA 4ELVA 2VA8A 4BWJA 5D46A 5AI8A 1XU4A 2AXTU 3L3FX 7ICLA 2WF9A 2PFNA 4B9MA 4TURA 4YQWA 2KIVA 2RQ5A 3JPOA 1ZQOA 2KNJA 1HEKA 5KFLA 8ICHA 1QSSA 4QWAA 7ICQA 1Z00B 8ICGA 3QUQA 2ZIXA 3M8SA 2YMLA 4GIBA 4Q44A 3RRGA 3JPRA 4UB5A 4PHDA 2ISOA 3WK7A 1N48A 2G07A 1C20A 4PGXA 3TQ1A 2HSZA 5KFOA 4ELTA 5AHXA 2YN4A 3C28A 3KZXA 5KG4A 3M1YA 3NUQA 1ZJNA 4Z6FA 2WHEA 2G0AA 4XRHA 1QTMA 4M0AA 2BQRA 4OJ6A 2W7PA 3UXOA 4UB8U 4QZGA 4M2YA 2AJQA 1KFDA 4IL6U 2IA6A 3ALRA 4RNNA 1X9SA 4UW9A 4YVZA 1NI3A 1ZQ1C 3MR5A 4C7ZA 3KZIU 2R8GA 4B9NA 2NRZA 5IIKA 3NVVA 4B9LA 4B6JA 3MR2A 5AK4A 1TAQA 2G5HB 4HYKA 4RQMA 3GU3A 5KFVA 3ISBA 3QUTA 5EWFA 3H4BA 1KSPA 1PVRA 5KAIU 4KITB 8ICPA 2W04A 3N7PD 4JV0A 3AUOA 3RH5A 3RR7A 4CE6A 5KFPA 4J9PA 2BPCA 3IP4B 3HRDD 1NK4A 5KFYA 3LWMA 1HJPA 9ICSA 2M9NA 4O3MA 4F4YA 5J2BA 1VDVA 2ZIWB 4TUPA 1RQLA 1UT8A 4EBEA 5J2FA 4DL2A 3RJKA 3K1ZA 4U6PA 3JPTA 4JWNA 2V4QA 2ZIVA 2MA1A 4I2DA 2BCVA 4DF4A 1NJXA 3ZDCA 4DOBA 2IMWP 4ECZA 3RJHA 2CN1A 4GLXA 3PW5A 2BDUA 3OHAA 2EH9A 3BJYA 4RQ4A 4DQSA 1S8OA 3TAQA 3C2KA 3BQ1A 9ICJA 9ICMA 4C8NA 2E8MA 5HNKA 1ZQDA 4C8MA 2KMDA 2R8JA 4UAUA 3C21A 4UB2A 2OWOA 1SGGA 5D49A 2KFZA 4NY8A 1NKCA 2OYYA 1N62A 3SI8A 1LKYA 4ECQA 2ZIXB 1L3TA 3HWTA 2E8NA 4DF8A 1ZOLA 4KN4A 4MHVA 2XGPA 2XC9A 8ICWA 4Q8FA 2A3VA 2KZZA 3PX4A 1XWLA 5J0RA 5HMMA 1NK5A 1Z4OA 2QB1A 3LVWA 4EX6A 2P6RA 4QZ8A 3TAPA 3CNHA 4JUZA 4NJ8A 4KLMA 2W11A 2W9MA 1V97A 3RAQA 5AKXA 1ZQHA 2JEIA 2FE9A 5KT3A 2YB4A 3ZD9A 3EUB2 3EPGA 1CUKA 1ZQCA 5AKJA 1U45A 5G5GA 1CI4A 4BWMA 2KG5A 4O5KA 3RF9A 4DQPA 5CHGA 1D8LA 3ZDEA 5J29A 1KFSA 4K4GA 1UCVA 4TQRA 3H8MA 1NJYA 1ZQGA 4M9GA 4ED8A 3OJSA 3MFHA 3LYSA 5J2JA 1UPHA 4GXJA 4UATA 3TKAA 1RXVA 3PMLA 5TZVA 4NM1A 1JI7A 3TADA 3T5JA 5ALZA 3SV3A 2BCQA 2PI4A 2ZJAA 4DFMA 2Y9UA 2B21A 5AI4A 9ICPA 4Q8EA 3DEEA 3SQIA 1Q3VA 2P35A 3QXGA 1TV9A 2BKEA 8ICZA 4HAIA 2N1RA 4F5RA 1NK8A 1B0XA 1RYRA 4G3IA 3N4MB 1AROP 3AQFA 1XO1A 4IS7A 3V7LA 4UBBA 4EEYA 1O03A 4DOCA 1BVSA 9ICQA 3SAFA 2V4RA 5HR7A 4MFFA 5KT6A 1X40A 5ALIA 2BDPA 4DOAA 4EYIB 4DQRA 3PX0A 1KRPA 1Z4NA 2MSNA 2ZIVB 4UARA 1BNPA 2DQNB 3M9NB 3SZ2A 8ICIA 2E3TA 4EELA 4UB6U 2CXYA 3RTVA 2B6GA 4IRCA 2I9GA 1KEJA 3KKAA 4XA5A 3IDWA 4QZHA 3GILA 2Y9TA 4ICAA 1MA7A 4F91B 5J8YC 1F44A 4DSFA 2UVUA 1COOA 2W9CA 4Z6CA 3V72A 8ICYA 1BNOA 3C2LA 5J0PA 4OJLA 2OCEA 2XGQA 4J03A 3ZD8A 5AM2A 4A8EA 4PH5A 4BGDA 2A1JA 2NRXA 2UVWA 2HBKA 1ZD2P 2WF7A 2H3QA 4R63A 3Q8LA 4J9KA 3MR3A 5ALHA 4ED2A 2FMSA 3RJJA 1LKYB 2ESEA 5DBAA 9ICTA 5ALYA 5DQIA 2LMRA 5ALFA 3GDXA 4RPZA 5J2CA 2KHQA 7ICJA 3OTQA 3KOOA 4NV0A 3AL0B 2Z7JA 5J0UA 1S97A 3KHHA 1ZD4A 4BUGA 5C5JA 2FPMA 5F9NA 5AKLA 3EYZA 4I2FA 5EE1A 4UAYA 1U9LA 3D2SA 3UXNA 5EOZA 2OHFA 2FDRA 4YMNA 5KL1B 2HVIA 5JU5A 1TK0A 4KX5A 2GH1A 2G5IB 2DPJA 2BZFA 2HHQA 1A0PA 2XICA 4QZAA 7ICFA 1L3SA 8ICTA 2EANA 3SAGA 5KFIA 4FZMA 3IG8A 3RBDA 1T3NA 2XY5A 4G9BA 5ALXA 3GIJA 2I1QA 4JK1A 2VKQA 4RQ7A 2EDUA 3RJEA 3ETLA 5IIMA 1YT3A 2KOBA 2LYAA 2KKVA 4KMUA 2UVVA 2PFPA 5KAFU 2EQYA 3TARA 1ZD3A 3K4GA 2PKEA 3PZPA 2DL0A 9ICUA 5KG5A 4PZOA 2J6SA 4ECRA 4R65A 5EE3A 5KG3A 5J2HA 1WWUA 3WU2U 2ASJA 1Q3UA 4DLGA 7ICVA 2R8HA 3V7KA 8ICBA 4J9QA 2J6TA 4J9MA 2F2AB 4DS4A 1QSLA 2H3FA 2IHMA 2W54A 3PMNA 2BCSA 5J2EA 4KLQA 1S0NA 2BHNA 3ZI4A 3PO4A 8ICMA 2AGQA 4I2AA 3UQ2A 2KTQA 3A0HU 2KD1A 4M47A 3FM9A 2E8PA 2KK0A 3R9KA 4IRKA 3WK8A 5DKWA 4QZDA 8ICAA 2W9CB 3N28A 3C1YA 4GFJA 3C1ZA 4QWEA 3PW4A 2Q4TA 7ICNA 4F5PA 3SEIA 1TAMA 2BCUA 2NRVA 2A1JB 1XSLA 4DSIA 4ECWA 1KLNA 3M8RA 5L1IA 3C23A 3OSNA 1MQ2A 3HP6A 4C8KA 4P4PA 1JX4A 3UMBA 3MDCA 4FBTA 4YG2A 2DF4B 3FC4A 3ZDBA 4RQ0A 1N61A 3AU6A 3LK9A 4RT3A 4XUSA 4UAVA 3PSIA 1VJ5A 1HUZA 4RQ8A 1Z1VA 3I28A 4DL6A 8ICCA 3NVYA 2XVTA 5ALGA 4M6WB 1ZRMA 2LHTA 3MGVA 3HPOA 3PO5A 3HILA 4PPXA 4I27A 1GO3F 1X9XA 1NJZA 1Z19A 3NS1A 2YTUA 1XO0A 1HIWA 1QSYA 1X42A 4KLFA 2JZBB 2ZUCA 5HHHA 3IRUA 5AM1A 1TFRA 5JUMA 2Y1IA 4UAWA 5J2KA 3PSPA 3D2NA 9ICIA 4O3RA 2PFQA 3QNMA 2JEJA 5KG2A 1SV0A 4RQ5A 3F2CA 4Y2VA 7ICTA 4WJ3B 1JN3A 2E8OA 2VIXA 1SL2A 7ICMA 3ZDAA 5AM4A 1XC9A 2BPGA 3RAXA 3ETRA 4JWMA 5L1MA 1L3UA 1KN5A 2KN7A 2CPRA 3AM9A 1JMSA 3RFAA 5K4LA 5HHIA 3M6KA 3UXPA 2RDJA 2DFLA 2BCRA 1FIQA 3HT3A 2EZXA 1SKSA 3V7JA 3H0LB 4MEYA 5AKIA 4PHAA 2RRDA 2M0NA 1MQ3A 2IOHA 4JB3A 3IM1A 1IG6A 1T94A 1NZPA 2QKQA 3DDHA 5HP4A 2NRWA 5AM5A 4I2HA 3VC8A 3HJEA 5TISU 1WG8A 3RB3A 4XQ8A 9ICBA 4RPXA 5AI0A 1K5OA 2ISPA 5CP2A 2ZXIA 2RDIA 4DL5A 4Q45A 1SXDA 1JXEA 5J2DA 4FZNA 4OD0A 4O5EA 5KFEA 5DG9A 2R8IA 3CP8A 2W9AA 3SENA 3V6HA 5ALMA 4CF3A 1L7PA 4IQTA 1WCNA 2JMGA 3KHLA 4ZH4A 3HW8A 2LKYA 2EAOA 2LI6A 4ELUA 3MABA 2W3SA 2AGOA 3LVVA 2DPIA 7ICKA 1QH9A 3QEAZ 1BPYA 1KKXA 5AKYA 3LWLA 2R18A 1N5WA 2ES6A 3UM9A 2NRTA 3PX6A 1KTQA 1NJWA 3BS5A 4YR0A 4M9NA 2WF6A 4DEZA 2K8AA 4Y2RA 2K60A 5KG6A 3Q8MA 1CRXA 4CNQA 3QU2A 1ZQVA 4PZNA 2MAXA 1TAUA 1NK0A 2F77X 3V6JA 4CGZA 5ALEA 5J8YA 3PVXA 3WK9A 2W55A 2DGZA 7ICPA 2FJ6A 3SR6A 4RQ2A 1TKDA 4EBCA 3SAHA 5AI6A 5F9LA 8ICFA 1U48A 9ICEA 1ZQJA 2HOQA 3HKZC 5T14A 5JRTA 1ZQBA 2VA3A 4GXIA 1NK9A 4KMOB 3K1RB 4KLSA 4RZRA 4EENA 2KKPA 4CF4A 5AI9A 4YFKA 2XO7A 3NRWA 4I2BA 2KJ9A 2K4IA 2O6KA 3I76A 5ALJA 4Z6DA 4DSLA 2K4PA 4NLGA 3DV9A 3F2DA 1S10A 2V9WA 5KFBA 2HBJA 1B43A 2RLTA 3PW2A 5HMLA 2BQ3A 3QUCA 2KIWA 1COKA 4NLBA 5DG8A 1BPBA 1UA0A 3G6VA 3BQ7A 4ECUA 2NYVA 4J9NA 1K1QA 7ICSA 1SKWA 5J2IA 3UPQA 9ICVA 3ED5A 3RJGA 1FEZA 4KX3A 5DG7A 4X5VA 1RYUA 7ICEA 1N63A 4GC7A 1D9FA 8ICKA 4TQSA 3RRHA 1T8EA 3J81j 2HHTA 3T5HA 1NNLA 3KHRA 2A19A 4NLNA 2R8KA 2KVSA 4DFKA 9ICOA 2KE7A 3NASA 4IR9A 1M6YA 2D3DA 4I2EA 2I5HA 1WUDA 5KFJA 1SWVA 3JPNA 4AYBC 4O3NA 2C2DA 3GV5B 5BOLA 4DCCA 5DBBA 2FMQA 3PY8A 4J9RA 3FYHA 1DOQA 2HVHA 3Q8PB 4DQQA 2F8KA 2GWSA 1J2MA 3QU5A 1KQQA 8ICRA 1UT5A 1S76D 1IIPA 9ICXA 3FAHA 5D4BA 5CRXA 5E79U 1TK5A 3NGDA 2HHSA 5CEHA 2KJ5A 3BS5B 2DKZA 3B0YA 4PL1A 2VJ4A 4PL2A 4C80A 3PV8A 2FLNA 1S5LU 3ONNA 3SD7A 5KFFA 3Q8SB 4OO1J 1S9FA 4F4ZA 2E5SA 3HKZF 2YY6A 3H8SA 1SWWA 2LM1A 3D6JA 4UAZA 3PW7A 4NL9C 4EX7A 1JRPA 5KFTA 4I2IA 1KBUA 2C22A 4O3SA 2KHVA 4NLKA 2YX8A 4B9TA 2QARA 3QEBZ 5CWRA 4DL7A 5KG0A 2KEYA 1SV4A 5DDYA 5CR0A 5ALTA 4RUAA 1DXSA 2B0CA 1L7MA 8ICXA 4QJFB 5KFCA 4M6WA 2WTFA 4M9LA 4RT2A 4QIWC 1ZQXA 1Z1BA 1DGJA 4FBUA 1S0MA 1MSWD 2QB0A 4FS1A 2AHOB 1DK2A 1TK8A 1UQVA 2VANA 2HBLA 2VA2A 4QW9A 1IV8A 5DDMA 2JZBA 1EXNA 7ICRA 3E58A 2JGAA 5L1KA 3ICXA 1JIHA 1C7YA 2HHWA 2F3NA 3IHQB 1RYSA 5DB6A 5BOMA 4R64A 1CEZA 2LBOA 1SZHA 1BPDA 5A0LA 5DGBA 1JXLA 4CF5A 3MFIA 1FFVA 4YR3A 9ICNA 3HX0A 3RBEA 3G6XA 3NTUA 4US9A 3PSTA 2EAPA 4F72A 1IXRA 4K4IA 2KV2A 3JPSA 3ISDA 5BPCA 5B66U 4F8RA 4YCXA 8ICSA 4J9LA 2YQEA 5KG1A 5J0QA 2WFAA 4AYBF 1AQ6A 2YMQA 3L4PA 5KFHA 1YZ6A 3V6KA 4JMUA 3CYMA 1SL0A 3PNCA 2XY6A 2ATLA 2KSOA 4YMMA 2FPLA 2L5YA 4ECXA 2AQ0A 2GO7A 3D2QA 4RQNA 4ZOHC 5KNIA 2HI0A 5IILA 4P2HA 3BQTA 1NK6A 2FMPA 1D9DA 2DKXA 4Y2SA 5HR6A 3ZDDA 4R8UA 4C8OA 3TFRA 4KLHA 2ZG6A 5EE9A 3NRZA 1U49A 4QWDA 3BQ0A 2KZMA 3TACB 1XS9D 5H2FU 1V85A 3B0XA 2ZIUA 3RB4A 4P4MA 3MDAA 2KICA 4USAA 2HW3A 4IQVA 4JV1A 1T3QA 4KLGA 3NVWA 2KFNA 1L8OA 2G09A 3MC1A 1OUQA 3ORYA 3TI0A 3H8JA 2EZYA 2XCPA 1LVHA 4C7YA 4P0PB 1SL1A 1NOMA 9ICLA 1ZQTA 4QIWF 1ZRNA 4CDGA 2G08A 3QU7A 1NZBA 4BX9C 4M04A 2NV3A 3WKDA 1XNSA 1SXEA 2FI1A 2HCFA 3G6YA 1X6JA 1ZQFA 8ICJA 4F2RA 2QARB 4ED1A 4O5CA 4R66A 3OSPA 4PJ0U 2NO5A 4RQ6A 2YB1A 3NVZA 1SB3C 3GQCA 1S77D 3Q8KA 5KFMA 1QCKA 4KLJA 5ALKA 2WB1F 2RHFA 2JEGA 2HDOA 3GFKB 5F3XB 2ASDA 1IM4A 2KJ8A 9ICCA 1Z3EB 2QB0B 3WK4A 3T5KA 4TUQA 4BXOA 1OW5A 3QU9A 4YXJA 4Y2TA 3RH4A 4PGQA 4F3OA 2FPKA 1ZQMA 2PMZC 4CCHA 4MFAA 3C5FA 4B9SA 3MGHA 4MF8A 5J2AA 4DFPA 3I1YA 5AI5A 2ZUDA 4QW8A 4C4TA 5KT2A 4EZ9A 5J0YA 2F44A 1YZ7A 1XSPA 2WAQC 4KLEA 4PHEA 3GV7B 1XSNA 2KZ3A 3WKEA 3WKCA 1L5UA 2XY7A 1Q8KA 3EWAA 1FO4A 4DL4A 2ASLA 2XIDA 2XCAA 2LYBA 4ED0A 2ZJ8A 4DSEA 5IIJA 3WK6A 4KLUA 4DQIA 5KFNA 2D6FC 3E0FA 5J2GA 1X9WA 1RZTA 4YP3A 5IIOA 1A76A 4DFDA 1N60A 4LJXA 1T7PA 4KN7A 2F1JA 5DBCA 3T79A 8ICEA 1QLNA 2VJ5A 2K8BB 3M6ZA 5AKKA 3N97B 1ZJMA 2LM4A 1PUZA 2KSOB 8ICLA 1MN8A 5CA7A 3QUBA 1HUOA 4TUSA 2XI9A 1L7NA 1SZPA 2DWQA 4ECSA 1NK7A 2HMXA 1PZNA 5KFDA 2ALZA 2F76X 1QQ6A 3FDSA 3JPQA 1A77A 5DB8A 1LV5A 2NO4A 5KG7A 1K1SA 4R8UB 3IV6A 5KFWA 2PFOA 4O3QA 5DB7A 5GTHU 8ICOA 2DUYA 3CRXA 1J2NA 5EWEA 4KLLA 1VLBA 5JTIA 2C2RA 1RDFA 4RQ1A 1N2XA 3RR8A 2IOFA 5AIAA 2HOIA 1RM6C 5ALSA 4GC6A 2UVRA 2ZIUB 4IR1A 3EPIA 3GIIA 1BPZA 5J0SA 1L3VA 4F5NA 5KFRA 2PI5A 4Y2QA 1LB2B 5AM3A 2IBKA 4IQWA 3UMGA 3M7DA 2BQUA 4CRXA 1ZQYA 5L1LA 4I2CA 4MFCA 2H5XA 2ZTCA 1JUDA 2K4EA 4DO9A 1FFUA 2F1IA 4Q43A 4OJ5A 3N7SC 3M9MB 3GZFA 5FP0A 4YN4A 1L7OA 2F8LA 3UQ0A 3RB0A 1RXWA 1F0MA 4FFDA 5DQGA 2W3RA 3L5KA 4KLTA 2ZUBA 3GIMA 1QQ7A 4RNMA 4QNLA 4UB4A 4J9OA 1OXJA 5ALVA 2OXOA 1ZQNA 2PMZF 3SMVA 1ZQSA 3PW0A 4IC9A 1WCLA 4RNOA 2GOLA 1DRGA 5ALWA 4OCZA 3ISCA 1JALA 4F4KA 1Q46A 1PK1A 5KFAA 2JXJA 8ICUA 3B9JA 1O08A 1UA1A 1ZYQA 9ICWA 2WAQF 2MRLA 1NKEA 4F5QA 2HOFA 4Z6EA 4BDPA 4ED7A 2W7OA 4Y2JA 4KLIA 2A1AA 4B9VA 4IRDA 4BXOB 2YMMA 4F5OA 5GTIU 4BJQA 2FLPA 4RUCA
chains in the Genus database with same CATH topology
1SZHA 2YB4A 2RP5A 3VC8A 3SAHA 3VCBA 5A0LA 1NZBA 2HBKA 4BX9C 3MGVA 2NV3A 2H3QA 2XI9A 4P0QA 2ZXHA 1XNSA 2OH2A 2HMXA 2Y0SC 1GO3F 2JHDA 2G07A 2HOQA 3AQEA 3HKZC 3K1ZA 5T14A 2F76X 4FE3A 4U6PA 1D8BA 1Z19A 3PSTA 2ZIVA 1Q3UA 3RF9A 2K8CB 2MA1A 2ZXIA 4KMOB 4U7CA 1XO0A 1HIWA 2KV2A 1L6NA 3IG5A 2KKPA 4CGZA 3C28A 2YB1A 3CRXA 2CRXA 1IIPA 2CN1A 3NRWA 5CRXA 1ED1A 3KZXA 2W03A 4FZNA 3OPXA 2BDUA 2K89A 2WB1C 3NUQA 3PSPA 4NWIA 2F2AB 2H3VA 2KJ9A 3D2NA 2G0AA 2H3FA 2JH1A 2KJ5A 4PL1A 2K4IA 2WB1F 3CP8A 2RHFA 4AYBF 2HOIA 2VJ4A 4PL2A 2KHQA 2ZIUB 4OJ6A 4NV0A 2W7PA 2G06A 3AL0B 2KJ8A 2Z7JA 3O0FA 4OJPA 3ONNA 3LYSA 3F2DA 4BUGA 1UPHA 4OO1J 4JMUA 2JH7A 2HBJA 2E5SA 2E1EA 2H3IA 2JMGA 1ECWA 2Y0SF 3CYMA 3M7DA 2KD1A 3HKZF 1URJA 2ZIWA 4CRXA 3D2SA 2K4HA 3F2CA 2PMZC 2KIWA 2HBMA 4C0ZA 4NLBA 3ALRA 3KFUF 2LKYA 3D2QA 3IN5A 1KBUA 5KL1B 1ZQ1C 3DEEA 3H0RB 3SQIA 2VIXA 1Q3VA 2K4EA 4KX5A 2GH1A 2KHVA 2G5IB 1F44A 2YX8A 2N1RA 4OJ5A 3N7SC 5HR6A 3GZFA 3LVVA 2OYYA 3F5AA 4GFJA 1A6SA 2F8LA 2KEYA 3AQFA 1A0PA 2WAQC 2XICA 2ZG6A 2Q4TA 4OJOA 4P0PA 2ZIXB 4FZLA 4NLCA 1TAMA 2R18A 3N7RC 2G5HB 4P0QB 4QJFB 2CPRA 3SAFA 3GU3A 5HR7A 2KVCA 2ZIWB 4KX3A 3SAGA 2XIDA 4QNLA 5C0YA 4QIWC 3RFAA 2LYBA 4FZMA 1Z1BA 2OXOA 2ZIUA 2A3VA 2K8AA 3M6KA 3IG8A 3C29A 2PMZF 3L3FX 2ZIVB 2DF4B 3SMVA 2DQNB 2D6FC 4IC9A 3E0FA 1PVRA 2KICA 2GOLA 1DRGA 1CRXA 2E1FA 2HBLA 2VKQA 2W04A 3N7PD 2H3ZA 3LVWA 1YT3A 2KOBA 2KNJA 2KKVA 1HEKA 2LYAA 3H0LB 4ICAA 1MA7A 2G09A 1OUQA 3F53A 3T79A 2F77X 2WAQF 2MRLA 3PSIA 3H0MB 3F2BA 2RRDA 2JGAA 2M0NA 2K8BB 2VJ5A 3ICXA 3M6ZA 2HOFA 3IP4B 3PSFA 4ACOA 2W7OA 4P0PB 4OJLA 2OM6A 3PZPA 2DGZA 1PVPA 1WUDA 3F5EA 1T94A 2XVTA 4O3MA 1PVQA 4AYBC 4QIWF 4BJQA 2ZIXA 4A8EA 1P7DA 4WJ3B 4CDGA 2LHTA 5KL8B 2G08A 2LBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D2S A;  2E5S A;  3D2N A;  3D2Q A; 
#chains in the Genus database with same CATH topology
 2RP5 A;  4QZC A;  5KFX A;  4NLZ A;  4K4H A;  1U47 A;  4NXZ A;  1KW4 A;  3A0B U;  2OH2 A;  1SV0 C;  4ECT A;  1KDH A;  2JHD A;  4O3O A;  1D8B A;  4UQG A;  1PK3 A;  5ALU A;  4U7C A;  3BS7 A;  5ALR A;  3IG5 A;  3SV4 A;  4EBD A;  4PGY A;  3OPX A;  4ED3 A;  2K89 A;  2H3V A;  4F92 B;  4O3P A;  4AP9 A;  3MR6 A;  1U4B A;  4Y2U A;  5KFU A;  1S0V A;  7ICI A;  2K4H A;  2AQ4 A;  5KFK A;  3KFU F;  2HHU A;  4NL9 A;  3IN5 A;  4LZG A;  1ZQA A;  5DLG A;  1DGS A;  1ZQE A;  2ZJ5 A;  4IQU A;  2DBY A;  3BZC A;  4I2G A;  5DQH A;  4FZL A;  4ECY A;  3QZ7 A;  5DGA A;  2AGP A;  2AU0 A;  4MEX A;  2W8L A;  2KVC A;  2JV3 A;  3GV8 B;  1ZQL A;  4DSK A;  1Y88 A;  5EWG A;  3BDP A;  4QZB A;  4M9H A;  4NM2 A;  2E1F A;  1ZQP A;  5ALP A;  5B5E U;  2BR0 A;  2LYH A;  1ZQK A;  2JRZ A;  1J97 A;  1X6I A;  3F2B A;  4C4R A;  4QZ9 A;  1X2I A;  4ACO A;  4EYH B;  5L1J A;  3OJU A;  2EZZ A;  1BGX T;  4F4X A;  2OEH A;  2C28 A;  2JEF A;  1N56 A;  2ZTE A;  2ZXH A;  5KFS A;  2W8K A;  1ZET A;  2IHN A;  2Y0S C;  2W9B A;  4RPY A;  4FE3 A;  5III A;  4F93 B;  1ZD5 A;  4QZF A;  5G5H A;  1L6N A;  3Q8Q B;  1SKR A;  1NKB A;  2CRX A;  4YD2 A;  9ICG A;  2MU2 A;  4I28 A;  3U26 A;  5DB9 A;  4F50 A;  8ICV A;  4OJP A;  3BQ2 A;  1ZQI A;  4KLD A;  2JH7 A;  4YD1 A;  2I6X A;  3AMZ A;  1PK1 B;  4DL3 A;  2HBM A;  2WF5 A;  5AK5 A;  2MUT A;  4B9U A;  4ECV A;  4C4S A;  3WKB A;  3BZK A;  4UB1 A;  7ICG A;  5ALN A;  1TVA A;  4UBC A;  2QLT A;  2LPE A;  4P0P A;  3AU2 A;  4NLC A;  4Y2Y A;  3K75 D;  5AM0 A;  3PR5 B;  4QZE A;  3THV A;  4I2J A;  4EEK A;  3KHG A;  4KTQ A;  4F71 A;  1V9P A;  3QU4 A;  3OGU A;  1X9M A;  4MF2 A;  4YMO A;  3QZ8 A;  4DWI A;  2IOF K;  4ED6 A;  2H3Z A;  1ZQU A;  4QWB A;  2Y1J A;  3RJI A;  3H8W A;  3F53 A;  3H0M B;  5EE0 A;  1ZQR A;  3WK5 A;  4YXM A;  4GXK A;  3LDA A;  1PVP A;  2YMP A;  1BPX A;  1PVQ A;  3QYP A;  1P7D A;  4P0Q A;  2F1H A;  4E0D A;  4J9S A;  5ALQ A;  4US8 A;  2HHX A;  9ICK A;  7ICU A;  3C2M A;  3KTQ A;  4I29 A;  1MC8 A;  4JV2 A;  3M9O B;  3UMC A;  5AKH A;  1ZQZ A;  3WKA A;  1F5S A;  4M9J A;  2WF8 A;  3EW9 A;  5AK3 A;  3RB6 A;  4UAS A;  2WB1 C;  1RQN A;  4NWI A;  3CW2 C;  5KTQ A;  1KL9 A;  2ZTD A;  5J0T A;  1DK3 A;  2JR5 A;  1X66 A;  3EZ5 A;  3T5L A;  5J0X A;  3C5G A;  1L8L A;  3TAD C;  3MBY A;  1Z00 A;  5AK6 A;  2H3I A;  1ECW A;  2Y0S F;  5DLF A;  4DFJ A;  8ICN A;  4RU9 A;  2C2E A;  5KT7 A;  3PR4 A;  1ZXI A;  3JPP A;  4LVS A;  1B22 A;  5KFG A;  3H0R B;  1WYG A;  3GIK A;  3H40 A;  4RQ3 A;  3OHB A;  1RPL A;  4QZI A;  2GLE A;  1T4G A;  3S6J A;  5IIN A;  4F4W A;  1SIJ A;  4PHP A;  5AKE A;  9ICH A;  2W9B B;  1D8Y A;  8ICQ A;  3C29 A;  3Q8R B;  5ALD A;  1ZQQ A;  4O9M A;  3AN1 A;  5AKZ A;  3KKA C;  4QWC A;  4FO6 A;  4KLO A;  5CB1 A;  1WWV A;  5KT5 A;  1S0O A;  2AH5 A;  3H4D A;  2PXI A;  3H7I A;  5KFZ A;  3QX7 A;  1B4F A;  4C8L A;  1TE2 A;  4P4O A;  2BGW A;  3PSF A;  3TFS A;  2OM6 A;  5KFQ A;  3F5E A;  9ICA A;  2W43 A;  3KD3 A;  5KL8 B;  4FS2 A;  3VCB A;  3E2E A;  7ICO A;  5AIC A;  4F2S A;  2MUT B;  4O0I A;  1KFT A;  3AQE A;  5AKG A;  2EAM A;  2K8C B;  2Q0Z X;  3MGI A;  3T3F A;  2ODG A;  2FLL A;  4Y2X A;  2BPF A;  3TAN A;  1ED1 A;  1QQ5 A;  4LZD A;  2W03 A;  4DLE A;  1ZQW A;  3RH6 A;  4Y2P A;  4UB3 A;  3QE9 Y;  2JH1 A;  1V38 A;  5L9X A;  9ICR A;  2G06 A;  5ALO A;  3O0F A;  5ALL A;  3AEV A;  5AIB A;  2J6U A;  2E1E A;  4YR2 A;  1N5X A;  1URJ A;  2ZIW A;  4C0Z A;  1RG6 A;  5J0O A;  2HHV A;  2D8C A;  4EZ6 A;  2P6U A;  1BPE A;  1UHU A;  7ICH A;  2KP7 A;  1JRO A;  9ICF A;  5J0W A;  4DS5 A;  3KBB A;  5KT4 A;  1H38 A;  3F5A A;  1A6S A;  4OJO A;  3RJF A;  4P0Q B;  3N7R C;  5CJ7 A;  3SYZ A;  2P66 A;  4DSJ A;  5C0Y A;  4ELV A;  2VA8 A;  4BWJ A;  5D46 A;  5AI8 A;  1XU4 A;  2AXT U;  3L3F X;  7ICL A;  2WF9 A;  2PFN A;  4B9M A;  4TUR A;  4YQW A;  2KIV A;  2RQ5 A;  3JPO A;  1ZQO A;  2KNJ A;  1HEK A;  5KFL A;  8ICH A;  1QSS A;  4QWA A;  7ICQ A;  1Z00 B;  8ICG A;  3QUQ A;  2ZIX A;  3M8S A;  2YML A;  4GIB A;  4Q44 A;  3RRG A;  3JPR A;  4UB5 A;  4PHD A;  2ISO A;  3WK7 A;  1N48 A;  2G07 A;  1C20 A;  4PGX A;  3TQ1 A;  2HSZ A;  5KFO A;  4ELT A;  5AHX A;  2YN4 A;  3C28 A;  3KZX A;  5KG4 A;  3M1Y A;  3NUQ A;  1ZJN A;  4Z6F A;  2WHE A;  2G0A A;  4XRH A;  1QTM A;  4M0A A;  2BQR A;  4OJ6 A;  2W7P A;  3UXO A;  4UB8 U;  4QZG A;  4M2Y A;  2AJQ A;  1KFD A;  4IL6 U;  2IA6 A;  3ALR A;  4RNN A;  1X9S A;  4UW9 A;  4YVZ A;  1NI3 A;  1ZQ1 C;  3MR5 A;  4C7Z A;  3KZI U;  2R8G A;  4B9N A;  2NRZ A;  5IIK A;  3NVV A;  4B9L A;  4B6J A;  3MR2 A;  5AK4 A;  1TAQ A;  2G5H B;  4HYK A;  4RQM A;  3GU3 A;  5KFV A;  3ISB A;  3QUT A;  5EWF A;  3H4B A;  1KSP A;  1PVR A;  5KAI U;  4KIT B;  8ICP A;  2W04 A;  3N7P D;  4JV0 A;  3AUO A;  3RH5 A;  3RR7 A;  4CE6 A;  5KFP A;  4J9P A;  2BPC A;  3IP4 B;  3HRD D;  1NK4 A;  5KFY A;  3LWM A;  1HJP A;  9ICS A;  2M9N A;  4O3M A;  4F4Y A;  5J2B A;  1VDV A;  2ZIW B;  4TUP A;  1RQL A;  1UT8 A;  4EBE A;  5J2F A;  4DL2 A;  3RJK A;  3K1Z A;  4U6P A;  3JPT A;  4JWN A;  2V4Q A;  2ZIV A;  2MA1 A;  4I2D A;  2BCV A;  4DF4 A;  1NJX A;  3ZDC A;  4DOB A;  2IMW P;  4ECZ A;  3RJH A;  2CN1 A;  4GLX A;  3PW5 A;  2BDU A;  3OHA A;  2EH9 A;  3BJY A;  4RQ4 A;  4DQS A;  1S8O A;  3TAQ A;  3C2K A;  3BQ1 A;  9ICJ A;  9ICM A;  4C8N A;  2E8M A;  5HNK A;  1ZQD A;  4C8M A;  2KMD A;  2R8J A;  4UAU A;  3C21 A;  4UB2 A;  2OWO A;  1SGG A;  5D49 A;  2KFZ A;  4NY8 A;  1NKC A;  2OYY A;  1N62 A;  3SI8 A;  1LKY A;  4ECQ A;  2ZIX B;  1L3T A;  3HWT A;  2E8N A;  4DF8 A;  1ZOL A;  4KN4 A;  4MHV A;  2XGP A;  2XC9 A;  8ICW A;  4Q8F A;  2A3V A;  2KZZ A;  3PX4 A;  1XWL A;  5J0R A;  5HMM A;  1NK5 A;  1Z4O A;  2QB1 A;  3LVW A;  4EX6 A;  2P6R A;  4QZ8 A;  3TAP A;  3CNH A;  4JUZ A;  4NJ8 A;  4KLM A;  2W11 A;  2W9M A;  1V97 A;  3RAQ A;  5AKX A;  1ZQH A;  2JEI A;  2FE9 A;  5KT3 A;  2YB4 A;  3ZD9 A;  3EUB 2;  3EPG A;  1CUK A;  1ZQC A;  5AKJ A;  1U45 A;  5G5G A;  1CI4 A;  4BWM A;  2KG5 A;  4O5K A;  3RF9 A;  4DQP A;  5CHG A;  1D8L A;  3ZDE A;  5J29 A;  1KFS A;  4K4G A;  1UCV A;  4TQR A;  3H8M A;  1NJY A;  1ZQG A;  4M9G A;  4ED8 A;  3OJS A;  3MFH A;  3LYS A;  5J2J A;  1UPH A;  4GXJ A;  4UAT A;  3TKA A;  1RXV A;  3PML A;  5TZV A;  4NM1 A;  1JI7 A;  3TAD A;  3T5J A;  5ALZ A;  3SV3 A;  2BCQ A;  2PI4 A;  2ZJA A;  4DFM A;  2Y9U A;  2B21 A;  5AI4 A;  9ICP A;  4Q8E A;  3DEE A;  3SQI A;  1Q3V A;  2P35 A;  3QXG A;  1TV9 A;  2BKE A;  8ICZ A;  4HAI A;  2N1R A;  4F5R A;  1NK8 A;  1B0X A;  1RYR A;  4G3I A;  3N4M B;  1ARO P;  3AQF A;  1XO1 A;  4IS7 A;  3V7L A;  4UBB A;  4EEY A;  1O03 A;  4DOC A;  1BVS A;  9ICQ A;  3SAF A;  2V4R A;  5HR7 A;  4MFF A;  5KT6 A;  1X40 A;  5ALI A;  2BDP A;  4DOA A;  4EYI B;  4DQR A;  3PX0 A;  1KRP A;  1Z4N A;  2MSN A;  2ZIV B;  4UAR A;  1BNP A;  2DQN B;  3M9N B;  3SZ2 A;  8ICI A;  2E3T A;  4EEL A;  4UB6 U;  2CXY A;  3RTV A;  2B6G A;  4IRC A;  2I9G A;  1KEJ A;  3KKA A;  4XA5 A;  3IDW A;  4QZH A;  3GIL A;  2Y9T A;  4ICA A;  1MA7 A;  4F91 B;  5J8Y C;  1F44 A;  4DSF A;  2UVU A;  1COO A;  2W9C A;  4Z6C A;  3V72 A;  8ICY A;  1BNO A;  3C2L A;  5J0P A;  4OJL A;  2OCE A;  2XGQ A;  4J03 A;  3ZD8 A;  5AM2 A;  4A8E A;  4PH5 A;  4BGD A;  2A1J A;  2NRX A;  2UVW A;  2HBK A;  1ZD2 P;  2WF7 A;  2H3Q A;  4R63 A;  3Q8L A;  4J9K A;  3MR3 A;  5ALH A;  4ED2 A;  2FMS A;  3RJJ A;  1LKY B;  2ESE A;  5DBA A;  9ICT A;  5ALY A;  5DQI A;  2LMR A;  5ALF A;  3GDX A;  4RPZ A;  5J2C A;  2KHQ A;  7ICJ A;  3OTQ A;  3KOO A;  4NV0 A;  3AL0 B;  2Z7J A;  5J0U A;  1S97 A;  3KHH A;  1ZD4 A;  4BUG A;  5C5J A;  2FPM A;  5F9N A;  5AKL A;  3EYZ A;  4I2F A;  5EE1 A;  4UAY A;  1U9L A;  3D2S A;  3UXN A;  5EOZ A;  2OHF A;  2FDR A;  4YMN A;  5KL1 B;  2HVI A;  5JU5 A;  1TK0 A;  4KX5 A;  2GH1 A;  2G5I B;  2DPJ A;  2BZF A;  2HHQ A;  1A0P A;  2XIC A;  4QZA A;  7ICF A;  1L3S A;  8ICT A;  2EAN A;  3SAG A;  5KFI A;  4FZM A;  3IG8 A;  3RBD A;  1T3N A;  2XY5 A;  4G9B A;  5ALX A;  3GIJ A;  2I1Q A;  4JK1 A;  2VKQ A;  4RQ7 A;  2EDU A;  3RJE A;  3ETL A;  5IIM A;  1YT3 A;  2KOB A;  2LYA A;  2KKV A;  4KMU A;  2UVV A;  2PFP A;  5KAF U;  2EQY A;  3TAR A;  1ZD3 A;  3K4G A;  2PKE A;  3PZP A;  2DL0 A;  9ICU A;  5KG5 A;  4PZO A;  2J6S A;  4ECR A;  4R65 A;  5EE3 A;  5KG3 A;  5J2H A;  1WWU A;  3WU2 U;  2ASJ A;  1Q3U A;  4DLG A;  7ICV A;  2R8H A;  3V7K A;  8ICB A;  4J9Q A;  2J6T A;  4J9M A;  2F2A B;  4DS4 A;  1QSL A;  2H3F A;  2IHM A;  2W54 A;  3PMN A;  2BCS A;  5J2E A;  4KLQ A;  1S0N A;  2BHN A;  3ZI4 A;  3PO4 A;  8ICM A;  2AGQ A;  4I2A A;  3UQ2 A;  2KTQ A;  3A0H U;  2KD1 A;  4M47 A;  3FM9 A;  2E8P A;  2KK0 A;  3R9K A;  4IRK A;  3WK8 A;  5DKW A;  4QZD A;  8ICA A;  2W9C B;  3N28 A;  3C1Y A;  4GFJ A;  3C1Z A;  4QWE A;  3PW4 A;  2Q4T A;  7ICN A;  4F5P A;  3SEI A;  1TAM A;  2BCU A;  2NRV A;  2A1J B;  1XSL A;  4DSI A;  4ECW A;  1KLN A;  3M8R A;  5L1I A;  3C23 A;  3OSN A;  1MQ2 A;  3HP6 A;  4C8K A;  4P4P A;  1JX4 A;  3UMB A;  3MDC A;  4FBT A;  4YG2 A;  2DF4 B;  3FC4 A;  3ZDB A;  4RQ0 A;  1N61 A;  3AU6 A;  3LK9 A;  4RT3 A;  4XUS A;  4UAV A;  3PSI A;  1VJ5 A;  1HUZ A;  4RQ8 A;  1Z1V A;  3I28 A;  4DL6 A;  8ICC A;  3NVY A;  2XVT A;  5ALG A;  4M6W B;  1ZRM A;  2LHT A;  3MGV A;  3HPO A;  3PO5 A;  3HIL A;  4PPX A;  4I27 A;  1GO3 F;  1X9X A;  1NJZ A;  1Z19 A;  3NS1 A;  2YTU A;  1XO0 A;  1HIW A;  1QSY A;  1X42 A;  4KLF A;  2JZB B;  2ZUC A;  5HHH A;  3IRU A;  5AM1 A;  1TFR A;  5JUM A;  2Y1I A;  4UAW A;  5J2K A;  3PSP A;  3D2N A;  9ICI A;  4O3R A;  2PFQ A;  3QNM A;  2JEJ A;  5KG2 A;  1SV0 A;  4RQ5 A;  3F2C A;  4Y2V A;  7ICT A;  4WJ3 B;  1JN3 A;  2E8O A;  2VIX A;  1SL2 A;  7ICM A;  3ZDA A;  5AM4 A;  1XC9 A;  2BPG A;  3RAX A;  3ETR A;  4JWM A;  5L1M A;  1L3U A;  1KN5 A;  2KN7 A;  2CPR A;  3AM9 A;  1JMS A;  3RFA A;  5K4L A;  5HHI A;  3M6K A;  3UXP A;  2RDJ A;  2DFL A;  2BCR A;  1FIQ A;  3HT3 A;  2EZX A;  1SKS A;  3V7J A;  3H0L B;  4MEY A;  5AKI A;  4PHA A;  2RRD A;  2M0N A;  1MQ3 A;  2IOH A;  4JB3 A;  3IM1 A;  1IG6 A;  1T94 A;  1NZP A;  2QKQ A;  3DDH A;  5HP4 A;  2NRW A;  5AM5 A;  4I2H A;  3VC8 A;  3HJE A;  5TIS U;  1WG8 A;  3RB3 A;  4XQ8 A;  9ICB A;  4RPX A;  5AI0 A;  1K5O A;  2ISP A;  5CP2 A;  2ZXI A;  2RDI A;  4DL5 A;  4Q45 A;  1SXD A;  1JXE A;  5J2D A;  4FZN A;  4OD0 A;  4O5E A;  5KFE A;  5DG9 A;  2R8I A;  3CP8 A;  2W9A A;  3SEN A;  3V6H A;  5ALM A;  4CF3 A;  1L7P A;  4IQT A;  1WCN A;  2JMG A;  3KHL A;  4ZH4 A;  3HW8 A;  2LKY A;  2EAO A;  2LI6 A;  4ELU A;  3MAB A;  2W3S A;  2AGO A;  3LVV A;  2DPI A;  7ICK A;  1QH9 A;  3QEA Z;  1BPY A;  1KKX A;  5AKY A;  3LWL A;  2R18 A;  1N5W A;  2ES6 A;  3UM9 A;  2NRT A;  3PX6 A;  1KTQ A;  1NJW A;  3BS5 A;  4YR0 A;  4M9N A;  2WF6 A;  4DEZ A;  2K8A A;  4Y2R A;  2K60 A;  5KG6 A;  3Q8M A;  1CRX A;  4CNQ A;  3QU2 A;  1ZQV A;  4PZN A;  2MAX A;  1TAU A;  1NK0 A;  2F77 X;  3V6J A;  4CGZ A;  5ALE A;  5J8Y A;  3PVX A;  3WK9 A;  2W55 A;  2DGZ A;  7ICP A;  2FJ6 A;  3SR6 A;  4RQ2 A;  1TKD A;  4EBC A;  3SAH A;  5AI6 A;  5F9L A;  8ICF A;  1U48 A;  9ICE A;  1ZQJ A;  2HOQ A;  3HKZ C;  5T14 A;  5JRT A;  1ZQB A;  2VA3 A;  4GXI A;  1NK9 A;  4KMO B;  3K1R B;  4KLS A;  4RZR A;  4EEN A;  2KKP A;  4CF4 A;  5AI9 A;  4YFK A;  2XO7 A;  3NRW A;  4I2B A;  2KJ9 A;  2K4I A;  2O6K A;  3I76 A;  5ALJ A;  4Z6D A;  4DSL A;  2K4P A;  4NLG A;  3DV9 A;  3F2D A;  1S10 A;  2V9W A;  5KFB A;  2HBJ A;  1B43 A;  2RLT A;  3PW2 A;  5HML A;  2BQ3 A;  3QUC A;  2KIW A;  1COK A;  4NLB A;  5DG8 A;  1BPB A;  1UA0 A;  3G6V A;  3BQ7 A;  4ECU A;  2NYV A;  4J9N A;  1K1Q A;  7ICS A;  1SKW A;  5J2I A;  3UPQ A;  9ICV A;  3ED5 A;  3RJG A;  1FEZ A;  4KX3 A;  5DG7 A;  4X5V A;  1RYU A;  7ICE A;  1N63 A;  4GC7 A;  1D9F A;  8ICK A;  4TQS A;  3RRH A;  1T8E A;  3J81 j;  2HHT A;  3T5H A;  1NNL A;  3KHR A;  2A19 A;  4NLN A;  2R8K A;  2KVS A;  4DFK A;  9ICO A;  2KE7 A;  3NAS A;  4IR9 A;  1M6Y A;  2D3D A;  4I2E A;  2I5H A;  1WUD A;  5KFJ A;  1SWV A;  3JPN A;  4AYB C;  4O3N A;  2C2D A;  3GV5 B;  5BOL A;  4DCC A;  5DBB A;  2FMQ A;  3PY8 A;  4J9R A;  3FYH A;  1DOQ A;  2HVH A;  3Q8P B;  4DQQ A;  2F8K A;  2GWS A;  1J2M A;  3QU5 A;  1KQQ A;  8ICR A;  1UT5 A;  1S76 D;  1IIP A;  9ICX A;  3FAH A;  5D4B A;  5CRX A;  5E79 U;  1TK5 A;  3NGD A;  2HHS A;  5CEH A;  2KJ5 A;  3BS5 B;  2DKZ A;  3B0Y A;  4PL1 A;  2VJ4 A;  4PL2 A;  4C80 A;  3PV8 A;  2FLN A;  1S5L U;  3ONN A;  3SD7 A;  5KFF A;  3Q8S B;  4OO1 J;  1S9F A;  4F4Z A;  2E5S A;  3HKZ F;  2YY6 A;  3H8S A;  1SWW A;  2LM1 A;  3D6J A;  4UAZ A;  3PW7 A;  4NL9 C;  4EX7 A;  1JRP A;  5KFT A;  4I2I A;  1KBU A;  2C22 A;  4O3S A;  2KHV A;  4NLK A;  2YX8 A;  4B9T A;  2QAR A;  3QEB Z;  5CWR A;  4DL7 A;  5KG0 A;  2KEY A;  1SV4 A;  5DDY A;  5CR0 A;  5ALT A;  4RUA A;  1DXS A;  2B0C A;  1L7M A;  8ICX A;  4QJF B;  5KFC A;  4M6W A;  2WTF A;  4M9L A;  4RT2 A;  4QIW C;  1ZQX A;  1Z1B A;  1DGJ A;  4FBU A;  1S0M A;  1MSW D;  2QB0 A;  4FS1 A;  2AHO B;  1DK2 A;  1TK8 A;  1UQV A;  2VAN A;  2HBL A;  2VA2 A;  4QW9 A;  1IV8 A;  5DDM A;  2JZB A;  1EXN A;  7ICR A;  3E58 A;  2JGA A;  5L1K A;  3ICX A;  1JIH A;  1C7Y A;  2HHW A;  2F3N A;  3IHQ B;  1RYS A;  5DB6 A;  5BOM A;  4R64 A;  1CEZ A;  2LBO A;  1SZH A;  1BPD A;  5A0L A;  5DGB A;  1JXL A;  4CF5 A;  3MFI A;  1FFV A;  4YR3 A;  9ICN A;  3HX0 A;  3RBE A;  3G6X A;  3NTU A;  4US9 A;  3PST A;  2EAP A;  4F72 A;  1IXR A;  4K4I A;  2KV2 A;  3JPS A;  3ISD A;  5BPC A;  5B66 U;  4F8R A;  4YCX A;  8ICS A;  4J9L A;  2YQE A;  5KG1 A;  5J0Q A;  2WFA A;  4AYB F;  1AQ6 A;  2YMQ A;  3L4P A;  5KFH A;  1YZ6 A;  3V6K A;  4JMU A;  3CYM A;  1SL0 A;  3PNC A;  2XY6 A;  2ATL A;  2KSO A;  4YMM A;  2FPL A;  2L5Y A;  4ECX A;  2AQ0 A;  2GO7 A;  3D2Q A;  4RQN A;  4ZOH C;  5KNI A;  2HI0 A;  5IIL A;  4P2H A;  3BQT A;  1NK6 A;  2FMP A;  1D9D A;  2DKX A;  4Y2S A;  5HR6 A;  3ZDD A;  4R8U A;  4C8O A;  3TFR A;  4KLH A;  2ZG6 A;  5EE9 A;  3NRZ A;  1U49 A;  4QWD A;  3BQ0 A;  2KZM A;  3TAC B;  1XS9 D;  5H2F U;  1V85 A;  3B0X A;  2ZIU A;  3RB4 A;  4P4M A;  3MDA A;  2KIC A;  4USA A;  2HW3 A;  4IQV A;  4JV1 A;  1T3Q A;  4KLG A;  3NVW A;  2KFN A;  1L8O A;  2G09 A;  3MC1 A;  1OUQ A;  3ORY A;  3TI0 A;  3H8J A;  2EZY A;  2XCP A;  1LVH A;  4C7Y A;  4P0P B;  1SL1 A;  1NOM A;  9ICL A;  1ZQT A;  4QIW F;  1ZRN A;  4CDG A;  2G08 A;  3QU7 A;  1NZB A;  4BX9 C;  4M04 A;  2NV3 A;  3WKD A;  1XNS A;  1SXE A;  2FI1 A;  2HCF A;  3G6Y A;  1X6J A;  1ZQF A;  8ICJ A;  4F2R A;  2QAR B;  4ED1 A;  4O5C A;  4R66 A;  3OSP A;  4PJ0 U;  2NO5 A;  4RQ6 A;  2YB1 A;  3NVZ A;  1SB3 C;  3GQC A;  1S77 D;  3Q8K A;  5KFM A;  1QCK A;  4KLJ A;  5ALK A;  2WB1 F;  2RHF A;  2JEG A;  2HDO A;  3GFK B;  5F3X B;  2ASD A;  1IM4 A;  2KJ8 A;  9ICC A;  1Z3E B;  2QB0 B;  3WK4 A;  3T5K A;  4TUQ A;  4BXO A;  1OW5 A;  3QU9 A;  4YXJ A;  4Y2T A;  3RH4 A;  4PGQ A;  4F3O A;  2FPK A;  1ZQM A;  2PMZ C;  4CCH A;  4MFA A;  3C5F A;  4B9S A;  3MGH A;  4MF8 A;  5J2A A;  4DFP A;  3I1Y A;  5AI5 A;  2ZUD A;  4QW8 A;  4C4T A;  5KT2 A;  4EZ9 A;  5J0Y A;  2F44 A;  1YZ7 A;  1XSP A;  2WAQ C;  4KLE A;  4PHE A;  3GV7 B;  1XSN A;  2KZ3 A;  3WKE A;  3WKC A;  1L5U A;  2XY7 A;  1Q8K A;  3EWA A;  1FO4 A;  4DL4 A;  2ASL A;  2XID A;  2XCA A;  2LYB A;  4ED0 A;  2ZJ8 A;  4DSE A;  5IIJ A;  3WK6 A;  4KLU A;  4DQI A;  5KFN A;  2D6F C;  3E0F A;  5J2G A;  1X9W A;  1RZT A;  4YP3 A;  5IIO A;  1A76 A;  4DFD A;  1N60 A;  4LJX A;  1T7P A;  4KN7 A;  2F1J A;  5DBC A;  3T79 A;  8ICE A;  1QLN A;  2VJ5 A;  2K8B B;  3M6Z A;  5AKK A;  3N97 B;  1ZJM A;  2LM4 A;  1PUZ A;  2KSO B;  8ICL A;  1MN8 A;  5CA7 A;  3QUB A;  1HUO A;  4TUS A;  2XI9 A;  1L7N A;  1SZP A;  2DWQ A;  4ECS A;  1NK7 A;  2HMX A;  1PZN A;  5KFD A;  2ALZ A;  2F76 X;  1QQ6 A;  3FDS A;  3JPQ A;  1A77 A;  5DB8 A;  1LV5 A;  2NO4 A;  5KG7 A;  1K1S A;  4R8U B;  3IV6 A;  5KFW A;  2PFO A;  4O3Q A;  5DB7 A;  5GTH U;  8ICO A;  2DUY A;  3CRX A;  1J2N A;  5EWE A;  4KLL A;  1VLB A;  5JTI A;  2C2R A;  1RDF A;  4RQ1 A;  1N2X A;  3RR8 A;  2IOF A;  5AIA A;  2HOI A;  1RM6 C;  5ALS A;  4GC6 A;  2UVR A;  2ZIU B;  4IR1 A;  3EPI A;  3GII A;  1BPZ A;  5J0S A;  1L3V A;  4F5N A;  5KFR A;  2PI5 A;  4Y2Q A;  1LB2 B;  5AM3 A;  2IBK A;  4IQW A;  3UMG A;  3M7D A;  2BQU A;  4CRX A;  1ZQY A;  5L1L A;  4I2C A;  4MFC A;  2H5X A;  2ZTC A;  1JUD A;  2K4E A;  4DO9 A;  1FFU A;  2F1I A;  4Q43 A;  4OJ5 A;  3N7S C;  3M9M B;  3GZF A;  5FP0 A;  4YN4 A;  1L7O A;  2F8L A;  3UQ0 A;  3RB0 A;  1RXW A;  1F0M A;  4FFD A;  5DQG A;  2W3R A;  3L5K A;  4KLT A;  2ZUB A;  3GIM A;  1QQ7 A;  4RNM A;  4QNL A;  4UB4 A;  4J9O A;  1OXJ A;  5ALV A;  2OXO A;  1ZQN A;  2PMZ F;  3SMV A;  1ZQS A;  3PW0 A;  4IC9 A;  1WCL A;  4RNO A;  2GOL A;  1DRG A;  5ALW A;  4OCZ A;  3ISC A;  1JAL A;  4F4K A;  1Q46 A;  1PK1 A;  5KFA A;  2JXJ A;  8ICU A;  3B9J A;  1O08 A;  1UA1 A;  1ZYQ A;  9ICW A;  2WAQ F;  2MRL A;  1NKE A;  4F5Q A;  2HOF A;  4Z6E A;  4BDP A;  4ED7 A;  2W7O A;  4Y2J A;  4KLI A;  2A1A A;  4B9V A;  4IRD A;  4BXO B;  2YMM A;  4F5O A;  5GTI U;  4BJQ A;  2FLP A;  4RUC A; 
#chains in the Genus database with same CATH homology
 1SZH A;  2YB4 A;  2RP5 A;  3VC8 A;  3SAH A;  3VCB A;  5A0L A;  1NZB A;  2HBK A;  4BX9 C;  3MGV A;  2NV3 A;  2H3Q A;  2XI9 A;  4P0Q A;  2ZXH A;  1XNS A;  2OH2 A;  2HMX A;  2Y0S C;  1GO3 F;  2JHD A;  2G07 A;  2HOQ A;  3AQE A;  3HKZ C;  3K1Z A;  5T14 A;  2F76 X;  4FE3 A;  4U6P A;  1D8B A;  1Z19 A;  3PST A;  2ZIV A;  1Q3U A;  3RF9 A;  2K8C B;  2MA1 A;  2ZXI A;  4KMO B;  4U7C A;  1XO0 A;  1HIW A;  2KV2 A;  1L6N A;  3IG5 A;  2KKP A;  4CGZ A;  3C28 A;  2YB1 A;  3CRX A;  2CRX A;  1IIP A;  2CN1 A;  3NRW A;  5CRX A;  1ED1 A;  3KZX A;  2W03 A;  4FZN A;  3OPX A;  2BDU A;  2K89 A;  2WB1 C;  3NUQ A;  3PSP A;  4NWI A;  2F2A B;  2H3V A;  2KJ9 A;  3D2N A;  2G0A A;  2H3F A;  2JH1 A;  2KJ5 A;  4PL1 A;  2K4I A;  2WB1 F;  3CP8 A;  2RHF A;  4AYB F;  2HOI A;  2VJ4 A;  4PL2 A;  2KHQ A;  2ZIU B;  4OJ6 A;  4NV0 A;  2W7P A;  2G06 A;  3AL0 B;  2KJ8 A;  2Z7J A;  3O0F A;  4OJP A;  3ONN A;  3LYS A;  3F2D A;  4BUG A;  1UPH A;  4OO1 J;  4JMU A;  2JH7 A;  2HBJ A;  2E5S A;  2E1E A;  2H3I A;  2JMG A;  1ECW A;  2Y0S F;  3CYM A;  3M7D A;  2KD1 A;  3HKZ F;  1URJ A;  2ZIW A;  4CRX A;  3D2S A;  2K4H A;  3F2C A;  2PMZ C;  2KIW A;  2HBM A;  4C0Z A;  4NLB A;  3ALR A;  3KFU F;  2LKY A;  3D2Q A;  3IN5 A;  1KBU A;  5KL1 B;  1ZQ1 C;  3DEE A;  3H0R B;  3SQI A;  2VIX A;  1Q3V A;  2K4E A;  4KX5 A;  2GH1 A;  2KHV A;  2G5I B;  1F44 A;  2YX8 A;  2N1R A;  4OJ5 A;  3N7S C;  5HR6 A;  3GZF A;  3LVV A;  2OYY A;  3F5A A;  4GFJ A;  1A6S A;  2F8L A;  2KEY A;  3AQF A;  1A0P A;  2WAQ C;  2XIC A;  2ZG6 A;  2Q4T A;  4OJO A;  4P0P A;  2ZIX B;  4FZL A;  4NLC A;  1TAM A;  2R18 A;  3N7R C;  2G5H B;  4P0Q B;  4QJF B;  2CPR A;  3SAF A;  3GU3 A;  5HR7 A;  2KVC A;  2ZIW B;  4KX3 A;  3SAG A;  2XID A;  4QNL A;  5C0Y A;  4QIW C;  3RFA A;  2LYB A;  4FZM A;  1Z1B A;  2OXO A;  2ZIU A;  2A3V A;  2K8A A;  3M6K A;  3IG8 A;  3C29 A;  2PMZ F;  3L3F X;  2ZIV B;  2DF4 B;  3SMV A;  2DQN B;  2D6F C;  4IC9 A;  3E0F A;  1PVR A;  2KIC A;  2GOL A;  1DRG A;  1CRX A;  2E1F A;  2HBL A;  2VKQ A;  2W04 A;  3N7P D;  2H3Z A;  3LVW A;  1YT3 A;  2KOB A;  2KNJ A;  2KKV A;  1HEK A;  2LYA A;  3H0L B;  4ICA A;  1MA7 A;  2G09 A;  1OUQ A;  3F53 A;  3T79 A;  2F77 X;  2WAQ F;  2MRL A;  3PSI A;  3H0M B;  3F2B A;  2RRD A;  2JGA A;  2M0N A;  2K8B B;  2VJ5 A;  3ICX A;  3M6Z A;  2HOF A;  3IP4 B;  3PSF A;  4ACO A;  2W7O A;  4P0P B;  4OJL A;  2OM6 A;  3PZP A;  2DGZ A;  1PVP A;  1WUD A;  3F5E A;  1T94 A;  2XVT A;  4O3M A;  1PVQ A;  4AYB C;  4QIW F;  4BJQ A;  2ZIX A;  4A8E A;  1P7D A;  4WJ3 B;  4CDG A;  2LHT A;  5KL8 B;  2G08 A;  2LBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...